2VDQA

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 107
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdqA00
3VI3A 4Z7QA 4G1EA 4MMZA 4WK0A 3ZDXA 2VDOA 2VC2A 5FFOA 2VDMA 4UM9A 4IRZA 3ZDYA 3ZE1A 4WK2A 4WJKA 3FCUA 3VI4A 4Z7NA 5HDBA 3T3MA 3T3PA 5FFGA 1M1XA 3V4PA 3ZDZA 3IJEA 1JV2A 5E6UA 4UM8A 3V4VA 1L5GA 2VDNA 3NIGA 5E6SA 3ZE0A 3K72A 4WK4A 3FCSA 4NENA 1TYEA 4MMXA 3NIFA 5E6RA 4O02A 3K6SA 1U8CA 2VDLA 4G1MA 2VDQA 3ZE2A 4MMYA 2VDPA 4Z7OA 3K71A 2VDRA 2VDKA 3NIDA
chains in the Genus database with same CATH superfamily
2UZYB 4NBMA 5EMMB 4WK0A 2AQ5A 5HE2B 3EG6A 4CZXA 3HFQA 4J87A 3DWLC 4ZOVA 5HE0B 3AL8A 3IIYA 5H17A 2XL2A 3T3PA 1H2XA 3V5WB 1GG2B 2QR5A 3OF7A 5K19A 5EALA 1B9XA 4GM8A 4J0XA 3PSLA 4BH6A 2IUQA 2VZ3A 3AL8B 1R5MA 2HU7A 2HXCA 3SWSD 2EIEA 4MMXA 4R7AB 4X63B 3UKRC 2H9MA 4J77A 2HKRA 3KCIA 5EMKB 4FA1D 3PSCB 2J57G 3FGBA 5FXYA 4BCCA 2VC2A 5M5RA 2GC7A 4J82A 4UM9A 5EM2A 5HQGA 2H68A 3BWSA 5CXCA 3VH0A 5GXIA 4N14A 3T3MA 4A0AA 2YMUA 2AGXA 2G9AA 2YBAA 3JRPA 2P9LC 1L5GA 3GREA 2Z2NA 4NENA 1XKSA 5EM2B 4CY5A 3K6SA 4J73A 4DNUA 4FA4D 5CXCB 2XDWA 3BG0A 3EQ8A 4GQBB 4A0AB 4J81A 1MG3A 3SVWD 1H2ZA 4YVDA 1N6FA 1VZ3A 4ZOYA 4J78A 4FA9D 1PI6A 3DXMC 1UTCA 4AMYA 2QXVA 4BCBA 4UI9R 5FFOA 4FWWA 5EARA 4MK0B 2AH1A 4PXWA 3O4GA 4O2WA 4NC4A 1BPOA 4GQ2P 4AEZA 5AMSA 4PSXB 4Y7RA 4QL1A 4O9DA 2VDLA 1K3IA 5KDOB 5FLXg 4JT6C 1K32A 1ERJA 1NEXB 4D9SA 4ZOZA 3FRXA 4RE6A 1GXRA 1UOOA 3O4JA 3E0CA 2HESX 3PE7A 1GOHA 2PM9A 2CE9A 5GSAA 2QC5A 3UVKA 1XHMA 2AGYA 2CO0C 2IUVA 1JMZB 1UOPA 2O9KA 3RLMD 3DXKC 5FKSA 3FM0A 2PM9B 1GOTB 4QRJA 4K3JB 3UVOA 4X61B 4AX4A 1TBGA 4AOWA 3UVNA 5FKQA 3PXTD 4L3GD 4FAVD 4ERQA 4G1EA 2P9SC 5IGOA 4NSXA 2IURA 4L3HD 3IIWA 4IRZA 3ZDYA 4FAND 2EBSA 2AH0A 2IUPA 4WJKA 3RFHA 4L1MA 3DM0A 1JTDB 4J0WA 3A0FA 4LG9A 3F3GA 2QZPA 1U4CA 3FCSA 3I89A 4BP8A 1VE7A 3SHFA 3CFSB 3MUOA 5GMKn 3L4MD 4Z7QA 3OKTA 5H1MA 4PNKB 4JD2C 1RI6A 4IA9A 4U7AA 3OTTA 5JWZA 4E5ZA 3P4FA 5GXHA 3NVNA 3OKWA 3EI3A 3JZHA 5C92A 3IJCA 3SXTD 3RMZD 4CI3A 5C2WB 3JZGA 3RN0D 3IJ0A 2EICA 1FWXA 4E5ZB 2TRCB 3ODTA 3EI3B 3J80g 3IURA 3KRWB 3B7FA 3JZNA 2VDKA 2OK6A 1N6EA 4CI1A 4ZOXA 5IGQA 1N6DA 1GP2B 3QHYB 3SBQA 4JSXC 3V9FA 3DSMA 3I8CA 4BUJC 4GMBA 3ZE1A 2I3SA 5IC7A 4CZVA 3IUMA 3ULEC 5IJ7E 1H2WA 3AL9A 4DNVA 2P9IC 3U4YA 5C9ZB 3V4VA 4BL0A 2H14A 2GNQA 4WK4A 1O6FA 1OLZA 4G56B 2BCJB 5A2Qg 2J55H 5TEEA 1NR0A 2H9PA 5IT9g 4E54A 2PM6B 4MMYA 1XIPA 4JHNA 1Q47A 2YB8B 3I7NA 2JKXA 3W15A 3I7LA 2HJBA 2OIZA 5FA5B 4KFMB 2J56H 4E54B 4O45A 2H3XA 4LG8A 3MKSB 2AGWA 3JPXA 3FCUA 3MVDK 2Z2OA 4Z7NA 2YNNA 5HDBA 3SCYA 5FFGA 3NVXA 1SQJA 5FKTA 3RSEC 2P9NC 2CO0A 4FHLA 3F3PA 1L0QA 3NIFA 2IWFA 4O3TB 4ERYA 3BG1A 1C9LA 3MXXA 2VDQA 3NVQA 4CY2A 4JSVC 4ERZA 3SJLD 1A0RB 5EAMA 4O3UB 3KRXB 2I3TA 1T2XA 4G55A 4L1QD 4A2MA 2WQ8A 4JXMA 1SQ9A 2OVPB 4A11A 2OVQB 2VZ1A 4AMZA 1QNIA 2H6KA 1QFSA 4O1QD 1I2MB 3MUNA 3ZE0A 4J84A 1TYEA 3SLED 3N0EA 1U8CA 4A11B 2AGLA 2I0SA 1PBYB 3EI2A 4L9OA 1JJUB 2Z2PA 3JROA 4H5JA 3UKUC 4GGAA 2PBIB 1UOQA 2IWKA 3SBPA 3C75H 2VDMA 5TDHB 2Q7QA 3EI2B 2H6NA 4D6VA 1S4UX 4OWRA 3V4PA 3VA6A 5SXMA 2HJ4A 3IJEA 2XL3A 1E5TA 5HYNB 3PXSD 3PVUB 4OZUA 4QAMA 1SHYB 2VDRA 4A08A 3I7PA 4IMMA 4JHPC 4D0KA 1C9IA 2HYEA 2YNOA 3EQ7A 5EAPA 3K26A 2I0RA 2CNXA 4EWRA 1TYQC 2OK4A 3OW8A 2XZGA 3CFVA 3UVLA 4JT5C 4BP9A 5H14A 4GM9A 3MZKA 4TZ4A 5M5UA 3N0DA 3IUJA 4GGCA 1H2YA 1E8MA 3I7HA 5EMJB 3J81g 2BBKH 4Z7OA 4X3EA 4XYHA 3GD1I 4CZYA 5TEFA 3EI4A 2VDOA 4J86A 4ESGA 2EIBA 4QQEA 5EMLB 2PM7B 3SFZA 1B9YA 2UZXB 1GOFA 3EI4B 3SN6B 3EI1A 2VDNA 3IUNA 3EMHA 1VYHC 3MMYA 3K72A 1GOGA 2P9PC 5E6RA 2H9NA 3K71A 4JSPC 4K3ID 4PBYA 3NIDA 4X60B 3SMRA 3EI1B 4I79A 4FB1D 3JAMg 4MMZA 3OL2A 3L4OD 1P22A 2XE4A 4A7JA 1U2VC 4JSNC 5AFU3 2G99A 3AH8B 3V7DB 3O4HA 3C5MA 3EQ9A 4LGNA 5FQDA 4AN0A 4DNWA 1PEVA 5CYKA 4J8BA 5C2VB 4CI8A 4PBZA 4BCDA 3RRMC 3C99A 3O4IA 1K8KC 3OL2B 1JV2A 3IUQA 3C9CA 4PSWB 4XEIC 2B4EA 2AGZA 3GFCA 4GQ1A 1YR2A 3CIKB 4Y5RD 4CI2A 5CYKB 5I5IA 3PVWB 2VDPA 3UR4A 3I7OA 5FKRA 4A09A 4A0BA 1MG2A 2CE8A 3I2NA 2XYIA 4CY1A 1PGUA 4QT8A 1MDAH 5AJAA 3IKOA 4XYIA 4H5IA 4WK2A 2GC4A 4GZ8A 3VI4A 4GM3A 4A09B 2H6QA 2IAAA 4RE5A 3SBRA 4A0BB 4UM8A 5CXBA 3NIGA 2P9KC 2B5LA 2EIDA 3AFCA 2B5MA 2OVRB 3I8EA 2BKLA 5M61A 3ZWLB 2W18A 2H47A 4NAAA 5I5MA 3VI3A 5CXBB 2YNPA 5IJ8E 2HU8A 5HE1B 3VGZA 3DDUA 4CC9A 5M5VA 3ZDXA 5THAA 1VZ2A 3F3FA 2HU5A 5I5JA 3MKQA 3UVMA 3I7KA 3IVMA 1M1XA 4CY3A 3JB9L 3EU7A 2B5NA 4U1EI 5E6UA 1A12A 3RFGA 5K1CC 5C86A 2OJYA 2P9UC 2H9LA 2XU7A 1YFQA 3PXWD 3ORVD 4A2LA 4J8GA 2HKMA 3EWEA 3ZE2A 3GC3B 1VE6A 1OMWB 3MZLA 2H13A 5M5SA 2MTAH 4Z8LA 1O6GA 1JMXB 3OKYB 5M5TA 5HE3B 4AN1A 1QFMA 4PC0A 4FA5D 4ES0A 1JOFA 4A08B 3IULA 3OKYA 3ZDZA 2CN2A 5TF2A 3QI0A 5E6SA 4GGDA 4J79A 4HDJA 4O02A 3K27A 4G1MA 1E8NA 2I0TA 3RN1D 5B4WA 2CN3A 4ZN4A 3IJ1A
chains in the Genus database with same CATH topology
3VI3A 4Z7QA 4G1EA 4MMZA 4WK0A 3ZDXA 2VDOA 2VC2A 5FFOA 2VDMA 4UM9A 4IRZA 3ZDYA 3ZE1A 4WK2A 4WJKA 3FCUA 3VI4A 4Z7NA 5HDBA 3T3MA 3T3PA 5FFGA 1M1XA 3V4PA 3ZDZA 3IJEA 1JV2A 5E6UA 4UM8A 3V4VA 1L5GA 2VDNA 3NIGA 5E6SA 3ZE0A 3K72A 4WK4A 3FCSA 4NENA 1TYEA 4MMXA 3NIFA 5E6RA 4O02A 3K6SA 1U8CA 2VDLA 4G1MA 2VDQA 3ZE2A 4MMYA 2VDPA 4Z7OA 3K71A 2VDRA 2VDKA 3NIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VI3 A;  4Z7Q A;  4G1E A;  4MMZ A;  4WK0 A;  3ZDX A;  2VDO A;  2VC2 A;  5FFO A;  2VDM A;  4UM9 A;  4IRZ A;  3ZDY A;  3ZE1 A;  4WK2 A;  4WJK A;  3FCU A;  3VI4 A;  4Z7N A;  5HDB A;  3T3M A;  3T3P A;  5FFG A;  1M1X A;  3V4P A;  3ZDZ A;  3IJE A;  1JV2 A;  5E6U A;  4UM8 A;  3V4V A;  1L5G A;  2VDN A;  3NIG A;  5E6S A;  3ZE0 A;  3K72 A;  4WK4 A;  3FCS A;  4NEN A;  1TYE A;  4MMX A;  3NIF A;  5E6R A;  4O02 A;  3K6S A;  1U8C A;  2VDL A;  4G1M A;  2VDQ A;  3ZE2 A;  4MMY A;  2VDP A;  4Z7O A;  3K71 A;  2VDR A;  2VDK A;  3NID A; 
#chains in the Genus database with same CATH topology
 2UZY B;  4NBM A;  5EMM B;  4WK0 A;  2AQ5 A;  5HE2 B;  3EG6 A;  4CZX A;  3HFQ A;  4J87 A;  3DWL C;  4ZOV A;  5HE0 B;  3AL8 A;  3IIY A;  5H17 A;  2XL2 A;  3T3P A;  1H2X A;  3V5W B;  1GG2 B;  2QR5 A;  3OF7 A;  5K19 A;  5EAL A;  1B9X A;  4GM8 A;  4J0X A;  3PSL A;  4BH6 A;  2IUQ A;  2VZ3 A;  3AL8 B;  1R5M A;  2HU7 A;  2HXC A;  3SWS D;  2EIE A;  4MMX A;  4R7A B;  4X63 B;  3UKR C;  2H9M A;  4J77 A;  2HKR A;  3KCI A;  5EMK B;  4FA1 D;  3PSC B;  2J57 G;  3FGB A;  5FXY A;  4BCC A;  2VC2 A;  5M5R A;  2GC7 A;  4J82 A;  4UM9 A;  5EM2 A;  5HQG A;  2H68 A;  3BWS A;  5CXC A;  3VH0 A;  5GXI A;  4N14 A;  3T3M A;  4A0A A;  2YMU A;  2AGX A;  2G9A A;  2YBA A;  3JRP A;  2P9L C;  1L5G A;  3GRE A;  2Z2N A;  4NEN A;  1XKS A;  5EM2 B;  4CY5 A;  3K6S A;  4J73 A;  4DNU A;  4FA4 D;  5CXC B;  2XDW A;  3BG0 A;  3EQ8 A;  4GQB B;  4A0A B;  4J81 A;  1MG3 A;  3SVW D;  1H2Z A;  4YVD A;  1N6F A;  1VZ3 A;  4ZOY A;  4J78 A;  4FA9 D;  1PI6 A;  3DXM C;  1UTC A;  4AMY A;  2QXV A;  4BCB A;  4UI9 R;  5FFO A;  4FWW A;  5EAR A;  4MK0 B;  2AH1 A;  4PXW A;  3O4G A;  4O2W A;  4NC4 A;  1BPO A;  4GQ2 P;  4AEZ A;  5AMS A;  4PSX B;  4Y7R A;  4QL1 A;  4O9D A;  2VDL A;  1K3I A;  5KDO B;  5FLX g;  4JT6 C;  1K32 A;  1ERJ A;  1NEX B;  4D9S A;  4ZOZ A;  3FRX A;  4RE6 A;  1GXR A;  1UOO A;  3O4J A;  3E0C A;  2HES X;  3PE7 A;  1GOH A;  2PM9 A;  2CE9 A;  5GSA A;  2QC5 A;  3UVK A;  1XHM A;  2AGY A;  2CO0 C;  2IUV A;  1JMZ B;  1UOP A;  2O9K A;  3RLM D;  3DXK C;  5FKS A;  3FM0 A;  2PM9 B;  1GOT B;  4QRJ A;  4K3J B;  3UVO A;  4X61 B;  4AX4 A;  1TBG A;  4AOW A;  3UVN A;  5FKQ A;  3PXT D;  4L3G D;  4FAV D;  4ERQ A;  4G1E A;  2P9S C;  5IGO A;  4NSX A;  2IUR A;  4L3H D;  3IIW A;  4IRZ A;  3ZDY A;  4FAN D;  2EBS A;  2AH0 A;  2IUP A;  4WJK A;  3RFH A;  4L1M A;  3DM0 A;  1JTD B;  4J0W A;  3A0F A;  4LG9 A;  3F3G A;  2QZP A;  1U4C A;  3FCS A;  3I89 A;  4BP8 A;  1VE7 A;  3SHF A;  3CFS B;  3MUO A;  5GMK n;  3L4M D;  4Z7Q A;  3OKT A;  5H1M A;  4PNK B;  4JD2 C;  1RI6 A;  4IA9 A;  4U7A A;  3OTT A;  5JWZ A;  4E5Z A;  3P4F A;  5GXH A;  3NVN A;  3OKW A;  3EI3 A;  3JZH A;  5C92 A;  3IJC A;  3SXT D;  3RMZ D;  4CI3 A;  5C2W B;  3JZG A;  3RN0 D;  3IJ0 A;  2EIC A;  1FWX A;  4E5Z B;  2TRC B;  3ODT A;  3EI3 B;  3J80 g;  3IUR A;  3KRW B;  3B7F A;  3JZN A;  2VDK A;  2OK6 A;  1N6E A;  4CI1 A;  4ZOX A;  5IGQ A;  1N6D A;  1GP2 B;  3QHY B;  3SBQ A;  4JSX C;  3V9F A;  3DSM A;  3I8C A;  4BUJ C;  4GMB A;  3ZE1 A;  2I3S A;  5IC7 A;  4CZV A;  3IUM A;  3ULE C;  5IJ7 E;  1H2W A;  3AL9 A;  4DNV A;  2P9I C;  3U4Y A;  5C9Z B;  3V4V A;  4BL0 A;  2H14 A;  2GNQ A;  4WK4 A;  1O6F A;  1OLZ A;  4G56 B;  2BCJ B;  5A2Q g;  2J55 H;  5TEE A;  1NR0 A;  2H9P A;  5IT9 g;  4E54 A;  2PM6 B;  4MMY A;  1XIP A;  4JHN A;  1Q47 A;  2YB8 B;  3I7N A;  2JKX A;  3W15 A;  3I7L A;  2HJB A;  2OIZ A;  5FA5 B;  4KFM B;  2J56 H;  4E54 B;  4O45 A;  2H3X A;  4LG8 A;  3MKS B;  2AGW A;  3JPX A;  3FCU A;  3MVD K;  2Z2O A;  4Z7N A;  2YNN A;  5HDB A;  3SCY A;  5FFG A;  3NVX A;  1SQJ A;  5FKT A;  3RSE C;  2P9N C;  2CO0 A;  4FHL A;  3F3P A;  1L0Q A;  3NIF A;  2IWF A;  4O3T B;  4ERY A;  3BG1 A;  1C9L A;  3MXX A;  2VDQ A;  3NVQ A;  4CY2 A;  4JSV C;  4ERZ A;  3SJL D;  1A0R B;  5EAM A;  4O3U B;  3KRX B;  2I3T A;  1T2X A;  4G55 A;  4L1Q D;  4A2M A;  2WQ8 A;  4JXM A;  1SQ9 A;  2OVP B;  4A11 A;  2OVQ B;  2VZ1 A;  4AMZ A;  1QNI A;  2H6K A;  1QFS A;  4O1Q D;  1I2M B;  3MUN A;  3ZE0 A;  4J84 A;  1TYE A;  3SLE D;  3N0E A;  1U8C A;  4A11 B;  2AGL A;  2I0S A;  1PBY B;  3EI2 A;  4L9O A;  1JJU B;  2Z2P A;  3JRO A;  4H5J A;  3UKU C;  4GGA A;  2PBI B;  1UOQ A;  2IWK A;  3SBP A;  3C75 H;  2VDM A;  5TDH B;  2Q7Q A;  3EI2 B;  2H6N A;  4D6V A;  1S4U X;  4OWR A;  3V4P A;  3VA6 A;  5SXM A;  2HJ4 A;  3IJE A;  2XL3 A;  1E5T A;  5HYN B;  3PXS D;  3PVU B;  4OZU A;  4QAM A;  1SHY B;  2VDR A;  4A08 A;  3I7P A;  4IMM A;  4JHP C;  4D0K A;  1C9I A;  2HYE A;  2YNO A;  3EQ7 A;  5EAP A;  3K26 A;  2I0R A;  2CNX A;  4EWR A;  1TYQ C;  2OK4 A;  3OW8 A;  2XZG A;  3CFV A;  3UVL A;  4JT5 C;  4BP9 A;  5H14 A;  4GM9 A;  3MZK A;  4TZ4 A;  5M5U A;  3N0D A;  3IUJ A;  4GGC A;  1H2Y A;  1E8M A;  3I7H A;  5EMJ B;  3J81 g;  2BBK H;  4Z7O A;  4X3E A;  4XYH A;  3GD1 I;  4CZY A;  5TEF A;  3EI4 A;  2VDO A;  4J86 A;  4ESG A;  2EIB A;  4QQE A;  5EML B;  2PM7 B;  3SFZ A;  1B9Y A;  2UZX B;  1GOF A;  3EI4 B;  3SN6 B;  3EI1 A;  2VDN A;  3IUN A;  3EMH A;  1VYH C;  3MMY A;  3K72 A;  1GOG A;  2P9P C;  5E6R A;  2H9N A;  3K71 A;  4JSP C;  4K3I D;  4PBY A;  3NID A;  4X60 B;  3SMR A;  3EI1 B;  4I79 A;  4FB1 D;  3JAM g;  4MMZ A;  3OL2 A;  3L4O D;  1P22 A;  2XE4 A;  4A7J A;  1U2V C;  4JSN C;  5AFU 3;  2G99 A;  3AH8 B;  3V7D B;  3O4H A;  3C5M A;  3EQ9 A;  4LGN A;  5FQD A;  4AN0 A;  4DNW A;  1PEV A;  5CYK A;  4J8B A;  5C2V B;  4CI8 A;  4PBZ A;  4BCD A;  3RRM C;  3C99 A;  3O4I A;  1K8K C;  3OL2 B;  1JV2 A;  3IUQ A;  3C9C A;  4PSW B;  4XEI C;  2B4E A;  2AGZ A;  3GFC A;  4GQ1 A;  1YR2 A;  3CIK B;  4Y5R D;  4CI2 A;  5CYK B;  5I5I A;  3PVW B;  2VDP A;  3UR4 A;  3I7O A;  5FKR A;  4A09 A;  4A0B A;  1MG2 A;  2CE8 A;  3I2N A;  2XYI A;  4CY1 A;  1PGU A;  4QT8 A;  1MDA H;  5AJA A;  3IKO A;  4XYI A;  4H5I A;  4WK2 A;  2GC4 A;  4GZ8 A;  3VI4 A;  4GM3 A;  4A09 B;  2H6Q A;  2IAA A;  4RE5 A;  3SBR A;  4A0B B;  4UM8 A;  5CXB A;  3NIG A;  2P9K C;  2B5L A;  2EID A;  3AFC A;  2B5M A;  2OVR B;  3I8E A;  2BKL A;  5M61 A;  3ZWL B;  2W18 A;  2H47 A;  4NAA A;  5I5M A;  3VI3 A;  5CXB B;  2YNP A;  5IJ8 E;  2HU8 A;  5HE1 B;  3VGZ A;  3DDU A;  4CC9 A;  5M5V A;  3ZDX A;  5THA A;  1VZ2 A;  3F3F A;  2HU5 A;  5I5J A;  3MKQ A;  3UVM A;  3I7K A;  3IVM A;  1M1X A;  4CY3 A;  3JB9 L;  3EU7 A;  2B5N A;  4U1E I;  5E6U A;  1A12 A;  3RFG A;  5K1C C;  5C86 A;  2OJY A;  2P9U C;  2H9L A;  2XU7 A;  1YFQ A;  3PXW D;  3ORV D;  4A2L A;  4J8G A;  2HKM A;  3EWE A;  3ZE2 A;  3GC3 B;  1VE6 A;  1OMW B;  3MZL A;  2H13 A;  5M5S A;  2MTA H;  4Z8L A;  1O6G A;  1JMX B;  3OKY B;  5M5T A;  5HE3 B;  4AN1 A;  1QFM A;  4PC0 A;  4FA5 D;  4ES0 A;  1JOF A;  4A08 B;  3IUL A;  3OKY A;  3ZDZ A;  2CN2 A;  5TF2 A;  3QI0 A;  5E6S A;  4GGD A;  4J79 A;  4HDJ A;  4O02 A;  3K27 A;  4G1M A;  1E8N A;  2I0T A;  3RN1 D;  5B4W A;  2CN3 A;  4ZN4 A;  3IJ1 A; 
#chains in the Genus database with same CATH homology
 3VI3 A;  4Z7Q A;  4G1E A;  4MMZ A;  4WK0 A;  3ZDX A;  2VDO A;  2VC2 A;  5FFO A;  2VDM A;  4UM9 A;  4IRZ A;  3ZDY A;  3ZE1 A;  4WK2 A;  4WJK A;  3FCU A;  3VI4 A;  4Z7N A;  5HDB A;  3T3M A;  3T3P A;  5FFG A;  1M1X A;  3V4P A;  3ZDZ A;  3IJE A;  1JV2 A;  5E6U A;  4UM8 A;  3V4V A;  1L5G A;  2VDN A;  3NIG A;  5E6S A;  3ZE0 A;  3K72 A;  4WK4 A;  3FCS A;  4NEN A;  1TYE A;  4MMX A;  3NIF A;  5E6R A;  4O02 A;  3K6S A;  1U8C A;  2VDL A;  4G1M A;  2VDQ A;  3ZE2 A;  4MMY A;  2VDP A;  4Z7O A;  3K71 A;  2VDR A;  2VDK A;  3NID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...