2VDQA

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 107
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vdqA00
3ZDXA 2VDRA 1U8CA 4WK0A 4UM9A 2VDLA 3ZDYA 3ZE2A 4UM8A 5E6SA 5FFOA 2VC2A 3FCUA 3V4PA 3K72A 3K71A 4MMZA 4IRZA 5E6UA 5HDBA 3VI3A 4Z7OA 2VDPA 2VDKA 3ZE0A 4MMYA 2VDQA 5FFGA 2VDNA 3NIFA 3V4VA 1JV2A 3IJEA 3NIDA 4Z7QA 3T3MA 3K6SA 4O02A 3ZDZA 4Z7NA 3ZE1A 3VI4A 5E6RA 4NENA 4WK2A 4G1MA 1M1XA 1TYEA 4MMXA 3T3PA 2VDMA 4G1EA 3FCSA 3NIGA 4WJKA 4WK4A 2VDOA 1L5GA
chains in the Genus database with same CATH superfamily
4PC0A 3UVMA 2AGXA 3AL9A 3I8EA 5M61A 4A0AA 4U7AA 5M5UA 3SHFA 3F3GA 4JT5C 3L4MD 4CZVA 4XYIA 2J55H 2XL2A 4H5IA 1C9IA 5C92A 2IUVA 2XE4A 3OF7A 5FKRA 2H9NA 4L3HD 2YNNA 1N6EA 3SCYA 2HKMA 4FHLA 3AFCA 5HYNB 3VA6A 5CXBA 4O3TB 5C2WB 2I3TA 4GMBA 4J0WA 3DSMA 4L1MA 4FA4D 3FCUA 2OK4A 4QAMA 4QL1A 2B5MA 3MXXA 5JWZA 5M5TA 4RE5A 2YMUA 5H17A 4IMMA 1K3IA 4JT6C 4J87A 5FQDA 2OVRB 2O9KA 4CI2A 2Z2NA 3EI4B 3EU7A 4LG9A 2HU7A 1E8MA 2OJYA 4LG8A 5EMJB 3AL8B 3FGBA 4MK0B 2IWFA 3A0FA 3N0DA 4RE6A 4GZ8A 5M5SA 5H1MA 5TF2A 4PSXB 5K19A 3JZGA 2G9AA 4Z7NA 3PSCB 1H2YA 5TEEA 5EAMA 4JD2C 4E54A 4WK2A 4G56B 3IURA 1M1XA 2CN2A 5THAA 3GD1I 4FAVD 2XYIA 3BG1A 4WJKA 1PGUA 2UZYB 1ERJA 3C99A 4BH6A 4A09B 5GSAA 4UM9A 3ULEC 1Q47A 1GOFA 4FWWA 3MUOA 2AGWA 3E0CA 3JROA 4O3UB 3UVOA 5K1CC 3RN1D 5C86A 3K71A 4D6VA 3BWSA 4Z8LA 3NVXA 5FFGA 4A11B 2VDNA 4CY3A 4J0XA 2I0SA 2IUPA 3RFGA 4A0BB 2H3XA 1TYEA 4CI8A 2IWKA 4D0KA 3U4YA 3F3PA 1VZ2A 3IJ1A 3CFSB 4LGNA 5SXMA 4AOWA 2H14A 4Y5RD 3I7PA 3OKTA 4CZXA 4GM3A 2AGZA 1VZ3A 3V5WB 2H9PA 4PBYA 5IGQA 4NC4A 3EQ8A 5GXHA 5IJ8E 3PXWD 3T3MA 5CXCA 2PBIB 3ZE1A 1S4UX 4CY5A 3UVLA 5TDHB 5HE3B 4NBMA 4JXMA 3PVUB 1SQJA 2P9PC 4G1EA 4GGAA 4JSPC 3C75H 1U2VC 4L9OA 2QXVA 4AX4A 2UZXB 2P9UC 4AEZA 5AFU3 3I89A 4ERQA 3B7FA 5FFOA 1GOGA 2XL3A 2B4EA 2HU8A 3K26A 3I7NA 4JSVC 2AQ5A 1UOPA 3RN0D 3I2NA 5EM2A 1K32A 2EIEA 4O02A 2H9LA 1H2XA 3OL2A 5E6RA 2JKXA 4JHPC 3ZWLB 3IJ0A 3EQ7A 1UTCA 4BP8A 1FWXA 2P9IC 2XDWA 4R7AB 4X63B 3RRMC 4ESGA 4GGDA 3P4FA 4UM8A 1JJUB 3NVNA 5CYKB 5H14A 4XEIC 4J79A 2YBAA 2B5NA 3EI3A 4GGCA 3MKSB 4J82A 4L3GD 3NIFA 5HE0B 5C2VB 3GREA 3EI2B 1VE7A 2EIDA 1B9XA 3KRWB 3C9CA 3EWEA 4PSWB 5EMKB 3I7KA 4A2LA 2W18A 5GXIA 2CNXA 2H6NA 4CY1A 4E54B 1OLZA 2VDRA 2OK6A 2GC4A 3HFQA 4ZOZA 2TRCB 4U1EI 3ODTA 4BL0A 2IUQA 2VC2A 5HQGA 3UVKA 2VDKA 1YR2A 5TEFA 1T2XA 3IJEA 2HYEA 3J81g 3V9FA 1E8NA 2BKLA 2P9SC 4A08B 4X3EA 3I7LA 4E5ZB 3UVNA 1I2MB 3RFHA 3SBRA 3IKOA 4BCBA 2EICA 3AH8B 3OKWA 4O2WA 4JSNC 4WK0A 2OIZA 2VDLA 2Q7QA 4FA1D 3C5MA 5IJ7E 1QFSA 4JSXC 3O4HA 3PSLA 4D9SA 4J84A 3V4PA 3EQ9A 3PE7A 4GQ2P 4QRJA 4IRZA 1U4CA 4X61B 3NVQA 3SJLD 3V4VA 3IIWA 3V7DB 2PM9B 4XYHA 3SVWD 4OWRA 2AH0A 3MKQA 1RI6A 2I0TA 3FCSA 2H68A 3O4JA 4QQEA 3SN6B 4NAAA 3SBQA 5IT9g 1L5GA 4J77A 3OKYB 3JZHA 1U8CA 4TZ4A 1GOHA 3ZDYA 1GP2B 3BG0A 1YFQA 4A2MA 3PVWB 4FB1D 4X60B 4Z7OA 3RLMD 2Z2OA 2GC7A 1UOOA 2PM6B 1N6DA 4J86A 4A0AB 1PBYB 4Y7RA 5FKSA 4CZYA 4CI1A 3SWSD 1B9YA 1TYQC 4J73A 4GQ1A 1VYHC 3O4IA 2HKRA 3EMHA 4JHNA 3OL2B 2H47A 5AJAA 5EALA 3ZE2A 4CI3A 2G99A 4FA5D 4DNWA 4EWRA 3RMZD 4A0BA 3I7HA 5CXBB 4MMZA 5HDBA 5HE1B 3VH0A 4ERYA 1NEXB 1MDAH 2H6QA 3MZLA 2BCJB 2BBKH 2OVQB 4BUJC 3GC3B 3NIDA 1GXRA 3ZDZA 1OMWB 3VI4A 3QHYB 5HE2B 3DWLC 2J57G 4HDJA 4AN1A 2B5LA 3CFVA 4PNKB 3T3PA 2VDMA 1JTDB 2CN3A 1A0RB 1K8KC 5FLXg 2GNQA 4PXWA 3DDUA 2HU5A 2QR5A 5EMLB 3UKRC 3EI1A 2H9MA 5E6SA 2IAAA 3OTTA 2MTAH 3VGZA 3CIKB 3IIYA 3JZNA 5FKTA 3JPXA 4FAND 2EBSA 5B4WA 2J56H 3IULA 3N0EA 3L4OD 1JV2A 3MZKA 4FA9D 4AMZA 3KCIA 3OW8A 1E5TA 5GMKn 4ERZA 3PXTD 4BCCA 3SFZA 3DXKC 3I7OA 5M5RA 3RSEC 2H13A 1O6GA 5EAPA 5AMSA 3IUNA 4BP9A 4YVDA 2P9LC 4H5JA 2I0RA 1JMXB 3FRXA 4BCDA 2EIBA 5C9ZB 4J78A 1SHYB 1H2ZA 4L1QD 5IC7A 4AMYA 1H2WA 3ORVD 2P9NC 1XKSA 3K27A 4NENA 2AH1A 3EG6A 4O45A 5CYKA 4MMXA 2CO0A 5FXYA 5EARA 4KFMB 3IUQA 1GOTB 1XIPA 1PEVA 2CO0C 1PI6A 3EI2A 1XHMA 5I5MA 1QNIA 4J8GA 3K72A 1JMZB 3MVDK 3I8CA 2XZGA 4N14A 4IA9A 2AGYA 4ZOYA 2VDQA 2YNOA 4GM8A 3JB9L 1QFMA 4CY2A 5EMMB 1SQ9A 5I5JA 2AGLA 3MMYA 2HESX 3EI4A 3MUNA 4UI9R 3JAMg 3AL8A 1NR0A 3IUMA 4J81A 3SBPA 1BPOA 2XU7A 3FM0A 2HXCA 1C9LA 3IUJA 4K3JB 1MG2A 4OZUA 4WK4A 2QZPA 5CXCB 4CC9A 2IURA 2P9KC 1R5MA 4DNVA 3SMRA 2PM7B 3W15A 2I3SA 3KRXB 3SLED 2VZ3A 4GM9A 4DNUA 4A08A 2HJBA 3VI3A 3F3FA 2VDPA 3O4GA 3ZE0A 4ZN4A 1TBGA 4E5ZA 5I5IA 1VE6A 5M5VA 3K6SA 4G55A 4PBZA 4A09A 1O6FA 3IVMA 4ZOXA 5EM2B 1JOFA 3PXSD 4I79A 3NIGA 2YNPA 2CE9A 2VDOA 1UOQA 5FA5B 3IJCA 1A12A 3ZDXA 3DM0A 1MG3A 4GQBB 3J80g 2CE8A 4AN0A 4A11A 2H6KA 2QC5A 4ZOVA 2VZ1A 2OVPB 3QI0A 2PM9A 2HJ4A 3UR4A 3EI1B 3DXMC 4NSXA 2Z2PA 4K3ID 5E6UA 3GFCA 4MMYA 3UKUC 2WQ8A 4Z7QA 5A2Qg 3SXTD 3EI3B 3OKYA 1P22A 4ES0A 3JRPA 4O9DA 5KDOB 4QT8A 4A7JA 2YB8B 5FKQA 5IGOA 1GG2B 1L0QA 4J8BA 4O1QD 4G1MA 1N6FA
chains in the Genus database with same CATH topology
3ZDXA 2VDRA 1U8CA 4WK0A 4UM9A 2VDLA 3ZDYA 3ZE2A 4UM8A 5E6SA 5FFOA 2VC2A 3FCUA 3V4PA 3K72A 3K71A 4MMZA 4IRZA 5E6UA 5HDBA 3VI3A 4Z7OA 2VDPA 2VDKA 3ZE0A 4MMYA 2VDQA 5FFGA 2VDNA 3NIFA 3V4VA 1JV2A 3IJEA 3NIDA 4Z7QA 3T3MA 3K6SA 4O02A 3ZDZA 4Z7NA 3ZE1A 3VI4A 5E6RA 4NENA 4WK2A 4G1MA 1M1XA 1TYEA 4MMXA 3T3PA 2VDMA 4G1EA 3FCSA 3NIGA 4WJKA 4WK4A 2VDOA 1L5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDX A;  2VDR A;  1U8C A;  4WK0 A;  4UM9 A;  2VDL A;  3ZDY A;  3ZE2 A;  4UM8 A;  5E6S A;  5FFO A;  2VC2 A;  3FCU A;  3V4P A;  3K72 A;  3K71 A;  4MMZ A;  4IRZ A;  5E6U A;  5HDB A;  3VI3 A;  4Z7O A;  2VDP A;  2VDK A;  3ZE0 A;  4MMY A;  2VDQ A;  5FFG A;  2VDN A;  3NIF A;  3V4V A;  1JV2 A;  3IJE A;  3NID A;  4Z7Q A;  3T3M A;  3K6S A;  4O02 A;  3ZDZ A;  4Z7N A;  3ZE1 A;  3VI4 A;  5E6R A;  4NEN A;  4WK2 A;  4G1M A;  1M1X A;  1TYE A;  4MMX A;  3T3P A;  2VDM A;  4G1E A;  3FCS A;  3NIG A;  4WJK A;  4WK4 A;  2VDO A;  1L5G A; 
#chains in the Genus database with same CATH topology
 4PC0 A;  3UVM A;  2AGX A;  3AL9 A;  3I8E A;  5M61 A;  4A0A A;  4U7A A;  5M5U A;  3SHF A;  3F3G A;  4JT5 C;  3L4M D;  4CZV A;  4XYI A;  2J55 H;  2XL2 A;  4H5I A;  1C9I A;  5C92 A;  2IUV A;  2XE4 A;  3OF7 A;  5FKR A;  2H9N A;  4L3H D;  2YNN A;  1N6E A;  3SCY A;  2HKM A;  4FHL A;  3AFC A;  5HYN B;  3VA6 A;  5CXB A;  4O3T B;  5C2W B;  2I3T A;  4GMB A;  4J0W A;  3DSM A;  4L1M A;  4FA4 D;  3FCU A;  2OK4 A;  4QAM A;  4QL1 A;  2B5M A;  3MXX A;  5JWZ A;  5M5T A;  4RE5 A;  2YMU A;  5H17 A;  4IMM A;  1K3I A;  4JT6 C;  4J87 A;  5FQD A;  2OVR B;  2O9K A;  4CI2 A;  2Z2N A;  3EI4 B;  3EU7 A;  4LG9 A;  2HU7 A;  1E8M A;  2OJY A;  4LG8 A;  5EMJ B;  3AL8 B;  3FGB A;  4MK0 B;  2IWF A;  3A0F A;  3N0D A;  4RE6 A;  4GZ8 A;  5M5S A;  5H1M A;  5TF2 A;  4PSX B;  5K19 A;  3JZG A;  2G9A A;  4Z7N A;  3PSC B;  1H2Y A;  5TEE A;  5EAM A;  4JD2 C;  4E54 A;  4WK2 A;  4G56 B;  3IUR A;  1M1X A;  2CN2 A;  5THA A;  3GD1 I;  4FAV D;  2XYI A;  3BG1 A;  4WJK A;  1PGU A;  2UZY B;  1ERJ A;  3C99 A;  4BH6 A;  4A09 B;  5GSA A;  4UM9 A;  3ULE C;  1Q47 A;  1GOF A;  4FWW A;  3MUO A;  2AGW A;  3E0C A;  3JRO A;  4O3U B;  3UVO A;  5K1C C;  3RN1 D;  5C86 A;  3K71 A;  4D6V A;  3BWS A;  4Z8L A;  3NVX A;  5FFG A;  4A11 B;  2VDN A;  4CY3 A;  4J0X A;  2I0S A;  2IUP A;  3RFG A;  4A0B B;  2H3X A;  1TYE A;  4CI8 A;  2IWK A;  4D0K A;  3U4Y A;  3F3P A;  1VZ2 A;  3IJ1 A;  3CFS B;  4LGN A;  5SXM A;  4AOW A;  2H14 A;  4Y5R D;  3I7P A;  3OKT A;  4CZX A;  4GM3 A;  2AGZ A;  1VZ3 A;  3V5W B;  2H9P A;  4PBY A;  5IGQ A;  4NC4 A;  3EQ8 A;  5GXH A;  5IJ8 E;  3PXW D;  3T3M A;  5CXC A;  2PBI B;  3ZE1 A;  1S4U X;  4CY5 A;  3UVL A;  5TDH B;  5HE3 B;  4NBM A;  4JXM A;  3PVU B;  1SQJ A;  2P9P C;  4G1E A;  4GGA A;  4JSP C;  3C75 H;  1U2V C;  4L9O A;  2QXV A;  4AX4 A;  2UZX B;  2P9U C;  4AEZ A;  5AFU 3;  3I89 A;  4ERQ A;  3B7F A;  5FFO A;  1GOG A;  2XL3 A;  2B4E A;  2HU8 A;  3K26 A;  3I7N A;  4JSV C;  2AQ5 A;  1UOP A;  3RN0 D;  3I2N A;  5EM2 A;  1K32 A;  2EIE A;  4O02 A;  2H9L A;  1H2X A;  3OL2 A;  5E6R A;  2JKX A;  4JHP C;  3ZWL B;  3IJ0 A;  3EQ7 A;  1UTC A;  4BP8 A;  1FWX A;  2P9I C;  2XDW A;  4R7A B;  4X63 B;  3RRM C;  4ESG A;  4GGD A;  3P4F A;  4UM8 A;  1JJU B;  3NVN A;  5CYK B;  5H14 A;  4XEI C;  4J79 A;  2YBA A;  2B5N A;  3EI3 A;  4GGC A;  3MKS B;  4J82 A;  4L3G D;  3NIF A;  5HE0 B;  5C2V B;  3GRE A;  3EI2 B;  1VE7 A;  2EID A;  1B9X A;  3KRW B;  3C9C A;  3EWE A;  4PSW B;  5EMK B;  3I7K A;  4A2L A;  2W18 A;  5GXI A;  2CNX A;  2H6N A;  4CY1 A;  4E54 B;  1OLZ A;  2VDR A;  2OK6 A;  2GC4 A;  3HFQ A;  4ZOZ A;  2TRC B;  4U1E I;  3ODT A;  4BL0 A;  2IUQ A;  2VC2 A;  5HQG A;  3UVK A;  2VDK A;  1YR2 A;  5TEF A;  1T2X A;  3IJE A;  2HYE A;  3J81 g;  3V9F A;  1E8N A;  2BKL A;  2P9S C;  4A08 B;  4X3E A;  3I7L A;  4E5Z B;  3UVN A;  1I2M B;  3RFH A;  3SBR A;  3IKO A;  4BCB A;  2EIC A;  3AH8 B;  3OKW A;  4O2W A;  4JSN C;  4WK0 A;  2OIZ A;  2VDL A;  2Q7Q A;  4FA1 D;  3C5M A;  5IJ7 E;  1QFS A;  4JSX C;  3O4H A;  3PSL A;  4D9S A;  4J84 A;  3V4P A;  3EQ9 A;  3PE7 A;  4GQ2 P;  4QRJ A;  4IRZ A;  1U4C A;  4X61 B;  3NVQ A;  3SJL D;  3V4V A;  3IIW A;  3V7D B;  2PM9 B;  4XYH A;  3SVW D;  4OWR A;  2AH0 A;  3MKQ A;  1RI6 A;  2I0T A;  3FCS A;  2H68 A;  3O4J A;  4QQE A;  3SN6 B;  4NAA A;  3SBQ A;  5IT9 g;  1L5G A;  4J77 A;  3OKY B;  3JZH A;  1U8C A;  4TZ4 A;  1GOH A;  3ZDY A;  1GP2 B;  3BG0 A;  1YFQ A;  4A2M A;  3PVW B;  4FB1 D;  4X60 B;  4Z7O A;  3RLM D;  2Z2O A;  2GC7 A;  1UOO A;  2PM6 B;  1N6D A;  4J86 A;  4A0A B;  1PBY B;  4Y7R A;  5FKS A;  4CZY A;  4CI1 A;  3SWS D;  1B9Y A;  1TYQ C;  4J73 A;  4GQ1 A;  1VYH C;  3O4I A;  2HKR A;  3EMH A;  4JHN A;  3OL2 B;  2H47 A;  5AJA A;  5EAL A;  3ZE2 A;  4CI3 A;  2G99 A;  4FA5 D;  4DNW A;  4EWR A;  3RMZ D;  4A0B A;  3I7H A;  5CXB B;  4MMZ A;  5HDB A;  5HE1 B;  3VH0 A;  4ERY A;  1NEX B;  1MDA H;  2H6Q A;  3MZL A;  2BCJ B;  2BBK H;  2OVQ B;  4BUJ C;  3GC3 B;  3NID A;  1GXR A;  3ZDZ A;  1OMW B;  3VI4 A;  3QHY B;  5HE2 B;  3DWL C;  2J57 G;  4HDJ A;  4AN1 A;  2B5L A;  3CFV A;  4PNK B;  3T3P A;  2VDM A;  1JTD B;  2CN3 A;  1A0R B;  1K8K C;  5FLX g;  2GNQ A;  4PXW A;  3DDU A;  2HU5 A;  2QR5 A;  5EML B;  3UKR C;  3EI1 A;  2H9M A;  5E6S A;  2IAA A;  3OTT A;  2MTA H;  3VGZ A;  3CIK B;  3IIY A;  3JZN A;  5FKT A;  3JPX A;  4FAN D;  2EBS A;  5B4W A;  2J56 H;  3IUL A;  3N0E A;  3L4O D;  1JV2 A;  3MZK A;  4FA9 D;  4AMZ A;  3KCI A;  3OW8 A;  1E5T A;  5GMK n;  4ERZ A;  3PXT D;  4BCC A;  3SFZ A;  3DXK C;  3I7O A;  5M5R A;  3RSE C;  2H13 A;  1O6G A;  5EAP A;  5AMS A;  3IUN A;  4BP9 A;  4YVD A;  2P9L C;  4H5J A;  2I0R A;  1JMX B;  3FRX A;  4BCD A;  2EIB A;  5C9Z B;  4J78 A;  1SHY B;  1H2Z A;  4L1Q D;  5IC7 A;  4AMY A;  1H2W A;  3ORV D;  2P9N C;  1XKS A;  3K27 A;  4NEN A;  2AH1 A;  3EG6 A;  4O45 A;  5CYK A;  4MMX A;  2CO0 A;  5FXY A;  5EAR A;  4KFM B;  3IUQ A;  1GOT B;  1XIP A;  1PEV A;  2CO0 C;  1PI6 A;  3EI2 A;  1XHM A;  5I5M A;  1QNI A;  4J8G A;  3K72 A;  1JMZ B;  3MVD K;  3I8C A;  2XZG A;  4N14 A;  4IA9 A;  2AGY A;  4ZOY A;  2VDQ A;  2YNO A;  4GM8 A;  3JB9 L;  1QFM A;  4CY2 A;  5EMM B;  1SQ9 A;  5I5J A;  2AGL A;  3MMY A;  2HES X;  3EI4 A;  3MUN A;  4UI9 R;  3JAM g;  3AL8 A;  1NR0 A;  3IUM A;  4J81 A;  3SBP A;  1BPO A;  2XU7 A;  3FM0 A;  2HXC A;  1C9L A;  3IUJ A;  4K3J B;  1MG2 A;  4OZU A;  4WK4 A;  2QZP A;  5CXC B;  4CC9 A;  2IUR A;  2P9K C;  1R5M A;  4DNV A;  3SMR A;  2PM7 B;  3W15 A;  2I3S A;  3KRX B;  3SLE D;  2VZ3 A;  4GM9 A;  4DNU A;  4A08 A;  2HJB A;  3VI3 A;  3F3F A;  2VDP A;  3O4G A;  3ZE0 A;  4ZN4 A;  1TBG A;  4E5Z A;  5I5I A;  1VE6 A;  5M5V A;  3K6S A;  4G55 A;  4PBZ A;  4A09 A;  1O6F A;  3IVM A;  4ZOX A;  5EM2 B;  1JOF A;  3PXS D;  4I79 A;  3NIG A;  2YNP A;  2CE9 A;  2VDO A;  1UOQ A;  5FA5 B;  3IJC A;  1A12 A;  3ZDX A;  3DM0 A;  1MG3 A;  4GQB B;  3J80 g;  2CE8 A;  4AN0 A;  4A11 A;  2H6K A;  2QC5 A;  4ZOV A;  2VZ1 A;  2OVP B;  3QI0 A;  2PM9 A;  2HJ4 A;  3UR4 A;  3EI1 B;  3DXM C;  4NSX A;  2Z2P A;  4K3I D;  5E6U A;  3GFC A;  4MMY A;  3UKU C;  2WQ8 A;  4Z7Q A;  5A2Q g;  3SXT D;  3EI3 B;  3OKY A;  1P22 A;  4ES0 A;  3JRP A;  4O9D A;  5KDO B;  4QT8 A;  4A7J A;  2YB8 B;  5FKQ A;  5IGO A;  1GG2 B;  1L0Q A;  4J8B A;  4O1Q D;  4G1M A;  1N6F A; 
#chains in the Genus database with same CATH homology
 3ZDX A;  2VDR A;  1U8C A;  4WK0 A;  4UM9 A;  2VDL A;  3ZDY A;  3ZE2 A;  4UM8 A;  5E6S A;  5FFO A;  2VC2 A;  3FCU A;  3V4P A;  3K72 A;  3K71 A;  4MMZ A;  4IRZ A;  5E6U A;  5HDB A;  3VI3 A;  4Z7O A;  2VDP A;  2VDK A;  3ZE0 A;  4MMY A;  2VDQ A;  5FFG A;  2VDN A;  3NIF A;  3V4V A;  1JV2 A;  3IJE A;  3NID A;  4Z7Q A;  3T3M A;  3K6S A;  4O02 A;  3ZDZ A;  4Z7N A;  3ZE1 A;  3VI4 A;  5E6R A;  4NEN A;  4WK2 A;  4G1M A;  1M1X A;  1TYE A;  4MMX A;  3T3P A;  2VDM A;  4G1E A;  3FCS A;  3NIG A;  4WJK A;  4WK4 A;  2VDO A;  1L5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...