2VDQH

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
219
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 43
structure length 219
sequence length 221
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqH02
3VDAA 3GJFH 5ESAA 3OMZA 2ADIB 5IG7A 5CZKA 1T20B 3B43A 2APBA 4OKVB 3BEWB 4NIKB 5FDWB 3O41A 2CK2A 4NKIL 1RMFL 4X4YB 4YHMH 3VXMA 2DKSA 2HYMA 3LD8C 5C0AD 2AEQH 4NPYA 1NAMA 2DIJA 4PJ9B 1MWAL 4ZS6C 3OKDA 2UWEF 4YFEA 2Y23A 3RKDD 5GS0C 3EYVB 5KSAC 4PBXA 4JAMA 4G6JH 1AP2B 3H9HB 3UTTD 2Y36H 3IAGC 2EIZB 3HE6A 2UZIH 5EBWA 3RL2B 3U30B 5JOPE 2B1AH 3WNPA 4HHAB 5T3XD 1VDGA 3ALWA 4BK4A 3P4NA 4PB0H 1JWMA 2R23A 1P4IL 3CDGA 2ZOLB 5CEXA 5C08E 3HNTL 5D1XB 3PWPE 3VFMB 4AM0A 4G80B 4HKBA 1IKNA 1KJMA 4KXZI 5F7YC 4GMSL 3VDBA 3UBXA 3W5NA 2D2OA 1KELH 4POYA 4PJXA 5JIHA 3ZE2F 1PG7L 2FJGB 4MWFB 1KACB 2IF7A 2NY0C 2P7TB 4HWUA 4QNPF 2ESVE 2NLJB 2AXGB 1BZ7A 1VESA 1ND0A 1FIGL 5BV7L 4OCXL 4JFPB 4KTDL 1AD9A 4NN7B 4N5UA 1BJ1H 4ODXA 1U41A 3UTPE 3W2DL 3JV5A 2AJXL 3D5OF 3HTLX 4DOHB 2Z4QA 3VXPA 1DDHA 1I7RB 3MRHB 4BZ2L 4CAGA 1G0YR 1T03H 3MV7B 1QUNA 2AABH 5C6TL 2H1PH 1CWVA 1CK0L 1GGIL 2A38A 4O02H 4LIQH 4XVUD 1P53A 3X14A 1MCSA 4G7VL 1AGDA 4NC1C 3AFLA 4KI5F 3NCYP 2PKDA 5SWSE 3MYZA 4IIQB 4MA1C 5IBLD 2G2RA 3MRGB 3MRKB 4U1LA 2HA1A 2LU3A 1MI5A 4JKWA 2VN4A 2R4RL 1QFWM 2ZUQC 2BSRA 4I9WD 1F13A 5AUMB 1YPZA 2F54B 4KUZL 3KPPB 1QG3A 4FQQB 3PWLB 4S1RL 1W72B 2H26A 1YNLL 4HFWB 3KGRA 5JQHC 1LO3H 5CHNA 1JUFA 1AH1A 3B5GA 4XPHH 2WANA 3OJVC 3MV7D 1E27A 5GHWH 4C54A 4X4ME 4RDQG 3FN9A 1FYTA 3PWVA 4LHUD 4J3OC 4ODUA 4P2RE 1E4KA 2ED7A 3U0WH 3MLTA 5CP3A 2P8LB 2WWKT 3WDJA 4G3YL 2ZKHL 1ADQL 1MRFH 3N9GL 5GGRY 3WD5L 2MCPL 4TRPH 3QNYA 3O9WC 5I18H 2ADFH 2WLYA 3NFSL 5F88B 1RZIB 1IM9D 3C6LC 2WIMA 5JW3H 1JNNL 4GXUM 3QCUH 1WFTA 4I2XE 4X7SH 5ID0A 3QIUC 2X10A 4ODUB 2VDNH 2A9NL 4J3VA 2PTVA 3GBLA 4OTXL 2Y5TA 5A2IH 4GSDL 4XRCB 4JCLA 3CDCA 1MRDL 1DSFH 1I7UA 2NW3B 4UT7H 2YPLB 4L5FL 4Z0BL 4DAGH 3P77A 3QA3A 4W70A 4O9HL 5C3TA 2FHFA 4ELMA 4NN5C 3TO2A 5D1QB 3IDXH 5C0BB 4XTRD 5HYSA 2P48B 5KVGL 5HD8D 5IB5B 4LPUA 5D5MB 3MRKA 4TULL 2BHYA 3MRLB 4JO3L 1G7MA 5E5UB 3KVQA 3QUZD 3LDBB 1RHHA 4U3HA 1A4JA 2Q1EA 2F74B 4MLSA 5D7KD 3OAZH 2MQCA 4NRZB 1K6QL 4YHOL 1IGJB 1EFXB 4PYHA 4H26B 4G6ML 4Y4FA 2ATPA 3WJLA 3HNVH 2BC4B 3O6FC 4JO2H 2B1AL 4RWYH 4YNYB 3ILQC 1JZ6A 3HC3H 5H8DA 2AXFA 4X98B 1HINH 1EGJA 5B39B 3MGTB 2NLJA 4JZJB 4M6NH 4PTTB 3NVQA 2QKIB 2Y25A 3IU4H 4WFED 1OM3H 4MWFA 3QDHA 3TZVB 4GAYB 1Z3GH 1KIUA 2B5IC 2PR4L 2DBJA 4UIMA 3JWDC 1RHFA 6CGTA 2RCSL 3BP6A 1XGTB 3RNKB 7CGTA 3BEVA 1UZ8A 4WEBH 5B21A 3QFJD 5C0EA 1KTDB 5IBTH 4N0YL 2ICWA 2I5YL 5GZND 1ZLUK 4J4PD 2HT4C 1RK0A 4OM0L 4X6FA 4NQCE 3TF7C 1I9IH 3RWJA 1MCHA 1QSED 3D18B 4XP4H 1C7TA 1I1CA 3F6LA 3KYOB 3MJ8B 5EBWB 4LDLB 4M8QB 4KZEL 1HI6A 4OM1L 3ZL4L 5FUCC 1QFUH 5T3XH 4PRIB 2VUYA 5E8EA 5DJ2B 5D9SB 4YAQB 4H8WH 2Z9TA 3TN0B 4F9LA 4S2SB 4X7DC 4ZPTB 3WFHA 5L9DL 1B4RA 1C08B 3MQIA 3RL1B 4JR9L 4XPFL 5C0AA 4DVRH 2FJGA 4OFIA 1KN4L 2EIBA 3BUYB 2ICWJ 1KENH 3C08L 2J6EA 3ARGA 1F11B 5C0RL 5I8KH 1G9NC 1F4XL 4Z9KB 4EUPG 3Q1SL 2VJXA 2A6DA 3LQAH 4ZFOA 3C8DA 1K2DB 3O3EB 3NFSH 4X6CB 4Z7UA 1HYSD 2VITA 3QWOA 1A3LH 3FONA 12E8H 3MRRA 2GJ6D 1UJ3B 2NYYD 3V6OC 4XAWL 2IPTH 1HEZA 1YJDL 2QQLL 3RDTD 1I3UA 1AIFB 2A74B 4PJEA 3TN0D 3F58H 5EIIA 3UTTE 2AI0L 2OR7A 1YYLH 3MLZH 4Y2DC 3WLBB 4QHUA 4U0RB 1P2CA 1D5IH 4KROC 4WGVB 2JJUA 4JPKL 1INDH 1NCBL 4GKNA 4KI5E 1PDKA 3D87B 4FQQA 2R4RH 5FO8B 1GGCH 4MNQE 3FQWB 3KAAA 2QBWA 3CMOH 1FNEA 1ZHKA 1AHWA 4Q9BA 3HR6A 1OT1A 1NCAH 1FV1A 5F3BA 4PJ5E 1WZ1L 2BHUA 5EU6B 3TBWB 1L9MA 3BKCH 3RGVB 4XAKE 3GI8L 5DMJB 2C3HA 3F7VB 2P24B 5KS9E 1RVFH 2AV1B 2QHLA 3HPLB 5GS1B 2DWEB 1ZKAA 1AQDB 4XNMA 3LMJH 3U30C 2HT4D 4XWGL 2W1NA 2G9HA 4U6XB 1HXMA 4XMPH 3NIFE 3Q5YA 2HLFD 4HF5H 1D7FA 4KMTH 1RJCA 3BUYA 4NFBA 4L8DA 1FO0H 1T7WA 2OTUA 5I73C 2VERN 5CSGA 5I1CL 2CDGB 1T5XA 1P4LB 2A6JA 3MLXL 1PYWA 2ZUQB 2XRAH 5F9OH 5DS8B 2HJFA 5EOCL 2K1MA 4RAHA 1F4YH 1DVFB 2JK5A 2NX5E 1AGFA 3BESR 5I1HH 1QR4A 4BZ2H 1YECL 4ERSH 5CKAA 1CDCA 3BZEA 1JYXA 4XCEB 5IJVB 2V7NB 3EYQC 3QPXL 1RJLB 4PRIE 4YJZL 1B0RB 1SY6H 3PDDA 4MAYB 5BRZD 3ES6B 3CH1B 3MROA 3P3YA 4JGMA 5CGTA 1PG7H 5C0CD 1HHKB 1KNOA 4G8GE 4Y5XA 4LQFL 1DBBH 4NM8H 4ZTOH 3FB5B 2EDHA 4RSVA 2IQ9H 3HMWH 3MXVH 5I76A 3ARUA 1XIWD 3MLPA 2CIKB 5BZDA 5GRVL 4EIZC 1F3JB 1OSZA 1U92B 4XTRC 1CG9A 3RX5A 5F9JA 3D2UA 1TENA 5GJTH 2ILLA 3BWAB 3P9LA 1EO8H 1XR9B 3HR5A 3BISA 3ZE0E 5LKNA 3BYTA 4PREA 1DE4A 4LIQL 3E6FB 3U9UB 3PWPB 3BIKA 3EJJX 2W0PA 1U36A 5F7EH 1BF8A 2YRPA 4L5FH 4Z0BH 4DAGL 4TVPL 2BY0A 3PHOB 3MA7B 4M5YH 5HHNA 3D85A 2NX5D 4D8PA 3OPZL 1U6AH 1F42A 3DX6A 3ARYA 5FYLD 3IRPX 3U7WL 2J8UB 4PRDB 3RUGB 3ULUD 4NCC1 2HT3D 4NNPH 4Y5YC 4ZS6D 4NRXA 3BP7B 3DYMA 3G9AB 5ESVB 2FL5B 1NUDA 4LIQE 4LSRH 5F1NB 4PJHE 1QP1A 1BHGA 3GJFK 3FT2A 4PJFE 5FGBA 3D0LB 3ELAT 3GMPB 3FRPG 3QNXB 1T03L 5BW7C 1P9MA 3OF6D 3H9SE 3OXSA 2B7DT 4G3YH 4PR5B 4O2FB 5IHUH 4ONFH 3DPBA 4PRIA 5F70A 3MACH 2Y5TB 4GAJH 4AIZB 1CF8H 4U7MA 4YE4H 1IE5A 1X9QA 5EO1B 1EFXD 1X4YA 3NMEA 1SJHB 5DJ8A 1BFSA 2HFGL 2Z8RA 4BSWB 1G6RH 2O5ZH 3LEYH 1NCNA 4M1CD 1NUFA 3ILQD 3RPIA 2XWJA 1J0YA 3VG9C 3EDEA 2YPVH 4L3CB 3UPRA 3HC3L 4DW2L 4U3CA 5EO0A 1GIGL 4HKXA 2BVEA 3KPNA 4QNPE 3O2VH 4N9GA 4QRPE 4NO5B 3MLUL 2IJ0C 4D9QE 1I7TA 3HPJA 5J9PB 5H35A 5DC4B 1JRHL 5AAWA 1H8OA 2YN3A 1QLEL 2BRRL 4L1DA 2AK1H 4YWGL 5KS9A 4L9LA 1MHHA 4JO3H 4PRPA 3P40A 4TPRL 5D6DA 4JFED 4YHYC 5H35B 1Y18B 4N8VA 1TQCB 3HS0B 5IW6A 3G5XA 4UUJA 1NBYA 3ZKNC 3ARWA 4E9LA 2Q8AH 3FFDA 3K1KC 1FZMB 1U8PB 1AD0A 3KR3L 3V8CA 3CUPA 1RZKL 3ULVD 3E8UL 3BAEH 3FN3A 2A2QT 3QR2A 4P2OB 5GGQH 1SYSB 5EZOL 5JUEH 5C0BE 1GHFL 1TPXB 2H9GB 4G6AC 2Z91A 3EDDA 3HNSH 3QG7L 2E7BA 4JFDA 4IOFC 3WSQL 3CSYA 1UQSB 1FFQA 3GSRA 2M26A 4X5XA 3L7FB 5JQ6H 4WUKH 2WUCL 3I02A 4JFXB 1IGCH 5T3ZH 5JPNB 4NCDA 1J05B 1KLUB 4GMTL 4KK5D 1TETH 1RFDH 4R2GC 3V5HB 5KSVB 4RGOL 4D9LH 4OJFL 4HJ0D 5DQDL 3SDDD 5J6HA 2R2HB 2AXHA 3VW3H 4OAWA 4LPYA 4YZFF 3VFVB 4U1SB 3BGMB 3UTPD 5EFIA 5CUSL 1R5WA 5GJTL 5MEOB 2EH8H 4QHKJ 5F3HA 3GI9L 4GRLA 3LCYA 1UH4A 1MHEA 2ZOLA 2WINB 4NM4L 3P0YH 4G8EA 4BZ1L 2C7UB 4X8JB 1U91A 1JMXA 2CDFB 5HHOD 1DUYB 4M43L 5HPMB 5KTEH 5KZCD 2VAAB 1I8KB 2PF6A 1ACZA 1DJSA 5CGYD 4X99B 2F19L 2L7JA 5BJTA 1TJHL 4QY8A 5E6ID 3OKDB 4R4BB 2CRYA 3LV3A 1W72A 4G8FB 5D71H 4LVHB 3I75A 4K55A 3QXDA 2V5SA 1ZTXH 3VGBA 4OKVA 4YDJA 3G5VB 4KK5C 1GSMA 5BZDB 4TYUA 1WZLA 1HOCB 2F15A 3OKMB 3T77A 4Z7NF 3BQUA 4QTHA 3TBSA 1G7JA 5EU4B 1CD9B 1CXKA 1R5IB 2VAAA 3DVIA 4I18C 2X1OA 4LRIC 1FNGA 2Q20A 3KPRB 4JEGB 4S0SD 4LCYA 3CGTA 4ONGH 1CZ8L 2Q76A 1UWXH 2GYSA 4XX1E 5CEZE 2R0LL 2BY2A 4JFQB 5IQ7L 2XXMB 3RIAF 3MLYH 4EKXA 5EORL 2FGZA 1KBGL 5JMRA 3PWUA 2ZZUT 4LLDA 2VZ1A 1QYGL 3K46A 2YD1A 3U4BL 1BZ7B 4R0LB 2QSCL 2DQGH 4X6BA 4JKPH 1WAAF 4XP6H 3ZLQC 3QPQD 2OTUB 5IEHA 5E1AA 1OAKL 4L4TB 1W8OA 5C0CA 5GSVB 5LBSH 1SY6L 4DTGH 4LLVA 3L3JA 3MUZ1 1T5WA 4R3SA 1QO3A 2P5EE 1GH7A 3DSFL 5DJXA 3C5SB 4W4OC 2KQMA 1KCUH 3LSOA 1BQLL 4MJIB 5J6GB 1IQDB 3CUPB 4N8CH 4JFYB 3HZYA 4ESKA 4TVSa 3HNSL 1CLZL 4ZO7A 2G5BB 5L6YL 1B6DA 2ZCHH 1IRAY 2Z8VC 5SX4I 3MMEB 3PG2A 1S8DA 5L2JA 5CWSB 1MIML 2J7LA 5IJKA 2VZ3A 1JJUA 3TPUA 4UIMB 1JFQH 5HGAA 1P7QB 5HHVL 4MS8C 3X17A 3S37X 5ALBL 1XF2A 3G04A 4HS8L 1M6OB 4QT5B 1A6ZB 2FBJH 3P9LB 2ZPKH 1NCUA 3K4DA 5ADPL 4UAOC 1S9YB 1SQ2N 3SDCA 2OR8A 2EDJA 5BVPL 4X4MA 2NQCA 5F9WB 3RGHA 4V1DB 4Y5YB 4K23L 1NJ9B 2XWJB 2VLME 5M7QA 4H5SA 4L3EA 3MJ9A 1IC4L 3TEUA 3KWWB 2DYPB 2BVQB 4LKCB 5DRXB 2BOBA 1GAFL 4TTDC 4E5XA 1X7QB 4GW1A 5HYQB 2YPVL 1UB5A 1VGKA 4RZCA 3WIHH 5DFWH 1MI5E 3QUMB 1CXHA 4ODHH 5JHLH 1A7OL 3U4EA 1WAAE 1A7QH 2CGRL 1V7ML 4CL7A 1W0WB 2IMMA 2VXTL 2WMPA 4OCRL 5C86A 3T04D 2A6IB 4G5ZL 5E5MB 1UB6B 2CSPA 3EW3B 2B4CH 3QZWG 4XPTH 1LEGA 1D5XB 3C5JA 5DHXB 5DJDB 2F8XC 3GZKA 3VD3A 1E0OB 1D5BB 2WAHA 5BMFL 3TO4D 1KJ2B 1G9ML 2R56H 2RIKA 4ZFFB 1CE6A 4OUUB 4JN2A 5CZVH 4EUPH 1U2CA 3UZEA 2VDLL 5D7LD 1UM4L 3HG1B 3SDCB 1UWGL 1TITA 1FP5A 3H9HA 2P5EB 3EYQD 3VCLA 3OPZH 3PWPA 1AJ7H 5DEZA 1CR9H 1MCNA 1P6AB 1CLOH 1KOAA 3RUGE 3D3VE 2NZ9C 4DKFH 1AGEA 5E94B 3AB0B 3ARRA 1NKOA 3C6LB 4HCRA 4LSUH 2JKXA 3RBSA 3W5MA 1BZ9A 4KJWD 5DO2C 3PP3H 4AT6B 1E4KC 3PQYA 3MLSL 4K07A 4ORGA 3VXNB 5E03A 4RIRB 5EIIB 5DJZA 4JPVH 4P2QD 4GH7B 2EXYC 4HMCA 4NO3A 3FFCE 3BDBA 1GPOL 2J4WH 4NNYA 3OG4B 2C4XA 3W2DH 3MXWL 5TQ2H 4FFWD 1U8KB 1ORQA 1OGTA 2RBLA 1X5XA 4PJIF 3RP1A 4JPIA 3AMKA 4MXVF 3WCYA 4ODSH 1FAIL 1VEMA 3GM8A 4OLZL 4PG9B 4G7YH 4N8PA 4WWKA 3WXVL 3KNBB 1RSFA 4Z8FH 4PY8I 2LAAA 2YZ1A 5C0DA 4I18A 2X1PA 3U0PB 4K7FA 3RWFA 1ZWIA 4AZ8A 4HDIB 1LDSA 4OZIB 5KAQF 4R97C 4JHZA 1S7UA 3QCUL 5JW4R 3S96B 2IAMC 4Y0GA 3PWJA 1RUQL 1FJ1B 4XCCH 4S1RH 5EBLA 1J8HA 5I1AA 4G8IA 3SJVB 4QWWD 5L2KD 3Q1SH 3B9KA 3L3KB 4E0RA 1A5FH 3BKJH 3IJHB 1IGCL 3BH8A 3GMMA 4X7CC 3SJVA 1WVZA 2CKBL 3BQUD 4LOUC 3T2QA 5A2LH 5TE4H 4H1LH 3I3EA 1CLZH 4X4ZA 1YNTA 4K23H 3PGCB 1QEWA 3BSZL 3L9RA 2DD8L 3QXAA 1KBGH 3IU3A 2ADGA 5E8OA 4FTVD 2W07A 1U3HD 2IQAA 3RWGB 4OD1H 4RX4D 4Y19D 3FO1A 4W4OA 2R56L 4X80H 1I1YB 1OT2A 3QDMB 2PYED 3HUJF 1FH5L 3HNVL 4OBSA 1DANU 3O8XA 1A6UH 1PZUB 2Q86B 3QHZL 5GIRB 2VZTA 1H5BA 1NMAH 5E4EC 3MNVA 2I27N 3IXTB 1X6NA 2YD2A 3WHXA 1X5JA 4ZQKA 1PG7X 1VFOA 5EORH 1BQLH 1KCUL 4X0KB 4HUXB 3HI5H 4OCRH 4ZOBA 5DJAB 2OL3L 4M6MH 4HGMA 5IQ7H 3U6RA 2A6DB 1XGYL 3GO1H 4OFVA 5IB5A 1T22A 1IAIH 5T1LB 3RHWF 4RBPH 3LRHA 2GHWB 4HKZA 2NY5C 3JSSA 3B9AA 4MZ3A 4F9LC 1MRCL 3WNOA 1MQ8A 4JKPL 1QFWI 3VH8B 2D31B 2XFXB 1JZ7A 3FFCB 1GRWA 4XCFH 5I1EL 2FJHB 3NZ8B 4DTGL 2IH3B 4LLYB 5KOMC 1IEAB 2F53D 1BX2A 4I3RL 4IHOB 4WVRA 3RJQB 3WIFB 1WFNA 4F8TA 4KVNL 1SYSA 4WFFD 4KRLB 3GSWA 5DURB 5FYKD 3TT3H 5FYJE 1FFRA 1AD0B 5DJYA 4PV8A 3V6OA 2W38A 4K9EH 2IG2H 4R7NB 3QUYB 3NGBC 4MNQB 1H3UA 3HE6B 5E8DL 5GGRB 4NWTH 4Y8AA 2A73A 5H37H 3OJMB 2XZQH 3RDTA 1FNEB 1ZHKB 4KK6D 4DOHE 5AYUL 2HFFA 3BD3A 2Q8BL 5TF1H 4IDLA 1MVUA 2YA1A 2VLJE 3X3GH 5DK2A 3VXMB 4YDVB 2IMNA 1EMTH 1HNGA 2H32A 5IIEA 1JF6A 4P3WA 4L3ED 2ADIA 1LO2L 1T83C 2XQBH 3D9AL 1RUAH 3BWAA 1X4ZA 3VCLB 3MO1B 1P7QA 3N85L 4L4JA 4Z77B 4Y1AA 3WFZA 1EK3A 3MV11 1CGYA 5C7XH 1P84K 4D0DB 1RUKH 3DYOA 1GGUA 4HAGA 2JJTA 2HKHH 1Q9KB 4XP6L 4EN3D 1X5IA 4L4TE 2SEBB 3QDAA 4P2OC 4HBQA 2HMID 2DM2A 2NX5B 3MRCA 3LAFA 4EI6A 3BDYL 3VGGA 1T4KB 1XF1A 1FL5A 1EA9C 5FYLH 1II4E 5IHZB 3OJDA 1RUPL 4J12A 5CIPB 5I1LA 1DQDH 5I1IL 4YHIB 3VXTB 3GRWH 5DRNA 4JDTL 4FN0A 5TDNB 1NCCL 1C16A 3TIEA 5MENA 3VXQB 1A7BA 1J1PH 5CJ5A 3IJSB 4NP4L 4OZHE 4HIXH 3JWNC 5EU5B 4PJ8C 5SWQA 4M4RA 2DJ4A 4LARH 1WGOA 3TM6A 4IMLB 4LLUA 3ROOB 4WFGD 2WLZA 4XP9L 3IJYA 2EDXA 3MV01 5E6IC 3JZ7A 3U9PH 4P5TA 3VRLE 3T2OA 3SY0B 4YXHH 1TZGL 4MAYD 4Y5XC 4WWKC 4DK3A 3DURA 3MA7A 1Z9MA 5F3BB 3PGFH 2VL5B 3QAZC 1IM3A 5FYJL 1JGDA 3U82B 3OB0K 4RGMB 3DMMA 1U95B 1I9RH 1ZLSL 1J9CT 1NFIA 4F7CB 2OK0L 3EUUA 3G5YA 2FJHA 5IEHB 3B83A 5CEYB 1AGBB 4JRYA 1QQDA 3AC0A 1IQWH 2NY4D 2H3NA 4NZUL 1NC4A 3V6ZA 4PJAE 3GSQB 3QUMA 3TJEL 3QIWB 4RZCB 5EOTB 4U1GC 4ALAH 4EQ3A 1GGBH 1UVQB 1QSFE 1I8KA 1OW0C 2DYPA 3H9YA 1CT8A 4ZSOE 2O61A 2O5ZL 4YDIL 1KB5A 3VFOB 1K4CA 4XX1G 4Y4HC 4XPTL 3SGKC 1IGFH 3BZEB 2C26A 3V4UH 4KZDH 3O3BA 4OGXL 4PRBA 1EEZB 4F7MB 1WBZA 3H7BA 1GOFA 5J1SC 3MACL 4OT1L 1Q0XH 3KLAA 3BH9B 3SQBA 4KMTL 5KSUB 1NGWA 2NW3A 5L88L 5E2VL 2GTZB 3DXAB 3KPSE 4X6EB 1XF2B 5C0AB 3F7YA 2HP4A 3OAYK 1H15A 2EYSB 4YGVA 4ZPVA 3VFSA 5K9QI 3IS0X 5GRUL 1N0XH 3DECA 5MP6L 4S2SA 4PRNB 1ZLUH 1QSFA 3LQAC 4LASL 1LE5B 8CGTA 3U7YL 3SKNB 1KJMB 3FQRB 5F7DA 4F7PB 3QPXH 3MV9E 3GSNH 4P4KD 1A6UL 3V9FA 5I1HL 2FLBT 1NQBA 1TVDA 5EZLB 5AZ2H 4K94L 3W0WB 2LV4A 5F3HB 2P8LA 5J57B 4U1IB 4P46D 3AS0A 2GK0B 3L3JB 4FG6C 6FABH 1KB9J 4I0PD 1K4DB 1RZGB 5JXED 1EO8L 1V3LA 3H9SD 4R8WL 4U33A 5ELIA 3TYGL 3X12A 1VCAA 1U3ZA 5HHMB 1JI2A 3PGCA 2PUQT 4GG6F 4N90D 1A1MA 5GS1C 4C58B 4Q58C 1QLRB 4P57A 2D7TL 3SKJL 2HH0L 2AJSH 3MLUH 2EIEA 5MENE 2MWCA 2PTTB 4GRMA 1OGTB 2X4UA 3IF1A 4KJPC 2BOCA 1KB5L 3P30L 5I74B 3BHBB 3IXTA 1EEYB 2IQ9L 4Q9QL 3SGJC 4A6YB 3MLRH 1NBVH 3K8MA 3VG0H 4P49A 1AE6L 2Y72A 4OAWB 3QFJE 5C0FB 1EXUA 4ODXB 3L5HA 4YDKL 4OSUL 2YA2A 4KGJA 4RNRA 1S7XA 2W60B 3WNKA 5F71A 3PL6C 3VRIA 5EUKA 3S5LG 3HE6D 1AGBA 3MUHL 4ETYA 4QRQA 2QL1A 1D6EB 3D3VD 5C08B 1JZ4A 3CSYB 2OTPA 3O0RL 2CO7B 5IK3B 3RTQA 5DR5L 3N85H 4P2OA 3DBXB 5F89B 2VB5A 4PJIE 3RU8H 2CKBB 2OP4L 1DVFD 1I1RA 5FB8B 5FOBA 1BJ8A 2E6JA 3B3IA 3WD5H 2A77L 2HRLA 5FO7A 5CBEB 3WKNA 5AZEH 3KPSA 2J8OA 1JWSA 2NNAB 2IH1A 4NT6B 2HKHL 4UI2A 5H37G 4RQQB 2VLJA 4FFZL 3N06B 4OZIE 5EO9A 2FX7H 5E2WH 4JFHD 4OLEA 4EJ1C 2YKLL 4C56A 5C0BD 2I9TB 4DFHA 4P5KB 1FC1A 4LBEB 5T1LD 4XBPA 4X7TB 3CVHH 1D5MA 3SKOA 3PL6D 3V4PH 3LKOA 1GC1L 2D7MA 4XBGA 1LEIA 1S5HA 4QXUL 4C59B 1T1ZA 1FCGA 1ACYL 3DETD 2HN7A 5A1AA 5INDB 1LQSR 4QGTA 3BW9B 4LGRB 3G08B 3ARDD 3D2UB 1CXLA 4IRSB 3GSRB 3HZMB 5DVMA 4GAGH 4ZMAT 3UDWA 4L8CB 5E8NB 3LRGA 4P2RA 2A0LC 2Y06L 5MEQA 5IQ9A 1OOAA 3WUWB 3EFFB 1Z5LB 4G8GD 4ZUUA 4N8CL 4HGWB 3IDXL 1VKXB 2X1XR 5D72L 2Q7NA 3TA3C 5KG9B 2MKLC 3O3UN 1FZJA 2XZZA 3REVA 4FFWC 1E4XL 1GCFA 3AVEA 4L9DA 2HKFH 1MLBB 5DEFB 5LGJA 5E6IB 4PJCE 4J3UA 4QEGA 2YBRA 4Q0XH 4P2RB 3D85D 3FAWA 5DQJB 5LAXB 2GQHA 5ILTL 2H8PB 3MUGA 5M95B 1L7IH 4PLKC 2NR6C 4O2FA 5HDBF 2J5LB 5JHLL 1IT9L 3V8OA 5LGHH 4UDTB 4G7VH 3DSNA 3CDFA 5IBLC 1CIUA 5FCSH 3FT4B 1AO7E 3LDBC 5HHQB 3OBAA 1IM9A 1NLBL 1RIVL 1G9MC 2IANB 3QSKB 3MCKA 5K9OB 2VLJB 3MJ7A 4Q9QH 4CMMA 5JMOC 1XIWA 3RKPA 1MF2H 4LCWB 5DMIH 2R1YB 5SWZE 3BN9C 3QRGL 2GUOB 4BSWA 2AV1A 3HPLA 4H88H 2IBZY 4WFHE 4LLUB 4ODWB 4GKOA 2AJSL 2R0KH 1KCVH 2ZUVA 3WFCH 2I5YH 2VR5A 1DR9A 2K9UA 3GKWL 4OZ4A 1P69B 4TUOB 2CRMA 4ENEC 4YO0A 5CZXD 3VMPA 2R0LH 4APQB 3JV4A 1MCIA 4RNRB 4KV5E 4CN4A 1G7PA 1Q0YL 5BS0E 1S7TB 3MODL 3RU8L 1J8HE 5DJCA 2BERA 3WV0A 1VGKB 3H3PL 1QACA 3SDCC 4UIKL 4YHNA 3Q3GB 3STBA 3MMEA 3DX8A 4HSQA 4KJQD 4WUUA 5TFSH 3T0ED 1OAKH 1EVTC 4PV9A 3VXME 2CGRH 1HSBA 1NMBL 2P5WE 5ACMA 5DK0A 3FL7A 3WN5B 4ETQA 4J3WA 3TA3D 4U1NB 3P2TA 4MDJB 3J7HA 3HI1A 1UCBL 2VLRE 3MRHA 4XBEL 3DX8B 3MR9A 1YEHH 4Q9RH 3SE8H 4M48H 5I18L 1EEQA 3MO1A 4WHTA 3WJJA 1G7JB 1T7VA 4KY1H 1BREA 1SHMA 4R26H 2J1KA 5KVGH 4XBGB 1LEIB 3M07A 1FNAA 1ORSB 5D8JH 3KPMA 3LY6A 4WFFE 4WEBL 4B7IA 3P0GB 1S9WA 1F3RB 3ALXA 1KC5L 4X5LA 2OI9C 1HZHL 5CWSA 4LSQH 5C09D 2VKWA 5C2BH 2XKSA 5ALBH 2AK4D 2CRIA 2AK4A 4CADA 3DUSA 2Z35B 3V79C 3ZO0A 1B3JA 4YBLB 4LRNL 3VD5A 1T89C 3D3VA 5DJYB 2IAMB 2DTSA 4Z7WB 3V4VL 3DUUA 2X4SB 5CP7A 3BN3B 5DJ6A 2NXZC 1BAFL 4XMKH 4PP1D 2NY5H 4K3HA 4D2NA 1QA9A 4P4RA 3K81A 2OJEB 4Z7VE 3INUH 1T5WB 5D7LA 1DVFA 4OD2A 5CCKL 5D7IE 5EU5A 2DQTH 3GSNA 1JCKA 1HSAB 2XKNB 3I6LD 3I75B 2AJYL 3BXNA 3D39E 3QXTA 4R4BA 2BNRA 4FMKA 4EQ2A 1Q9OB 1J1XH 3ULVC 5IKCB 3SE4A 4JY4B 4D9QD 4AIOA 4I4WA 1LEKA 3N50A 2NY0B 1KB5H 1JV5A 3HMXH 5C0IA 2DLFH 3RVWD 3EYSH 5DGQA 3VFRA 2G5RA 3LQZA 4JGUA 1EHAA 4KK9D 1M1SA 4MB3A 4FNLL 4ZS7H 1XGUB 4O5LL 3PWNB 4FQCL 1BPVA 2HG5B 1FSKB 2A83A 3GMNB 4GRMB 3PHQA 1R3KB 2ENYA 3D39A 1KIQA 1H5BB 1YEIH 1CDGA 3EFFA 4ZUUB 1IFHH 1V3KA 4JM2D 4AL8L 5B3JF 3MRMB 4O51B 5E4EB 5BS0B 1WAAA 5HVHC 4HJJH 1G9MH 4RIRA 4D9RE 1FIEA 2YOCA 3RA7L 5D7LE 3EDKA 1FFOB 2GTWA 2P42B 2ZSVA 3SJVE 1GAFH 2FIKA 1U3HA 3UJIH 4MA8L 1NC4B 5DLML 1IEBB 1NBZA 3G5YB 1KF9B 4Y4KA 3SCMA 1RIHH 5DD0H 3FZUC 2ARWA 1QSZA 4MNGE 4U7SA 2HFEA 4WHYG 1IAMA 1NEZG 5HGDB 2M8XA 4IRZH 5BVPH 5FGCE 3DI2B 5DA0B 3VI4E 3LPWA 1VFBA 3ISWA 1WCQA 2EKJA 3MV8B 4XB8A 5IVXF 4TSAL 2DQCH 4ONFL 3S9DB 1WK0A 4JPWH 2I24N 5KBNC 2ZCKL 3TJHC 4GFTB 2WWKO 3VD7A 5I8OL 4KQ3H 5BQ7A 1NBYB 3RIAK 3S3SA 3BKMH 4MA3B 2YXMA 4B50A 3MOBH 5EWIH 5HYSB 3GRWA 1EDQA 4EDWL 1MCJA 2V17L 3WFEH 2VH5L 5GQBA 4OZIA 1OB1B 3SDYL 5B8CB 2IALA 5J13C 3VFSB 1TNNA 4GG6A 4HKJA 3SDAA 5AWNL 5SV4A 4CU8A 5CP3H 4MMXC 5I71B 4GAFB 4MB5A 2Q3AA 3TYFB 2VO5A 3T1FB 1OARL 3NCMA 2DQUH 1HQ4A 5FYLE 2CRZA 4Z5RB 3TWCL 3HCVA 5J7CC 3HLAB 1R0AL 4HS3A 1QHPA 1MIEL 5GS0L 1YPZB 2F54A 4I2XB 1XF5B 3CMGA 4R4ND 2GTWB 2W0FB 4WO4B 4YFDB 3MNZB 3O8XC 4MHHG 5BV7C 5BS0A 3MODH 4ZFZB 4DN3H 4XPAH 3RVTC 3U36A 1UEYA 4KV5F 3VFGL 1SJXA 1IAOA 2AJUH 1T1XA 1KC5H 4LVEA 4IDJH 4O00A 1A3QA 3E1F1 4RISH 3MNZA 1BP3B 5KN5B 1XF5A 4Z0XA 4RAVB 2R0KL 4O58L 5AAMA 4M6AA 1FGVH 2VQUA 4LU5H 4Y19B 2DDQH 1YEHL 4Q9RL 3X12B 5K9KB 2DLFL 5F96H 5SWZA 4CMHC 1FLRL 3TT3L 4HH9B 4UT6H 2P5ED 1DBAH 1BOGB 3VFWA 3VXOA 2GITA 2DQEL 2Z31A 1NGYB 4L8SC 1AO7A 1S7QA 4R96B 1JWSB 3MRGA 3LEXB 4MQXD 5D1XA 1KNOB 2ZOKA 4JN2B 3CDGB 1P7KA 5J1AB 1GIGH 1XF3B 2B8OT 4JLRA 3BZFB 5ANMA 3WIFA 3MRPA 4P23A 2WW8A 1BQSA 4BYHA 3KYKL 1FJ1A 4QRRE 1LE5A 4LQFH 2YPLD 1YEKH 4XVSH 5DT1H 5IFHH 4EVNB 3P0YL 3NIFF 3SCMB 4MD4B 1SJVA 1RUAL 5GRVK 4YGVB 5D72H 2H41A 4ZPVB 1OP9A 4H25A 1MFBL 1MFDL 4G42A 3SBWA 3TIDA 5MEND 3CXDL 1EBAA 3IFOB 3BXNB 4ZFOL 3C60A 3GUTA 1CYGA 4M93C 4NNPL 5E95B 3BWUC 1NAMH 4PJDE 2ARJA 1YZZA 1NMBH 4NO0A 3NCJL 3W11D 3A6CL 4EBQL 1BVKA 1PZ5A 1P1ZB 3HAEG 2O5XH 4LAQL 1PSKH 4Y16D 1RQ5A 1XMWA 4HC1A 5ACZB 4HUWA 4GQ9L 4MAYA 4UDUA 5J11C 4R4FL 4MA8H 3MRBB 4NNXA 4LF3B 4MXQD 3Q5OA 4HIHB 2R1WA 2VDKL 5FM5M 2GY5A 4C56E 2C3VB 4NQXA 1HQRA 1FL3B 2GJZA 1IFHL 1NFDE 1CK0H 3OKMA 3T77B 4BFGA 4ONOA 1U8IB 5F9JB 5I0DA 4NP4H 5T1DL 3RWHB 2GY7B 2FEEI 4QHLA 5E0QA 3VFPB 3MNWB 1JGDB 1EUUA 4Z95L 5EZJB 2NY2C 3DRTA 4PJCB 4WU5A 3S35H 1CFQA 1K8DB 1EFQA 5DHYB 1E6OL 1DBML 4PGBA 4P3DA 5IB3A 5GISH 4LP5A 1I3GL 3PIQA 3W9EA 3TVMA 3C5ZD 3QIBB 4G8EB 3O11A 4MAUL 1A6WH 2FGWL 3ZTJG 1LMKA 3EOTH 3QWOB 4AEIL 5K9JH 2ITDA 4WU7B 1P1ZA 5T3ZE 3MNWA 1HN1A 2FECI 2V5RA 1ZXQA 3VFUA 3NIDF 5C0CB 5BOZG 4NQEB 4HXAL 3SO3B 1QBML 4WCYL 3C09B 4Z7WF 5KANI 1LNUA 3IS1X 5SWZB 5C0DB 2OQJB 2XTJB 4I3SH 1ZA6A 1FFNA 3ARBD 1W72L 4NSKA 2FR4A 3MR9B 5HYJD 1EEZA 3K3QA 4BKLA 4WWID 4LP4A 1FL5B 1XT5A 2G9HB 4MJ6A 3OL2A 1C12A 4PD4J 1UKQA 1FHGA 2EEBA 3FFCD 2J12B 1U8KA 4JG1H 3I6GA 2BFVH 3NCEB 1F97A 3RL2A 4Y4HA 1RD6A 3SGKA 4I77L 4NZJA 1NBQA 5JORA 3DRTB 4ZUSB 4NKMA 3SDAC 5BS0D 3NN8A 5I9QC 2DQGL 4OLXH 5D96C 4L8CA 1JFQL 5C07D 3T8XA 4RMQA 1ZHNA 1BIHA 5D7KE 3QUXC 1UM5H 4HT1H 1H3GA 4UDTA 2XZCL 3EYUL 3IFNH 2OSLA 3IDNA 2CIIA 3B9KD 3NA9L 4HCRH 4BH7B 1W2KT 3VXSD 3LN5B 4HFUL 3QULA 4ZAKC 1MELA 1ZGLM 4U1JB 3W81A 3AREA 4WFHD 5GS2D 5HGHB 3GIVA 5HHMD 1HEZB 2ID5A 2NY2D 5SV3A 3RWJB 1NUGA 1MEXL 1XCQA 2R2EB 4K8RD 3CC5A 5TE7H 3OKLA 2EZ0D 3BDXA 2DM3A 2ICWB 4PJDF 1IAOB 3LEXA 1MUJA 1T1YB 2V2XA 2PXYB 3MRDA 5FOBB 4R96A 1UZ6F 1U8OB 3ZTNL 4K7PL 3A6CH 4Y88A 1WISA 4LSVH 1DQMH 4L29A 1S5IH 1CN4A 2NY6B 2BK8A 4NUJA 4OF6A 4ODHL 4YX2H 3SDDB 1MCPH 3VXQA 3OF6A 2B0SL 3RL1A 4J8RB 1TCRA 2IAMD 3G08A 4JO2L 3QEUA 4RWYL 2CK0L 1NCAL 3QDGE 4KRPD 3I02B 1F2XK 1HIMH 3GDBA 5D2NC 4KH2A 5EN2A 4XT1C 2PCPA 2R2BA 4U6YB 4J8RA 1CFVH 4XPGL 3LN9A 1Q9LA 1ACYH 2W9LA 4MNHB 1YEJH 5D7JD 5ALCL 1EXUB 4ELKA 3LPGA 1PW3A 3PV6B 2I25N 3FRUA 1EAPB 4PRHD 5DRXA 5JOEA 1ZT4B 1FZJB 2VL4A 5K33A 3F7QA 3EOTL 1DN0B 2SEBA 4AEIH 2I26N 4MYWB 5IOPA 1KPUB 3C60D 3KWWA 3MRNA 4POUB 2GSIA 5IQ9B 4AG4L 4K3GA 3SGJA 2ZG2A 5HHVH 3ZTJH 4ZOEA 2HRPL 2VDNL 3AS3A 2HTKC 4XXCC 1PVHA 2HKFL 3C60C 3L3DA 1MCFA 4GUPB 1CXFA 3MGTA 1CICC 4V1DE 3ZDZF 2WBJD 1DBKH 3I6KA 1QKZL 4I0PC 5L8LB 2X40A 4XRCA 2VLLB 1YYML 3OJ2C 2AEIT 1QYGH 3ESVF 2HFTA 2PR4H 1UGNA 4EI5D 4JR9H 4XPFH 5H94B 4DVRL 1QEWB 4MQXC 1MFCL 4P48A 5IW3A 3DETC 1NAML 4K8RH 4WCYH 5FOJA 4U1MA 3WUZA 1T6WA 3HE7C 1T7ZA 4RRPG 3OKOB 3L1OH 3PHQB 3V4PL 3C5ZB 3I6LE 4BELD 1SJHA 5DJ8B 1JN6A 4FS0A 3S6CA 3ZHDA 4WO4A 2ZKHH 5EBLB 3BIAX 4PP2A 1GPOH 2P43B 2CJUH 3O6KH 3MLYL 4OZFG 4G6FD 4DZ8A 2HFEB 5CJ8A 3RWCA 4DQOL 3OSKA 4F15C 1ND0B 4KRNA 5A16B 2HMIC 5BMFH 4PGEA 4R0LA 5JW3L 5JTWA 4FFVC 1KXQE 4JFZH 1NCBH 2FB4H 1QFWH 4ZFGH 4EN3A 2X41A 1BECA 3RVTD 1CLCA 5T1DH 2WQ8A 4GQ9H 5KAQG 2HH0H 3HC4L 3QFDB 2YKLH 4PP2B 5BQ7B 1MRDH 2H9GA 4P4RB 3SPVB 4NRXB 4HUVA 1CTNA 3QUXD 4PJHF 4IIQA 4K7PH 3VFMA 2DTML 2K7PA 2P1YA 2XZCH 3EYUH 3IFNL 1H3PH 5FYJU 2WP3O 4JDVB 2WUBL 5IMMA 2LQRA 3VXUD 3VU2A 1K5NA 5D2LF 1MFDH 3T0EB 3KPRA 1HILA 1T2XA 3IDMB 2XKUA 5IEKA 4TNVK 3BMWA 5I1JL 3PP4H 4JY4A 1A1MB 4NJ9L 2BZDA 2EEAA 2BNQB 5T5FL 5CHNB 2O5XL 5D1QC 3UZQA 1I1FA 4POZD 4QCIA 3ZYOA 1YY8B 4YPGB 3F7YB 4UU9A 4W4NA 1MHPH 3TFKC 1NL0L 4MA7H 2YD9A 3IFPA 5C3LD 4XP1L 1F3DJ 3UJTH 3MBEC 1W72H 4O51A 5HPMA 2VISA 5IFAL 4ACPA 3PNWB 5KSBA 4MZ2A 5CEXB 2VXUL 4OF3A 3P9WB 2KDGA 1MNUH 2NZIA 2NY1C 3ES6A 2BX5A 2DI8A 2DLGA 5CLWA 1BFOB 5IOPB 4JG1L 2DM7A 3MREB 1R5WB 1FORH 1XGPA 4MDIB 1QSFD 2EH7H 2VITB 4TUJA 4WUUB 3MCKB 4WW1A 1YQVL 4KGLA 3CFIC 5IB2B 1S7SB 3M17B 3VFVA 4UV4H 3V5KB 1YMME 1XZ0B 1MLCA 3GFUA 3F62A 3JV0A 3RNQB 2FJFA 3PABA 1T5XB 2AERT 5FDWA 3JTSA 2JTDA 1SVZA 2DYPD 2OJZL 3DWTA 1RMFH 2APTA 5GZOC 4PR5A 4G8GB 3ARGD 5BCAA 2CKNA 2F5AL 1YC8A 3ULSB 3ECBB 4MXWH 4KI1A 25C8L 3QDJD 3CVIH 5CLTA 4ZD3L 5I6XC 3ZDZE 4XNQB 2V5YA 1U42A 3GM0A 2XY1A 4QHNB 1OSPH 4XMLH 4JY6B 2JJSC 3B2UD 5J1AA 2ADJB 3RGVD 2MSPA 1VACB 1YN6A 4CMHB 3MV9D 1N64L 1G9NH 4PJDB 4KK8D 4C57C 4NN7C 2Q3ZA 4PGCB 3WJJC 2C1PA 4U1HB 1KJVA 3OXRB 4MJIE 4PRPB 4QO1A 4OLVH 1BM3L 2QEJA 4D9LL 4KRMB 4M7LL 4PJBA 5GS0D 4RMTA 3NIGF 4L9LB 2VE6B 3VD9A 1U8JA 3LKSA 4OCXH 5TPWL 2DWDB 4GT7A 4X99A 4YUEH 2C1PB 3A6BL 4YBQD 2Y07L 3G6JF 5DMKA 5HHXL 1WF5A 4PJDA 1FYTE 1T4KA 4U1NA 3RDTB 1H3XA 1WCBB 3EOBA 4WDIA 4WY7L 3NABL 3HE7D 2GW5A 3EBAA 1NCCH 1B9ZA 1Q94A 3IRZA 1MFCH 3IFLL 5D8JL 4GXUN 1RZKC 1WBXA 2CH8A 3IDYC 5CBEA 3VWKC 3HZVA 2FIRT 2XRAL 1IGMH 1U8LA 5FB8A 3Q3GA 4UIKH 2Q8AL 4KQ4L 1IMHC 1KGCE 1RJZB 5HI3C 5HHQA 5IM7A 2CK0H 5C8JB 1CLYL 1CFTA 2QQKH 2WIIA 1Q72H 5DRZA 4R3SB 2OBGA 4Y1AB 1G6VK 1MFAH 3TZVC 2WUBH 5JPNA 5INDA 1LK2A 3WFDH 5L2KB 5ID1A 1YY9D 4CN6A 2W9EL 4R2GD 4XI5C 2AK1L 4OZHF 5HVHB 4XMKL 3UPCA 1KCLA 1C5DB 3T0AA 1E28B 1Y6KR 2D3VA 4GBXB 5DI8B 4KU1A 5FYJH 5I8CB 4JN1H 3QEQD 3UYRH 5IV2A 5CCKH 3BZFA 4O5LH 5ANMB 5I1CH 5E8DH 3FB6B 2NY0D 4IOFD 1QFWL 4ZFGL 4JFQA 4MCZB 4ZO8A 3L7EB 5DO2D 1KJ3L 1FH5H 1A6TA 1N8ZB 4PJXE 5FO7B 1LP9A 4L8BB 1BD2B 3ZT6A 4ERSL 1S78C 2R9HC 4N8VG 1QR1A 3BAEL 3DGGB 3SE8L 1IVLA 1YUHB 4G9FA 3IETB 1NEUA 5ITBL 3HKFA 2IBZX 1WSST 1U3HC 5IESH 4FNLH 2B5IB 4NCC2 1DBKL 4QF1A 5J0BA 4LMQE 5DD1H 1U8IA 4HK3N 3I50L 3T3PF 5JOPD 4XBPB 3S4SB 1WITA 1NGZB 4HS6A 4IIQC 5T5FH 1YUHA 1ZHLA 1RFDL 1IEHA 3DVNB 5D93B 1I7ZB 1JHTB 3BPNC 3ORJA 5FKPB 3Q6FA 4JDZB 1QFOA 4OCYL 2N7AA 5JR1H 1JGVH 5E2VH 1H0DA 5JA8B 2R1WB 4OLYL 1U8MA 5CMAA 4KAQH 2L0DA 4LLQA 4XP1H 2L7UA 1G7MB 2X70B 4GG6E 5E08H 2NY5L 4ZAKD 4CJ0A 3MV8D 5MEOA 3HFMH 1YEJL 3P9MB 3MLWL 4NQSB 1P5VA 5I30L 4R26L 3MRJB 2CR6A 1A14H 2FEEL 2HVKA 5EN2B 4Q6IB 3GUTB 4B41A 1KPRB 3O2DA 4L3EE 3EYOB 3G9VA 3RNQA 5EUOB 3MLVH 4MD4A 1OTUC 3V5DA 3IDGB 4M7KH 5DSCA 4OD2B 4EDWH 3L5WB 1WTLA 2X4PB 4W68A 5D5MF 1MUJB 3DXAE 1BVLB 1NPUA 3EAKA 3KPOB 4MNGA 1D6VH 2BDNH 4D94A 4OFPA 3B3IB 1HK6A 4PJBE 4C55A 2BVPA 5I1JH 3GHEL 3O9WA 3TC9A 5L2KE 2QSTA 3RZCD 2XPGA 1AXTL 1OHQA 2VC2H 4APQD 1UKSA 4XP4L 4XVTL 3FQTB 4RDQF 5D7SH 2DJUA 2HTLD 2APFA 3QEHB 2ZUYA 1QLRA 2WWMD 2JB6A 2V2WA 1CDUA 4LGSB 2NY3D 2ICEB 4G6KH 4EZMA 3CDYA 4HS6B 3E6FA 4CVXB 1FGNL 3IDIB 5SWSA 3QHFH 5FCUH 1PY4A 4FQHA 3QH3A 3DTXA 1VADA 3QDGD 1A9EA 2AKRB 2AXFB 4P46A 1LDPL 1HHHB 1FDLL 2JB6B 4HUKB 2W59A 3MOAL 1ADQA 4TVPE 2VLRB 1HKFA 1MJUH 3T08A 2D7PA 1YMMD 4U1IA 4N9GB 5E6ZA 4OV5B 3MRMA 1HHKA 3Q6GL 4JCMA 4JO1H 4P4KA 5FM8A 4NJ9H 4UBDC 2ESVA 3S37H 4DGVL 2WP3T 1A3RH 3QQ4A 5TDPA 5D7IA 3QFDA 1Z9LA 4YHKH 3BT2H 4FQLL 3WJLC 2AI0H 4NN5B 2GAZB 2NXZD 1I8LC 4Y8DC 4JFPA 3GSUB 1AGCA 2D9QB 2EIDA 2FO1A 5D6CA 3SHSA 3B9EA 1I8IA 2J8UE 1QQDB 2DLEA 3PE9A 4EI5C 2X05A 2APVA 4HXAH 2YRZA 1CZ8H 2J6EH 3GSNB 1GOHA 1KLGA 4JPVL 3P73A 3UEZA 3HB3D 2YSSA 4R6UA 5D1ZA 3QNXA 1WFOA 1MRFL 1HI6B 2BNUB 3GMRA 3VWJA 2HLFC 4K94H 1ORQB 1IC5L 3NABH 4L3EB 2YPLE 1SJEB 4GAGL 1YN7B 1CL7I 3SGDH 5C0EB 4BQ6A 3UTSE 3L6FB 1YEGH 3H9SA 5D2LA 5IVXB 3WXVH 1YY9C 1AKJB 2BY3A 3I50H 5HYSG 3QP3A 4ODTL 1J1OL 2DBLH 4GS7C 4OIIH 1E6JH 1BBJA 4PJHA 4PJIB 4HWBH 4KQ4H 1IGTB 3ULUF 5CGYC 3KPMB 4XCNA 3BPCB 5ICXA 5FECA 2LVCA 5HI3D 4BZ1H 4W6YB 1DE4B 2NW2A 3ARSA 1BWWA 5HGBA 1ZGLP 1T3FA 5F9OL 4NFCA 2BC4A 4WUUE 5L6YH 2VDKH 1AQKL 1ZMYA 4LNVA 2OS7A 2X4QB 5IMOA 2OR9L 1MHCB 1NEZB 4JDVA 4LHJB 2LAGB 1NBVL 3VG0L 4E41B 3T4YB 4DN4L 2DQEH 4RGNB 4UTAH 4M3JA 4UQ3A 1CT8B 4BFBD 1B0GA 4HLJA 5E7BA 1AGDB 4OGYH 3T2NL 2GCYA 1KPVB 3AU1B 1PZ5B 4KKCD 2EYTA 5IJVA 4NO0B 5GGSB 4YEFA 1JI1A 2V9QA 4Y2DA 4ZAKB 4JY5H 1UM4H 3CAFA 3QA3B 1DEEB 3ZSTA 3HZMA 5HDQH 5IMKB 4G8GA 3LKRB 4H88L 5HI5C 1FVCB 3U4AA 2HN7B 4NQCB 4TSBL 2HAZA 3L3OA 2CMRL 4C4KT 4QXTB 1CLOL 5GGVL 3T0VA 3GMLB 4CN1A 3VFUB 2V5MA 5DC0A 4BQCA 3EHBD 1JNHA 4N0YH 2NX5A 1HXMB 4LASH 1INDL 4JLRB 5ETUB 3B9DA 1M7IA 5E99H 2ITDB 2IPUK 5JLZB 3RBGA 3MREA 1CGSL 4MDIA 4OLXL 1ZANL 4V1DA 1FGNH 5FA4B 1NGXB 1GL4B 3LKNB 2OYPA 1LO4L 1X5KA 3CX2A 2DMBA 1XGTA 3RNKA 4PGBB 1ZT7A 3DUSB 4NZTH 1DBMH 4U1JA 3DUHA 1A5FL 4PJCA 2YR3A 5CJOH 3QO0B 4GAYA 3CIQA 1CGTA 3BQUB 4QTHB 3G5VA 3V2AR 4F8QA 1FVEB 3EO0B 4FFYH 1BFVL 4GUPA 3L3DB 3AS2A 1E4WH 4DCQA 4RMUA 3QJHB 1VHPA 5FIEA 5FM4A 1IL1B 1QOKA 3NN8B 2IPUG 4Y2DB 4ZAKA 3X11B 3CFEB 3FB7B 1NGPH 3R8BB 3AM8C 3SGDI 5IR1A 1KCSL 4XC1H 1HILB 1UCTA 1OLLA 3QUYA 4MNQA 5FKAA 3ARFB 3QXWA 2VXQH 3NGBB 4ZUVA 1MCOL 3QDGA 4ORZC 3ZL4H 3X14B 3MRLA 4YXKL 3PDOA 1E4JA 4EXPX 2VXSH 3BE1H 3I2CH 3JV6B 1B0RA 2ESVB 3WHXB 4X80L 2DI9A 4MJ6B 1KEML 1UM6H 4M1DH 4G8IB 2MFNA 3O3EA 1TQBC 4YHYB 4HEPG 1PLGH 3U0TB 4PJ5B 3UO1H 4XPBL 5I15H 5I16B 5J6HB 2EDYA 1CGUA 1MCWW 3V5HA 4OCLC 1K9TA 5KSVA 4OI9A 3IFOA 4E41E 1UKTA 4YQXL 4PJXB 1KLUA 4XCNB 5D6CB 4RGMC 1WC7B 5FHBL 4OGAD 9CGTA 1EZVX 3OZ9L 3B9VA 4D0BA 1J5OH 4PG2C 4XNZC 3CFJA 1SMOA 3CK0H 1EX0A 3TNMB 3S97C 2CR3A 4UTAL 3FKUS 2ITCB 2ZUXA 5TDOA 1OTSC 4JHWL 3M45A 3ZDYE 4CVZA 1AJ7L 1UACL 2IADA 4JG0L 3HI6H 4LSQL 2QV2A 4NJAH 3DLQR 1WV7T 4PRAA 1BBDL 1TCMA 1G7LA 3O3AB 4JDTH 3MCLH 5FKPA 2ZG1A 2ERJC 3TNMA 1X4XA 1HOCA 5GZOD 1P9MC 5FO8A 1OTTC 3R06B 4JFOA 5JW5A 5T3ZL 4CW1B 5D1ZC 1PX3A 4TOYL 4NHCH 4CGTA 1BD2E 5KSUA 5DUML 3QDJB 3OHXA 4K8RL 1KT2A 3BYYA 4OLWL 3DMMD 3W39B 1WIPA 3UTZA 4DKDC 4M1CC 1QR1B 3GJFA 4WFEE 1OCWL 4ZQKB 1ZS8A 3H6JA 4XNXL 1S7WB 4GRLB 3MRRB 4XXDA 2FCBA 3AY4A 1M4KA 5JUEL 1Z5LA 2AS5M 2ZJSH 1KULA 2E7LA 5FHAL 1HHIA 1IC7L 2RJMA 3R4DA 5DSCB 1DDHB 1DFBH 1OQXA 1A21A 2X4RA 1UVQA 5ISZA 3PQYB 2PW2A 4DQOH 5K59E 4FABL 2IPKA 2ZUTA 5DJCB 5E7FA 4OD1L 4XCYB 4H25B 3K8KA 3WS3A 2EDOA 4IMKC 1F90H 1AY1H 5EH1A 3BDYH 3GSXB 1KLFA 2BNRD 1I7UB 2IFFH 3GNML 2EDQA 2B0SH 1EMTL 4NQEA 5D6DC 5TH2B 5E8EB 4WI3A 1HHJA 4YXLH 1EBPA 4QRRD 5CINH 1D5MB 2XWTA 1OB1A 1QTYT 1D5ZB 3SDYH 1YEFL 5EU7C 1KYOK 4G80A 4HKBB 2HT3C 2QJDA 4ELME 1TVBB 2BNQE 3HG1A 4X6FB 1RIUH 3STLB 4TPRH 4LLQB 5CJBA 2IEPA 4P3DB 1NFDA 3DV4B 4LPVA 4NKDB 5T1MA 5HI5D 1FRGL 3EYVA 1G6RB 5JW4M 1G7QB 2AQ1A 5D93C 4I3RH 5TF1L 1LO4H 4N0FB 5IFAH 3EYOA 2FX9L 2IGFH 2OSLB 4J7RA 4NYLB 4QF1B 4JZOA 3QCTL 1CF8L 4LRNH 4NQDA 3IAPA 5E9DE 4Z7UE 5LBSL 5HYIA 1NCWL 2IG2L 3OJDB 5IFJB 4HKXB 5F44A 4O4YH 2EDNA 3FO0L 4RMVA 3CSPA 5F1NA 2F53B 5ESVA 1L0YA 1U8LB 2DM4A 1N8ZA 2X4OB 2NCMA 1IC1A 3RVVD 2AJYH 3MROB 3FO2A 1YPZE 5C2UB 2I60H 1MCRA 1NEZA 2RCSH 1A9BA 5CEZH 4NBZB 4TSBH 3RWIB 3FHQA 1RJYA 2Z4QB 3VXPB 1S7RB 2ENSA 3HLAA 3VXSB 4HJGA 2WBJC 3C6LA 5CJOL 2WBWB 1QLFB 3SDAD 2A6IA 1Q9OA 3MRQB 3VXRE 3U9UA 3QIUA 4QT5A 3OKEB 3HR5B 3VFTA 1JPTH 2OK0H 5ADOL 4JRXD 4BK5A 3QUYC 3OAUL 3TCLA 4P59L 3SN6N 3X3FL 1NC2B 1E4WL 4U1HA 1VSCA 2HWZH 2CLRA 2V2TA 3UTTB 4EDXA 3M1BB 4OZHA 4PPTA 1BLNA 1J18A 2VDOH 4KUCF 3JWOC 3MGOB 4HLZG 5LXGL 4V2BA 2ICES 3HMXL 5EU7E 3OKLB 5EWIL 1R24B 1BMGA 1KV3A 1PY9A 2C1OA 5GGUA 1Z6JT 3O4LD 3GIVB 1P5UA 4GRWB 5CD5D 5FYLL 1S3KH 4EDXB 2GIYA 3BE1L 3I2CL 2RAMA 3KXFB 2H45A 1JWUA 4OB5H 4NM4H 1NC2A 2KZWA 1FYTB 1AO7D 3UC0L 1BOGA 2IANE 4PRHA 2W9DL 5BVJA 1E27B 3KLDA 1IEAA 3RVWC 1LWRA 1HKLH 4KHXH 4WTXA 5C08A 4OF0A 5T33H 3ET9F 5C0JA 1NCDL 5SWZD 3HZKA 1CICB 4H1LB 3A67L 4X6BB 4JFFE 4TULH 4Y1AD 3S34H 2Z93B 1PAMA 3O81A 4HXBL 1J1XL 5GGSA 3GJEB 1P2CB 5DD0L 5DEFA 4Y1AE 5HBBA 2F54E 4F58H 2QADC 4AENB 3ABZA 3S88L 4AEEA 4K8RC 3W0WD 2DQIH 1RUML 5I8KL 4OLUL 2D7TH 1EEYA 3PWNA 1IKFL 3ALPA 5CIPH 1SYVB 1RJLA 4PJFF 3HI6L 1GJIA 1N2RB 2F9BT 4K2UL 1FE8L 2VNCA 1UADC 5DMKB 4RAUA 1YEIL 1F02I 4NO0D 1PLGL 4M6NL 4ZFOB 3RZWA 4OCSL 4YBLC 4HS3B 2MMXA 3IFPB 5HXMA 3WE6B 1TZIB 2J88H 2EDEA 3T1FA 2CLZB 3BVNB 3T65B 4K9EC 3V6OE 4TRPL 4UZGA 5HGAB 5DHVA 4XZUA 2YC1B 2C3XA 3RWCB 5ISZD 1D9KB 2JIXD 3AGVA 1VA9A 3HAEB 3WO4C 5A43C 5CZVL 2YWYA 2AJZA 5CBAA 5K9QG 1S9XA 3AY4C 4NKOB 3NCYS 1EUTA 32C2B 1U91B 4XAWH 3HAEH 3TA3B 5IHBA 2E7LC 2FBJL 2Y6SD 4FFYL 1EZVY 5EB9A 5C0GB 3H2WA 2XXCB 1DLHA 1U8PA 1Y6MR 1NMCC 4JQVA 5LWYH 1WWCA 1FNHA 1HH9B 3KPOA 4O9HH 1TVBA 5FV2A 2JE8A 2B2XL 5DJXB 5ICZA 5DD3H 4DKFL 5GRUH 5B4MD 1FO0B 2IPTL 3PGDB 1YQ2A 4HIJA 4IMKA 1T80A 2D03L 2MJWA 3MLWH 5I30H 3EYFB 4FRWA 4LCIL 2APXA 3ILPB 3ARGB 3IJSA 2F58L 5DD1L 3ZKSD 4W6WB 1YY8A 1IC4H 2OTWA 3M8OL 3HB3C 5CSBA 4HBCH 4WI9A 3UTSD 1T20A 4CVXA 4X6EA 3QUZB 3EHBC 3LVEA 2BXYA 1U3YA 1VERA 3EO1A 3O6ML 1A3LL 1A0QL 2D9CA 1T2QL 2BVOA 3HI1B 2JJWA 1F58L 1TJIL 1A22B 5L0QC 4PJEB 4DKEL 4WI6A 4MMZC 4Y4FB 3IKCB 5FUZL 4K94C 4MQ7A 3CJJA 2C4FT 5T3XL 4HULB 4M5ZL 3SGEH 2BNRE 3LMJL 1GC1H 4MVBD 1H3TA 2PTTA 4P4KB 3D39D 3TJEH 5L9DH 2J2ZA 1H3WM 3AB0C 3IVKA 3CXDH 5KW9H 1SBSH 4YHOH 3EGSA 3KJ6L 3H3BC 4WHYH 1WWAX 2O26U 3OAUH 3UP1A 4M7KL 1OAYH 4OD3H 3EDJA 2EZ0C 3CMOL 5FUOH 2BSSB 4HGKC 4YHLL 4NHUB 1F3DH 3KYKH 4RX4A 4PS4L 3V7MA 12E8L 5T3XE 4DZ8B 3QUMH 2UUDK 3L7FA 4KFZC 5E08L 4I48B 3MRJA 3IU4L 1OM3L 2B1HH 1WEJH 1FNSL 1JYWA 4ZODA 3KYOA 5LGHL 2JELL 4MX7A 4DUVA 1CR9L 4OFDA 5FO9A 3QT2A 1INEH 3CFCH 4NN6C 4NQVA 3WL9B 1L7IL 1K8IB 1RK0B 4R4NC 5GGRA 5JO5B 3NCJH 1TQBB 2XTJD 2ZG3A 3FT3B 4XVJH 5J1TC 2VDPL 1YDPB 2KL6A 1KIPB 2VDQH 1BLNB 1XFPA 2XTJE 3WL9A 3MGOA 3WHE1 5D2NE 4YDKH 4HIIA 2Y6SC 1EAPA 1ZLVH 1S7UB 3MV8E 3QRGH 3I85A 4KKLD 5IV2B 2JJVA 3UZVB 5CAYB 4LFHD 3VGAB 1UC6A 5IESL 2RGSA 1C16B 3RQ3A 3TIEB 5HHPA 1ZVSB 3ZT7A 5C0ND 3OKEA 1YECH 2P5WA 3D1MC 4JFXA 1OTUD 3FFCA 1DZBA 1KJ2H 2D31A 2XFXA 5BO1L 3VRIB 1U0QA 4HWEH 4YNYA 4YHZH 2YPKB 5A3ID 4WTZA 2JIXB 3PQYE 3VJ6B 1CFBA 2EC9T 5ISZB 3MFFA 3X3FH 1B4JL 1NGQL 3V0AC 4FQXA 4FQXD 5I76B 1LO5A 4G6KL 4GW1B 1EV2E 1K4CB 1CGVA 1F4WH 1FNFA 2GCYB 5D70L 1HSBB 3TH2T 3QDGB 5FGRA 2OX5A 5F7MC 3MRIA 1QBMH 3WEXB 5IWLA 1G9EA 1LO5B 3MNVB 3VXNA 2F53A 4ZO6A 5EOTA 2UYLA 5H94A 1I8LA 3HA0A 4PLNC 2HT2C 2VXVL 1IARB 1CDYA 2FGWH 3QDJA 3VE0B 3ARED 5IKCA 1BFTA 1RZKH 3EO0A 4JJHA 4F7EA 4M7ZC 5HD8C 4IRJC 2KH2B 2F5BL 2Q6WB 3UTSB 4P2YA 1JGUL 3MZGB 5B8CA 4LBEA 4E42A 4WEMB 5LGKA 2WQRA 3CPLA 4JM4L 4EEEA 4DK6A 3ZSSA 1G6RA 1QFPA 1T66C 3LRSB 3MJ6A 4ZG1A 5FA4A 3W0WA 2GUOA 1VACA 4S1SL 5JDSA 1AQDA 5C71A 5CP7B 4U6TA 4LCWA 3HFML 2D0FA 5IF0B 3WKMH 3EZJB 2G75B 2DOCA 1BQHB 1VFBB 1J8HB 2COQA 3VA6A 3VWJB 4TTDD 4MNHA 4XNZB 4AIZA 1AGFB 3CFJB 2HT2D 1X5YA 1OAUL 5DRNB 4LEOB 2R8SH 2X6MA 4YHIA 3VXTA 3V4VH 1XGYH 3GO1L 4JFEA 4MD0A 1TPXC 1KCRL 2Q7YB 3S34L 3OQ3B 5JOFB 4WNQA 5DEGA 1JGEA 1N0LA 3MYJA 4PG9A 1QZ1A 2YUXA 2GAZA 4L9LC 3F8UB 4J3XA 3IB4A 3QHTC 2G2RB 4P5MA 4JPIB 5J4MA 2DLIA 3WS6C 3X3GL 1NDGA 2W9DH 4MS8D 5GS2H 3GMOA 3U46B 3CX5J 4XXDB 3TFKD 2YRLA 3VWKD 3F7VA 1JRHH 4HHAA 1C8PA 3IKCA 3QDME 4TQEL 3TESA 1FL6B 4Z7UB 4S1DC 2JB5H 1CFQB 4GQPH 4WTZG 5SX4H 3QRFM 2WUCH 4IRJB 3OHXB 4XVUC 3FQNB 4FZEL 3WSQH 1M7XA 4M6OH 1O0VA 1JMZA 4Z6AT 4L8DB 4XP9H 3QNZA 1T83A 2R4SL 4PJHB 4PJIA 1CQKA 3CCHA 3TNNB 3KXFE 3G6AA 3I3DA 3ARTA 3QFJB 1Q1JH 4LARL 1IM3B 3KR3H 3FRPA 4UV4L 4PRHB 4QHUB 2MQ0A 3KPLB 3KXFD 4KJQC 1B2WL 2CD0A 1SY6A 4LGPB 2DQFA 4JHAH 4C4KO 4X8JA 4H1LG 3D9AH 2VH5H 4Z7WA 4NQTA 4YXHL 5IMMB 1I8MA 3QG7H 3L5IA 4RA0C 1IAIL 1UJ3A 1MAML 2DJSA 1C7SA 2Z0BA 4PGJA 4FP8H 2IADB 1FBIH 4XCEA 2IFGA 5EU6A 5I66B 4OUUA 3PP4L 1KJ2L 4BKLB 5ETUA 2YSSB 2FX8L 2EC9U 3QFJA 4KWUA 2XN9A 3ECBA 3O2WH 1IM9B 3EO9H 2MCG1 3QUKB 5KW9L 3V52H 5DEGB 4XCFL 5I1EH 1J7VR 4Y5VB 4HBCL 5F6HJ 4MGXA 4LLMA 4ODTH 3UJIL 4DN3L 2A9ML 3U2SB 3N1GC 4DW2H 4LVOC 1W0YT 4WHTB 3SO3C 2O93L 5IVOA 1ITCA 5MI0C 4OUOA 4NZTL 4FQJH 3GSVB 1F58H 1TJIH 4UMGA 4WUUD 5I8EA 4TUJB 4F2MB 5DJ0A 2OR9H 4BUHA 1R0AH 1ZEAH 2WK2A 3RY4A 3ZYJA 1IGIL 4OT1H 3HNTH 1G7HA 1DBJL 3OR6B 1H8SA 2X4OA 3FOLA 4NJAL 3ME0A 3C9NA 1DQJB 3INUL 1YA5A 3WYRA 4JO4L 4AL8H 1K2DA 1MRCH 1TJHH 2NXZB 2V6HA 5A3IC 3OAYH 4WENB 4OCNC 2MPAH 5CSZA 4QHLB 3VFPA 5T1KB 2MNUA 2IBBA 4NOFA 5IFJA 3CK0L 4YLQT 5F9DC 3HZKB 3DMMC 3OR7B 4BUGA 5I6XB 3K4ZA 3P77B 4M1GL 5HTSA 3LD8B 3UJTL 2QKIA 1CD1A 2R1XB 4GG8A 3UTQA 4AH2B 3WUWG 4F7EB 3QI9D 5GHWL 1R3HB 15C8H 3MV9A 3SDDC 3VE0A 3ULVH 2W65A 1ZGLB 1LO0H 1MCBA 1VGEH 4XPBH 1FAKT 2QQNH 4QRPB 3D18A 3K1DA 4MLIA 1ZLSH 4LF3A 2XIDA 3MRBA 4NNXB 2A73B 4ELMF 3O9WB 1RZIA 2H2PD 3F7RA 1HXYB 1IAKB 1XH3A 4X83A 1RHHB 4HMDA 1MCWM 3LRSA 4G6AD 1XF4B 2ZJSL 2RHEA 5F93C 4NQVB 5TGBA 4N0CC 3GSOB 4EUPA 4JFDE 1JNHB 3KDMA 3TCLB 3P4LA 4HWEL 3GMLA 4JVPA 3LN4A 3TIDB 4M93B 1J05A 1QBAA 4LSPH 2F8VA 4FMFA 1KPRA 1HQ4B 1CXIA 1UM6L 3IT8D 1UH3A 2FSEA 3T09A 4CVUA 5DUMH 4OZGA 1S7XB 3VXMD 3TBVA 1FLRH 5DFVD 4KZEH 2EXWC 2VZOA 4PJGB 1GOGA 1ZE3C 3IDUA 3MLRL 4JM4H 4JFDD 4IBLT 2X4TB 4S1QL 3KYAA 3S4SG 3FO2B 5F7NC 2N1KA 4JRYE 4PRPE 3ZKMC 3TPKA 3O4OB 4GKSA 5FA3A 1A8JH 2FX8H 3BO8A 3V0VB 4W81A 3WIHA 1A7PH 3NIDE 4JPKH 5D5MA 2VZSA 1MHCA 3C2AH 5DJZB 2Z8SA 2YMXH 5TJWK 1KEMH 1NANH 3Q6FB 4JDZA 1WEJL 3CFEA 4QRPA 1EGJH 3QIWA 1P4BH 3MJ9H 1HH6B 3F5WB 1N59B 4KDVA 4O2CA 4R7DB 5MHSD 2BJML 2VLRD 3RVXC 5EU4A 3NFNB 1PBYA 1DCLA 4CVWA 4UTBL 3QISA 5F1IB 3D69A 5TQ2L 1HINL 3RWEB 5CD5C 4XVJL 5CKGA 4F15B 3P30H 4S10A 4XH2A 1U8HB 1KCKA 1OF2A 2XACC 2ADGB 3E3QC 1I7TB 3HPJB 4F3FB 5J9PA 3H8NA 3K2MC 2XZAH 4KJYA 1ZLWK 3WIIL 5B4MC 2I9TA 3P0VH 3UAJD 5AZEL 3ULUH 3KPNB 1WWBX 1DBJH 5KOVC 1KTRL 3W9DB 2HJLA 4HIJB 1CQYA 5E2TH 1QA9B 1O7SA 2HTKD 1C5CH 1RZJH 4O2EB 4PB9H 2W91A 3SDXA 4OQ1A 1F6LL 5F1OB 2EDWA 4FXKB 1FYTD 3MLTB 5DWUL 4PJGA 3NTCL 3E2HB 4PJFA 2ITCA 3SKNA 1NCWH 3C5JB 1I7RA 4QKXB 5EOQL 5HGDA 1AC0A 4OZGB 2B4CL 2CIIB 3AMLA 2MHAB 1LEKB 4I4WB 1WQVT 4YC2B 5TDNA 3IDJB 4NPYB 1H9VA 2Y06H 3PL6A 4L4TA 2H2SC 4JRXA 4KRPC 2VQ1A 5JHDD 4QXGL 1NMCB 1UH2A 4I0PB 3BGFB 3TBTB 3FO0H 1FRGH 1ZT1B 2X4RB 2VLJD 4MD5B 4PJCF 3IVKB 1PFCA 4OZFA 2B39A 3BKYH 1UJ3C 2BOBB 4JQXA 4LDEB 3BPOC 1T1YA 4Y2DD 3DSFH 3OKKA 1JTTA 4ZYKA 4MA1B 1DLHB 4HUUB 4AQ1B 4YX2L 5GRWA 1I3RA 3U46A 1FZMA 5DJ0B 1PGRB 4LPWA 5IB3B 1JPGA 3E0GA 1UWEH 2FH8A 1PEWA 5EZIL 1VFAB 3BKJL 15C8L 2FHCA 1VADB 3MRFB 3FQXA 1I9JH 2AJVH 5JHDB 4LSUL 4ODSL 1BOYA 2YC1A 5IIEB 3DOSA 1F90L 3JUZA 1XR9A 4N0CD 1JGLH 4JRYB 1CLYH 1FZOA 4AEHH 4K3EH 2W92A 5EU3B 1ZHNB 1FVEA 1CU4H 4YHPA 2EKSB 4GRWE 1GGCL 1Z0NA 1BBJB 3QEQE 2VLKE 4Z95H 2ED9A 1T04B 2E7HA 1FFPB 1F4YL 5KJRH 4LAJH 3KYMA 4YXLL 5J3HD 1I85C 1CDJA 4BQBA 2IAMA 1FVDB 3BD5A 4G5ZH 3QI9A 3HMXA 1I4FA 3AXLB 4MAUH 5DK0B 2Y9RT 3PIQB 3TA3A 32C2A 5F9WC 1AE6H 5ADOH 2DQFB 4G43B 1OGAD 1TVHA 4RWHA 3TO4A 4X7EC 5KVEL 1P6FA 2UVFA 1AKJD 5EFIB 4YZFE 5DD3L 4K7PY 3GB7B 5LXGH 1D5XA 1WBYB 1K85A 2Q7YA 5SWSD 1UB6A 4YHKL 1RUQH 1OPGH 2GTZA 3O0RH 2VDLH 3GB7A 1ZEAL 1URLA 4ONHB 1V7NH 1WZ1H 2YWZA 5DJ2A 5F6HI 5IBUB 2BMKB 5DRZB 4NC1E 4X6DF 4AYFA 5EIVA 4JO1L 1RIUL 3ULVL 1BQHA 3V7AE 3MA9H 3CFKB 4U31A 2PO6A 3HRZB 3D3VB 5T33L 1EIBA 4KROD 3MRIB 3VA2C 1JZ8A 4A6YL 5B38A 2J88L 2B20A 5FKAB 5GRJL 1R6VA 4J4PA 3RX7A 3PNWA 1K8DA 5DHYA 3PQYD 1U93A 4YH6A 3QZWA 5IGXL 1KEGH 3L3IB 4HJ0C 1NFDF 1PSKL 1QBLH 2XYCA 3QQ3B 4GMSH 3UTTA 3PP3K 4PB9L 3HUJB 1V7MH 2DQTL 3QNZB 4M8VA 5IB4B 2GJ6A 4NKIH 5CEYA 4HH9A 2V7HA 4LEOA 4OLUH 1NFIB 5C07E 4F7CA 1AR2A 5IROC 2J8UF 1IGIH 1MWAB 2LU7A 3BZ4B 5KVDH 3BGAA 5ESAB 3FQUA 3O6LH 5TE6L 2E6QA 2Y36L 2AEWA 4X5WA 2YK1L 4WW2C 4TTGA 1OTSD 5F7UA 1K5NB 5D7IF 3VRJB 5JPMA 3DROB 1KIPA 4FOMA 4NRZA 1ZSDB 3IJYB 1CI5A 1QRND 4XC3L 4JQVC 2Y7QA 3QJFB 4GOSA 4JFYA 5JO5A 1WZMA 4M7LT 1KYOJ 3V6FB 4GW4B 2XNAB 5DK3A 5BZWA 2DMCA 5I2IA 3K2UH 3QIBC 4OCMC 4QXWA 1B0WA 1L9NA 3GHEH 4RGOH 3THMH 2XZQL 4K7FB 4ELMB 2FEDC 4P2QA 4HIEB 4Z5RA 4Q6IA 1JRHI 3KS0H 1UCBH 3GSXA 4JZOB 4QTIL 1CVRA 5I17B 2RFXA 4JZNA 5HHPB 5CS7A 5E5RB 1GHFH 3I3BA 2G75A 4HG4J 4YR6B 3LIZH 1RUKL 5IVZB 5T1LA 1FN4A 2AQ3A 1N5YL 4QRUA 2IBGA 2AQ2A 2F58H 1A7RH 4GRWF 4OV6F 4P9HH 4U0RC 3U6RB 3ULVE 1XGPB 3C2SA 3BP7A 3RAJL 3KPSB 4R90H 3FMGL 3RUGA 2FDBP 2YN5A 5DLMH 1WCBA 1H0DB 4ALAL 3KLHD 1EH9A 3S7GA 2A6KA 3FO9A 1JHTA 2KBGA 3MOBL 5ESQA 3U9PL 5DMYA 4G9FD 3DX9A 4EI5B 2CXGA 3NACH 5FUOL 5IP4A 2OZ4A 4POZC 3BP4A 3TBSB 3F65A 1N26A 1V3JA 1GGIH 3WIIH 4L3AA 1JHKL 2QSVA 3O6KL 5BV7B 4PJ7F 1AI1L 4RA3A 1HNFA 3RWDB 4KKBC 1F2QA 4N0FA 4YPGA 7FABH 4PREB 4ISVA 4M1DL 5L7XL 5SWSB 4YK4B 3SE3C 3WS3B 3BFOA 1M05A 5D2NB 3KPPA 1L7TH 3FQXB 4XNYL 4URTB 4X9HA 3CFDA 1MSPA 4LSTH 2DQCL 1IGJA 1JK8A 2BRQA 2BSTB 3RJDA 3T2NH 5JORB 5H2BB 2F74A 3UYOD 1UXSA 4PJ8A 3RPIB 4Q9CA 5E24E 4NZDA 2OMBA 4I8DA 1S7WA 3OKYA 4GW5A 2PO6B 3HRZA 3FRUB 2VWEC 1LE9B 3O45A 4RISL 1OARH 1YYMH 4YE4L 2P47B 2AP2A 3MV7A 3L5WA 4P5TC 4GBXA 5DI8A 4PB0L 1N3NA 1UJTA 5C0IB 2PYEB 3ARDB 4IRSD 4JZNB 2DKMA 3O8XD 3HAEA 1D9KD 4R2GB 5JDJA 1G7IA 4PIRF 5KSAA 5KSAD 1KTLB 4Y4KC 3VXUE 1S9KC 2VSDA 4HJJL 5IGXH 1KEGL 5F1KC 1U3HB 3PL6B 5D70H 3U83A 5JW4N 3PABB 1OAUH 1CDHA 2Z31D 3OZ9H 2NXYB 1NGQH 1V05A 3UBXB 3QI9C 4L29B 3LB6C 1G0XA 4LVHC 2NTSP 3KHQA 2ZP0T 4FQXC 5GRXG 2R0WL 3P9MA 1FO0A 3U4BH 4LPCA 4KVNH 3JTTA 1LO3L 4JRXE 4U0QB 1XH3B 1SYVA 4XNMB 3VWKB 3JV6A 1IZJA 1IC5H 1Q38A 3S5LA 1GZQA 1J0IA 2KKQA 1EEUA 1CFSA 3B4NA 4KY1L 3PJSA 4PGDB 4K3EL 4OFKA 2E6PA 3W9DA 2D0GA 1AP2A 2EH7L 1I9JL 2AJVL 4YGAB 1J8KA 3O4LE 1OF2B 1U3JA 4MSWA 4QCIB 4S11A 4PJBB 2BP3A 3SDXE 5I75C 4JN1L 1A1OA 1A4KA 1H3PL 1DQQB 4UNVA 3P4OA 5B8CC 3HUJA 1TZIA 1YNTB 4LCUB 4Z7QE 1LO2H 1OGAA 4PRID 4OLWH 2P5EA 4UQ2A 5IW1A 4J23A 3U0TA 3QCVH 5BOPA 4L4VE 1ZVHA 5SX5K 2VYRE 5HVFB 1NC2D 3O6LL 5C0CE 2G60L 4GJTB 3NH7H 1Q72L 4PTUB 3OR6A 1MHEB 3HZYB 3UO1L 4PRPD 4JM2C 3OG6B 2GI7A 3JUYA 5HYJE 3VFRB 2AGJH 3ZKXB 1BGXL 1T1WB 1N5YH 3IFLH 5CZXC 1NLDL 3L3HA 1EJOH 5I1DB 5EIQA 1JPFB 1Q9LB 2EH8L 1EERB 1H15B 2EYSA 2PCPB 1MHPL 4NHCL 2CLZA 3BVNA 3EYSL 3T65A 4X9FA 4MQTB 1JPFA 4NRYB 3MA9L 3TN0A 4IRJD 1UQSA 3JXAA 5I1DA 4M61B 4XP5H 4NQSA 1KB9K 4AMKH 4PJ7E 3O3BB 4PJGF 2UVEA 1G1CA 4X4XA 2DAVA 3WNNA 5GS0H 1J0JA 2PYEE 4WI7A 4OZGE 5K93A 1BBDH 3DURB 5GS1A 3PDOB 4LKCA 1HYSC 2M1KA 3QIBA 1OAQL 3SE9H 2DLTA 1TIUA 4FZEH 4PYGA 4AENA 3F58L 5HSFA 3KPLA 2JCCB 2P8MB 3H42L 3ROLB 4R8WH 1QSFB 2W0KA 3V6ZB 2UV3A 4Q6IC 3R1GL 2Z31B 2H2SD 2H3NB 1AFVH 4PJ9A 5C09A 2OZ4H 4GRLD 4LSTL 3TH4T 2R4SH 3LV3B 4S0TD 4APQA 3TGXA 3NFPB 5B39A 1QRNA 3WE6A 2GJZB 4NBYB 4WW2F 2NPLX 3WLBA 4RMSA 1S7RA 3IGAA 3LZFH 1U8QB 2N7BA 4Z0XB 3UBXG 5DDHA 3EFDH 1I3RB 4J3TA 3B8YA 4HZAA 3U7YH 2BNQD 1CE6B 4N68A 4M9OA 4JY6A 4CMMB 3VGHA 1VFUA 1BIIA 1ONQB 1FG2B 4OM0H 2DQJH 2VLKB 4Z78B 5C0BA 1BQHG 4TSCL 3GBNH 2FX7L 2MQ3A 1UA6L 1RZJC 4F7TB 3AUVA 4FTVA 2R0ZL 4RRPA 1Q0XL 3ZMRA 1ZLVK 3U1SL 1QRKA 2WV3A 3O6FD 2WBKA 2P5WB 3LS5L 2X44D 1YNKH 1JF1A 4ZTPL 4YAQA 4FFVD 1HDMA 1QFHA 3S35X 4F7TA 2PYEA 1OD9A 5IHZA 2OP4H 3QYCA 4PY8J 3SJVD 5KS9F 1SEQL 1DUZB 1A9BB 2QADD 2UWEE 3FAXA 4MJ5B 5I0ZA 4XWGH 4D3CL 4U2YA 4X9GA 5F6IC 4Z76B 1GZPA 2EO9A 4U6HA 5IBTL 3C8KB 4K71C 3HMWL 3MXVL 2VDOL 1MH5B 3CVHL 3WO4B 1XCQB 2R2EA 3CZFA 3BRDA 1NGYA 2IFFL 3SKMA 1U8QA 3MXWH 5HGHA 3JBG7 5IVNA 3LOWA 2A1WL 3ZYIA 3ARFC 2QHRL 1R5IA 4PJ7B 3QB7C 4N8VB 4F37F 2VUOA 5HYJA 2WM0A 3P73B 43CAB 1A14L 1IKFH 1JZ3A 2N4IA 1TLKA 5TH2A 4F57L 1ED3B 5D7SL 1F4HA 1JUFB 1S78D 2R9HD 2IQAB 3RWGA 3VI4F 1MEXH 1KJ3H 1PX4A 4CW1A 3NH7L 4XWOD 4OIBA 2BSSA 3DVGA 3TPUB 1M7DB 1HWGB 1JNLH 3O3DB 1ZHBA 3MLSH 4H26A 3C08H 2FYYB 1ETZA 2X5PA 3L6FA 5C0NC 3HUJE 1GYAA 1KIRB 1T21A 3STZB 4DUXA 1JL8A 1DANT 5F8RC 1VKXA 2QQLH 4Q7DA 1KPUA 3MRNB 1M71B 3OB8A 2BVPB 4WHCA 3IJHA 4I5BA 1UWGH 2RR3A 5DUBA 1E6OH 3O4LA 4F9PC 4PBWD 3OKNB 5HHXH 5DQ9A 5JNYA 4UILH 5CJQL 2GT9B 3MOAH 5I8EB 4WI5A 5DWUH 4LLYA 2D0HA 1XGRB 3BJ91 5DD5H 2HVJA 1ZWIB 4OSUH 3VH8A 1AHWC 3LKQA 4PGEB 4EBQH 3ZYZA 4TUKH 2WSKA 4FFZH 2XKNA 3EZ8A 3DRQB 3KDMB 2ERJB 2ICEA 3ILPA 2VR4A 4WW1B 3SKJH 4WU7A 1MY5A 1SEBA 4HAFA 4JFFD 5FYKH 4M1GH 5F88A 4RQQA 3H3KA 3V6BR 4KROB 1I4FB 3TV3H 3STLA 4HK0B 1R5VA 3UTZB 4WU5B 4JKKA 3HI5L 4P23D 4LL9A 4ODVL 3BGFC 1CD8A 3CFDB 1KGCD 4IRSC 5CBAB 4OFYD 2I60L 4H8WC 4M4PA 1M7DA 4P5TD 4KK8C 2EECA 5CEZD 4MJID 5ITFB 5J89A 4C83B 3BIBX 4I18B 4HD9A 5JHDA 1U8NB 1D6VL 3L9RB 1F3JA 1OSZB 1U92A 1N5AB 2I07B 4NWTL 4OZIF 4HW6A 4QXGH 2CIKA 2HVKB 2E9WA 3F6IA 2R29H 1H8NA 4N90E 4PRAB 5IBUG 3LPFA 5DJAA 5K9JL 2XA8H 1QSEB 1D5IL 1NC4D 1ODAA 3D0VA 2OL3B 1EJOL 2GEEA 4YWGH 1BVLA 2E8ZA 1OD7A 3QDJE 2ARJQ 1SEBB 4KHTH 4P57B 4OI7A 4LDOB 2JK5B 4H20H 1D5BA 4Z7VF 1N6QL 5MI0B 3DIFB 3EO1B 1E28A 4GLRH 3TZVD 1AR1D 1C08A 4JFEB 4MD0B 4KTYA 1CICA 4H1LA 3KLHC 3RA7H 4QGYA 3L3OB 3REWB 1WBYA 3QEGH 3CSBA 4NQED 1V8HA 1FVCA 3U79A 4KPHL 4UINL 2QQNL 3FB8A 4PJ5A 1JPTL 3H7BB 3PUCA 5JXEC 3O3AA 4DWHA 4NUJB 4AM0B 4CDHA 1LE9A