2VDQH

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
219
Chain Sequence
b'EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 43
structure length 219
sequence length 221
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqH02
4KROD 4I4WB 5E9DD 1LEIB 2H26B 2VQ1B 1Z6JT 4FFYH 1WWBX 4L4VB 1CGYA 4XXCA 2XKNA 1FO0L 3B2UD 5CD5C 5IFAL 3C5ZD 2CLZB 1TXKA 2DLFH 1MWAL 3PP3H 2H1PL 2DQHH 5ICXB 2CPCA 1MFEL 2CGRL 4RCAA 3PHQB 3J7HA 2HTKD 1ZSDB 3QUZB 1OTUD 5IB3A 4BZYA 3IFOA 2QHRH 5DO2D 3WO3B 1HIML 3H3PH 2WP3T 2R29L 4UILL 3EYSL 4MQTB 4WU7A 3GBMH 1LE9B 1QVOA 3IDJA 5HHPB 3BGAA 4OZIA 2VXSL 2PXYD 1U6AH 4ZTOL 1U3JA 4OD1H 3QI9A 1ED3B 1ES0B 4M7ZB 2F54B 3DMMD 3I02A 3P4OB 4JO1H 4HQQL 2I25N 4HGKC 5KSUA 4HKZA 3GZKA 4NM4H 4X5WB 3H3KA 2EDQA 1J0HA 3IU4H 3I6GA 5ELIA 3BRFA 1ORQA 2A6IB 3KPRB 4M7JH 4KDWA 1D5IH 1DQJB 4FQ1H 32C2B 4JY4A 3UTSA 4X83A 3LKNA 1HSAA 3C60D 3ZDZE 1F3RB 3LQMA 4LPUA 1CZ8L 5ADOL 5D6CB 2PYEE 1JGEA 4I2XB 3QDME 2MNUA 1SJHB 2W65B 3UTZB 2YSSA 1PX4A 2XN9B 1NSNL 3AXLA 2VDRH 2QSCL 1L7IH 2PYED 3GO1L 3EYFB 4WO4C 5T3ZL 1BQSA 3VI4F 4PRPE 5FM5M 3QDMD 2CJUL 5B3JE 3K1DA 4JHWH 4ZFOA 4LOUD 4XAKE 4Y5YC 3WHE1 1U8HB 4PRPD 3BP7B 1JHTB 4C83A 4DUVA 4OSUL 4HEPG 3LPFA 4XAKD 1KENH 4PY7B 1F90L 4K2UL 3MQIA 4F80A 4R0LA 1N4XL 2NY4C 4IDJH 1P5VA 1QLRA 1NUNB 3RAJH 1XCQA 2Q8BL 3WLBB 3OPZH 3RA7H 1HH9A 3T1FB 3HRZA 1K4CA 4DVBB 1MJ7H 5KANI 4MJ6A 5FO9B 1N2RB 1DUZA 4FZEH 4N0YL 1ZXQA 2V17L 3SOBH 3QXDB 4O2FA 4X6BA 2CK0H 1JK8B 5ILTL 4FQXB 4PJHE 3LHPL 5KVDL 2JCCE 4OLVL 5FM5O 3VDAA 4GAYB 2VDQL 3SKMA 4S1DD 1HOCA 3L5XL 4GT7A 3L7EB 3U9UB 1INQB 5T3ZE 3VW3H 4XAWH 3M07A 3AU1B 5ACMA 5IVXE 4KDVA 3O2DH 1HI6A 3S37H 2R1XA 3FN3A 4GMTH 2D7MA 2P8LB 5DDHB 4YXHL 2EYTB 4ZDHB 1K2DB 1QFWL 1KCUH 1BFOB 4NJAH 4KZEL 3W0WB 1C08B 5SWZE 1T0NB 1RURH 2HN7B 3QNZB 3OKDB 3N1MC 1BIHA 4P48A 1JWMA 3O3AB 4UQ2B 4MD0A 1QFPA 4WTWA 1QOKA 1J05B 4CRPA 3PL6D 4MNQA 3LH2L 2P46B 2XRAL 2HVKB 5BRZB 2C26A 1BF8A 2F19L 4NZRH 3DX7B 1JF6A 1NDMA 5MI0B 3PJSB 3NIDF 4J23A 4KI5F 2VZVA 3IXAA 4Y2DB 3TT1L 2UWEF 1ADQA 3RUGB 3SCMC 2NY3B 3HE6C 3WEXB 4Y4FC 1CD1B 4POYA 1KLGB 1MPAL 4XNUL 4JRXA 3VRLF 3G08A 3IDYB 1H3GA 2XTJC 1G7HB 1B2WL 3V0WL 3NFSH 2E6JA 1MCNA 1E28A 1K8DB 1UZ8B 1YJDL 3VFSA 5DI8A 1DFBH 2Z31B 5FGSA 4NYLA 1J0IA 2FGWH 3QDJE 4FXGB 3EIFA 2P49B 3ALXA 5GGSB 4RFEB 3V4UH 2DQTL 3JV6A 5F9WC 1NFDF 3LKRB 3WKML 1W0VA 1XR9B 2NY0C 3QDJD 3WSQL 1EO8H 1A4KA 1M7IA 1QFWI 4F7EB 4PJ7B 4P9HH 3C5SA 1UM4H 4UZGA 4EDWL 2IADA 3QZWB 2IMNA 1G7IB 4CU8A 4MA1B 5ERWB 1VACB 3QUKA 4ZTPL 4F15C 5BVPL 1XF5B 4AY0A 5EU7E 5I1KH 3EDJA 5EBWB 2NXZD 1W2KT 4AH2B 1FL6B 1DLFH 3LKSB 2G2RA 4XTRC 2XACC 1YDPA 3ES6A 3REVA 2MMXA 4KKLC 2WIIB 2BHYA 3W5MA 1INEH 2D7TL 2RQ8A 2FGZA 3QQ4A 3L7FB 3DARA 3IAQA 1RZ8A 3KS0J 4JPKH 1XIWD 3WXVL 2NX5A 1HHJA 3P0GB 2P47B 2BXYA 3CFIC 2FHFA 3ZYJA 1XR8A 2DS4A 1J1OL 1OSZA 3KYNB 5L88L 1J8HA 1DUYA 1GGCL 4HJGA 5JLZA 1WBZB 5TF1H 4BSWB 2PYFB 4OZGB 3H9SB 2DLIA 3BD5A 5L6YH 1IGJA 3MRLB 1MUJB 1UH2A 5BXFB 4OD2B 2XKSA 4PLKD 2OI9C 3MRKB 3THMH 2WK2A 3H0TB 5GGRY 1MCQA 1AGDB 2X5PA 3KLSA 4J1UB 3PXHA 4WJ5B 2Z9TA 3VFNA 3KPMA 3NACL 5FO8A 3IDNB 3K2UH 4XGZB 1B0GA 3NA9H 4MS8D 4RMQA 1RIUH 2MWCA 3L3JA 2DL2A 4YHZL 1A2YB 1EJOH 1I1FA 5IB1B 1YEJH 3P11H 4P59H 1P7QD 5IROA 2MPAL 3FOMA 2YPLA 4NIKB 5AEAA 5LGHL 2D03H 2H8PB 4P23D 5DMJB 1CGUA 1MRCH 4XH2A 4TSBH 4M6OH 1JZ3A 1SJEA 3QNYB 1K3IA 4XNZB 4GFTB 5T5FH 2C7UB 4X6DA 1NDGB 1KEMH 4POZC 1NC4A 2K7PA 5H2BA 1WBYA 1YEGL 5DLML 1KEGH 5C07B 2VXVL 4MZ2A 4JM2F 1DLHB 4HXBH 4WW2A 3T3MF 2NNAB 3MJ6A 1IM9B 5F7EH 2ZG1A 1S8DA 3HNSL 3OB8A 5F1NB 3V4PH 3TBWB 3VXUB 4OQTA 5L2KE 3CCHB 3GSXB 4OBRA 4PJ8C 3RJDA 1NAMB 4R2GB 4GG6A 4JG0L 3LEXB 1X5HA 4JB9L 4LMQE 1SBBA 2R2HA 3FQNA 5E8OA 1QBLH 5L2KD 1I9JL 3MV8D 1HWHB 3EDFA 5JNYA 5EZLB 5K59F 4BH8B 3QUXD 4IOSD 4LSTH 4QRSB 1KB9K 3A6OA 3LQAC 4XPAH 2C3GA 3GI8L 2SEBA 3V5HA 2C3VA 2ZCHL 3QPQC 1LNUB 5E94B 4CGTA 2ZCLH 2DQUL 4G8GA 4Y19A 1D6VH 1DSFL 4G8EA 3DETC 3TA3A 4XVUC 3FB8A 3BKCH 5DJ2B 3SCMD 4PBWD 3DVNA 3TO2B 5DQJB 3OAYH 1AD9B 4LRNH 2BERA 5CLWA 3RDTC 1MWAB 3DRTA 4GRLB 4YDVA 5IR1B 3TJEL 5D6DC 1U0QA 3ULUH 2NY1C 3VFUB 1JI2A 3O6ML 2DM7A 4HS3B 5DC4B 5TH2B 5DYOB 2OMBA 3V6FA 2BOCB 4CN1A 4MD5A 2VLJE 5DD6A 1NQBA 4WUUB 2VZOA 1CF8L 3MNZB 4K23H 4MX7B 5DMKA 3AS3A 4K3HA 3IXTB 4GKNB 3MOBL 4XBPB 4PBVC 5F1OB 3RJQB 5CJ8A 4TRPL 3GMLA 4YAQA 1LD9A 1S7UB 1CCZA 5JIHA 5K9KB 3GI9L 4V1DB 3HE7D 4Y1AD 4M7LL 2CDFA 1LEKB 5DK3A 4NO0D 3Q3GB 1IZKA 3CNKA 4UINL 1W72A 4YLQT 2XIDA 1YECH 2NY2C 1T21A 2VJXA 5KAQG 5F3HB 3OWEA 1B4RA 4WWID 4RQQA 1KV3A 5T1KD 4F7PB 3J8F7 3H7BA 1RV6X 1OCWH 1P53A 2MCPH 4IOIA 4XNQA 2HG5B 3FZUC 2BNRA 3T0DA 3QG6B 4GO6B 2DQJH 2DD8L 5D1ZB 3DBXB 3L3IB 4PJHB 3FTGB 2FIKA 2RR3A 2LVEA 4J4PD 2Z8SA 5B3NA 2J6EA 2EDDA 3FT4B 4Z0BH 2DKSA 4LVHC 5DHVB 1PAMA 3DOSA 2WUCL 1RHHA 1VFAA 2X4PA 5EU6A 4DUWA 3MLRH 1T5WA 2P8MB 1RMFH 2C9AA 3G6JE 4FG6C 5ALBH 3U2SA 3TBSA 4UDTB 1BGXL 3HAEH 3KLHD 4KTDH 1T5XA 4MA7H 5JQHC 1E4WL 4TUJA 3FO9B 5EC1A 4AENB 3OKOA 5HDLA 3H9YA 4ODTL 4XWOD 3S7GA 2PTTA 4WVRA 3OXSB 1JGDB 1EGJL 3R4DA 4BSVA 2C1PA 2AVGA 4NN6B 5F72S 1QNZL 5I18H 4CADA 5I1IL 2W91A 1AC6A 1FE8L 4ZXBA 3LCYA 3VXPB 5SWZB 1KN4H 2BRRH 5DD5L 1TFHA 4ODWA 2D2OA 1FIEA 1U3ZA 4MWFA 3UTTA 1AQKH 3BPNC 4JKPL 2AK1H 4B5EA 5JOFB 3NBNA 2W60B 3E6HA 3BW9B 4P46A 4D0BB 3T4AA 5FDWA 3HPLA 4EXKA 4U6XB 2DJUA 2E6PA 3FB6A 3BT2L 1A7OH 5HGDA 1IGIH 1HCFX 2I9LB 2J8HA 5LXGH 2Y6SC 3FT3A 4GRMB 2EICA 5I8OH 2NYYD 3DROB 4OFVA 3CGTA 1HXMA 5ANMA 4HLZG 4YDJB 2CMRL 1G1YA 3CFDB 1LWRA 3TPKA 2VXUL 1QRNA 1VENA 3MRHA 4NC0B 5B39B 5DUBA 4DN3H 2QTEA 2AJUL 1ZLUK 4BYHA 5D1QD 1MF2L 3ZTJG 1BD2A 5JIKA 1D7FA 4X99A 2P5WE 5EZJA 1JF1B 4P99A 4QTIH 1H5BB 4NJ9L 4I1NB 4LRIC 4JFYB 1E6JH 4Z95H 1N5YH 4KRNA 2P5WD 4GBXA 1BZ9A 3C2SA 1ZHKB 1F11B 1MFDH 3H9HA 1KB5L 2DF3A 3BZDA 5FM4A 4PRHE 2IQ9H 3ETBF 1FGNL 3QFJA 5D7IA 3QUZC 4APQD 2LVCA 4PRHD 4YC2B 3RUGF 4Y4HA 3UJJL 1GC1L 2GHWB 4PG9A 4KI5E 5I15H 2DAVA 2VYRE 2X1OA 5C0ND 3FB5B 4XMLH 2X7LB 4U7KA 4W81A 4KI5D 3QXVA 4PJ5E 2CUMA 3D18A 2NY5C 4E5XA 3HCVA 3L3HB 3KR3H 4PJBA 4CJ0A 2VN7A 4PJ5D 1D9KB 5MHSE 4D9RD 5HGBA 2VDKH 5IHLB 1UJTA 4H8WL 4M7ZC 1CFSB 1MCJA 5ECJE 4HC1L 1ZVHA 4PJAB 2I27N 4ODSH 5MHSD 2J88H 3MRQA 3ZKNC 4PJ7F 2CDGB 4ZO9A 3F7RA 2E7MA 3IFLL 2KUTA 4A2LA 4JDTH 3DVGB 4GG8B 3QA3B 3ILPB 3QDGB 5IKCB 2JLLA 4RMRA 3SE8H 1S9VB 3QCTL 2DMBA 1E27B 3QCVL 4XP5H 3D25B 3MNWA 1AFVH 1QYGH 2NY2D 2QKIA 3G6AB 4FQHA 4ZO8A 3I3BA 1ZAGA 2XWJA 4EVNB 4QO1A 1CFVL 2EH7L 3I9GL 1G6RA 3CZJA 4HGWA 3O6FA 4I77H 2MHAA 1REIA 1RY7B 1U42A 1H9VA 2YUWA 2X6MA 3QULA 2DOCA 2HJLB 3QUYA 3WN5A 2C1OB 4GW1B 1GGUA 1X4ZA 1A1NB 2RJMA 3ZTNL 4XX1E 5JZ7C 4MLIA 3LN5A 3MUGB 2VC2H 5EO0B 5FXCH 5F7FA 3MRCA 4OZGF 1YEIH 2EH8H 4FS0A 1P4IL 4XPBH 5IBUB 2HJKB 3HI1B 3DTXA 4LGSB 1NL0H 3LZFL 1DQDL 4I0PD 5H35A 4YXLL 4HPOL 4WCYL 4X0KB 4LQ1A 3R0MA 3FQXA 2EIZA 3RZCA 2BVTA 4FG6D 4OCSL 3PQYB 3DYOA 5CZVH 1JUFB 1U92A 4ODXA 4R6UA 4Z6AT 3VWJB 4QNPF 2X4RB 3FQTB 4NFCA 3OZ9L 5LGJA 1F6AB 1T2QH 5BVJB 4KJYB 1CDGA 1ZVSA 2P44B 3BVNB 4FQXC 4NUGH 3QHZL 2APTA 4QRUA 4NO2B 4KPHH 2A6DB 1ZA3B 4NBXB 1DBKH 5J11B 3G6DL 4GXVH 5DJ8A 3FFCA 3B3IB 5GS1A 3ZT7A 3BISA 2ILLA 3LEVH 3K81A 2LFGA 5IG7B 1NBYA 2V9RA 1BQHG 4KY1H 5HHQA 3IDMA 2FATL 3KYOA 2D7QA 1KF9B 4U1KA 5CKGA 3PP4H 4YDIH 1YYMH 2P5EE 1KJVB 2ESVE 4M5ZL 1W0WB 3MUZ1 3CX5J 3ME0A 2OXGA 2P5ED 3LKPB 1SVZA 2P7TB 3GBLA 1OWRM 3OXRB 2RGSA 4O2CA 5IEKA 3C6SA 3T0VA 4DK3A 5GRUL 1F8TL 4S1RL 4EUPA 4CU6A 1BBDH 3N0PB 5TDPB 4JM2D 4U3HA 5BO1H 1T0MB 5GGVY 3MRGA 1CICB 5DA4A 3D2UD 4R7DB 3BEWB 3LMJH 5EIQA 3ZE0E 1G0YR 2B2XH 4NNPL 3CSGA 4RAUB 3BPLB 1GOGA 3RY6A 1IILE 1JGUL 5HYSG 5T1LA 5E2TL 3VDBA 2AV7B 4XXDA 3MROB 2VXQH 5EFIB 1BF2A 4PS4L 1RJLB 2NTSP 2VLJB 3BIAX 2E9IA 5K93A 1AJ7H 4IRSD 5IMOA 3JWOH 4I8DA 5H94B 4P5KA 1J5OH 2AGJH 4Y2DC 4XNMB 3IAGC 2AXFA 2ENYA 4POUB 2VQUA 2WZPD 5DQDL 5B22A 1WCBA 5KVFL 1J0JA 2NY3C 4A6YH 5LQBL 1O5DT 1TZGH 4LF3B 2A2QT 4BFBD 3C2AL 2VERN 3LRHA 5DTFA 2CRZA 3PWUB 5D9SA 3VWKD 5JXAL 1JHLH 4F3FA 3IDYC 1R3IL 5BS0A 5CEYA 4H88L 3WFDL 2J4WL 3GUTB 3F8UB 3TYFA 1FNSH 1DVFB 2F74A 3B83A 4YO0B 2X1PA 4AMKL 2Z31C 2W0FB 3TCLB 4W4OC 3TC9A 3D39B 1Y6MR 2K3TA 3TT3H 3FQRA 4N8VG 4WEBL 4JFDE 2WINA 3DUUB 1EVTC 2NLJA 1U3HB 4JFDD 3RWDB 4M3KB 4MA1C 1IQDB 3W2DH 1G6VK 3SGKC 3HZVB 4ENEC 3BZ4B 4JY5H 1SMOA 4LHJB 2X4NA 3G6JB 2W1NA 3B9VA 5M94B 4QRTA 2EDBA 3V0AC 2AK4B 2ERJB 3QIWA 4F8TA 5ETUB 4OCYL 3QIBD 1MI5D 4GW4A 3PHSA 4PRBA 2ICWI 3WXWH 3ARYA 5DQ9B 1PKQE 2FBJL 3MFFA 3V6ZA 4AQ1B 4JKLA 4DFIA 5JZ7D 5IMLB 2JJVA 4JZNB 4K71B 4UIMA 1M71A 3OKEA 3V0VB 3ZE2E 5FFLA 3R8QA 1PLGH 3O4LA 4JN2A 1ZOXA 3V5DB 1IAOA 5AZ2L 3D0LA 1JZ4A 1JNHA 3RGVD 1A64A 4MDJB 3GSOB 4JKKA 2ZZUT 5ENWB 5A2LH 1FLRL 4QHLB 2XZCL 4H0GA 3MLTA 1HHIB 4R3SB 2VZ3A 4HZLA 5JDSB 1T1ZB 2UUDK 1RJYA 4OJFL 5EN2B 4ONOA 4FQXD 4J3WA 1AR1C 4OGZA 4LP4A 3NMEA 1YPZF 3BUTA 4ONHB 4YHKL 4MDIB 4DKEH 4JLRA 4G6FB 5D72L 1UM6L 3HG1E 4U0RB 4PTUB 3SEPA 5E6YA 4I48B 4NQCE 4FFZL 2Z93A 3BKYL 1X4YA 3N85L 1FO0H 1UXWA 4IJ3B 5IFAH 3TZVB 4S1QL 4NQCD 1XMWA 1MWAH 1I3UA 4ODHL 3LKQA 3U7WL 2H1PH 4XNZC 1MFEH 4Q6IA 3TWCL 1T0PB 2CGRH 3WJLC 1NGYB 1RZIA 2VR5A 3RRQA 4L5FL 3MRRB 2LABA 1TVBB 4MCYB 1HIMH 5I8KL 4XPFL 2DLEA 4UILH 2R29H 3EYSH 2XQBL 2E9JA 5GHWH 3I75B 2VXSH 3CMGA 4BKLB 4ZTOH 2VISA 4HT1L 2GUOA 2A6JB 1Q94B 1CE6A 4R2GC 3X12B 3NAAL 4TUOA 5KVMC 4MQ7A 4OCRL 4HQQH 1XGUA 3QRGL 3HC0A 3O41B 3UCRA 2AJYL 5HPMB 3P2TA 2IGFL 4FQ2L 3NCEB 1DQTA 1SEQL 4RFOL 3ROOB 3JWDC 1ZGLA 1U2HA 2DICA 4LFHD 2G9HA 1VEMA 2NW3B 1S9YB 3QEQB 3KDMA 4PJGA 3B6SA 2DKMA 5T1DL 3GSNL 5E0QA 4YHPA 1Q1JL 2R0WL 4YIQB 3RPKA 5T3XL 1N8ZA 2ZSVB 1ITCA 2IMMA 1J10A 1Z2KA 1CZ8H 5ADOH 5DJYA 1ZHLA 2EYSB 3HNVL 4XCYB 2L7JA 4GRLC 4PJAF 1NSNH 1MCCA 2QSCH 3SDYL 3GO1H 5T3ZH 1RVFL 3EYVA 1A7BA 2CJUH 3T0EC 2Q8AL 4RIRB 3EOAB 3KXFE 3IDXL 5GXBB 5GPRA 3MLVL 4OSUH 4UV7L 5GRYA 1MCEA 5DXWA 3KXFD 3O81A 4NCC2 5IMMB 5DMGC 1F90H 3CSYA 4K2UH 4EI5D 3TJHD 1N4XH 1UKTA 2BMKA 3A67H 1CXLA 1NAKL 3LDBB 1VEPA 2Q8BH 1YEHL 5KSBB 4OQ1A 1PY4A 3GSWB 5E8EB 4N0YH 5EDXA 1RZJL 2QADD 2V17H 2HFEB 4NSKA 3BD3A 4KK5C 3GJEA 2N7BA 3IGAA 4KV5F 5A2IH 5ILTH 3TESA 1TTUA 4WO4A 2ORBL 2WMPA 4RSVA 4OFYD 3ARDB 3DECA 2VLRE 1PY9A 2ADJA 4Z7VF 2GT9B 3LHPH 2I07B 3VFMB 5KVDH 1OP5H 4OLVH 3PWJB 1KTDB 4N8VB 2VDQH 5T3XE 3QO0B 4HXAL 5D1ZC 2GFBB 4Z7OF 5BJTA 2APBA 2ATKB 5E6ZA 5L2JA 2ZUUA 3L5XH 5T3XD 2EDRA 4G80A 5FB8A 3BZFA 4PR5B 4NQEE 3RL1B 3ARRA 5KAQF 4XP9L 3GB7B 3MJ9A 3JVGC 4QF1B 4JFZL 4ZYKA 3KLDA 1RZKH 1YEEL 3I6KB 4YBQC 1P84K 3EJZC 4FMFA 3P4NA 1PD6A 1J1PL 3FO1A 5CBAB 4YXHH 2ESVB 5IB4B 3DNKA 2IBGA 1QFWH 1AR1D 4UTAL 4D0CB 1AHWB 4KZEH 4X7DC 5EIIA 4L9LB 5I75B 3IETA 2V2TB 1RPQA 1FGVL 2UZXB 4NN6C 3OHXB 1JPSH 3WMSA 4TTDC 4M1GL 5J1AA 4L8DB 6FABH 3M8OL 2Z4QB 1NEZB 4OCXL 1G9NL 2DL9A 4ZFFA 1S7TB 3TV3L 4P5TD 3CK0L 1C5DA 1QHOA 3P9MB 3RWJA 3LH2H 1ZT1A 4GKSB 2XRAH 4PG2C 1N5AB 2F19H 4QXWA 1OM3L 1OAQL 1U8PA 1CS6A 4DCQB 3UC0L 5LJYH 3CXHJ 3PE9A 4L3EA 3KPQA 1HNGA 5DT1L 2EDLA 4PJIB 3TT1H 3MRNA 2VZ1A 3ILQC 4Z78B 1FZJA 3ESUF 3O45B 1MPAH 4XNUH 5HSFA 4XMKL 4PTTB 1XGQA 2BVOA 2XWBA 1B2WH 1GZQA 3V0WH 3DSFL 4Z7QF 1FAKT 4H0IA 5DWUH 1FVCA 1YJDH 2NMSA 1RZKC 2OSLB 3MV8A 4Q6YA 4NRYB 2VITA 4CKVX 4LLMA 2A73A 2AI0H 2VDNL 2DQTH 3D85B 2W92A 1ZHNB 3KG5A 3GMQB 4EQ2A 3WKMH 3WSQH 3MBED 2BVQB 5HHMB 1DBBL 4DZBB 1UB5B 2F9BT 2R1WB 2DIBA 4EDWH 3WDIA 3F7YB 2CH8A 2A77L 4YC2C 4WI6A 4E42A 4JFXA 3PDOA 4ZTPH 3SKNB 2DM3A 3VFVA 1HH6A 3E6FB 3OV6A 1I4FB 3HE6A 4UAOB 4Y4FA 1NJ9B 4AZ8A 4LSSH 1FBIL 2DQGL 1H3TA 4LSDA 1XF2A 1I1CA 2Q7YB 2D7TH 1EEQA 1U41A 4EBQL 1M6OA 1D9KC 4ZUWA 4HCRA 1UQSB 2VL5A 5IIEB 3WXVH 1AGBA 3T0ED 4X4XB 5C0CA 3VCLA 3MO1A 1C5BL 4K9EL 4XI5C 3UPCA 1J1OH 5L88H 1RJCA 1GGCH 4I3SL 4N8CL 5FUZL 3DVFA 5J6HB 5BQ7A 4NQVB 4L4TB 4N5UA 7FABL 1A4JB 3O3UN 1ZGLM 5BV7B 3TNMA 3BMVA 1FRGH 1HQRB 3HPJB 3TVMA 2R4SL 5CIPA 1F42A 3TBVB 2QQKL 2F53B 1UVQB 1U8MA 3NACH 1QEWA 2HFFB 2CKBL 1V05A 1GGTA 1KNOA 3MOQA 4YHZH 3QJHB 3IYLW 4F7CA 2Z35A 2GK0A 4HIJB 1CTNA 5E5MA 2MPAH 2ZOLA 1CDYA 5ICZB 4P4KA 3CFJA 1R5VB 1UG9A 5LGHH 3HG1B 5CGMA 1CFTB 3H2WA 5J13B 4K3JL 3W11C 4AEIL 3T77A 3DXAA 1OTTD 3LN4B 2NY6D 2X9WA 1RUAH 5DGRA 1I3GH 1NKOA 1YEGH 5DLMH 3WFHB 3BHBA 3RFZC 5F9JB 2DQDL 3BP5A 4KHTH 2VXVH 3IJYA 3PG2A 3VWJC 1ZT4A 3VGEA 4LSUL 1S7SB 1ZLSL 1EAJA 5CJOL 1D5BA 1EV2E 1X5ZA 3HNSH 1YPZE 1AQDB 3MRJB 4QOKE 5J11C 2B20A 3EO9L 3HN3A 3PNWA 1FCCA 4YNYB 5CEXB 4JG0H 4JB9H 4J7RA 5E8NA 4AM0A 1YY8B 2YD4A 5DF0A 2IEPA 5I0ZA 5C0DA 3PHOB 1HHHA 3BOVA 5HVWA 2VSDA 1KJ2B 4WFGD 2P8PA 3GI8H 1F6FB 2ZCHH 1X5GA 2NR6C 3OR7B 1X5AA 2DQUH 4XBEL 1DSFH 4FZ8L 3MA7A 4HJJL 4ISVA 2GJ6E 1Y0LB 1IEAB 1N0XL 5DK0A 4HUVB 4NOFA 4MD4B 1G7LA 1CICC 1QG3A 2GJ6D 2J3SA 4PJ8A 3W9DA 3TJEH 4HK0A 2X4SB 4GRWE 1HE7A 3S96A 1ZLVK 3W9EB 3O6MH 5DURD 5F1IB 2OL3B 2PR4L 1XH3A 2JF1A 3DPBA 5I66B 5DRXA 1CF8H 1PEWA 1EFXD 2EZ0D 3MOBH 1FG2A 2EDTA 2BK8A 3Q1SH 4TRPH 4PGCA 1JP5A 4U33A 1X6NA 3GI9H 3T04D 3MGTB 4M7LH 4BM7A 3BEVB 3RI5F 2X41A 5GRJL 5E8DL 1QSED 5EU4B 2VABB 1F13A 4UINH 5IV2A 3U30C 5JW4M 5E8PB 3RDTA 4LARH 3I2CH 4G6ML 4PJFE 2UWEA 4U1NB 5HDOA 1SY6L 2VLKA 2Q87A 4PUBL 3CXHK 5F96L 3VFOB 5D6DA 3BAEL 2YD5A 4U1GB 3FQWB 1OVZA 1KTRL 5IB2B 5JR1L 1NBVL 1JV5B 5FV1L 3KNBA 1DVFC 4JRYE 3IVKA 1IL1A 2DD8H 2IANA 1LDSA 2VLRB 3P9LA 4JRYD 1T1WA 1C12A 1H3VA 4ZS6D 3WYRA 5D1XD 2WWKT 1WZKA 3UDWC 4HKXA 4ELKB 1NFDA 4X6CB 4YHIB 4ZNEA 3C6LD 2GSGB 4MAUL 1AKJB 1U3HC 5AYQA 4NZTL 3OKYA 2WBJB 4NO5B 4NQEB 3GSUA 1I8MB 3DX8B 4B41A 4M3JA 1BGXH 3PWNB 1KTLB 1E4WH 4OLWL 4ODTH 3FFDB 4KUCD 2ERJC 3WS6C 4P2QE 3DURA 2ATPA 1EGJH 3BZEA 4YHLL 4YZFE 1QNZH 3RIFK 1A7NL 3CVHL 4OFKA 5I1IH 2OR7A 4HIEB 4HUMB 1FE8H 1S7WA 4K71C 4F37K 4WHYH 5DD5H 4HJ0C 3RNKA 1KPVA 5C08A 5J12B 4GXUN 4JKPH 3W11D 3OSKA 1K85A 4LEXL 4N9GB 4OZFB 2XI9A 4P2OB 5EB9A 3SY0A 3WE6B 5HGAB 2Z8WC 1QFHA 4HFWA 2YD6A 1WZLA 1BVZA 2YKLL 1U8OA 3LKOA 1FFOA 2XPGB 4YK4B 5EO1B 1HCVA 2CMRH 3WNLA 2VXUH 4MZ3A 4Z76A 4P9ML 5HHVL 1YYLL 4TOYL 4CVXA 3HS0B 5GRXG 2AJUH 4KK8D 2X89A 1MF2H 2LAGB 3L3KB 1WTLA 4P4RB 1JPGB 2ZCKL 4NJ9H 1TPXB 4MLSA 1XGPB 4I9WE 3EJJX 3QQ9C 4WDIA 4WEUD 3DGGB 4PV9B 3VG9B 3ZDXE 4IJ3C 5HHOB 1U8JB 2ID5A 4K8RC 4UU9B 3TZVC 4AIZB 1KB5H 3FHQA 1BFSA 1T3FA 2BOBB 2Z91B 3VRJB 5HYQB 2YEZB 4NRXB 3EYUH 3PV7A 3B43A 1IGML 1FGNH 1ZV5A 2NR6D 3ZZ1A 4GH7B 3BP4A 3UJJH 1GC1H 4EN3B 4MXWL 4RISL 1FJ1B 2WAHA 5I8EB 5IMKB 3Q6FA 4OLEA 2UZYB 3S3PA 5E6IB 2BSTB 5T1MB 3WDHA 5E70A 4U2YA 2PCPA 5BZWA 3HUJE 5F9OL 4I4WA 2OTUB 1LEIA 1I75A 2H26A 3QEUB 2VQ1A 4L4VA 3RI5K 2HLFC 4LRIA 4NKOB 2HAZA 2LQRA 3M45A 4H8WH 1A1MB 4HC1H 4KMQA 2CLZA 5KSVB 5ICXA 5TGBB 4PJDF 3IFLH 3PHQA 1YNTB 1ZSDA 3QUZA 4H25B 5SWSE 4W6YB 4UQ3B 5AG8A 3QB7C 5SWSD 1QFUL 3QCTH 4KJWC 3V79C 3QCVH 2N7AA 5ESVB 5JTWA 2Y07L 1LE9A 3QQNA 4RBPH 1P9MC 5HHPA 3C8KB 4C56B 2GEEA 4KKAD 1CFVH 2EH7H 1ONQB 4MSWB 3I9GH 3T09A 5JMOC 1KCKA 1ED3A 3BIKB 1JRHL 1ES0A 4MXVE 4OT1L 2F54A 4O9HL 3P4OA 4U1LB 1FNGB 3VXSB 1WWAX 5CKAA 4U49A 3EYQC 4Z7UB 3ZTNH 3D39D 1OPGL 4WI5A 4U6VL 4X5WA 2V2XB 4N1EA 5ACZB 1P4IH 4LIQL 3LZFH 2A6IA 3KPRA 1VEOA 4WTZA 1DQDH 4LLQB 2E3VA 1KIPB 5GRVL 2GI7A 4YXLH 1DQJA 4NWTH 32C2A 4HPOH 4IM8A 4WCYH 2WWMD 2IPTL 4X6FB 4OCSH 5SWQB 2DBJA 4FTVE 5GZND 3DUHA 3RVTD 2XG4A 1ZA6B 3KS0H 5C0BE 1TTFA 5D6CA 3EO1B 2YD2A 3OZ9H 4RMWA 4I2XA 1SJHA 2W65A 3UTZA 2XN9A 4NQXB 5C0BD 1Q9LB 4HPYH 3A6CH 4WWKB 3QHZH 3EYFA 2APFA 2ZP0T 5A3IC 2EE9A 4PRDB 3G6DH 2GSIB 3X3GL 5T5NG 1Q0YL 1FYTB 1U8HA 3WO4B 4D8PB 3BP7A 4MAYB 4WEMB 1JHTA 4QOKB 3SJVE 1IM3B 5FEBA 4PY7A 4KHXL 3U48A 2FATH 5DS8B 3CDYA 4QXTB 3SJVD 2CR3A 4W70A 4R8WL 5HD8C 1WIUA 3VH8G 3WLBA 1JE6A 4M5ZH 3T1FA 4N0UE 4DVBA 5HI5D 4LIQE 1J8KA 3CFBB 1N2RA 5FO9A 4P2YA 5FA3B 4LDEB 5FCSH 3QXDA 3RHWF 1JK8A 5GRUH 1F8TH 4FQXA 4S1RH 3RVXC 1AGEB 1HDMB 4UMGA 3UYRL 4QWWC 1BJMA 1UJ3B 1AHWC 4M9OA 3OX8B 2C4FU 4WUKL 1JNLL 5EOCH 4EIGB 4GAYA 4L9LC 5I75C 2AJZB 3HNTL 4NNPH 3X17A 5I30L 3L7EA 2DQIL 5EU5B 3U46B 2A9ML 3U9UA 5E2TH 3VXRD 1INQA 4U1HB 2AEWA 3DV4B 3AU1A 3MLSL 4G6KL 4NUJB 4Z9KB 3OB0K 1D3CA 1HK6A 4PS4H 3NN8B 1FNEB 3U1SL 5A2FA 2IBZX 2P8LA 1FFPB 4KQ4L 5DDHA 1VGKB 4LCWE 3ULVF 4UNUA 2DI7A 2EYTA 4M6NL 4ZAKD 5GGTL 4JFFB 4ZDHA 1K2DA 2JIXB 3TH3T 3DSNA 2Y25A 4LCWD 5KVFH 1BFOA 3NFPB 4YEFA 3W0WA 5LQBH 1C08A 1T0NA 4PJ9B 5I0DA 1UWXH 2HN7A 5JXAH 5DZLA 1F45A 1XF4B 3QNZA 3OKDA 4PLJC 1LO3L 4H88H 2J4WH 3O3AA 1T7XA 4UQ2A 5E95B 2D0FA 3IKKA 1J05A 4V2CB 4AMKH 4OIAA 4QRPB 4JR9L 4YEEA 2AABL 35C8L 5BRZA 2HVKA 4KKCD 3RY5A 4WEBH 1XAUA 2AAVA 2E7HA 4I5BB 3DX7A 2YRZA 4DVRL 2BY3A 1T2JA 3RWFB 3PJSA 2BNQE 1V8HA 3LRSB 4Y2DA 2XV6B 4B50A 2A74B 3E8UL 2BNQD 3RUGA 3SDAD 2DTML 4JG1L 4ZUSB 4UAOC 3WEXA 1CD1A 1KLGA 2E9BA 2YD1A 1MVUB 5DEFB 1G7HA 3C8HA 5TQ2L 4IOFD 1NCCL 4OCYH 1UZ8A 1K8DA 2Z31A 4W4OA 3S36X 2IPUG 2FBJH 3EYQD 4FXGA 5DEGB 5GGSA 4RFEA 3RX5A 4P2QB 4MGXA 2CLRB 3LKRA 1QSFB 1XR9A 4KRPB 3RNQB 4F7EA 4ZUUB 4PJ7A 5C2UB 3MCG1 3QZWA 1M05B 1G7IA 5IBLD 5ERWA 5AZ2H 4YHOL 2MFNA 1VACA 4UOW1 3IFPB 4OZHB 3CH1B 1XF5A 1PG7L 4QGTA 3SGKA 5EBWA 1KXVC 3QUMB 4EUPG 5BV7C 4AH2A 4J2XA 1FL6A 5I1AB 3HC3L 5C3TA 1XGTB 3LKSA 1Z0MA 1S5IL 2XZCH 3JV5A 3VGHA 4XHJC 2XZQL 1ITBB 2WIIA 1T2XA 1UWGL 2BY2A 4OJFH 1B4JL 3RWGB 3QSKB 3SKOB 4YHKH 1CDHA 2FLRT 3L7FA 3NPZB 4IRJD 4D2NA 1IQWH 1S7RB 5D72H 1UM6H 4BFGA 5HVFB 3RHWK 3T1WA 1LGVA 3KYNA 5EUKB 3TIEB 4FFZH 2Q20A 3BKYH 2X44D 4H26B 3N85H 3QPXL 1WBZA 5D2LE 4BSWA 4OIIL 5C71A 2PYFA 4S1QH 4OZGA 3H9SA 3QIUD 5DD1L 4XPGL 4ODHH 3ZT5A 3OF6D 3U7WH 3MRLA 4L29B 1MUJA 2V5YA 4OUUB 4LAQL 4Q58C 3NZ8B 4OD2A 3TWCH 5BXFA 3O2VL 4M4RA 5ITFB 3SQOL 4L5FH 3MRKA 2WLZA 3H0TA 2HA1A 1AGDA 5A2KH 5I8KH 4XPFH 5JXEC 4J1UA 4WRLA 4WJ5A 4GBXB 3IDNA 3IAPA 1EAPB 1YY9C 2XQBH 4XGZA 4F7MB 3O3EB 4QWWD 3MLXL 1OY3B 3NVQA 4WHTB 1A2YA 1EHLL 4HFUL 5IB1A 3OJDB 3U7YL 4F8QA 5DK2B 5F1SA 1LO0L 4NNYB 3NAAH 2H8PA 3HUJB 3V6OE 1KPRB 4OCRH 1NBZB 5C09B 1DQLL 2AJYH 3QNYA 3MGOB 3BWAB 3MYZA 3WLWD 2IGFH 3WJLA 3VH8B 4FQ2H 3MV9E 2C7UA 1SEQH 1NDGA 4RFOH 5DUPL 1WAAA 2VRAA 5B38G 3MV9D 5C07A 3VG0L 2GYSA 1DLHA 1H8OA 2EDKA 2NNAA 5T1DH 4PJCE 3GSNH 1YMME 4PREB 1IM9A 1S5HB 1Q1JH 2R0WH 5F1NA 5T3XH 1YMMD 1EPFA 4HUNB 3TBWA 3VXUA 1BOGB 3HNVH 3CCHA 3DYPA 3GSXA 4IMLB 4X4YB 3U83A 1NAMA 3LEXA 2E8YA 5KSAD 3JTTB 3SDYH 1RVFH 2O5XL 4DTGL 4MMXC 5EZLA 1QUNA 4JY6B 3VGAB 3ARGB 2Q8AH 4BH8A 4HWZB 4K7FB 3IDXH 5JORB 4QRSA 2DLGA 4PJDE 3MLVH 4UV7H 3UXFA 2D3VA 3X14B 1OAYL 1X44A 3S8WA 1BBJB 5EG6C 1LNUA 5E94A 3X13B 2PW1B 3TO4B 3RVVC 2VAJA 1MAML 5DJ2A 3ISWA 2BJML 3TO2A 1YEHH 3NABL 5DQJA 4EIZC 5CP7B 1AD9A 1GVIA 5HDBF 2M2DA 5F89B 1C5CL 4TNWF 1MWAA 4DW2L 4GRLA 5HY9B 1RZJH 5GISL 1EXUB 5IR1A 3SHSA 4FTVB 1ULVA 5DRWB 3GHBL 3VFWB 4Y16D 4Z7UF 4I18B 1RZFL 2ORBH 3VFUA 5E5UB 2HTLD 2UV3A 4HS3A 5TH2A 3GSQB 5DYOA 3SDDD 4S1SL 5IF0B 2BOCA 3K4DA 5TQ0L 4R0LC 1MJUL 3O8XB 4WUUA 1J88A 4MX7A 3MNZA 4HXAH 5ISZB 3IXTA 2AJ3B 3ARVA 4GKNA 4XBPA 5IJKA 2EDFA 2FYYB 2QEJA 4Y4KD 1S7UA 5K9KA 4V1DA 4KJQD 4XP9H 1LEKA 3N9GL 3Q3GA 4JFZH 3HLAB 1FYHB 5D7JB 1FVEB 1YEEH 2LU4A 3Q5YA 4QHNB 2WBJC 1VCAA 4LSVL 4JO3L 3UAJD 3UX9B 1J1PH 5F3HA 3BQUB 3D5OF 1MH5B 4F7PA 5C6TL 1A5FL 4G9FD 1RHFA 4UTAH 2A0LC 2W9EL 4X6DF 3KYKL 2HG5A 3BO8B 2QL1A 3STBA 5HDQL 3QG6A 4ODUB 1FGVH 5D1ZA 3DBXA 3L3IA 1A6TB 4PJHA 4GOSA 3FTGA 5GS2H 3VMPA 4WW2F 3FT4A 3FJTA 4M1GH 5DHVA 3M8OH 1CFBA 3ULVL 5KVEL 4OCXH 1G9NH 2B0SL 3WS3B 4M6MH 3TV3H 5J12C 3CK0H 2X1XR 3JVGA 2P8MA 3RWCB 4QHUB 1NCWL 2R4RL 5FO7B 3HZYB 1OAQH 4P2OC 4H1LG 4UDTA 4XPHL 2H2SD 1OM3H 3QCUL 3S37X 1GRWA 3UC0H 3DHMA 5DT1H 5CCKL 3BN9C 1A6UL 4CVUA 3FO9A 4AENA 5DJAB 4YK4C 3UMTA 4NDMB 2LV4A 1QSVA 3OXSA 2FO4B 3JV4B 1JGDA 3U4AA 4PGEB 4XMKH 4CN6A 1GPOL 4WGVB 4QHKJ 1S78D 4TUKL 4DZ8B 3DSFH 5F6IB 3VXPA 5SWZA 5KZCD 1TPXC 1X6LA 4ZFOL 3WL9B 5JOFA 3VG9C 4K3DL 4OZIE 2VDNH 2W60A 1T6WA 3BW9A 2DN7A 4PG2A 4NFBA 4YGVB 4D0BA 3PDDA 1CLYL 1ODAA 4YHYC 4U6XA 2Y4SA 3NOIA 1DBBH 2M8XA 5EPMB 4JFHE 2I9LA 3O9WB 1Y6KR 2A77H 4GRMA 3QI9D 3KPSB 3DROA 1KUMA 3ULVE 4EN3C 4G7VL 5CP3H 4OD3L 4JFHD 4YDJA 3CFDA 5B39A 1LP9B 2X4QB 3WIHA 1PYWB 1B3JA 3ULVD 5CILH 1FBIH 1UEMA 2DQGH 1H3XA 1JL8A 1TVHB 3KJ4B 3RP1A 1JF1A 1NANH 4X9FA 4EBQH 1H5BA 5E1HB 3UTSE 5E4EC 4LPVA 4JFYA 4KMLB 3CC5B 3SE4C 1HKLL 2AEIT 3UTSD 1ZHKA 4TNWK 1F11A 1C5BH 4K9EH 2ADFL 2E5EA 3DI3B 3SGEH 2VO5A 4LSPL 3RTQB 5B38B 4I3SH 2EXYC 1FL5B 4KMTL 4N8CH 1J0YA 1CXIA 1NPUA 5FUZH 4XBGB 1Z3GL 1IT9L 1OGTB 3RVVD 1UACL 7FABH 4V2BA 4OBSA 3FB5A 1XF1A 2X7LA 2HKHL 5JPMB 2R4SH 5GJSL 4JHZA 4L1HA 4RA3A 4DK6A 2R69L 1NCTA 3L3HA 2QQKH 4C57C 1KJMB 1D9KA 1GZPB 1QQDB 3EJYC 1CFSA 5C9JB 4PJAA 1AGFB 1P7KB 3VFPB 1KELL 2CDGA 1OGAB 1T20B 4AEFA 1E4XL 4GMSL 5DZOA 3DVGA 3OJMB 4GG8A 3QA3A 3ILPA 3QDGA 3SDXE 2Z8RA 5IKCA 2NW2B 4D94A 1Z0NA 4K3JH 4AEIH 3VXMB 1NCNA 1S9VA 1E27A 3D25A 1ZVYA 4NCC1 5IQ7L 5EULV 4JFEB 5F7UA 3HI5L 2FX9L 3TP4A 4FOMA 3G6AA 4EVNA 3EZJB 2DQDH 5IQ9B 1JZ8A 4GRWH 5IROC 1ADQL 4LSUH 3MLWL 3DUSB 5CJOH 4IRZH 1D5XB 2VKWA 2HJLA 2C1OA 4GW1A 5H8DA 2J8UB 4MJ5B 1A1NA 3G5XB 7CGTA 3MUGA 1J86A 5EO0A 1BMGA 3EO9H 2CIIB 3WO4C 1JPFB 1WT5C 4MAYC 4RGOL 2HJKA 3HI1A 2MQ3A 1SM3L 1NC2B 4CJ1A 1WISA 5FYKL 4WW2C 2UYLB 3UYOD 1MCSA 4X0KA 3TN0B 4AT6B 3MV7B 2X09A 3V7AG 2EC9T 1XFPA 2FR4B 2UY7A 2ARJB 3PQYA 1JUFA 2NZIA 4XBEH 5F44A 3VWJA 2X4RA 1KBGL 3FQTA 5LBSL 1VFBB 4RWHA 3OGCB 4FZ8H 1F6AA 5BVJA 5T5NF 4HJJH 3E0GA 4KJYA 4MNQE 4NC1C 3BVNA 1CIDA 4NO2A 5D7IF 5HTSA 1N0XH 2A6DA 1ZA3A 4KKBC 4RA0C 4PJCB 4MNQD 1JN6B 1UJ3C 5FKAB 3B3IA 2DYPB 3N1FC 4Q9BA 2FWOB 1X7QB 2R39A 1G9MC 5IG7A 4Q9CA 3U36B 2EIEA 5TDOB 1NCBL 5CJXC 5AYUL 2PR4H 4OI8A 2VIRB 3LPWA 5HHOD 1S9XB 3QDHA 3TA3C 1JNNL 4JRXE 1OT2A 1EO7A 4PJBF 1KJVA 4H1LB 4C58B 3VD9A 1W0WA 5FOBB 4JRXD 4U1SB 3H8NA 1J0ZA 3LKPA 2P7TA 4FQIL 3RBGA 1MREL 3I3DA 3OXRA 1U8NB 3F7PC 3GM0A 1U8KB 5FYKE 4J3SA 5GRJH 5E8DH 2GITB 3O3BB 5TDPA 1T0MA 3OG4B 4G6MH 4ONFL 1A3QA 1AXSB 5FYJD 5FYKD 1CICA 1SY6H 3BEWA 3EDEA 4R7DA 4PJ9C 3BMWA 4K7PL 4PUBH 1LK3L 5F96H 3BAEH 4N8PA 4RAUA 2AXGB 3C5JB 3SE3C 5JR1H 1NBVH 3E3QC 4ZMAT 1V5JA 4RGNE 4Z7WB 2HT4D 4M43L 3JBG7 2AV7A 3MROA 4N5EC 3NCJL 3ZDYF 1Q9KB 3GMMB 5EFIA 3C8DA 1RJLA 2VLJA 1FFNB 4ZPTB 3S35L 1GCFA 1OP9A 5E00B 4MAUH 4PJXB 5H94A 4C4KO 4NZTH 5IVOA 1WWCA 4XNMA 3QO1B 3MYJB 3KWWB 1A6AB 2C3WA 4W6XB 2NX5D 3KAAA 1CLCA 4LF3A 4M93B 3LSOB 3CDCA 3PWUA 1T7VA 2VB5A 1J8HD 4OLWH 3UYPA 3V9FA 4PGDB 3GUTA 2UVFA 5HI3D 2O5ZL 4ACPA 2C4XA 5TFSL 1DVFA 4YO0A 3V52L 1DDHB 2H2PC 2W0FA 5DRNB 3TCLA 4YHLH 4ZFGL 5HPOA 3D39A 4OQTL 3Q48A 1A7NH 3CVHH 2EDOA 5D2NB 4KRPC 4XMPL 3UDWA 3DUUA 5D7KE 3R8BB 4UT9L 1U3HA 5LVEA 3RWDA 2GJJA 5IHBA 1QFWM 1RULL 1SYSB 4MJ2A 1IQDA 1PX3A 1INDL 4P3CL 4ELME 3HHRB 3HZVA 3L6FB 3BZ4A 3AAZB 3C09C 3ZE1F 3G6JA 2YKLH 2AK4A 2YPLD 2ZUWA 3WS6A 5ETUA 4KZDL 4P9MH 5HHVH 1YYLH 4TOYH 5C0IB 4X6DE 4D9LL 5DQ9A 3FQUB 2FSEB 2CDEB 5IMLA 4JZNA 2UZIL 2ZCKH 1NC4D 2VH5L 5C0AE 3V0VA 4M7KL 5EBMB 2ED8A 5HYJB 2MKWA 9CGTA 2FECI 3V5DA 3MRNB 5FYKU 1S9WB 2LU3A 4JGUA 4XCEB 5ID1B 1IGMH 4MDJA 3GSOA 4DFHA 1LO5B 5DHYB 4YR6B 5ENWA 4EKXA 4GG6E 5KBNC 5FUCC 4QHLA 2FH8A 4ZS7L 3WHXB 4F9PC 4EEEA 2FJHB 2YBRB 1WIOA 4R7NB 3D3VE 4MXWH 1HHIA 1IGCL 4RISH 1BVLB 4R3SA 5JDSA 1T1ZA 4RX4A 2QQLL 5EN2A 1W72L 4ZSOB 3BP6B 4GBXC 3G9AB 1EUTA 4ONHA 4MDIA 5CZXD 5C2BL 1F2XK 5F9OH 1SMAA 4PTUA 2JJSC 4I48A 2EECA 4Y19E 5JA9A 2J1KA 1JYVA 2IH1B 5FAAA 3PWPB 2VWEE 4LCCB 3TZVA 4G8GD 4Y19D 3TA3D 5HJ3B 3G5YB 4Q9RL 2VLME 4HX1B 43CAB 2K7QA 1NGYA 2J6EL 5JPNB 2B1HH 5HYFA 2J12B 1EGJA 3ZHDA 3MRRA 1TVBA 4MCYA 5D7LE 1MHPL 2PO6B 1QFUH 1A6WL 4X7TB 1T22B 3GJFB 2JIXD 2Y07H 2YC1B 3BX7C 2ICES 4HMEA 3I75A 4BKLA 4UNTA 3UP1A 1JNJA 5FHBL 1I8IB 4PP1C 4QLRA 5D5MB 2D9CA 4PJ9D 1H15B 1A3LL 1FC1A 1FCGA 2A6JA 1Q94A 2HT2C 1JRHH 4LLYB 1KIQB 1EFQA 4OT1H 1TTGA 4O9HH 4TQEL 3X11B 2HJFB 3X12A 3MJ7B 2EXWC 1T6VN 4CNIB 3O41A 4Q7DA 1DR9A 1OPGH 3VGAC 5HPMA 3ARGC 4U6VH 3Q6GL 4F7TB 5C7XH 3WNKA 1PZUB 3ROOA 2QBWA 4LIQH 1WUNT 3LS5L 2NZ9C 3ZYOA 5J3HD 1T04B 1D5MB 3PGFL 1S9YA 2NW3A 2F58L 3QEQA 4U3XA 3TO4C 2BNRE 3MUJA 1CG9B 5ICYB 2IPTH 3SDXB 1Z5LB 1P9MA 3NCCB 1FDLL 1CGVA 4YIQA 2ZSVA 1GIGL 5JQ6L 1ZMYA 4LQFH 5L8KB 1F3JB 4XCYA 2EYSA 2QV2A 1DTUA 1PQZB 2HFGL 1N6VA 4TVPD 4I18C 1ZLWH 4WHCA 1A6VL 2H2PD 1E6OL 4LHQB 5EU6D 5HI4C 3X3GH 2IPUK 1Q0YH 3EOAA 3O8XC 1I7UB 4YXKL 1QR1B 2BVPB 4X98B 5IMMA 4KHXH 2EO9A 5EO9B 43C9B 3LVEA 4KVNL 2YA2A 4R8WH 5KSBA 1CD9B 5F7LB 1K8IB 4HC1A 5D7JC 3GSWA 1QACA 1FVDB 5E8EA 5GS1C 3RIAF 4E9LA 4ZXBD 2HFEA 3BQUC 3UTTE 2YZ8A 2I9TB 3UJIL 4LCIL 4OLYL 3ARDA 4JJ5B 3UYRH 3HAEG 2GT9A 2I07A 3VFMA 4BZ1H 4K94C 5C0EB 3PWJA 2DJ4A 4WUKH 1JNLH 1KTDA 3AM8C 3NGBB 2D9QB 1FN4B 1O7VA 4N8VA 3QO0A 2GFBA 3HNTH 3MJGX 4YFLI 2ATKA 5I30H 5ANME 2DQIH 1VPOL 3GIVB 2A9MH 4PR5A 3RL1A 3MRBB 4CU7A 3GB7A 1BD2E 3MLSH 4G6KH 1QRND 4QF1A 3ARBB 3I6KA 3FONB 3U1SH 1BD2D 4PY8I 2VNCA 4JGMA 3O0RL 4KQ4H 5CBAA 3ARFB 3HI6L 2ESVA 3LV3B 2X2YA 5IB4A 1TQBB 4M6NH 5GS0L 5GGTH 5D7SH 3ZSSA 4GBXD 3RVWD 4G7YL 1CR9L 4D0CA 2NXYD 1AHWA 3QFJE 5GJTL 5D7IE 5ESAB 3HA0A 4CAGA 4L9LA 1G6RL 2V2TA 4OGXL 5FECB 1LO3H 4PJGF 3QFJD 3OHXA 4LK4A 5F6IC 2HYMA 2C3XA 2OBGA 1OAUL 4L8DA 1YN6B 5I8CB 4Y4HD 2AXHA 2Z4QA 4WTZG 1NEZA 3ORJA 5IM7B 1QKZL 4JR9H 4I3RL 1S7TA 4E41B 1AH1A 3P9MA 2AABH 35C8H 1EBAA 5FYLL 4GKSA 1N5AA 4RGNB 2MCG1 4PJBE 4M1CC 4DVRH 4D3CL 4DCQA 3WDJA 2KKQA 3O9WC 4PJIA 2DLTA 1GGYA 5CLTA 1CE1L 2YRPA 3E8UH 4Z78A 2DTMH 4JG1H 5F88B 3O45A 1F5WA 2GTZB 4NRZB 4PTTA 4KVCL 2X9YA 2HT2D 5TQ2H 3KJ4C 4XT1C 1NCCH 4GW5B 2IAMB 1XGRB 2ZKHL 2OSLA 5IUSA 4NRYA 1PSKL 3DO7B 3AB0B 4ORGB 3D85A 4J6RL 4LVNB 5C1MB 4NWUL 2MQCA 1ZHNA 3GMQA 3K8LA 3F12B 3Q5OA 4PJXF 3CLFL 3WV0A 2BVQA 3BWUC 1N59B 2NZ9D 3S34L 1DJSA 3DLQR 4DZBA 1UB5A 3RTQC 3T8XB 4OLUL 2R1WA 3F7YA 4YHOH 4OCWL 3D9AL 3HB3C 3SKNA 4OAWB 4UT6L 1PG7H 3E6FA 4W6WB 1I4FA 1ZANL 4N0RA 1NJ9A 4M5YL 3QUYD 5FYLE 1DN0B 1NUFA 3HC3H 1MELA 1V7ML 4NO3B 1S5IH 2XZQH 3FCTB 5FYLD 4OGYL 2Q7YA 4ELMB 1A9BB 1F02I 1UWGH 4NPYB 3TYGL 3VI3F 1B4JH 5TE4L 3KPNB 3S6CA 1UQSA 4YBLB 2RFXB 5I9QB 4HKBB 5IIEA 5GZOD 2HMIC 4X4XA 2V7HB 3RIAK 1WFOA 3RZCD 3EZ8A 1I3VA 2FL5B 1KPUB 3V4VL 4GKOA 3NH7L 4Y8AA 3MC0A 1HYSC 3QPXH 2XXCB 1OD7A 1YZZA 4JPVL 4OIIH 2G5BB 3OR6B 3WHE0 5J6HA 4C4KT 5AD0B 3BUYB 4NQVA 5DD1H 2DBLL 4L4TA 4XPGH 5C0AB 3C08L 1TENA 4MXQD 1A4JA 4LAQH 3O2VH 1IGTB 1BJ8A 1HQRA 1RK1B 3HPJA 4AG4L 4B7IA 3SQOH 2EDJA 1C8PA 1EHNA 1RI8A 1ZTXL 3FFCD 1I9RL 4PYGA 2ZOKB 1K6QL 3TBVA 3OB0H 1QHPA 2F53A 1UVQA 1A14L 4X5LA 2HFFA 2NQCA 3AREB 5DVLA 2V2WB 3MLXH 4K55A 3D3VB 5I16B 3T2PA 3QJHA 1EHLH 4HFUH 2QR0B 3U7YH 1WEJL 3K46A 4HIJA 2BC4B 4DJMA 4ZPVB 5INCB 5K9QI 5ICZA 1R5VA 5DEZA 4ZUTB 1OAZL 1WGOA 3HG1A 4JCLA 3LPGA 1CFTA 1DQLH 2XKUA 2A83B 3CZFB 2ARWA 3LN4A 3EOBB 4QRRB 3PGDB 3TN0C 3DX9B 3V6OC 1R0AL 5DUPH 3WFHA 5F9JA 3VG0H 3V7MA 5JXEA 5DJ0B 3T0BA 1I8LA 3BGMB 1S7SA 1CI5A 2JKXA 2A1WL 5GGSY 2H9GB 4ZD3L 5D7LB 3HAEB 5T1LD 3I84A 4RWYL 3BKJL 1AQDA 3MRJA 4KRLB 4P2RB 3TBTB 2IBBA 4HS8L 4Z7NF 5LAXB 5IEHB 5IW6B 3SDCB 4YNYA 5CEXA 1YNLL 1YY8A 2O5XH 4DTGH 1T66C 3I85A 3QZWG 4XPTL 5E2WL 3L5IA 4J8RB 1XGYH 3PHOA 1MNUL 1CDJA 5HBBA 1TNMA 5E99L 3P77B 5E2JA 5MEQB 3B9DA 4KQ3L 4D9QE 1KJ2A 5BS0E 5GGUB 4JQVC 1OAYH 3OR7A 4D9QD 4LSRL 1JPST 4KK6C 5BS0D 1NGZB 5DMIH 1YEDB 1MAMH 3F5WB 3PF2A 3PP3K 5D5MF 2BJMH 2JB6B 4OFPA 3NABH 1Y0LA 1AO7B 1C5CH 1IEAA 3CXDL 3HZMB 2DQEL 4XP6L 2HRLA 4HUVA 1SBSL 3S5LB 4MD4A 4DW2H 1GHFL 4DKFL 4NQTA 3U0TB 2X4SA 3GHBH 1MJJB 4M6AA 4HF5L 1KXQE 1RZFH 3W9EA 4OB5L 5F1IA 2OL3A 4NQDB 4S1SH 5I66A 5TQ0H 1MJUH 3CD4A 4U31A 3UPRB 4MQXD 2KQNA 5K9QG 2KZWA 3RTQD 2X1QA 4PJEE 5I17B 3MGTA 5CINL 3HB3D 3QIWD 4NKMB 3BEVA 5F7NC 1GOHA 3N9GH 3RX8A 1F58H 2VABA 5EU4A 4HMCA 5IBTL 5D71H 1NMAL 5E8PA 4LSVH 4QHMB 5DD0L 4U1NA 5JIIA 1BLNB 4YE4L 4M93C 3VFOA 3QBTB 3FQWA 5C6TH 1A5FH 1R5IB 3MXVL 5IB2A 3KYKH 3O4LD 4XC3L 1JV5A 3VXOB 4OLXL 2HMID 1UZ6E 5HDQH 5IFHL 4OKVB 4BQ8A 2VLRA 3MBXL 5CGYC 4JO2L 4OLZL 3LB6C 5D2NC 2OLDA 4M8VA 1MOEA 4ELKA 3FAWA 4X6CA 5KVEH 2B0SH 4YHIA 1MHEB 2GSGA 2QSTA 1AKJA 1FAIL 4JQXC 4KI1A 3T2NL 3D6GA 3SBWC 1NLBL 5I1HL 1MCLA 1NCWH 2WBJA 3DO3A 4NO5A 4XPHH 4NQEA 1I8MA 3DX8A 3QCUH 2DDQL 3MODL 1KB9J 2AJVL 3PWNA 2WBWB 5CCKH 2AQ2A 1A6UH 1KTLA 1T1YB 2A9NL 3P9WB 5J1SC 4JN1L 3FFDA 2VR9A 4O00A 2OS7A 2C5DC 4JKWA 4WI3A 2M26A 4PRIB 4OIBA 1I1AB 1GPOH 1A21A 4TUKH 5DJDB 4HIEA 2OQJB 3GJFH 3B8SA 3O11B 1QA9B 4L4JA 2E8ZA 4F9LC 1JGLL 5J89A 1F4XL 2FD6L 4Z8FL 4K3DH 4N9GA 5F6HJ 1VESA 4OZFA 1CLYH 2H3NB 1CGTA 4P2OA 4XC1H 1K3ZA 3WE6A 5HGAA 1WK0A 4RDQG 5I1GL 4OGAC 1AD0B 2XPGA 3ALWA 4G7VH 4OD3H 2Y5TB 4O02L 5EO1A 4Y5VB 5EUOB 5CD5D 1DANU 1IJ9A 4OUOA 2PTVA 4L3CB 3HS0A 4O51B 4R97B 2AP2A 2OK0L 2F5AL 3L3KA 3FRPG 3AMLA 4JPIB 4P4RA 1JPGA 5JHDB 1OD9A 4PJGE 4Z0XB 4R4FL 1XGPA 1AC0A 3QWOB 4X9GA 1T66D 5KS9B 4JFPB 3DGGA 1HKLH 4FHBD 1BFTA 4PV9A 4LCCC 5HHOA 1U8JA 4UU9A 4AIZA 5C0FB 1LO4L 2ADFH 4DGVL 2BOBA 2Z91A 5HYQA 1P4BL 3VRJA 2YEZA 4NRXA 2HVJB 1LQSR 1YQ2A 5INDB 2VXTL 5KANG 4KMTH 3RVUC 4HAFA 3ZKMC 1HWGB 5C3LD 1Z3GH 1IT9H 1UACH 1U58B 2B4CL 4EN3A 1ZWIB 3MJ9L 3JV0A 1FJ1A 4ERSL 5I8EA 5IMKA 4DN4L 1T03H 1IBGL 5E6IA 3CFKB 1NFIB 4Q2ZB 2ARJQ 2BSTA 5GJSH 5F97E 5T1MA 1GJIA 2OTUA 5CJBA 3QEUA 4XWGL 2R69H 2VZSA 3SGDH 1GAFL 4NKOA 2PW2B 5LWYL 3SE4A 5HVHB 1A1MA 1U91B 1A7RL 1OTSC 4UNVA 1KELH 3U79A 3WNMA 5KSVA 1FC2D 5TGBA 5DFTA 1E4XH 1YNTA 2E9WA 4GMSH 4H25A 3TVMC 3ECBB 2MSPA 4UQ3A 4LL9A 1EVUA 1X5XA 4TSAL 2DQFB 2OX5A 2VDRL 4WO4D 4X5XB 5ESVA 5IQ7H 1CLOL 3HI5H 2FX9H 3C8KA 4C56A 4MNGB 2V5TA 3P30L 1ONQA 3GKZA 4MSWA 3TLRA 4YPGB 1YC8A 1ADQH 3BIKA 4P4KC 2EDNA 4A6YB 3MLWH 5DVKA 3ULUF 4LHUB 4U1LA 1FNGA 2ITDB 2NY4D 3VXSA 2CKNA 2LU7A 4Z7UA 3L3GB 5J1TC 4QEGA 3AGVA 5SX4I 3VFTB 2VE6B 1DP0A 3TF7C 2V2XA 5ACZA 3LB6D 3IS0X 2DJSA 3CVIL 1KJ3L 4RGOH 3QNXB 4BK4A 1LE5B 3BDYL 3SKJL 3HR5B 2OP4L 4MJIB 1VFOA 1SM3H 4LLQA 3OTTA 1KIPA 5FYKH 1CL7L 4IBLT 2CK0L 4JCMA 5MENB 4X6FA 3FMGL 4P9HC 5BCAA 5B39G 5SWQA 4CVZB 1CGSL 4ZOAA 2DMKA 1ZA6A 1FSKC 1WC7B 2ADIB 4KROB 4LPXA 5E9DB 1KBGH 4BK5A 1UKQA 3EO1A 5LBSH 1IGYB 4ODBD 2D4DA 4NQXA 1Q9LA 5B4MC 3NIGF 4WWKA 3C5ZB 4P49A 3RWIB 3JUYA 4FNLL 4PRDA 2GSIA 3HR6A 3NGBC 1FYTA 1EEYB 3VA6A 4L3EE 1WT5A 4D8PA 4MAYA 3ZKXB 4QOKA 4HCRL 1NCBH 4OZ4B 1IM3A 5AYUH 4L3ED 1HEZB 5EZOL 5DS8A 4QXTA 2R8SL 1I85C 1R24B 2V6HA 1JNNH 5AWNL 2AS5M 1NLDL 1KCUL 2PXYB 3ARBC 5IT2L 4GUPB 1X9QA 4OGAD 3CFBA 3MV8E 4TPRL 4URTB 5FA3A 3ARFC 1KT2B 1TQBC 4LLAA 1SJVA 5EBLB 4DKAA 2P1YA 3ULSB 1AGEA 1HDMA 3DMMB 5DGQA 1WV7T 4Y5XB 1L6ZA 5JMRA 4ONFH 1UJ3A 4LPCA 5FCUL 3OX8A 5J9PB 4LMQI 2R0KL 4K7PH 2AJZA 1LK3H 4M61B 4Z7NE 1H8NA 1CD8A 4JHAL 4O2EB 5CJXA 5SV4A 5EU5A 3PDGA 3U46A 3V7AE 1DBAL 4M43H 4QT5B 4G42B 4U1HA 1QLEL 3C60B 3DV4A 3HE6D 3NCJH 2XTJE 4NUJA 1FZOB 4Y4FD 1RAMA 1FO0B 1RZGB 2EYRB 4K3GA 4TTGA 3NN8A 3RVUD 4FFVC 1FNEA 3S35H 2XTJD 1EH9A 5JW4Q 1EHAA 1FFPA 5IP4A 4N0FB 1VGKA 1G9EA 1NFKA 5K33A 2Y7QB 3WFCL 5C0CE 4JFFA 2JIXA 4M4PA 2PYEB 2VKXA 4PJEB 3QDMB 3NFPA 5C0CD 5IB5B 4PJ9A 5IHUL 2NY0D 4PRPB 3DYMA 1XF4A 5ACLA 3SE3A 4Y1AE 5IBUG 2O5ZH 1W8OA 2IAMC 1OTSD 1TQCB 5TFSH 3OAYK 5I76B 3V52H 5I2IB 4QRPA 4OQTH 4F58L 5FGCE 4LVNC 2G75B 4I5BA 4XTRD 3TVMD 4XMPH 4R4NC 2J8OA 4KKLD 4UT9H 3RWFA 4OF0A 3LRSA 1RULH 3CDGB 4WW1B 1INDH 4HLJA 3EHBC 2A74A 4B7LA 4P3CH 1Q9OB 3VI4E 4ZUSA 3DHJA 4KWUA 5CHNB 4RFNC 3WUWB 1MVUA 2OZ4L 4AL8L 1BEYL 5DEFA 3OKNB 5KW9L 2JCCB 4P4KD 3K8MA 4KZDH 3DRQB 3DXAE 5TF1L 2YUZA 3AC0A 4XP1H 4D9LH 4YBLC 3QR2A 5I9QC 5DEGA 3DXAD 4DWHA 4P2QA 2UZIH 2CLRA 3TBYB 3ULUC 4NGHL 1QSFA 2VH5H 3RNQA 1S7QB 1NCDL 4M7KH 3INUL 4ZUUA 1PFCA 4FQPA 3THML 5IVXB 5IVNA 2D7NA 1M05A 5ESQB 1J12A 4PYHA 2R0LL 3W39B 3IFPA 3LQAL 3OAZH 3CH1A 4OZHA 4XVSL 4ZFZB 5B8CB 3QUMA 2IPKB 5I1AA 1XGTA 1SEBB 4R4BB 4BFIB 4NHCL 4ZS7H 1IAIL 2AKRB 3I50L 4HK3N 1PW3A 1I1YB 1IGCH 5GRWA 1R3JB 4P0DA 2QQLH 5JW4N 5EBGA 5B4MD 3RWGA 4KKNA 1UWEL 1W72H 3SKOA 1MRCL 1FORH 3AREC 3QXWA 5HYEA 5C2BH 3PL6B 3FN0L 1M1SA 1S7RA 4M00A 4DAGL 1TMCB 4POZD 5CUSL 1F4YL 5EUKA 3TIEA 4MYWB 4H26A 4ZQKB 5JW5B 3V8CA 2BSRB 2X70B 3STZB 4MA3B 4Q9RH 1OF2B 4L29A 4OUUA 1OP3H 3NZ8A 2R2CA 4PRNB 4L8CB 4ZG1A 4PD4K 2J6EH 2JELL 4EQ3A 5ITFA 4HV8B 4Z18A 3ARBD 3QHFL 3CDFA 4F9PA 5EUOF 3V4PL 4X8JB 3NIFF 4PJ8D 1MHPH 2BCKB 3H9ZA 1A6WH 4XCFL 1QFOA 1EAPA 2YPKB 5JUEL 3WNPA 5C9KA 1UCBL 4F7MA 3O3EA 4UB0L 2EO1A 1QD0A 4WHTA 1LO2L 5DC9B 3OJDA 3EFFB 5KS9F 5DK2A 2JJSA 2V5MA 3QDJB 1RK0B 3QPQD 3WFEL 4NNYA 4JJHA 3SDCC 4TQEH 3EDKA 3HUJA 5I1CL 2ZCLL 1KPRA 5F9DC 3DETD 1NBZA 3NIDE 5C09A 1D6EB 4XVUD 5EZIL 3MGOA 3BWAA 2UWEE 3Q6GH 3VH8A 2NXZB 2VLKE 2VDLL 3IRZA 5JO5B 3IU3B 5T33L 3LS5H 3RDTD 2R9HC 4D9RE 1Q8MA 1VFMA 2VLKD 4PGZA 3VRLE 3PGFH 2F58H 1L7TH 1J7VR 2NY1D 2VDOL 1G7QB 4P2CG 4LNRB 4OI9A 2IANE 3EUUA 4PREA 1S5HA 1FDLH 1XIWB 1BX2B 1GIGH 5JQ6H 2IAND 3OL2A 4Y5YB 5GRZA 1BOGA 2ENSA 4DOHE 1NFDE 4IMLA 4X4YA 2Q76B 1UADC 1TETH 3JTTA 2F8XC 1A6VH 1A6PA 3PWLB 3UBXI 1E6OH 4JY6A 3ARGA 4LLWB 4HWZA 2Q7NA 2MTPA 4K7FA 3BPCB 5JORA 1QRKA 4YXKH 3X14A 1ZHBB 1BBJA 3SKUD 2YD7A 3X13A 2PW1A 4ALAL 3TO4A 2X05A 2EDEA 4JAMB 1L4IA 2P48B 4KVNH 3OKMB 4J3UA 1MIML 4NC2B 5HGHB 3FZUD 5CP7A 4YGAB 4ETYA 3HMWL 5F89A 3ZSTA 3KGRA 1OW0C 2OYPA 3VD5A 5HY9A 1P7QB 4NNXB 4X7FC 1EXUA 5C08E 5DJCB 4FTVA 1MCKA 3NCFB 3UJIH 4LCIH 3OBAA 5DRWA 3VFWA 4KK9C 4P23B 4I18A 4OLYH 4YQXH 1IEBB 2HWZL 2RIKA 5C08D 5DJ6B 3GSQA 5IF0A 4JDZB 3O8XA 4DKDC 5ISZA 2GJZB 3EBAA 2AJ3A 5L7XL 4NFDA 1CFNB 1VPOH 4LVEA 2FYYA 3R0NA 3GMOB 1IMHC 3IDGB 2G60L 5JOEA 2WP3O 3KHQA 4WHYG 3HLAA 5D7JA 1FVEA 3QRFM 4HDIB 4QHNA 4YHML 4IMKC 3VXQB 1A1OB 4ZO6A 1JYNA 1AIFB 2X89D 2R2BB 2RCSL 2EEDA 3BQUA 3HI6H 4JVUA 1MH5A 5GS0H 2YN3A 1OHQA 4UV4L 5L2KB 4G7YH 1CR9H 3BO8A 5GJTH 1QLFB 3AM8A 2NY5L 4UTBL 1WAAF 1G6RH 3QUXB 4HH9B 4ODUA 1I1AC 4WV1B 5TJWK 5K9OB 4OGXH 1A6TA 3L5JA 4PB0L 4P5MB 1Y6NR 3BGFB 3OKKB 2Y6SD 1QPXA 1OAUH 4F2MB 1QKZH 3WS3A 4ZOCA 3UBXG 4I3RH 3T3ME 5FYLH 3SCMB 2R0ZL 1LMKA 4QHUA 3RWCA 4QXUL 1UT9A 5I6XB 1GYAA 4L4VE 5FO7A 3HZYA 3SPVB 3GRWA 4LBEB 3MRFB 4D3CH 4IDLA 4L4VD 5BW7C 4QTIL 5DJAA 5DR5L 1CE1H 1DE4B 4Z95L 5IWLC 2QQNL 1DQML 3MUHL 4NDMA 1RUQL 2FO4A 4R97C 3JV4A 1IKNC 4PGEA 4KVCH 5K59E 4PB9L 2JJTA 2EE2A 1CVRA 4DZ8A 5J8OA 2XZAL 3QUZD 1CQYA 5L8JB 3OMZA 3SDCD 2HH0L 1W8NA 2ZKHH 5MI0C 4YFEA 3WL9A 3HE7B 1OLLA 4Y1AB 2IJ0C 5I15L 4YGVA 2PUQT 1GGBL 4NO0B 4NWUH 4RDQF 4X7EC 3ZDZF 2EKJA 4DGYL 3CLFH 4GKZB 2R9HD 3S34H 3MUY1 4LLVB 3RBSA 2O26U 4OLUH 5EPMA 3O9WA 3D87B 2F54E 5AUMB 3KPSA 5T1KB 4OCWH 3D9AH 4NZDA 2N56A 4UT6H 1BFVL 5IOPB 2F54D 1ZANH 1B0RB 5IFJB 5C70A 1EHXA 1LP9A 2X4QA 1PYWA 4AK1A 3ZKND 5B3JF 4ODSL 1V7MH 2IH3B 1I3RB 3QWQB 1TVHA 5LG1A 4OGYH 1G7PB 1P84J 3AFLA 4F57L 3T08A 3TYGH 5TE4H 1VADB 3KPRD 4GLRI 3D69B 4RAVB 3CC5A 4UDUB 1YUHB 1GGIL 4HZAA 4HUXB 4CW1B 1IKFL 4RZCB 2CUIA 4XP5L 3V4VH 3JUZA 3TIDB 3NH7H 3DX6B 2GY5A 4I2XE 3RTQA 5B38A 4I13B 1FL5A 2XN9E 1HXYB 4JPVH 1MI5E 5JA8B 4XBGA 3TNNB 1OGTA 3VFGH 3U82B 5C0JB 2DBLH 3C08H 2XN9D 5IGXL 2O5YL 3VD7A 4BSJA 3AS2A 4PJHF 5AAMA 3RKDC 3STLB 2ZJSL 3MR9B 4HIHB 2WM0A 4AG4H 5JPMA 2CIKB 2ZG2A 1J1XL 2EC9U 1ZTXH 3JWOC 1I9RH 1V3LA 1WIPA 3VMNA 4G5ZL 4CUCA 2VC2L 1KJMA 1LK2B 4EI6B 1A14H 5EWIL 1TCRB 1GZPA 1QQDA 2EDYA 1NL0L 3EW3B 1Z9OA 5C9JA 1AGFA 1NEZG 1TDQA 3UZQA 1P7KA 3VFPA 4FQJL 2G5RA 4A2MA 1WEJH 4CDGC 5IVXF 1WFUA 1OGAA 1T20A 1WSST 8FABB 2KQMA 1OAZH 1MCIA 5E24E 3JTSB 2NW2A 4NKQB 3NCYP 4JFOB 3VXMA 3Q0HA 1T2QL 1AGCB 1RFDL 1KYOK 4GAGL 1MAJA 4LASL 4FQQB 5D93B 1GL4B 4JFEA 1R0AH 4NKDB 2GTWB 5D1QB 1YEFL 2X4UB 4XZUB 5IQ9A 4JREB 4XCCL 1MIEL 4KROC 3VD4A 1WBXB 4HUUB 3NCYS 3C9NB 3L95B 3HMXA 2A1WH 2P5WB 1TJGL 4ZD3H 3DUSA 3K2MC 1D5XA 3FO0L 3B2UC 1MLBB 4RWYH 3BKJH 3C5ZC 2J8UA 4MJ5A 2DQCL 3S4SB 3G5XA 4LU5L 4NZUL 1CT8B 4HS8H 3TPUB 2KPNA 4G8FB 2LE9A 3D0VB 1YYML 2CIIA 1JPFA 4AQOA 3GNML 2HTKC 1YNLH 4APQB 2VDML 5C86A 1OTUC 3CU7A 4PRHB 3HZKB 2BXZA 1MFBL 4XPTH 1J87A 1NC2A 5E2WH 4ZUVB 5DO2C 3W0WE 2UYLA 1MNUH 1PZ5B 3TN0A 3QQ3B 3V6OA 3MV7A 4AT6A 5E99H 4KQ3H 2FR4A 3W0WD 2ARJA 2PXYC 1VERA 4S2SB 3BKML 4LSRH 3MV11 5FK9B 5CS7A 1VFBA 4PJ5B 3OGCA 1I7RB 4B53A 3JZ7A 5BRZE 1VGEL 3DMMC 3CXDH 2DQEH 4HWBA 4PJCA 4Y5XC 1SBSH 1X3DA 5I1DB 1JN6A 1GHFH 5FKAA 5BRZD 2DYPA 4DKFH 2F8OA 5ITBL 2FWOA 1X5YA 1X7QA 5A40E 2WQRA 4JZJB 4HF5H 3U36A 1AJ7L 5TDOA 4OB5H 4DOHB 3UBXB 3RUGE 2VIRA 2I24N 1S9XA 4N90E 4Y2DD 4X4MA 2K9UA 3C60C 2NY3D 4H1LA 1MFAL 4JQVA 4N90D 2NY2B 1H0DB 5FOBA 3U4BL 4LKXB 4RMTA 1XT5A 1KB5B 4X4ZA 4U1SA 5FDYA 5HVGB 3AS1A 1MY5A 4HULB 5CINH 1YNKL 1U8NA 3LD8B 3PGCB 1U8KA 2XFXB 1JIBA 2GITA 1FNSL 2Z31D 3O3BA 5E2UL 5IBTH 1FP5A 1DEEB 1NMAH 5DD0H 1AXSA 4PJ7E 3P4MB 4YE4H 4LOUC 2AXGA 3ESVF 3MXVH 3C5JA 2FNBA 5IJKC 2EDWA 4ZOBA 4XC3H 1ZE3C 3MREB 4OLXH 5JW3L 1TQCC 4I0PB 2FEEL 4XVTL 4Z7WA 2UY6A 2OMNA 2YUVA 4U4BA 1I9IL 1P6AB 3MBXH 3SGJC 1Q9KA 4ENED 1DBJL 3GMMA 4JO2H 4OLZH 1FFNA 1X5JA 4OTXL 5IESL 4ZPTA 1JTPA 5E00A 4PJXA 1FAIH 3T2NH 2CK2A 3NA4A 1IFHL 1JWUB 4N9OB 1NLBH 3QO1A 3MYJA 5I1HH 4UI2A 3G9VA 1URLA 3KWWA 1A6AA 3EAKA 2IALB 2DDQH 3MODH 3LSOA 2A9NH 4OZGE 4S1DC 3H9SE 1JCKA 4JN1H 4PGDA 5I73B 5FKPB 3H9SD 3DIFB 1DDHA 5DZNA 5DRNA 2LTQB 4QY8B 2BNUB 1NAML 5GSVB 5D2NA 2H45A 1CDUA 1I8KB 3FO2B 2P5EB 1F4XH 3BXNB 4JQXA 4QNPE 3GSVB 4Z8FH 1P4LB 4HH8A 2EEBA 2XZZA 1OP5K 3WFBL 1SYSA 3SBWA 3V95A 2AJXL 2XG5A 3JWDL 5B8CC 5EOQL 4JM2B 1SHMA 2I60L 4LLUB 5MEOB 3L6FA 3AAZA 3D2UB 3MCKB 1B9ZA 4HGMA 5I1GH 4H5SB 1CFQB 4O02H 1RZ7L 5C0IA 3EGSB 4XHQA 3FQUA 3PL6C 1MQ8A 2FSEA 1WAAE 2CDEA 2OK0H 2F5AH 3B8YA 1FL3B 5C07E 4P57B 4R4FH 4F9LA 1XEDA 5EBMA 4GQPH 4XNYL 5HYJA 4IRSB 5C07D 2XYCA 3QG7L 1TCMA 5AAWA 1LO4H 1S9WA 4DGVH 3DJ9A 4L1DA 1N7ML 3BESR 1P4BH 4XP4L 4XCEA 3VXUE 1IM9D 2E27L 5ID1A 5GHWL 1LO5A 2IFFL 2VXTH 5DHYA 4YR6A 5BOPA 5KJRL 5FA4B 2AEQL 4G9DB 3WHXA 3VXUD 3VWKB 2FJHA 2B4CH 2YBRA 5SX4H 4R7NA 4CN4A 4R2GD 3MJ9H 1H5BC 1BVLA 2VSCA 4ERSH 4DN4H 3HFML 3BP6A 4ZSOA 1IBGH 2PTUA 4YFDB 4Q97A 1IE5A 4GAJL 3KPPB 2VLLB 1FIGL 2ZUTA 4XWGH 3IT8D 4GSDL 1GAFH 1BP3B 3KHOA 5J56B 1T7YA 1BJ1J 5LWYH 3REWB 2IH1A 3PWPA 1A7RH 4LCCA 4JFDB 2W38A 3UTOA 5BVPH 4LKCB 5HJ3A 3G5YA 4HX1A 43CAA 1T83C 5F7YC 1YN7B 3H7LA 4M1DL 2A38A 3UTQB 1N6QL 5JPNA 2NXZC 4HWEL 5EU7C 4GRLD 4TSAH 2PO6A 5HGGS 1HHGB 4X80L 4WY7L 3T0EE 3O2DA 4X7TA 4CMMB 1T22A 2BRQA 3QIBB 3GJFA 1MI5B 3U0PB 2YC1A 4WUUE 1CLOH 1XIWC 1I8IA 1UB6B 1UH4A 3P30H 5D5MA 1OB1B 4WUUD 1H15A 2K1MA 4PBXA 5CWSB 1PKQB 4V1DE 2FO1A 4LLYA 1KIQA 5DMGD 1A9EB 3BSZL 3X11A 2HJFA 3MJ7A 1JVKA 4CNIA 4V1DD 4H0HB 2B4CC 2WANA 3A67L 3U6RB 3G6JF 3RGVB 4OZFG 4F7TA 4PLKC 1YJDC 3CVIH 1KJ3H 2DWDB 3BDYH 3SKJH 1P1ZB 2OP4H 1T04A 1D5MA 3V8OA 1ND0B 4KK5D 1KGCE 3TH2T 1CG9A 1CL7H 4JFQB 5ICYA 1II4E 3SDXA 3FMGH 1Z5LA 5JHLL 1KGCD 4YUEL 4M03A 4MS8C 3VJ6B 1CGSH 2RBLA 5D1ZD 2AV1B 4MB4A 1N6UA 1F3JA 3P0YL 5E2VL 3VXNB 1PEZA 1P69B 1PQZA 2IC2A 2VMFA 3WIHL 4FP8L 4P23C 4NQCB 4FNLH 4BH7B 3RKPA 1XF3B 4FA8A 2YRLA 2KL6A 3S88L 1NANI 3EKCA 4J3TA 2E6QA 4FFWC 4Z77B 1I7UA 4YBQD 3GKWL 3EJZD 1RZKL 3F7QA 5T3ZD 1QR1A 4HCRH 2BVPA 3RWHB 3KPLB 2YZ1A 4X98A 3WIFB 1UXSB 1ACZA 1C16B 5EZOH 1BHGA 5EO9A 5MEPB 43C9A 2R8SH 3B5GA 5AWNH 3S3SA 3SGEI 1NLDH 4KH2A 1K8IA 3MLZL 5DMYA 8CGTA 2H6PB 3F7VB 5IT2H 1FVDA 1UYWL 4IEFB 4TPRH 3MJ8B 4Q0XL 2Q3AA 5SWZD 6CGTA 4TTDD 2I9TA 1JPSL 1I9JH 2COQA 3GGWB 3PWVB 6FABL 4JJ5A 5CIPH 4WFGE 1EK3A 4KUZL 2BSSB 5C0EA 1NGQL 2XTLA 5FCUH 4LNVA 5IHZB 2R0KH 3H3BC 3QUXC 1FN4A 5GSRB 4WV1C 3BH9B 3WBDA 2KBGA 1PDKA 4ZO7A 4BQ9A 4JHAH 2BX5A 1HYRC 3CAFA 4WI7A 2C3HA 3O6LL 3BGFC 4UUJB 3GIVA 1JI1A 1DBAH 1S9KC 1I85A 3RY4A 1T80A 3MRBA 1QLEH 2Y1VA 3ILQD 1Q72L 3QWRA 2C4FT 3ARBA 5HHNB 3WUZA 1RSFA 5I6XC 3FONA 4U6HB 4OCMC 3ZL4L 5TF0A 3CLEL 3MZTA 3ARFA 3LV3A 3L5WB 1U8IB 3QXAB 4O58L 3WFCH 2P4AB 3FT2B 4HWNA 3BPLC 5DWUL 3IJHB 3CFCL 1MRDL 3OAUL 3EFDL 5ESAA 2AI0L 3MRPB 5IHUH 3WIIL 4JVWA 4F33B 2M1KA 5FUOL 5FECA 5IVZB 1G7MB 1VFUA 5J0BA 2B1AL 5F71A 1H3WM 1L0YA 3KXFB 5I8CA 1QSEE 1YN6A 4EI5B 5IM7A 1EMTL 5F70A 4E41A 3HE7C 4F58H 1KTKE 2CXGA 1L9NA 3MLUL 5DSCB 4LSSL 4HBCL 1YMHB 1CQKA 2QADB 4PJAE 1DN2A 1D9KD 2ITCB 4ODVL 1KLUB 2X10A 5F88A 4QYOB 4RNRB 2GTZA 4NRZA 5FGRA 1WFNA 2GCYB 2OZ4H 4XI5D 4AL8H 1BEYH 3GSNB 3QDGE 5KW9H 4GW5A 4J4PC 2IAMA 4Y88A 3EYOB 5CD3B 1XGRA 3QDGD 3LIZL 2WUCH 5KSBF 5EU3B 3DO7A 1HN1A 3BJLA 4ORGA 5CBEB 4NGHH 3F12A 1FRGL 3NFNB 4XRCB 1N59A 1NCDH 4KFZC 3INUH 2OM5A 3T8XA 4J3OC 1NUDA 4EZMA 3KLHC 4FQCL 3QXUA 1NMBL 5FF6B 2R0LH 3LQAH 4KV5E 4OAWA 4QTHB 4XVSH 3PV6B 3AY4C 4XWOC 2X4TB 3B2VL 1DN0A 5LCVL 4Z7VE 3FOLB 4NHCH 4NO3A 3FN9A 1IAIH 3TCXA 2B5IB 4XNXL 1A3RL 1BQLL 3FCTA 3I50H 1G7JB 1HINL 4Z7OE 4ELMA 1A9BA 2X42A 5DJZB 2ZNWA 4NPYA 1VB9A 4PPTA 1UWEH 3KPNA 4S11A 3PABB 2RFXA 4HKBA 5EOCJ 3FN0H 4P5TB 4DAGH 2V7HA 1KIRB 3PQYE 1D5ZB 4FFWD 3EOTL 2FL5A 5CUSH 1RUAL 1KPUA 3U7AA 1F4YH 5F3BB 4G8IB 3IKCB 2W9LA 3BT2H 1I3GL 3PQYD 1S7XB 1UCTA 3VWJD 2G5BA 3OR6A 4KHTL 5AD0A 3BUYA 5C0AA 5HYIA 2NYYC 5C92A 1NGWB 3D48R 1DEDA 2EDHA 3MACL 2ICWJ 1IGTA 2JELH 4LCYB 5D93C 1RK1A 3QHFH 3S9DB 2BVYA 2GIYA 5D1QC 3UEZA 2ZOKA 3ZE0F 4JREC 4U0RC 4XCFH<