2VDQH

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
219
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 43
structure length 219
sequence length 221
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqH02
4QRTA 2NY5H 4OCYH 4P59H 5C0AE 2GJ6D 4OZIE 2XKUA 1IC5H 5HGAB 3LQZA 1AD0A 4CDGC 5JHLH 3NCMA 3S96B 5FKPB 1J0YA 1C16B 3PWPE 4K2UL 1JWUA 3TWCL 1I9EA 4MJ6A 1G7HB 2I9LB 2EDTA 2O26U 2OJEA 5ALBL 3IF1A 5HGHA 5IMLA 2PF6A 4X7TB 4DN4L 3K2UH 4NQSB 4MNQB 2C1OA 5T33H 3UYRL 5IUSA 4OZ4A 5ISZB 1NCCL 3PIQA 3O4OB 2GITA 4S10A 5LGHH 5GZNC 4NBZB 3ZE2E 3NCEB 2HTLD 2HKFH 3R0NA 2AJVH 3N9GH 3H8NA 1JZ2A 5FECB 3DPBA 4LVEA 3GB7B 3WCYA 1PVHA 4EJ1C 3ULVL 4NC2B 1H3PL 4ODXB 1NBVL 5ANMB 1PGRB 4XP1H 1CFBA 4ZQKA 5I1JH 5EZOH 4RBPK 4H5SB 4UINH 1D5ZA 3JTTA 1UXWA 2D0GA 3N1FC 1EERB 1JGLH 2XZCH 4X6DB 3RZCD 4BH7A 4XZUB 4YFEA 3QB7C 5HHME 5KS9B 3FO0H 5IBLC 2R2HB 4P2OC 5DTFA 4MJIB 3MRLA 4H26A 4XP9H 1BJ1H 4KZDL 1ZEAH 4OLVH 3VXOA 4ESKA 1HSBB 1YEJL 3DMMD 2X1OA 3MA7A 4LCYB 4JY6B 1OP9A 5JQ6L 3JV5A 2JIXB 3KWWB 3NCCB 4KKCC 1F4HA 1M7DA 5J1AB 2XV6B 3EFFB 2IAMC 4PJBA 5A2IH 2WQRA 5E2WH 1SYSA 1U36A 4HX1A 5EO1B 3O2WH 3UDWA 2UYLA 3QCUL 3L3IA 4X7CC 1P7QD 4U2ZA 4PY7B 4J23A 3CXHK 3EOTH 2IH3A 1BQLH 4QCIA 2F5AH 1E27A 5F7NC 1QBLH 4WI6A 4M6MH 5D7JA 1KB9J 1D9KA 5JPMA 1F58H 3V0WH 1F2XK 1AGBA 1MAMH 4LLAA 4ERSL 1JN6B 1HXYA 4M4PA 3DVGA 3EHBC 3PE9A 4GW4A 2DQJH 5L0QB 1QLEL 1O7VA 1UM6L 3NFNB 5F1NB 5JIKA 1FNHA 4GMTL 3QNYB 2EDYA 3L3KB 4BSWA 1HNFA 2AGJL 1M7IB 4HZAA 5E95B 3L9RB 1QSED 4QHMA 2EE6A 4P99A 1QSFA 4L8BB 4Z7VE 3O11B 1W72H 3PGDB 5IEHA 3RFZC 4U7SA 4JHAH 4L8DB 1H3PH 4RQQA 4H8WC 4ZNEA 1FIGH 3W11D 1CVSC 4PGJA 4FZEL 1BJ8A 4L3ED 2FGZA 3FT3A 3MO1A 5I1GL 4DJMA 1I7RB 3S5LA 4HUKB 3DV4B 3STZA 3MV8E 4MQ7A 4XMKL 4Y16A 2EYRB 5IESL 5CUSH 1CFQA 1KIQA 1IJ9A 1B90A 5IJKC 1FFQA 3AC0A 3B2UC 4DEPB 5EUOF 3I3DA 4G5ZL 2WW8A 4XCNA 3MLVH 5E2WL 2GI7A 3D9AL 4FQXA 1KB9K 4YLQT 5HYEA 4HPOL 2DTSA 3P77A 3QCUH 3QCTH 1AY1L 4OLWL 5J3HD 2VIRA 4YHLH 3P9WB 4PRHD 1EAPB 2FO4B 2X09A 2GUOB 2DI7A 3EGSB 3ROOB 5KVGL 1FDLH 1QUNA 3AREB 1MCWW 4WDIB 1ES0A 2DQHL 2FZ3B 1XGYH 3OKMB 4M7JH 5DS8B 5K93A 4OZIF 4OUUA 4YNYA 3L7FB 3EO0A 1UM6H 2JKXA 3KYNB 2GK0B 1JV5A 4WY7H 1MAJA 1MCRA 4QTHB 4WW2B 4ZTOH 1HEZB 5CIPH 1BD2E 4V2BA 4OFYD 3AROA 4HXAL 3O2DH 4U7MA 5MERA 4GQ9L 5JXEC 3M1BB 1MJ8L 1G9MH 2JF1A 3OKEB 2UZXB 3BD4A 1NDGB 4GG6A 3B3IB 4RAVA 3UBXG 1JGEB 5F71A 1NGWB 2DD8L 1QFUH 3F7PC 5KVDL 3WHXA 5BVPL 5KSAB 3ZE1F 4N9GB 4MWFA 3A6CL 3OHXB 5DFTA 4Y16D 2Q7YB 1GSMA 3ES6B 5DJXA 4LPWA 2FX9L 4LLDB 4MAUH 4EN3A 3GZKA 3MRKA 1RZIB 2B1HL 1GC1L 4N9OB 4TUKL 1IT9H 4NKQB 3V4UL 3QHTC 3X13A 4FQCL 3ZDYE 3MRIA 1I9JH 4TRPL 5FA3B 1GPOH 5HVHB 5EG6C 3BP5A 5KN5B 1J1OH 2W0KA 4R3SB 4AEHL 3FB7A 3VXRB 1IQDB 4JFEE 1ZVYA 1RZJH 2IFFH 3PABA 2ZUQC 4M5YL 1P5VA 3EBAA 4H8WH 5EZLA 3WN5A 3AAZA 1F6LL 1AD0B 2NX5E 4ZUSA 1CT8A 5KBNC 1NLDL 1JBJA 4YAQA 3GKWH 4HWEL 4OJFL 4U1MB 1UZ6E 2YK1L 3L1OL 1UYWH 4A2MA 4PRIA 1HKLH 1OAUL 3U0PA 5HYSA 1NLBH 5TF1L 4LPUA 2FHBA 4OZFB 4XNXH 1YN7A 5HDQL 4PJFB 3NCJH 5E6ZA 3GRWH 3OTTA 1QHPA 3CXHJ 3V2AR 4XP4H 5DQJA 4YFLI 1A3LH 4KMTL 1MCDA 1NCAL 2OXHA 1XGRA 4FQQA 1QSEE 1A1OB 1XCQA 5GGUB 4UTBH 1JCKA 4MD0B 3PGFL 4LMQI 2YSSA 4HLZG 3TV3L 1KACB 4QRQB 4M02A 3C2AH 4U1GB 3EFDL 2AXJA 2HT2C 5DYOA 3IFNH 3N1GC 1Y18A 3HC3H 1WC7A 5C09A 4EQ3A 1FGVH 1BFOB 3G5VB 1U8PB 4R90H 5JO5B 4LHJB 2R4SL 4HWBA 3LD8C 1VACA 4Q0XL 2R2HA 1XF4B 1CGWA 1LNUA 1CXIA 3TPUB 3VGEA 2L4OA 3EW3B 1RZGB 4PJDF 4AM0B 3C9NA 1TJHL 2EIDA 1A5FL 3EOYG 4MX7B 1G9MC 4O58L 4J4PD 3VGAC 1ADQL 5I1AB 3IS0X 4LDLB 4LGPB 1YEFH 1GGIH 1DSFH 4LDEB 5C0GA 3FB5A 3TYGL 1PZ5A 1UGNA 3TVMC 1FLRL 1IKFH 3KPNB 1QNZL 3RHWF 5MEPB 4U1LA 3RPIB 4HG4K 2MSPA 3IFPB 5B39A 3U9PH 2EDFA 4Y0GA 3NFPB 2BNRE 4XPFH 2EC9U 2JIXD 3MROB 3QBTB 1IFHH 5IR1B 4U1NB 4L8CB 1HXMA 5CJBA 3GIVA 4KQ3L 4J3TA 2IH3B 4I0KA 1U6AL 4U6HA 2XTJD 3C09C 2ARJB 2DWDB 5D93B 3LKPB 4JQIH 3IVKA 4JPIA 2AEQL 4P5TB 1KN4L 4JZNA 5GS2H 3P9MB 5DJ8A 1O7SA 3MLYH 1BX2A 3O3EB 3D85D 2YUWA 4LCUA 1DVFA 3UROR 1KB5H 2VC2H 1FP5A 3L3KA 1ZWIB 1YY8A 4ZSOE 5I2IA 1A2YA 2CDEA 2NNAA 5KG9A 2X44D 5IMKA 3DETC 3MUGB 1D5IH 5FEBA 5FK9B 4U1HA 1I9IL 4PG9B 3H3PH 1RJZB 2IBZY 2UVFA 2MPAL 1MFAL 2P5WB 4WENB 4Z8FH 2CKBB 5JOPD 3BDYL 2YEZA 2DYPD 1YEEH 1YYML 5L88H 1GZPB 4M5ZH 4MGXA 4NRXB 1UC6A 2D4DA 5H35A 1OAZH 5DO2C 3MLXH 1ZANL 4KTEH 5GIRA 2P44B 4AYFA 4HBCH 4Y4KC 3BDBA 2H8PA 1T03H 4AEIH 4E0RA 2CLVB 1FRGL 3FOLB 5T3ZD 3WL9B 5J6HB 1H3VA 3NZ8B 3O3DB 2CO7B 5EU6D 3T2NL 5KSBA 3QA3B 4NO2A 3G6DH 5DRWA 4AIOA 4ZXBB 4QXTA 1V7ML 1ZMYA 2APBA 2GJZB 4ENEC 5IVZA 2A77L 4XVSL 1G6RH 1YQVL 2NY2B 2WP3O 5HSFA 1I8KB 1JE6A 4NCDA 3G6JA 4TTDD 2OMBA 3WFEH 2VERN 2WAHA 3HNVL 4OM1L 1DBKH 2QTEA 3CFBB 3OXRA 3QEQA 4U6YA 4JHAL 4KUZH 5I73B 1R24B 4AH2B 2YA2A 3MOAL 4HAGA 4YPGB 1GCFA 4YHIB 3VWKA 3O2VH 5C08B 4HIJA 4JFED 4IHOB 2OTWB 5DR5L 4JQXC 4WCYL 4OD3L 2OTUB 3MGTA 1LO5B 2BSRB 3LDBC 3KYOB 4ZPVB 5GGSB 1ACYH 5EU7C 4YHOL 5K33A 5CKGA 4IOIA 4L4TB 3QZWB 2R69H 4LSQH 3QWQB 3FAXA 1S7XB 4DQOL 3GSVB 5BZDA 5CILH 1NCTA 1KFAH 1UM4L 5SX4I 3OX8A 2V9QA 4E41E 2JB6B 4OAWA 4ZTPH 4MB4A 4XCYB 2FLBT 4LRIA 4M7LH 4RGNC 1DUZB 5DJDB 1KJ2A 4A6YA 4XP5H 1JGUL 4WNQB 5DFVC 3ARFB 1KEMH 1QOKA 1RUQH 1VFAA 2YD2A 1HHIB 3NTCH 3QG6B 2BNRB 4OLWH 3DX6A 4KK9D 5TDPB 1ZLVH 1WZMA 2Y25A 4MWFB 4GXUN 1TVDA 4LAQL 3TCLA 2ZJSH 5IOPA 4QRPD 3TH3T 1S7VB 4ZAKB 1VEPA 4FQLL 4LLDA 1SY6A 2H1PL 3IETA 3LQAH 1TMCB 1FDLL 4XXDA 3VG9C 3HE7A 1HQ4B 3VFWB 1NSNH 5FAAA 3O6FB 2PYED 3MRDA 4Y4FA 5C0DB 1FYTE 2RHEA 2VITA 2VWEE 2NTSP 4UDUA 4LSUH 5C0JA 5JOEA 5HDBE 2DI8A 3FB7B 3KXFB 1KPVB 5IMOA 3P4MA 3ZKMD 5JXED 2Z9TA 4M62H 2R0KL 4L9LC 1R5VB 1FIEA 1XF1A 4NQTA 2NY3C 3RWHA 3DMMA 1A6TB 5BQ7B 4NNPH 2R1XB 1B2WL 3QUZB 3LV3A 3KPSB 1DBJL 3E6HB 4UNTA 1YA5A 1DE4A 5C6TH 4XVJL 1T20A 5TDNB 3IJHB 3V6ZB 5CSBA 1QSZA 3KPLB 3MODL 5ESQB 5KVDH 4LLYA 5ITFB 5IJVB 1RIUL 1JYVA 1I3GH 1S7TB 4KK6D 3GI8H 4P3CL 1QP1A 5I8EA 3UC0H 3CFJA 3W5NA 1G7QB 3QNZA 4PV9B 4MA8L 4QHNB 4K94L 4CBPA 1XH3A 4M61B 1KT2B 5F97E 3EKCA 3UBXB 3HFMH 5ICXB 4Q2ZB 3I02A 4U1IB 2BFVH 1FNFA 4TUJB 3VU2A 3ZL4L 3FO2B 3I85A 5BW7A 4ZDHA 5JO5A 3CFEA 3K8MA 4X6CA 4W70A 3LH2H 4YR6B 5CD3A 4YGAB 2E27L 4MSWA 3W5MA 1S7RA 4KKBC 3RGVC 1F3JA 3RX7A 3BN9D 3CDGB 3L5JA 4MX7A 4EUPH 5JHDE 1NGQH 5I1AA 4EI5C 1G0XA 2Z35A 2HJKA 5A3IC 3WLWC 3HLAB 1RMFH 3T0VA 3PWLA 4QRTB 2V7HA 4J4PA 3C6LA 3FO0L 3BE1H 1UJ3B 1RUMH 5FO7A 4DZBA 1K8IA 3QIBC 4NO5B 4U1JB 1XIWC 1NMBL 3S35H 2CSPA 4J2XA 5TGBB 2DIJA 4I9WE 4WHYG 3TIEB 5TFSL 3CD4A 1YMMA 3CU1A 5IW6B 5FYKH 4NSKB 1B9ZA 3D0LB 4PD4J 4P5TA 3PP4H 1C7SA 4IIQA 3QDJA 3K4DA 4F9LC 1U3YA 2UY7A 5FM5M 3SDCD 5KVFL 5E1AA 4QHLA 5CEZD 5C9KA 5EN2B 1Q1JL 2GK2A 1LE9B 3L95B 5C6PB 4ODWA 4Y1AA 1T5WA 3LQAC 4GW5B 2A83A 5D7KE 4O00A 2FR4B 2AQ3A 2R0ZL 4IOSD 5AZ2H 1Q94B 4D0CB 3JTTB 3IDMB 5CEZE 5D7LE 1CD0A 3RU8L 2PYEB 2NMSA 4H26B 5HHMD 4CAGA 3BQUD 1T3FA 4PJHA 4JFFB 3CVIH 5FF6B 1CE1L 5T3ZL 1B0GA 1C1EH 1WTGT 1XF3B 4PRID 1LE5A 4O02L 1A7NH 4IMKC 4L4VA 5DUMH 2VLJE 4I0PB 4HXBL 4PJHF 2YRZA 2AK4E 4Z0XA 4Z5RA 5I71C 1WZ1L 3TJHC 3KPSE 4LU5L 4MQXD 1YC8A 4N0UB 2LABA 2DLFH 3VD5A 1A7RL 3NAAL 4NO0B 4WUUA 4YHZH 3DXAA 3LSOB 5DRWB 2XPGB 5JA9A 2GJZA 3T0EA 3H9YA 3K1DA 1VERA 1DQDH 3D39A 3N50A 3QFDA 4QCIB 2IQ9H 3TBYA 1MAKA 4ODVL 2AV7A 3ZE0E 3IDXL 1QD0A 4XTRC 3KGRA 2ATPA 3UPAA 4OZHB 2EH7L 2F74B 5KOMC 2ADIA 1EUTA 4WI3A 5LQBH 3OXRB 1DEDA 4ZUUA 4EDWL 4AH2A 1XF2A 1KNOA 1JNNH 3NFNA 4Y2DB 1KEGL 2VXSH 2BVUA 4BSWB 2FIRT 1BEYH 1IC7H 3BESR 4HUXA 3W9EA 2Y36H 1TQCC 4DGVH 4Y8DC 3MJ8B 4MJIE 4YHLL 3OR7A 2X89A 5EUOE 2ICEA 4HBCL 4NC0B 5IQ7H 5KAQF 5JMOC 5ACZB 4RMTA 4FQJL 3DECA 5JOFB 5JW4N 4UUJB 4U05A 4DGIL 1I8MB 3C6LC 3F65A 4U0RB 1XGYL 4M7JL 1LDPH 4XCYA 3L6FA 3RDTB 3HZKA 2O5ZL 5MEQA 4LLWA 1GHFL 1N5YL 4Z77A 4MQ7B 3KPQB 4F8QA 5DMKA 4F58L 1S3KL 4XC1L 4POUB 1EEQA 3TZVB 2NY4C 3QNXA 3LMJL 3K8KA 4QRUA 4PRBB 1KYOK 5EORH 2AJVL 5C3TA 2P5WE 1I75A 5K9KB 1ZGLB 2OX5A 1BZ7A 2CMRL 5J13C 3UAJC 4F9PA 4BH8B 2DOCA 5F7LB 3SE9L 2HVKB 2GTWB 4PRDB 3O3BB 2EDRA 3TBWB 4EVNA 3OKDB 4KDWA 1OAXH 3V7AG 1TPXC 1U8LB 4CU7A 1IRAY 4XWOC 1JGLL 2XZCL 3IRZA 1UWXK 4OCYL 4P59L 1VFUA 2VIRB 4DK3A 3SEPA 5JORA 3CLFH 2W9EH 3ARTA 2QQLH 3KXFA 3S34H 4FQXC 3G08A 3ULSA 2BC4B 1H0DA 2CLRA 5DURB 5E2VL 1F5WA 2F54B 1DL7H 5F6IC 1YEJH 3AU1B 1H5BA 3CK0L 3W39A 1A6TA 2HT4D 4JN1L 1MI5E 5DS8A 4IM8A 2QQKH 3WIIH 2BRQA 3ARZA 3QPXL 4PJXA 1WEJL 3AFLA 4GRLA 2OL3A 3WNNA 2NTFB 3UYRH 1BBJA 5EZIL 3BEWA 3ZHLA 1AE6H 1BFVL 3GMLA 1JFQL 4XPHL 4X5XB 2ZKHL 4KY1L 5HVGB 3DYMA 4MNHB 2DQEH 4KKCD 5I1LB 4JE4B 3CVHB 1VFBB 1JYXA 1CTNA 5DD1H 3MV9A 1M71B 2HJFA 5CEYB 5ICXA 1S9YB 2V2TB 5IV2B 4TTGA 4I13B 1ND0B 5CJXA 3JZ7A 3WE6A 1RZKC 1GHFH 4Y19E 5IHZA 1OY3B 4L4VD 4NKIH 3OHXA 3S8WA 1A3LL 4X99A 3BKMH 3VD4A 4L29B 2ATKB 1BJ1J 1UT9A 2VDRH 2FBJH 3FQNB 3E6FA 4LKXB 5E8OA 5IFJA 5FOBB 3CSPA 5SWQB 5DGQA 3RAJL 1UM5H 4KZEH 1NBYB 4P9HL 5K9JH 3IFLH 2HH0H 3BKJH 1MI5D 5DZNA 2E3VA 5KSUB 1BOGB 3T4AB 1D6VL 5JOPE 4NFBA 4L3AA 1NAMB 4ZYKA 1CF8L 1YEGH 4JKPL 4P9MH 4XWGL 5HGDA 3DO3A 1DJSA 5EZLB 3C08L 4Y2DD 5F9DC 4P23A 1AP2A 5B8CA 1E6JL 1LO3H 4PJBE 3S34L 1EHLH 2H6PB 2PO6C 3T08A 3H9SD 5ICZB 3IS1X 2AJSH 3B9AA 2VQ1B 4WTXA 1CXKA 2J8HA 1LP9E 1MCPL 4PRIB 3MCLH 1E6OH 2C3WA 1OCWL 1RIHL 3Q48A 4GXVH 4G8FB 4V1DA 3LVEA 2FJHB 4PJ5A 1NBZA 2D03H 3HZMB 1HHGA 1AQDA 5B3NA 4OIBA 3QIWD 5CJQL 5IFHH 1CGTA 3QXVA 5HYIA 3C8HA 3VXME 1C5CH 3CDYA 4I0PD 1XGRB 3LEVH 4OFIA 4PJIF 3QDJB 4RFNB 1FFPA 1PSKH 1D7FA 5DEFB 5EZJB 1UZ8B 5FXCH 1F02I 4N0FB 3HC4H 1JHTA 5T5FL 3KPRD 4ZD3H 4KQ3H 5EN2A 3SOBH 3GMQA 4Q9RL 4LGSB 1G7PA 1GIGL 4K3JH 1IM9B 1NCDH 2M26A 1KCVL 1G7HA 4NJ9L 1AD9B 3BP4B 2OJEB 1EEYB 3G5VA 3KR3H 4PJEA 4F8TA 1G6RA 2JELL 4OBSA 2Y1VA 5C0FA 4ZFOL 1X5AA 4CVXB 4FZ8L 1RURH 1ZVHA 2AQ1A 3PIQB 3V4PL 1WCBB 12E8L 3QT2A 4OKVA 3VH8G 1YPZA 5TQ0H 1XF3A 1IAMA 1ZVSA 4Z95H 1T0MA 5HVWA 1MVUB 2IANE 1A6UH 3MBXL 4Z0XB 1AXSA 1ZHBA 2NY1C 2YS4A 1GH7A 2EYSB 5F7FA 1LP9A 1RZ7H 2VDQH 5TDOA 4HDIA 1A02N 5ESAA 3LN4A 3QRGL 5DMGC 3IFPA 3QDGD 3BH8A 5IW3A 2W59A 4JEGB 1UWGL 1BREA 3HE6A 1QFUL 3MROA 4WEMB 4I48B 3TO2A 3U2SA 3MBEC 1CD1B 2D7TH 3A6BH 4WO4D 1A6VH 4M9OA 2FLRT 3QIUA 5GHWL 1U3ZA 1NAML 1NFDE 2DWDA 5DC4B 3BISA 3VCLA 4XPAL 4M93B 4NZDA 4BQ9A 3HUJA 3MA7B 4LCYA 4M7KH 1MWAH 1TZHB 3ARED 5IW1A 3K2MC 4WI9A 1YQ2A 3ZKXB 2ZOLA 4TRPH 3TH2T 5E6IC 1OGAB 5IK3B 5DJ8B 1F3DH 1V7MH 4O2FB 3RUGE 2FECI 3ILPA 1DVFB 1N0XL 3BP7A 3CIQA 3DUUA 1DN0A 1Z6JT 4G7YL 2DKMA 1MWAB 1CR9L 5KG9B 1D9KC 1DEEA 3QO1A 3RY6C 3ZTJG 3MGOA 4KKLC 4U1HB 4XNUL 4ZODA 1SBSL 3TJHD 4HMDA 2VNCA 2OYPA 3RUGF 1CXLA 1QFWI 2ENYA 3GBMH 4WU7A 4D9QE 1EEZA 1R3IH 2LU4A 1MSPA 1UEMA 4WI5A 5SWZA 1AGBB 1A7PH 2FWOA 2QKIA 4PJDB 1PJ9A 4JRYE 1J87A 4X4ZA 5D2NB 4I3RH 4F80A 5MEQB 4TNVK 3LZFL 3DI2B 3QNYA 5T3XD 1QFWL 1T22B 1NFDF 5EDXA 3JSSA 2FX9H 1CD9B 1PEZA 2QBWA 2ICCA 5IFAL 3MLZL 4S2SB 4QXGH 3WL9A 1BECA 5IEHB 1JYWA 3QA3A 2ZUTA 3C2AL 4OZFH 3D3VD 5T1DH 4CVUA 1R3HB 1IAIM 2CUIA 4JFYB 2WBKA 1TCRB 5DJ0A 1OW0A 1AI1H 3LKOA 2H2PC 4GAYB 3IDNA 5BRZD 1I8KA 1J05A 4PJ9B 3QHZL 2P24B 1VB9A 5GGRA 1G7LB 1LILA 3BPNC 3V4VL 2DQGH 5AD0B 1BQHG 5I8CA 4YC2B 4P2OD 1BQLL 1FNEB 1Q9WB 3MRRB 2QQNH 3BWAA 4TTDC 2BVOA 1CFQB 1H0DB 3TBSB 3GMOB 3ALXA 1L0XA 1W0VA 4M7KL 2FSEB 3IB4A 1XAUA 2P48B 4P4KD 3F5WA 4JREC 2ZUYA 1D5XA 1YYLH 4X4ME 4MQXC 2YBRB 1X5XA 5EOCL 1UQSB 2MMXA 3SDXB 4U1GC 1EO8L 5T1MB 3GI9L 3S6CA 1S7QB 4J4PC 2JJTA 5BS0A 4CNIA 4JZOB 2VXTL 3OX8B 3JV6B 3SKJH 5CSZA 1MJUH 3NCBB 4KPHH 2APWA 4NYLB 4LSPH 5DZLA 2UV3A 5EU6A 4NP4L 1DUZA 4FFYL 5DJDA 4QRPB 2H32H 3R8QA 2ID5A 3AREA 3EIFA 5CEYA 4GKOA 2FZ3A 3EYUH 3LEYH 1UCTA 3VGAB 3TO4C 2WUBH 3O8XA 4TSCL 4YNYB 3L7FA 4HFUH 1JV5B 2SEBA 1KJ2H 4A6YH 3QI9D 4PJAA 1FYTA 5I15H 2Z4QA 4JPVH 3DX7B 4FMFA 1KLGA 4DCQB 3ARRA 5E6IA 4KVCL 2EIZB 5DD3H 3UDWC 1OTSC 3ULUE 3RL1B 4IDJH 4NC1E 2HLFC 5BMFH 5T1LB 5F88A 4OF6A 1J1XH 3D39E 3MUZ1 3SO5A 3W0WA 1SQ2N 2BOCA 3D9AH 1QR4A 1R3JB 2VLLB 4X5WB 2DI9A 3O6LH 4TYUA 3IGAB 1FZMA 1B0RB 3P9LB 5IMOB 1RZKL 4XH2B 2EE2A 1Q38A 2J5LB 2HYMA 2X4NA 3OGCA 5CS7A 5B8CB 4NOBA 2QQNL 4WFFE 3TIDA 1K8DB 4IJ3B 5TPWL 5TDNA 3TA3C 4ZXBD 1AKJB 4ZO8A 1HOCB 2FJHA 1I3UA 1NCBL 3S3PA 2GEEA 5FCUH 3L5HA 2XACC 1OARL 2I60H 2RFXA 1YYLL 4P4KB 3ULVD 1C08B 1PG7H 5GS0D 2CLZA 2ITDA 1P4BL 2QR0B 4EDXA 3BGFB 2HN7A 4G80A 5F7UA 3QUXC 4QHNA 5DEFA 1FGNL 4R6UA 3S98A 4NO3B 1N6UA 3UBXA 4P46C 1I8LA 3LN5B 4G8GE 1OF2B 4JQVA 4DAGH 2P5WD 4Y4KB 1AD9A 2OR9H 4UBDD 3G5ZB 3KLHC 2HA1A 4J3VA 4LVHB 4PR5A 4RX4D 2P8PA 2XRAL 1IC5L 1MVFA 2IBGA 4G9FB 3ZYIA 5D9SA 1BIIB 1UB6A 4UB0H 5FUZL 4JFHE 1AR1D 4MNGE 3HB3C 3IYLW 1M1SA 4Z7WA 3ULUH 2DQUH 5IT2H 4MD4B 4JHZA 2XKNB 1K2DB 1JZ6A 3F12A 2CDFB 4MCYB 3MCG1 3MXVH 1MVUA 4PIRF 4WFEE 2ED8A 3UTTA 5IMMA 1I9JL 3G6DL 4LK4A 5ELIA 5FHBH 3PNWA 1GPOL 2HMIC 4F15B 1NEZG 3NPZB 1DQQA 4B41A 4CADA 3TVMD 3GJFK 3CC5A 1U8PA 4Y4FD 3S37H 1IEBB 2XTJC 5F7DA 3TNNA 1C1EL 1CS6A 3VFOB 5CWSB 3U7YH 4NWTL 3QUKA 3SDDC 4X7SL 3PXJA 1WZ1H 1NBVH 5JHDA 1I4FA 4YO0B 2ORBH 1LO4H 4G42A 3DRTA 5L2JA 3EJZD 5IB4A 5DHVB 3ILPB 1YEDB 1G7JB 1ZA6B 3CH1A 5H8DA 4QHLB 1JHKL 3X17A 4FNLL 4JFFD 3W81A 1CFVH 3QJFA 2XY2A 1UCBH 3OGOE 2P45B 4M6OH 5LCVL 4ELME 2HWZH 5BJTA 5IR1A 1FGNH 1FBIL 1I1YA 2R4RH 2EDKA 4PLNC 4O9HL 3RP1A 3WJJC 4ZTPL 5HHOB 1WITA 4D0CA 3HMWH 1IM3B 4K9EH 1EEZB 5FGRA 1T80A 1AGDB 1LGVA 4UT6H 4X8XA 4MB5A 4XPBH 2DJUA 3OZ9H 4FP8L 5T3XL 1XMWA 4UDTB 1QKZL 1QPXA 3VG0L 3IVKB 1KTRL 2V6HA 4WGVB 1VGKA 1F4XL 5E8DH 1F3RB 4H1LB 3QUMA 1OSZA 2VDKL 5LG1A 4WO4C 1FNSH 2A6KA 4PJ7F 3I6GA 4LSRH 1H8SA 5EU3B 3O6FC 4PJGF 3PV6B 4DUWA 4WFHD 3N1PC 4HUWB 2J8UF 4XRCA 2WUCL 4NZUL 5CGMA 5JA8B 3BGMA 5IB5A 1ADQH 4H0HB 4KK8D 2A6IA 4PG9A 1YEFL 4Q58C 3EYVA 5F9WB 4H5SA 2J8UA 4F37K 1HIML 4PJCE 3FTGB 4BH7B 1KF9B 2F9BT 4JPKH 2G75A 3T0EB 1PLGH 3LIZH 5CLWA 1V3MA 2AEIT 2I9TA 2MNUA 4QLRA 4Y5YB 3ZE0F 3SBWC 4JB9L 4HG4J 3HA0A 3MUJA 4WJ5A 4X7SH 1EV2E 1FNEA 4MMZC 3S9DB 5L2KE 5FV2A 1Z0MA 3VXUA 1N59A 1X5GA 4MD5B 1QRNA 5DQ9B 3QIWC 3T4YA 5F7EH 1BM3H 2VZVA 3HAEB 3TA3D 3VXNA 4FABL 5C0CE 5HI3D 5LAXA 5KSBB 2XNAB 4NO2B 1J8HA 2NR6C 5I1CH 3VMNA 1VADB 2HFTA 4JDZA 4YHYB 3QFJB 3FKUS 3JXAA 1QFHA 4FNLH 1I85C 1Y6MR 4LASL 4YGVA 1UCBL 3CDFA 4EZMA 2BCKB 2OR7A 4ZFFA 4DFIA 3T65B 4YDLB 3OJDB 4JN1H 4GS7B 4X6FA 3VWKD 4J3SA 3RDTA 1AC0A 4GW4B 4HIXL 3BOVA 4GAFB 4GSDH 2BRRH 2YD5A 2VDLH 5FYKL 1YEEL 1MF2L 1F4XH 3CU7A 5E8DL 4OUOA 4JFEA 3QNXB 1EGJA 3O8XB 1AIFB 3T2PA 1QYGL 3O4LA 4QRRE 1WZKA 2L7JA 3MLUL 3GMNB 4D2NA 2H2SC 3KPTA 1OAYH 4U7KA 3VFNA 1CIUA 4L8DA 3CXDL 4JZJA 4PRDA 1HINH 4OGAC 5EBMA 5J12C 1XIWB 2AK4A 2XWJA 3H0TA 4HT1H 4JY5L 3HHRB 5FV1L 3LHPH 1R5WB 4Z76B 1B3JA 1RJYA 4LPCA 1KJVA 2ESVB 4C83A 3BE1L 3ZTNL 4Y5XC 3F58L 1ZT7A 5E99L 5IHUH 4Y16B 2BOCB 3REVB 2W0LA 4OZGB 1CE1H 2EYRA 1JF6A 1NFIB 2HT3C 3J7HA 1I1AA 2X4NB 3MUY1 5EU5B 2P7TB 3MFGB 3B9KB 3QUMH 4MCZA 2GSIA 1RULH 3OWEA 5C07B 3FFCD 3RZCC 2DJ4A 5K59E 4K23H 4R8WL 1FE8H 3P11L 4PJXF 1RU9L 4PJFF 4H1LH 4NP4H 5GS0L 3UBXI 2DLFL 1P84J 2PR4H 3IRPX 1HQ4A 3VFWA 4P2QA 3RNKA 3P0YL 4IBLT 1INDL 2WUBL 5J8OA 1P1ZA 4P3DA 5HYJB 1E4WL 4S0SD 3ZKSD 4I5BA 1AFVL 4KROB 2QSVA 3BSZH 1JF5A 1UG9A 2IADB 3V6OA 1IT9L 3HE6C 2CRMA 4NO3A 4FOMA 1TDQA 5IWLA 2FEDC 5GRJL 3PF2A 1W2KT 2R1XA 3QUZA 4FFVD 3E6HA 1N4XH 3ESUF 3HC0A 2YPLD 4L4TE 2B5IC 3IJHA 5I71B 4GW1B 3MRGA 1P4IL 4X99B 2X4PB 1BD2D 1RZKH 3TNMB 3I3EA 2ATKA 1T89C 3L5WA 3L3HB 4R0LB 4ETYA 4R4BA 4XB8A 5JTWA 5C0BA 3M1BA 3DSFH 4LU5H 2XWTA 3GSNB 2J6EH 4OF3A 3B3IA 1DR9A 3T0AA 1NSNL 3UTTB 1NEUA 2A74B 1K4CA 4KRMB 5IBLD 3F58H 4FTVA 4H25B 1CLYL 5DD5L 5I76A 2R39A 4LSVL 5FM4A 3CFEB 4KZDH 4M7ZC 5I75B 2H6PA 1NUFA 4Y2DC 4AENB 4YR6A 2Y9RT 5E4EB 4EI5A 3LS5L 2W1NA 1MHHB 3TF7C 1E4XL 2ZSWB 1FZKB 2DM3A 3MRJB 5D1XC 5DUPL 3R06A 1NKOA 4P23C 5C0BD 4V1DB 1NBZB 1SVCP 1T7YA 1OWWA 5MI0C 1P4LB 2OR9L 4F33A 2F54D 3Q1SH 4MNGA 1IM9D 3P0YH 4ODBD 1X4XA 1UWGH 2NW2B 2FYYB 2R4SH 3M07A 1YNTB 3OF6D 2VQUA 4FFWD 3WHE1 4DGVL 3DURB 3C6LB 5DHVA 3WLBA 4N0FA 3M8OL 1I3GL 1A6VL 3QJFB 5C09E 2M8XA 2X1XR 5D5MA 1FSKC 2NY0B 1A7BA 4YXKH 4QWWC 4WWKD 1F58L 3U0TA 3FRUA 5E08L 4KMLB 4ERSH 5GRJH 3MUHL 5A16B 5ALCL 1D5BB 4APQA 2YC1A 1FLRH 1EFQA 5J11C 2EC8A 3KDMA 2YWYA 3MJ7A 1QRKA 1MHEB 2BVEA 1I1AC 4CVXA 4GBXB 4FFZH 4DKFL 5B4MC 4IIQB 3K4ZA 4GKZA 1JF1B 4OF5A 5I19L 2AAVA 2DQCL 1U6AH 1W72L 2H2SD 1A22B 5DVKA 4PRIE 1LP9B 4GOSA 4HDIB 1IGMH 5DYOB 5FA4A 5I18L 1JPFA 5JR1H 1SEQH 1SMAA 2C9AA 3MRQB 4U2YA 2R0LH 3BZEB 1VENA 1DQJB 2OL3H 4X6DF 1IARB 1NC2A 4U1SA 1EZVY 3MTRA 4OD2A 5D2NE 3RWDA 5ENWA 2ESVE 1X9QA 2Q76A 1NEZA 3NCYP 5DUPH 3TN0A 1PZ5B 2DRUA 2VN4A 4Z5RB 3QIUC 4C54A 4MD5A 5DQ9A 3U4AA 3ULVC 2R1WB 3BJLA 3KJ6L 3MRHB 4NM8L 3RTQA 3BDYH 4U1LB 3HAEA 3VG0H 4WUUB 2DM4A 1JP5A 2QQQA 2LE9A 2V5TA 2XNAA 3OJ2C 1JPGB 4EI6A 2ADFL 1Q9KA 1F45A 4J3OC 3CDCA 4ELKA 2CRYA 5F3BB 4U1NA 4KY1H 3WYRA 2A9NH 4ORGA 3D39B 1TFHA 4ZFZA 5KVMC 2XZZA 3P3YA 1BQUA 3TJEL 1FCCA 2B39A 1EFXD 2I5YL 3OJDA 3K8LA 2QKIB 3GO1L 4PJDA 5AZ2L 2WBJB 4NQVA 5GJSL 3C87A 5D2NA 4X4XA 4RIRA 2ADGB 4HGMA 4WY7L 4JDVA 5B3JF 4NRYA 2PW1B 4I18C 3W9EB 3RTQD 2DQIL 3QAZB 3MJ8A 4DUVA 1U8KA 4GAGL 2AW2A 3EJJX 3BRDA 4P57B 4YXHL 2CKBH 5D7JD 2DLIA 4JFPA 2VDOH 3F7VB 5INDB 4Q9RH 1OB1B 3ARVA 4JO2H 4OQ1A 2C3VA 3H6JA 5HI3C 4HW6A 4V2CB 3RL2A 4HF5L 5IB1A 3UJIL 3H0TB 3O2VL 1P6FA 4JFYA 3PWVA 4OZGF 1N0LA 4FQXD 5ACMA 5AD0A 1SJVA 1ZT7B 5JDSB 2YPLB 4LNRB 1UH3A 3R8BB 4OZGA 1LD9B 2D31A 8FABA 3CFKB 4TSAH 4G6FB 1NUNB 5F7YC 3TBSA 2EDQA 2N7BA 3FOLA 3GMOA 4NJAL 5F8RC 2Z92A 1Q8MA 1IZKA 3LRHA 4QTIH 3NOIA 5DWUH 3VFMB 4PJCF 1QFPA 3T0DA 3IXAB 3IJYA 3VD9A 1QEWA 3S35X 5DRXA 2P5ED 1QLRB 5GRYA 3GFUA 1ZGLP 4NCC1 3RZCA 1K6QL 3LEVL 2HVJB 4YDVA 1QG3A 4KKNA 4P3DB 1X6LA 3C6SB 5INCB 5SV4A 3MRMA 2KL6A 3D85A 1U9KA 2V7NA 3B6SA 1XGTB 1RSFA 4WWKA 1OAYL 4U6YB 5BV7H 2DIBA 1QA9B 4UT9H 2OSLA 3V5DB 5CLTA 1R24A 1HINL 2F54A 2C26A 3VWKB 3BPCA 3DX8B 1K5NA 5D8JL 1DVFD 3BVNB 4TUOB 3BRFA 1OARH 3OSKA 4PJAB 4HIHB 4FTVE 1S3KH 2IALA 3GSWA 3Q0HA 4GW1A 3S4SA 2Z4QB 1U8JA 2ZG2A 3EDJA 3GMLB 1GGCL 3SE4A 5L7XH 1CR9H 4NDMA 3QZWA 4HC1L 3GIZH 1ONQB 3GSVA 1O5DT 4P2QE 2OP4H 4ZAKD 3CCHA 4PJ8B 3VI4E 1R3LB 2QADC 5T1LA 3TEUA 3SKOB 2NXZB 5DSCA 2Q3ZA 1FAIH 1NJ9A 3IKCA 1A6WH 2JCCE 3ZHKA 5E2UL 3UXFA 1ORQA 3KHQA 3QCVL 2PXYD 3D6GA 4XBPB 5IV2A 2Z8SA 1FG2B 3NCYS 4JG0H 3NH7H 4GMSH 4NFCA 4OT1H 4IDLA 1G9EA 2VLRA 4NN6C 4PRHE 3UTOA 5D1ZB 1YEHL 2MCG1 4YHML 5H37H 3ARYA 4K94H 3W82A 3WUWG 3HRZA 1MUJA 1IGTA 3FN0L 1WWWX 4LKXA 4XXDB 5KW9L 3QQ3A 4BFIA 5F1OB 2QQKL 1Z9SA 5CZVL 1KJ3H 2FJGB 2BNQE 4L9LA 4JM4L 3O4LE 2B0SH 4RDQG 1JZ5A 1KPVA 1AE6L 1OD9A 3P4MB 1AY1H 2X5PA 2NW3B 3QHZH 3O3AA 5DMIL 5F9AC 4WV1B 2D0FA 4YK4B 3DMMB 2Y7QA 2DQEL 3ZDXF 4D0DB 3LV3B 1RK1A 4F57H 4QNPE 1NFDA 3D18B 1U92B 3VA6A 1D5BA 1CDHA 4NQCE 1KIPA 1JTPA 2Z93B 3VH8A 4MNQA 5BV7C 4GAJL 4HS3B 4Y4HC 4NBXB 2APFA 3QNZB 4PV9A 1GGCH 1JVKA 2J4WH 4S1DC 1UVQA 3O6ML 2QLVB 4HWZA 1FO0H 2WLZA 3WUWB 3CFDA 4TSBL 2IANA 5JMRA 1Z9MA 4R4ND 2AV1A 4ODXA 3HR6A 3SJVD 3B5GA 2Z91B 2FJFA 4FFYH 3MFFA 3OZ9L 5T3XH 5B3JE 2R2BA 1QO3B 4JKLA 1JPFB 3KPMB 4GBXD 1YYMH 5L88L 1U3HB 2O5YH 3OR6A 1FL5B 5LBSL 1T1ZA 5JW3L 1UXWB 2C7UA 2WBJD 3EYSL 3GUTA 3EDEA 3RWGB 5C0FB 5DMGD 1LHZA 4URTB 4LPTA 3LOWA 4LIQE 3OG6B 5C0ND 1FVDA 4GKSB 4I8DA 5IEKB 4WEUD 3CDGA 4U49A 3IU3A 3JV4B 3U7WL 2VLKD 2Z8RA 3BZFB 4HUUB 5CAYB 3DRTB 3T2NH 4FQHB 1AXSB 5CZVH 4PJBB 2LU3A 5TDOB 1H8OA 2MQ0A 4WW2F 3MRHA 3RTQB 4AIXA 1YEDA 1YEIL 1ZA6A 2VXQH 4M1CC 1JZ7A 4OLZH 1MFCL 2DYPB 1S9XB 35C8H 5C2BH 3WIFA 4PY7A 5IROA 3SKJL 4KQ4L 1JGVL 3FONA 3TT3L 5F7EL 1EDQA 1HI6B 1HKLL 1OAUH 1CGSH 4F7TB 4EXKA 4K71C 2R29H 2R15A 4QXUL 4OCXL 2VMFA 4JG1L 2EKSB 4U6VL 3U46B 3I9GL 4HFUL 1J8KA 1J8HD 4OD3H 2I60L 5HGGS 4JDVB 5MENB 2AK1L 4OIIH 1X5FA 4XPGL 3MYJA 5ERWB 2J8UE 1DEEB 2CO6B 3QO1B 3BEVB 1UXSB 3L3JB 4BFGA 1GGBL 2A6IB 3T3PF 1EMTH 2ZUQB 5EO0B 4RA0C 4Z9KB 3G5YB 1FH5L 1AHWB 1A9BB 2X40A 3PQYB 5B8CC 4G9FD 4HIIB 1SJEB 3V6OC 2V5MA 2VXSL 4IJ3C 5EPMB 2FWOB 2YPLE 3UYPA 4BUHA 3BPLC 1J5OL 1MRCL 2ADFH 5GPRA 4FQIH 1MEXL 3WDIA 2BNQA 4L4VB 1N2RA 3D25B 4MDIB 3VFSB 4POZD 4TULL 5FYJH 3REWB 4KJPC 2VDNH 2V5RA 3C5JB 5FKAB 5B4MD 1FFOB 4Z7UA 1IAOA 4DGYH 1T04A 2F53D 4JY4A 1U95A 3SO3B 4AT6A 4P9HC 2ADJB 2VXVH 4XCCH 4E42B 1NMAL 5C0RL 5FGCE 3H3BC 1MCHA 1A1MB 5B38A 1T83A 4KKLD 4GMTH 2H9GA 5HI5D 4YHPB 4OGYH 1AR1C 5GGTH 3IDNB 3LCYA 2BCKA 5GGRB 3C6SA 4ISVA 5SX4H 3CMOH 4HJGB 1WWCA 3F8UB 3D85B 3BWAB 4K23L 4AK1A 4DKEH 1BVLA 3VFGH 4Y7MA 2CK0L 3TT3H 3BIAX 4H20L 3LAFA 3KHOA 6CGTA 3BPCB 2AEQH 3BIBX 2R29L 3OKMA 4HZLB 3VXRD 3GRWA 3SDXF 3HG1E 4C58B 1SYVA 2RQ8A 4R4FH 3UZQA 4LHUA 3QUYC 2V5SA 1OSPH 3GSWB 3WXVL 5A40E 3SDXA 4F2MB 1FN4B 2ILLA 3FCTA 4LVOB 3TVMA 2HWZL 5D7IF 1XIWA 1CE6A 1PFCA 5CSZB 3A67H 3FFCB 1ORSB 1I3RA 3TYFB 4NYLA 1JZ4A 4WI4A 4YIQA 3KNBB 1CCZA 1I9RH 2D7NA 4Z7WE 3TZVA 5ILTH 1NGWA 5IROC 2EDJA 2HLFD 2IPTH 4OGXL 4RCAA 4JM2A 5J9PB 5GGQH 2WWMC 5HYJD 1OT1A 3BHBA 1EO7A 3QQNA 5K9KA 2VLRB 4MCZB 2NLJB 4MXVF 1Z5LB 5D96C 4HLJA 3MR9B 5L8LB 2JB5L 3MRKB 2WNGA 4E41B 1MLCB 3P73A 4EI5D 2EXYD 2J8OA 1OP5K 4OCMC 4FQPA 2VXVL 4JLRA 4XCCL 3RI5K 1G9NL 1MNUH 1MY5A 2NX5B 2RBLA 1H5BC 5IQ9A 5GSVB 2YZ1A 2Y5EA 3UJJL 3VXRE 1FZMB 3W2DH 5JPNA 2R56L 4MNQE 5L7XL 3PABB 3EYOA 4MHHI 3K74B 2CLRB 2M2DA 3LS5H 2H26B 3M45A 1CK0L 4U3XA 4WRLA 2X1WL 2X70B 1CDJA 3MV7D 4QHUA 3O45B 4R7DB 4Q7DA 7FABL 4N0UE 3HMWL 2KH2B 1K8DA 4K9EL 5DXWA 5FO9B 3MQIA 4XMPH 4JFDE 1FVCA 2VYRE 4RWHA 4YDIH 4GRLB 3UJTH 3X14B 2NTFA 3D3VB 4RA3A 5IWLC 1BVKB 1K4DA 3Q5YA 4P46D 2E6PA 1BD2A 1X3DA 1WZLA 3DSNA 3SDYL 3TN0C 2DKSA 2H3NA 3FT2B 3V8OA 1M05B 4EOWH 1KGCD 5JHLL 2HP4A 1SEBA 5DQJB 2OS7A 1TJGH 1NAKL 4HS3A 3WS3A 4XAWH 3OMZA 3V79C 3RVWC 1KXVC 2DL2A 4CRPA 1VFBA 2MWCA 3J8F7 3UTSB 1AO7A 2JJWA 3QQ9D 4L3EE 5CILL 2B4CC 5DD3L 3HAEH 4PY8I 4QRQA 1P53A 1GXEA 1FZJA 4F7EA 2DLHA 4OB5L 2AEPH 5JIPA 5FYJU 2W38A 1OPGL 3LEXA 4H25A 2PXYB 3VE0A 2AXFA 1U3HA 3OR6B 4LNVA 5I73C 2IPUK 4DW2H 4KI5E 4L29A 2ICWI 3RWGA 2HT2D 3NZHH 1YECH 4RX4A 3MLUH 5IM7A 1FVDB 4NHCH 3MRJA 3PWJA 3RWFA 3H9SB 4LLQA 4WHTA 1E28A 3C9NB 1NUDA 1VKXB 2Y5TB 1J88A 3UTSE 3T2OA 4NJ9H 5GRUH 5F9JB 2JCCF 5TF1H 4D9RE 1FFNB 3HPLB 3B2UD 1XF5A 5LWYL 1SJHA 2ZPKH 1RVFH 1BBDL 3GNML 3FFDA 1W8OA 4PJBF 5B39B 4G6ML 5F72S 3TBTB 4PP1D 2FL5A 4IRJC 3W11C 3RUGB 1OGAD 2R56H 1NL0H 4OLVL 1C16A 4LSSL 3W9DA 5AEAA 5EU7E 4ONGL 3WIFB 5FYKE 4QRSA 3BXNB 4YXLH 3RWCA 4IS6B 3GIVB 3LKNB 2X4UB 3DUSA 4BA8A 2YC1B 5TH2B 5CBEA 4XMPL 2AABL 3ECBA 4NGHH 4F9PC 4KJYA 4PJIE 4G42B 5IJKA 1XGQB 4ZSOB 32C2B 5JW3H 4GKZB 1MFBL 1R5IA 1A9EB 1G7JA 1H15B 4L9DA 3ARPA 1F42A 4I0CC 3C5ZC 2BOBA 5CJ8A 5F96L 5FO8B 2JJVA 3O6FD 1FJ1A 5CP3A 4L3EB 2BVTA 3IAGC 5TQ2L 2CD0A 2D7QA 3QH3A 4X6DA 4NQDE 2MKLC 5B21A 1N5YH 2XQBH 3LKSB 1F11B 5DD0H 1HWHB 2VAJA 3QUMB 3KLAB 2KUTA 4KMQA 3TA3A 4MS8C 2D7MA 2Q76B 1N5AB 2BNQB 3AS2A 3PV6A 1MCEA 4LQFH 2CMRH 3KPSD 3MNWB 4PJIA 4I9WD 5BVJB 3BGMB 3X12A 1NGQL 5ESAB 5EC2A 4S1QH 3UJIH 3SDAA 1LO4L 3WS6A 2Z8VC 2VLKE 3DVIA 2HG5B 1I7TB 2PN5A 1L9MA 3HE6B 3FTGA 4ELKB 5LGKA 5EO9B 3E3QC 1AXTL 4UAOB 1RUPH 5C0AD 2D9CA 4P5KB 4HGWB 4K7FB 1EK3A 3FN9A 3VRJA 2IH1A 3MJ9A 4M6OL 5DJCB 4KC3B 1ZA3B 1Q0XL 4M1DH 2C4FT 3WFCH 4NNYA 1OGAA 5IKCB 1TITA 3IDGA 4WFED 5DVOA 3GHBL 4PRNA 5C08A 5LAXB 4RGMC 2WP3T 4HZLA 4NRZB 4QXWA 3PP4L 1OP3H 3RX8A 2VDKH 2MQ3A 1UEYA 4ONOA 5FB8B 3TC9A 4JDZB 1V7NH 5D7IB 3V0VA 2G60L 3UO1H 5BRZA 4P0DA 3P30L 3ZYJA 5D1QB 3O11A 2VLKA 2DMBA 3F7VA 5INDA 3RVWD 4WVRA 3BRGC 3FCTB 2XN9E 4GRMA 5F7KC 1S7XA 3C8DA 4XPTL 4UOW0 4WUUD 5CCKL 2V5YA 1WAAA 8CGTA 1DBAH 5LXGL 5ALBH 3BP6A 3D39D 3PWVB 5E4EC 2DICA 2EIBA 3DBXB 4KTYA 1HH6A 3PWUA 4Z78A 1F8TH 1IEAA 4NKOA 3ARFA 3GMRB 3ZSSA 5HDLA 4NUJB 4YDJA 1MPAH 4QOKE 4RFOH 4KVNH 1KIQB 1M7XA 3SKMA 5JHDD 4X9BA 1A4KB 3SGDI 1CICA 2CGRH 5DFVD 4DKEL 2HJLA 2VDPH 1G1YA 5IB3B 1RUAL 3EDKA 4NZTH 3PL6D 2NY0C 4KH2A 2IEPA 1PG7X 5FM8A 1GL4B 4ZOAA 4ORZC 4JAMB 5DK0B 3Q5TA 2FEEI 3ESVF 1Q9WA 3MRRA 1YEHH 4DEPC 4WWKB 1YJDL 1ZS8A 1BWMA 4MAUL 4LCWB 5MP6L 3TWCH 1I1AB 4M6NL 2IGFH 4WDIA 1S7WA 4MVBC 4ODTH 5FIEA 2OZ4A 3N85H 5TF0A 4BELD 3ORJA 3BVNA 4NWUH 5JW4Q 4D3CL 5D7SH 1J1XL 2F8VA 4LF3B 1T20B 4N5EC 3FL7A 3HN3A 4BZ1L 4NM4L 1IGCL 2DQDL 1X5LA 2E7LC 5ESQA 2VABA 3QI9B 3FZUD 5GGQL 3AREC 1KCUL 3HC4L 4CNIB 2D2OA 3K3QA 4I5BB 2XI9A 3OJVC 2E9BA 3TO4A 4M9PA 4FQLH 2VSCA 3UTSA 5DSCB 4YH6A 5DD6A 1XH3B 4M61A 4LQ1A 3RVUD 5T1LD 1J9CT 3KPOA 2AJZB 4R26L 1O0VA 5F1IA 4GJTB 3BPOB 3FB8A 4TUJA 2PXYA 4XX1E 3VE0B 5E2TL 2AGJH 4X6CB 1A7QH 5EORL 1T4KA 3O6MH 5DFWH 3FO9B 3ZKND 4FXKB 4X80L 2IPKB 4NN7B 4HKXB 3WDJA 1JTOA 3RL1A 3PWJB 3V5KA 4AG4H 1P2CB 2CGRL 1J10A 3JTSB 3NIFE 5DEZA 4OFKA 2A6JB 1E28B 1AGFA 5IB2B 3MLRL 3OPZH 4U6TA 1IL1A 1RUKL 3FZUC 4HD9A 1HZHL 1IGYB 3MV9D 2VLRE 3VDAA 3QXTA 5I1GH 5LBSH 4G9FE 3BI9X 1IAIH 4XH2A 4ALAL 3MGAA 2PYFB 4U0RC 4EOWL 4FTVB 4BZ2H 3DIFB 4YWGH 5GQBA 1LEIA 3TBTA 3H9HA 3INUL 3GI8L 5GHWH 2LV4A 1TQBB 4R96A 3U7WH 5KTEL 2A6DA 4MAYD 5E9DE 3BKYL 3GJEB 2NY4B 4IS6A 5DO2D 1U92A 4OZFA 5C3LD 4Z7VB 5FHBL 4OB5H 3DTXB 2NY5C 1N4XL 1BVZA 4NPYA 3MNZB 4BZ1H 2P8LB 1IEHA 4G6KH 4XC3H 1YNTA 1LEGB 2QJDA 2J3SA 3BYTA 4JKWA 1LDSA 1JGDA 1BWWA 3Q3GA 4XCEA 1TPXB 4HK3J 3D3VE 3S96A 1A14L 3L95A 4AEFA 2Q8AL 4ODWB 3KYAA 1MELA 3ARBD 3DSFL 2Z91A 4J3WA 1J0HA 1EJOL 5F8QC 4JQIL 5C1MB 4ACPA 5CP7A 1FL5A 1HK6A 4KAQH 4QXUH 1A4JB 3U4BL 3QH3B 5DJ2B 1MCIA 3GMPA 3Q6GH 2PYEA 1IKNC 4G9FA 4OZ4B 4FS0A 2ICWB 5F6HJ 1DUYA 4RMUA 3X3FL 1NL0L 1RZGA 1NC4D 2LAGB 1B0GB 3SY0B 4RRPA 2EDOA 3MJ6A 1JNJA 1ZHKB 4Q74A 5J6GA 4GQ9H 1EMTL 1UZ6F 3EHBD 3PNWB 4FQ1H 1UM5L 4XPBL 5ANMA 1CBVL 4P2OA 4ZQKB 3CX2A 3IFLL 1DQQB 1MRFL 4NGHL 1D5ZB 4PJAF 1IAIL 4ALAH 5JQHC 3NH7L 4XZUA 5KS9A 1HSAA 2GCYA 2YOCA 3CVHH 4LCIH 4NZRH 2A0LC 1ZANH 1HXMB 4MJIA 4K8RC 3KPRE 1JNHA 2RB8A 3VDCA 3SCMA 1DCLA 4U6HB 1KTKE 3VFRB 3M17B 4OD2B 5D7LA 3RWDB 1FAKT 2IH1B 5FYKD 4DTGL 5ADOL 1T6WA 3ILQD 3O9WA 5E9DD 3Q6FA 1CG9A 4X0KA 3BD5A 5E08H 4OZHA 3RKDD 3X11A 4JPIB 2DLEA 1ZHLA 1VGEL 1HIMH 5E4IA 3ZT5A 1S8DA 4K3DL 5IBUB 2Y6SC 1PLGL 1J1OL 3RU8H 3E0GA 4AEHH 4CVZB 4J7RA 2X1QA 6FABL 4XB7A 5EOCH 5SWSD 2G2RA 5BO1L 5D7JC 4HK3N 1Q72L 5I66A 5I19H 4Z7QE 1UXSA 3OXSB 4HXAH 1NGZB 3PDDA 1HNGA 4RNRB 4OM1H 5BRZB 1MJUL 1DBKL 1T1XB 1RJZA 4JRXE 4NN6B 1A9BA 3PQYA 2VLJA 5I1JL 1BM3L 2ICES 1C12A 3NGBC 3ARBB 1U8OA 1X5JA 1WT5A 4EIZC 2B20A 5D7KD 1OGTA 3U0WL 3DBXA 1F6AA 4RAUB 3TBVB 5H35B 4LFHD 3MREB 1CU4L 5DMKB 2VJXA 4NRYB 4GAJH 3GMRA 4LASH 3SGEH 4WEBL 5DK2B 3ARGD 5IVXB 1CFNB 1FFOA 1G9NC 5SV3A 4KDTC 2X6MA 3RJQB 4JY4B 1A6AB 1BZ7B 4QO1A 4RZCB 1A4KA 1JJUA 3EYVB 4XHJC 1C5DB 2BY2A 3RA7L 5HXMA 4TPRL 1P84K 3SBWA 2C3VB 3LRSB 4I4WB 2E7HA 3O3BA 4PLOB 2G75B 3IXTA 5E8EB 1BLNA 2PW2B 3MCKB 5EOQL 3BQUA 1MRFH 4EVNB 1U8HA 3HB3D 1IGFH 4LOUC 1HQRB 1IILE 1U8LA 2BZDA 2ITCB 2EDLA 3DV4A 5DMIH 4O5LL 4APQD 1KENL 4WUKH 5AG9A 2ARWA 1FZOB 3UO1L 5SX5H 2Y06L 5HGBB 2ZSVB 4HKJB 3DYPA 5ADOH 2BC4A 4TNWF 1UENA 4J3XA 4WFGD 2CUMA 4UIKH 3TT1H 3K80A 4Q6IC 3MV9E 2GT9B 4LAJH 4HIJB 5AUMA 5JW5B 2RGSA 4RMQA 4QRRB 3N0PB 3BZDA 1NDMB 1QLRA 2NY1B 1PG7L 4ZPVA 1S7UB 4F2MA 1U2CA 1MFCH 1U93B 5DK3A 1EZVX 1IFHL 5HHPA 2R0KH 4FTVD 1I8IA 4XVUD 5CZKA 4YBLC 3VJ6B 4WFFD 4R8WH 4GLRH 3HUJE 4LIQH 3ROOA 4BK4A 3RX5A 1ZT1B 4NNXB 1KJ2B 3G6AA 4A6YB 5DD6B 2W60B 4G3YL 5BZWB 4OCXH 1FO0A 4LVNC 4Y5VC 2D3VA 3A6OA 2AJXL 5DQDH 1YNKL 3FB8B 3DX6B 1RK0A 1RFDH 1OLLA 2R2EA 4F7MA 5I8OH 1NAKH 2NX5D 3RTQC 1PZUB 3AMKA 4ZFGL 2F58L 2R1YB 1C5BL 3JVGA 3U7AA 3KYMA 3EO1B 3PGCB 1GGIL 1TNNA 2ZP0T 4C59B 1QVOA 3MXWH 2ZOKA 2EXYC 1QBML 1WEJH 3VXSD 1IGYA 1FNGA 1OD7A 4HBQA 3UAJD 1UKSA 4DW2L 5HYFA 2XN9D 4ZOCA 4KK8C 2BNUA 3VG9B 4WUKL 1GZQA 4N9GA 3DIFA 2A0LD 2P7TA 5C08E 3H9HB 5C07A 5D2NC 5FO9A 5DJ6A 1JRHH 3MV11 2VZOA 5BOPA 5I8KH 1M4KA 1BD2B 1OT2A 1QR1A 3T8XB 3HZMA 3WIHH 2GKIA 2XA3A 3WFHB 2P8LA 3VXRA 3KLSA 5I8EB 4XPGH 1AHWC 1LEGA 4PS4H 4LSSH 1U8MB 2VISA 2IADA 1JGDB 2VDRL 4PBWD 4U31A 5J4MA 1D5IL 2VXTH 5GSRA 4OTXH 4YAQB 4PPTA 1CGYA 1VCAA 1RHHB 4Q2ZA 4U1IA 3SGDH 3VD7A 4P9HH 1NFDB 2ZUSA 4OLYL 1V5JA 3PWPA 4Z0BL 1LMKA 1KBGH 1A4JA 5F21B 1OOAA 2YKLH 1HCFX 4TSCH 2P49B 2EEDA 4XWGH 3VH8B 1KJ2L 1CDUA 4A6YL 5KVFH 1F6FB 2VLJD 1INEH 1ADQA 5HY9B 1ED3A 1KN2H 2B7DT 2F58H 5E0QA 3U6RA 2HTKC 1MCOL 2YD4A 4YQXL 3SPVA 4PYGA 4FQCH 5J6GB 4MLSA 2Z35B 2IANB 2J2ZA 3PWLB 4OZHE 4LLMB 2A74A 2EYSA 2RCSL 4KXZI 4LGRB 2R0WL 3GBNH 2XQBL 2XZQH 4NC1C 4QT5A 4HAFA 4U1JA 1Y0LB 2CH8A 5HPMA 2IPTL 4UTAL 3GUTB 1MCFA 1VACB 1WSST 4OM0L 1V8HA 3HR5B 3BXNA 1FZKA 2F8OA 5FUCE 4GKSA 1J12A 2X4UA 3DETD 5HHQB 3VFRA 1CDIA 5EWIL 4NQEE 4LKCA 3MOBH 4F57L 3O9WB 3VWJC 3Q6FB 1ITBB 5E5MB 4ZS6C 5IBTH 4V1DE 3X11B 1TZHA 3G6JE 4XNXL 3B4NA 3ZE2F 1PYWB 4Y4HD 3I2CH 2VAAA 1F4YL 3DURA 5FCUL 3WIHL 4M6AA 1JZ3A 5MEPA 3RPIA 5MHSD 2CR6A 4XP9L 1QQDB 1ETZA 3CH8A 4YHOH 5E94B 4D9LH 3IDXH 1S9XA 5FYKU 4XHQA 3PGFH 3F7QA 1NGZA 3BAEL 5GJTL 5C9JA 4G8GB 3QDAA 4MA1B 5KSBF 4APQB 1RZ7L 1RIVH 3E8UH 1KJMB 2AK4D 2FBOJ 2X89D 4NM8H 4ODSH 1SVZA 4R9HA 5HDOA 3UTPD 1B4JL 3GHBH 5I6XC 1KEML 4K8RD 1H3TA 4PGEB 3EYQC 3QDGE 3SDCB 3TA3B 1QYGH 2DF3A 1B88A 5DHYB 5JW4M 4RBPH 1WFTA 5IT2L 2QSCL 1QBAA 3NIGE 3V0WL 1KG0A 4JO3L 4TOYH 3QUXB 5CBAA 2HG5A 1NH6A 1EFXA 2JE8A 1GC1C 3FQTA 5E9DA 1G9NH 4U6XB 3PWNA 5C0BE 3FQXA 2OXGA 3BQUB 3FQRB 2L0DA 1WTLA 3QDHA 3TBYB 4G7YH 1MPAL 4HGWA 3THML 4OLZL 1G1CA 4G6JH 5DJCA 3QQ9C 1J1PL 4MYWB 2ATPB 1RULL 4LVHC 2ADIB 4KUCD 5D1ZD 1XGUB 3QHFL 3EOBA 2YZ8A 3K1KC 1WQVT 3S36X 1U95B 3F6LA 3GSOA 2ZUXA 1RZFL 5EO1A 4CDHA 1EA9C 2EICA 1CD8A 3N1QC 4NRZA 1JPGA 1Q9KB 4JN2B 4U6VH 4YHNB 3EAKA 5F3BA 1RVFL 3OR7B 1PG7W 3CLFL 4ZFZB 2H9GB 5FUOL 5T1MA 1WWBX 1VEOA 1TZGL 2XWBA 4GRMB 3G6JB 4UUJA 1IQWL 3MLZH 1A3QA 1I1FB 2BSSA 5GS3A 3QFJD 1ZSDB 2E9IA 4X8JB 4Z8FL 2BFVL 1FH5H 1SJXA 3QXUA 3PWUB 4YPGA 4FXLA 1FVEB 2GW5A 4Z7NE 3QXAA 3CFIC 1RY7B 4ELMF 2PW1A 1FV1A 3SKNA 1BMGA 4QRUB 3VXSA 3V4VH 3WD5H 1ZHNB 4R2GC 3MYZA 1RK0B 4OCSH 4UZGA 4NHCL 3IDYC 4AMKL 4F7MB 1CICB 5TE6L 1T03L 1HE7A 4DCQA 4HCRL 4JFDB 4F7PA 2QSCH 5GRXG 2HTKD 5IB1B 2DMKA 1Z2KA 2MFNA 3R1GL 2QSQA 3GK8L 3SE8H 1QVOB 1I3RB 4JM2C 2V9RA 1BZ9A 2P5EB 2YPKB 4EKXA 5F3HA 1JUFB 1NGPL 2YPLA 4HS8L 3ZHDA 1HHJB 3V6FA 3CFKA 3G08B 1SM3H 2WLYA 5C8JB 4D0BB 1MH5A 1N6QH 2EE3A 1J0ZA 3V0AC 2HT3D 1AGEB 3VFGL 2IWGA 4PJXB 1CLZL 3IXAA 5C0EA 3OPZL 4LF3A 4X5LA 5DRXB 3C5ZB 1OLZA 3FHAA 1QACA 3D2UB 4FQXB 1JMZA 4Y4FB 5C0DA 1CF8H 2HVJA 3T8XA 5F6IB 3UYOD 4MJ5B 4PTTB 2NX5A 3NN8A 3WFHA 4UDUB 4CMHC 5C0JB 3EUUA 2WV3A 5J7CC 3M8OH 1DQDL 2FO4A 1C08A 3H7LA 4H0GA 2V7NB 3B6SB 4KKBD 4MNHA 5JPNB 5KTEH 2E7LA 3ISWA 2WSKA 1C5BH 1WGOA 1MCPH 3GEWB 4M43H 5EFIA 1OCWH 5TQ2H 5ALCH 3LN5A 4PUBH 4CW1B 4JGMA 4W81A 3X14A 4KJQC 1KEGH 3TO4D 3Q5OA 1BEYL 5CIPB 1HEZA 3KYKL 1MHPL 1U8JB 1ZTXL 3SDXE 4P2QD 2VKWA 2QEJA 1T7XA 3N9GL 5IJVA 4DVRL 3NMEA 3ZKQD 2ZJSL 1CDYA 3WS3B 1NGXA 4J8RB 4UQ3A 3CFJB 2X41A 2UUDK 5HD8D 2EDBA 1OTSD 3RKPA 2OK0H 5BW7C 3U6RB 3MLWH 4OFPA 1EH9A 4MMXC 3RVXD 4PP1C 1FZJB 5BOZG 3PHQA 4P4RA 3ZE1E 4Q9BA 2PYFA 3LEXB 3KJ4B 1CGUA 1RUPL 1Y0LA 3VW3H 2WWKO 3CFCL 3PQYD 1PQZA 2UWEB 1MUJB 1Q0XH 2O61B 5IM7B 1HKFA 3ALPA 4KJQD 2ZCKH 2XTJE 3FO1A 5D4QA 5H2BB 1FE8L 3P11H 5L6YL 2VDPL 3EFDH 4EDWH 1NGYB 4UQ2A 5DJAB 4R97B 5C6TL 5D1QC 3WBDA 4IRJA 4GLRI 3RWIB 5J12B 1MIEH 2Y72A 4PB9L 3O3AB 4PRHA 3WN5B 4XCEB 4ZUSB 4Q9CA 3TFKD 1K8IB 1E4KC 4XVTH 3A0OA 5IQ7L 1KB5B 2ZCLH 4XAKE 2P1YA 3CZJA 4FQJH 3IKKA 5F6HI 5ADPH 2E7MA 3ULUL 4M6ML 1WISA 1B6UA 1YJDC 3AS1A 3FQWB 2VQTA 4QRSB 3RWCB 1CZ8H 2BP3A 3LKNA 3O4OC 4JPWL 3MXVL 5IBUG 1HYSD 1JHLH 2Q20A 4RFNC 2FGWL 1G7MA 1AGDA 5A16A 2P8MB 4CN1A 5A3ID 4K3DH 3AM8C 3FMGH 4MAYB 4GKNB 1PY4A 3QWRD 3FJTA 1DBBL 1XR8A 1CWVA 32C2A 1MHPH 4PGEA 1UA6L 1R5IB 5DHVH 3LPGA 1B4RA 4NWTH 3CFDB 4JFQA 1LE9A 3KVQA 4KQ4H 2AV1B 4P2OB 3MLSL 4FG6D 4GUPB 3WSQH 4L3EA 4GT7A 3BH8B 5LVEA 1AXIB 3LRGA 4M8QB 1EFXB 5TE4H 4IRSC 4L8SC 4M00A 3OB0H 2A1WL 4E5XB 1CD1A 2K7PA 2IPUG 2NY2D 5C7XH 1VPOL 3SCMB 4OV5A 5F9OL 4JFZH 2C3HA 4RMVA 4JVWA 1A47A 1LE5B 1CG9B 1DL7L 4ONGH 1N5AA 1FC1A 3HUJB 3HS0A 4N90E 3H3PL 4XAKD 2ZCKL 1QSFD 4XWOD 1NANH 5C0GB 2XY1A 4XNQB 5GGVL 1OTTC 4MA3B 3SDAD 4FQHA 3RAJH 3MLRH 5TFSH 2I27N 5ICYB 3T4YB 1S8DB 4FP8H 1X5HA 4C56D 5EC2B 4EUPA 3GSOB 4IMLA 5T1KD 5EZIH 1CN4A 3ROLB 4HPOH 1DN0B 3SKUD 4OZIB 3LSOA 2G2RB 1J8HB 3NFPA 4QOKB 1BFVH 1GGUA 1MIEL 4O51A 4PB9H 2DYPA 3HG1B 5I1IL 5DVMA 43C9B 3QFDB 1Q1JH 4WHCA 4XP6L 4K7FA 2XFXB 5L0QC 5DA4A 5HBBA 2WUCH 4NZUH 4UIKL 2OI9B 4DGYL 5C07D 3T65A 1MIML 4JZNB 1ZSDA 4NN5C 3CPLA 4OFVA 3LN9A 3QDGA 2VL4A 2BHUA 1T22A 2GFBA 4N0RA 5GGTL 2CJUL 4N1CA 4QYOA 2HLAB 5FK9A 4QRPE 5DEGB 5D1QA 4O2CB 3GSRB 1C5DA 4PV8A 3LKQA 3C5ZD 3CZFA 5ACZA 2CDGA 1AQKL 4JFDA 3IU4L 4TN9A 5EBMB 3MLSH 1NCWH 2XWJB 3P0VL 4HIIA 1SJEA 5JR1L 2XIDA 1TCRA 4M48L 1BZ9B 1L4IA 3VFTA 1R3KB 1I7ZA 2VE6B 2IFGA 4LLWB 4P46A 1CFTB 3KPRA 3BDXA 5I8CB 1DLHA 4QKXB 5D6DC 1RFDL 4OV6F 4PJHE 3DV6A 5ETUA 1FZOA 5C7XL 4MLIA 5JXAH 2IMNA 2YN3A 5I15L 5HGBA 5HTSA 4YHMH 4JFZL 1OW0C 3C5JA 4J3UA 3H2WA 4GBXC 4KVCH 3BKYH 1T83C 1T04B 4CGTA 4Z95L 1MHCA 4G7VL 4MZ2A 4JRXB 3QR2A 2FSEA 3EJYD 3O6KH 1OHQA 4HIXH 4NFDA 4QRRA 2D03L 5JLZB 3VXUE 3KJ6H 1N8ZA 5D5ME 1JGUH 5IB3A 4P2CG 4AJ0A 2YBRA 1Q9OB 3GJFH 5E8NB 2FB4H 3O2WL 5EBLA 3T1FA 3EJZC 5I1DA 1REIA 4ODUA 1WBZB 3NN8B 1P7QA 3ETBF 1PKQA 1GJIA 3WFDH 2N1KA 4NQXA 2Y07H 4PJXE 2IBZX 1GIGH 2AS5M 5TPWH 1JRHL 4NNXA 3LQAL 1KLFA 3AU1A 4Z7UE 4P2RB 2QSTA 1MLBA 1S7WB 3PDGA 4ENED 3U4BH 2O5ZH 2BSTA 3TH4T 4JRYD 3ZTNH 3SQOH 4TVPL 3ABZA 5EA0H 4LHUB 2OL3B 1NGPH 3QSKB 2BSRA 2VZ1A 5KSVB 1KPUB 3S7GA 3MNVA 4YDKL 3BFOA 2WMPA 1T5XB 4RISL 1S9WB 1N6QL 4X5XA 1QRNE 2EIZA 3QZWG 3KYMB 2DBLL 3C60A 1N64L 3OG4B 3BIKB 3FFCA 4G43B 1NGXB 4O2EB 4WW2C 5L2KA 3TO4B 2ZOKB 4XNZC 4QRRD 3TYFA 3QISA 1AQKH 1DBMH 1R3IL 1RU9H 4OI7A 5DT1L 2XWTB 2DWEB 3GSNA 3IFNL 4YIQB 1RJLB 1R3JA 1F90H 2VLLA 4ETQA 4R90L 3P9LA 3OKLA 4OCWH 2UZYB 5E5RB 3GSQB 1PAMA 3D0VA 4NQDA 4KJWD 3BMVA 2WBJC 3CJJA 1AFVH 4OF8A 3VRIA 3MR9A 1MQKH 3BSZL 1UWEH 4BYHA 1ROWA 1TENA 1HDMA 1CVRA 1MOEA 1LWRA 2YD3A 5D71H 4M6NH 3OKOA 4FXKA 4GRLD 3BH9B 2VR4A 5E24E 1MWAL 4R2GD 3R06B 3BD3A 5C92A 5SWQA 3QEGH 2YN5A 1AGFB 3HKFA 4X7EC 1QR1B 3EOAB 3WIIL 2CUHA 4DZ8B 1IL1B 1QSEB 5EOQH 1INQA 5DRZB 1V3KA 3ULUD 1CXFA 2CLZB 2QR0A 2X4TB 3UZEA 2FYYA 2NW2A 1EJ6A 3KXFE 4P23D 4XPFL 3WLBB 2L7UA 5D2LF 3LQZB 1R5VA 4N8VA 5GSRB 2KPNA 1L6ZA 1JTTA 3W0WD 4P5MB 2COQA 1KXTB 4YZFF 2K7QA 1JGVH 5IF0A 2A6DB 4NKDA 1QHOA 3SCMD 2VL5B 1JWMB 2UUDH 4FA8A 3CX5K 3OAUL 4PJ5B 3KPLA 1F4YH 1DTUA 1URLA 1HHGB 2OLDA 1AQDB 4FN0A 1SEBB 5D9SB 4HH9A 3MV8D 2NXYC 3BKML 1CFVL 3VFUB 2F53E 1ZXQA 1ZLSL 4LCCA 4NQUA 2NPLX 1T2QH 3O3UN 5FECA 4XBEL 5J89A 3RA7H 3GB7A 1DN2A 5EOTA 4F7EB 2G9HA 4KZEL 2JK5A 4NQEA 1QKZH 1S5HA 4L4JA 2IAMD 1D3CA 4ZDHB 3VI3E 1EEYA 3VXQB 1MRCH 5DJ2A 3BZEA 2AJXH 1TETH 1YEGL 4JKPH 2V2WA 3HI5H 5CWSA 5F7MC 3VI4F 4KTEL 4M8VA 1WWAX 3I3BA 4OV5B 5KANG 3NFSH 5KZCD 3BT2H 4N0CD 2B1HH 4TUKH 4F15C 5D71L 2IBBA 1ZVSB 3C5SB 1NEZB 4NQED 1ZHKA 2ENSA 4JY6A 1FFNA 3VWJD 3HLAA 2XN9B 3ZLQC 3EFFA 3ZYOA 1XF5B 3HNSL 4P2RD 4NQCD 4JM4H 2GSGA 4JM2F 4YBLB 5M7QA 4IMLB 1EHNA 3C09B 1FFRA 2W9DL 1PY9A 1KC5L 4QOKA 3GI9H 5FGCB 4M5YH 1HSAB 4GRWE 3U9UB 5BJTB 4KK9C 4DOHE 5TGBA 1LO2H 1UJTA 43C9A 1EBAA 4HXBH 4G8GA 1RZ8A 1FL6A 3U1SH 4LP4A 1IGML 1NPUA 4X0KB 4YE4L 5I1KL 3D0LA 4L5FH 2P47B 3WDHA 2F19L 3EZ8A 4H1LA 2IC2A 2WBJA 3LEYL 5I17B 3MRFA 4LCWD 5HDQH 3OAUH 2KDGA 2MQCA 2XKSA 3T3PE 2C3GA 5D93C 4LSDA 1MCJA 1PX4A 1NC4A 4UV7H 1YZZA 1ACYL 1DDHA 1MWAA 4XRCB 4PJCA 9CGTA 5I66B 2LQRA 5FO8A 1ZGLM 3ARGC 4AIZA 1Q94A 4UILH 1FLTX 1IAII 5BMFL 1H8NA 3FQTB 3ZDZE 2GY7B 2VB5A 4QEGA 3DMMC 3DJ9A 2VLJB 3ARBA 1VSCA 4MNQD 3FT3B 2O5YL 3HE6D 3MO1B 1T3FB 4PJHB 1DFBH 4HIEA 3NTCL 3ARDD 3STZB 3QEHB 4LCIL 4NZRL 3DV6B 5ETUB 3UTTD 4L1HA 2D31B 5E5UB 3RVVC 3AB0C 3EOBB 3SE3A 5CMAA 3VFVA 4N0UA 4QWWD 5CCKH 2F54E 1T66D 3GK8H 3SE8L 3DXAB 2X4QB 1DBAL 5LXGH 1CQKA 4P49A 1MIMH 2F5BH 4X6EB 2XPGA 2ZUWA 1JK8A 2OZ4L 3IXTB 1BLNB 2PW2A 1QEWB 3QIWA 2XZQL 1A6PA 1F4WL 4LCCC 4OQTA 4F58H 1U8HB 3UJJH 2UY6A 5KVEL 3LKOB 2W9DH 3BYYA 4WW1A 1X7QA 1Z9OA 2ITCA 4PS4L 3AY4A 4PJ9A 4RFOL 4ZXBC 4UU9A 3NA9L 4Q6IA 4PGBA 3HI1A 3MRMB 4Z6AT 4D8PB 1XGTA 1T0NA 4UV4L 3SE9H 1B2WH 2NY2C 3MOBL 2OSLB 1GGYA 3V5DA 4X8JA 2NCMA 3IDGB 4OLYH 4QNPF 4Y2DA 1M6OA 4Q9QH 1KN4H 4HUXB 3ARDA 2EZ0D 1OP3K 5FB8A 4I2XE 1AIFA 2ICEB 4UB0L 1S7UA 4P3CH 1KPUA 2VLKB 1Q9LB 3ARUA 4JZJB 3OV6A 5CGYD 2ICWJ 3ARFC 3CCHB 4PJ8A 3VJ6A 4O2EA 2ZCHL 4DUXA 1A1NB 3O8XC 1R3LA 1G7IB 3L6FB 5T1DL 5EU6B 2RCSH 4DKDC 1JMXA 1NJ9B 1RJLA 2KZWA 3IKCB 3EYFA 3MLVL 2N7AA 4KRNA 4XMLH 4Z18A 3RZWA 2FB4L 3B9DA 1P4IH 2YUVA 1FO0B 3S37L 2X4OA 4WI8A 4YUEH 3L3OA 2GJ6B 1NFIA 1OAZL 4NQCB 5FYJE 1MH5B 2SEBB 1MCNA 3D0VB 1OTUD 4NQDB 2R2EB 4PTUB 4S11A 1F4AA 2EDNA 2YR3A 2ERJB 4P5TD 3DX7A 1XIWD 2VDNL 2EZ0C 3R0MA 3BZ4B 3WV0A 3HRZB 4HGKC 1IVLA 3T09A 3QJHB 5GRUL 4ZO9A 3QP3A 5D8JH 3GHEH 5E6YA 4PJGA 2Q6WB 4MJ5A 4L9LB 5EH1A 4CUCA 2NY3B 5DD5H 4C57C 5AYUH 5DRZA 4PBVC 1X4ZA 2X7LA 3CFCH 2EDDA 2YD1A 2Z31A 1GZQB 1OM3H 4U1KB 1K3ZA 2K9UA 4I3GA 4K7PH 3BPLB 2VDML 4CKVX 4U1MA 3TIDB 4MB3A 2WINB 5BS0D 4P2YA 4TVSa 1RIVL 3H3KA 3MOAH 3O41B 2AABH 4GO6B 5D5MF 1B4JH 3HNTH 1YNLL 5KZCB 3OAYK 4WTZG 2FO1A 3MRGB 4B50A 5JNYA 3EJYC 2PO6D 2Z93A 1YNKH 4AZ8A 4JDTH 2IAMA 5IIEA 1MRDH 4P4KA 4R4BB 1MY7A 2R8SL 4RRPG 2YD8A 3DVNB 3T2QA 1U42A 4UQ3B 5CJXC 3I6LE 1KTLB 3BQUC 2R69L 3DX9A 1IGIL 1V05A 1BQHA 4U33A 4TOYL 3A67L 4KRPC 1LK3H 3MZTA 2R9HD 3MXWL 4OSUH 4N8CL 3PDOB 1DLFH 1OF2A 1QTYT 5F1IB 4DN4H 1ND0A 3ZT6A 3HZVB 1EXUB 1U58A 5CJ5A 1DQTA 2KZ1B 4PJAE 1DBBH 1BAFH 3VXQA 3K46A 3AGVA 2HKFL 2P8PB 1T4KB 2Q3AA 4H8WL 4EI5B 1S9VA 5FGBA 3UTTE 3MOQA 3TPUA 2FHFA 5HY9A 3TP4A 5IEKA 3V5KB 1IC4H 4PLKD 4K3JL 1TLKA 2NY7H 2KBGA 3PV7A 2W92A 4Z7WF 3C5SA 3CLEH 5BRZE 3F12B 3WFBL 5KSUA 3BZFA 4M7ZB 5I75C 4Y1AE 4XBGA 3RGVB 3GRWL 3RIAF 5HGDB 3CUPB 3RGHA 4LLVB 3S37X 2D7PA 5IHUL 4FZ8H 4P23B 4KMTH 3CC5B 5HPMB 5IVXF 12E8H 2CIIA 3VWJA 5D5MB 5SWZD 3UTQB 4L8CA 2LAAA 3GJEA 1CK0H 1UJ3C 2EKJA 2PCPA 5CKAA 1BOYA 3U30B 2LVEA 3QIBB 4LPYA 3IF1B 5HGHB 4I3SH 2AXHA 2OTPA 3KDMB 4WU5B 5DC9B 3IDYB 1HI6A 2XTLA 4OF7A 2V2XB 3MNZA 1KBGL 5KAQG 4DVBB 5IB4B 4XGZB 3MODH 3O3EA 3CVHL 4JDTL 1NC4B 1ETZB 4ZS7L 5I2IB 1DDHB 3NFSL 4ZG1A 4YX2L 2GIYA 5EU4B 3PL6C 2ESVD 1MFEH 1WIPA 5I0ZA 4Y89A 3BP4A 2CRIA 4Z7QF 3TYGH 4WO4A 4JR9L 3GSNH 2IF7A 1BFTA 3GJFB 1TTGA 4JGJA 2YEZB 3HI6L 2Z31C 4HWNA 1NQBA 1DUYB 4WWID 2XG5A 4GRLC 3VXOB 4LRNH 4S1RH 2H32B 3I6GB 3TM6A 5J1SC 1N2RB 1SBSH 1YN6B 3HS0B 3QEUB 2PTUA 3TN0B 4X9IA 4XNQA 3P0GB 3G9VA 4B7LA 2V17L 3QPQC 5FM5O 2BSED 4I77L 2NY7L 5FKAA 5FFLA 5ICYA 1F3DJ 5GS0H 1TIUA 3VFVB 5I9QB 4EUPB 4OF0A 1DZBA 1OAXL 1RMFL 2J8UB 4UOW1 3C60C 4X6EA 4RAHA 1KCLA 5HHOD 4NHUB 4J12A 1G84A 4JFFE 1BGXL 4X9GA 3TO2B 3HG1A 5B38B 3U2SB 1CLYH 3FQRA 1KCKA 4PLJD 1NMBH 3S35L 3KS0J 1J8HE 3QIUB 4TSAL 5GZND 3M17A 5D7LB 2PXYC 4D9RD 3RVUC 1Y6KR 1IE5A 3F7YB 5ESVB 1I9IH 4WJ5B 1B6DA 5E2JA 3PWPD 4ODTL 3NACL 5DWUL 1XGUA 2H2PD 3RHWK 2R2CA 1QRNB 4PUBL 4NQDD 1BPVA 2VN7A 1P69B 4KWUA 4C4KT 4EN3C 4CVZA 4Y8AA 3VXNB 3RJDA 3B43A 1Z9LA 5KANI 3CMGA 1HHHA 3RY5A 5DLML 1SYVB 4PGZA 4HJ0D 2DQGL 1U8KB 2LTQB 1L7TL 4HC1A 5HHXH 1YMMD 2ZWLT 1QSFB 2EO1A 3KYOA 4P57A 3RDTC 4AEEA 3DXAE 4I18A 4P2RE 4IOIB 4L4TA 3RIFF 3C60D 1WCQA 1J11A 4RQQB 2Q86B 4YX2H 2X4SA 4HV8B 4OCRL 1CE6B 5T1KB 5IG7B 4JO3H 3DRQB 4M1GL 2AJUL 5I30H 5IVNA 1G7IA 2VE6A 5EUKA 2KKQA 3LS4L 3RVTD 1FVEA 3O0RL 1ZV5A 1F4WH 2NR6D 5DD0L 4PFEA 4LSVH 4N0CC 5HHNB 1HHIA 4R97C 3QG6A 5T3ZH 3VXSB 1CFNA 4LRIC 4S2SA 1ZLWK 3BX7C 2EDHA 4JRXA 2KQNA 1KSRA 1S7VA 4KI1A 4CU8A 4E9LA 4ZAKA 5A2KH 3VFNB 3UMTA 3QG7L 4LSPL 4I77H 2DM7A 3IETB 4XP1L 1N8ZB 1HZHH 3D69A 3MCKA 1A6WL 5DZOA 3LKRA 2EYTB 4ZMAT 3WO4C 2WANA 1UB5B 4W4OA 5TE4L 4LDOB 5D72H 3FT4B 1AXTH 5INCA 1E6JH 4NT6B 3RQ3A 1WFOA 4ONFL 4JPVL 2ZSVA 4HKJA 2E7BA 2X7LB 1N3NA 4MAYC 3U36B 5EU5A 4U1KA 4EIGB 1RD6A 2EH7H 1W0VB 4X6BB 4Q97A 5K9QI 5J57B 1MCLA 4OCNC 4X9FA 2CKNA 4OUUB 4H88L 2BSTB 2C1PA 3BGAA 1DE4B 4NKMB 3S5LG 2R23B 5CJQH 4XMLL 5MEOB 3O6LL 1EVUA 5JNYB 3PUCA 5DLMH 1DQML 4JFXB 3ZTJH 1L7TH 1I8IB 4HCRA 3QQ4A 2RR3A 2JCCA 3TZVD 1CLCA 4HPYL 3SDAC 4RFEB 3LY6A 1WBXB 5GS1A 3L1OH 3OKEA 1Q0YH 3DX9B 3SE4C 3TJEH 2DWEA 4BUGA 3I6KA 1KCVH 1QLFA 3L7EA 5B39G 4RGOH 1MJJB 5EFIB 3LB6C 3WKML 5I30L 3PDOA 3DI3B 2R0LL 5AWNL 1MCBA 1NCBH 2DQJL 3I02B 5E03A 5KSAA 4AL8L 2Q7YA 3RVVD 3OKKA 5C0AB 2X4PA 3ZMRA 4XXCC 1ZT4A 2DQIH 4PRPB 3ES6A 4WUUE 5DJXB 3QIBD 1ZLSH 1HDMB 1RZIA 4PGCB 3WNPA 5GS2D 5CD3B 3V95A 3BH9A 2PKDA 4OLEA 4F7CB 4TSBH 3RWFB 4HFWB 4F37F 1YMME 4KJPD 1NANI 5F88B 1CBVH 5F70A 4K3EH 1EEUA 4UMGA 4R3SA 3HPLA 2X4TA 3MACL 2V7HB 4BQ8A 3SDYH 1I1AD 4JGUA 4W6YB 4FQ2L 2BNUB 3GM8A 4B7IA 1N26A 3HZYB 5JZ7C 1CFSB 2G5RA 4NO5A 4F3FA 2A2QT 5FUZH 2E8YA 4TQEL 2CIIB 2F5AL 4DTGH 2BMKA 3OKNB 1TJHH 4HKZB 3W9DB 3WIHA 4NJAH 2MKWA 4YQXH 4HH8A 1DSFL