2VDQL

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
b'DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqL01
2F8OA 3FB8B 4ZS6C 3U9PH 4Z0BL 1G9NH 2O5ZH 3LKSB 1YQVL 1CFQA 3RL2A 5C0CE 2OTWB 3T0EE 5J9PB 4BQ9A 4XPFH 3ARRA 2BHUA 1MQ8A 4BFBD 4XMKL 3SKMA 1S7UB 3ALPA 3TGXA 5CP3H 1KELH 4N0FA 3IRPX 2IBZX 2F5AH 3D18A 4R7DB 3G04B 4PD4J 2Z93A 3MV8E 3MRDA 4I1NB 3O2WL 3BKML 5ACZA 5IVOA 4I9WE 3PWNA 1CR9H 5ID1B 3WHXA 3MUHL 2ERJB 2VZUA 5BJTB 4XZUA 1OQOA 4HK3J 2ADJB 3E6FB 4KQ3H 3C5ZB 4WCYH 3AY4C 3MJ9H 2PTTA 1ERNA 3V7AG 4CVXA 5A3ID 1U8OA 4K7FB 1RMFL 3X14B 1UB5A 4LCWE 3NPSB 4JO1L 5D1ZB 1NGXA 1ADQA 1XGUA 1T0MB 1VFUA 1T1ZB 2P5WD 4H25B 1R3JB 4R6UA 4XC3L 2HA1A 4RGNE 3O3EA 5E9DB 4WHTB 1EO8H 1NBZA 2XNAB 3D9AH 2XTJC 3VFGH 2DD8L 4MAYA 5ESAB 2NMSA 5L6YH 1TJGH 2XQYK 2WINA 3IDXH 2PTUA 3L95B 1X6NA 5I1AB 3OKYA 4HEPG 4R90H 1RPQA 1VGKB 1WTLA 2B1AH 5L9DH 3BXNB 1PYWB 3GHBL 4YDKL 4XBPB 1HQRA 5I1GH 4PJIA 3BPLC 1IAIM 3LS5H 5L7XH 4OCXL 4KMTH 1JMZA 3GSRA 4LU5L 5E2WH 3UC0H 4JM4H 4MNGA 5HGBB 3VJ6B 5IB1A 5E4EB 1W0WB 5I76B 2BMKB 3MNWA 2Q8BL 4U33A 2N56A 3BJ91 4L29A 2BOCA 5EN2B 5D7LD 3BDBA 1AI1L 1OPGH 2E27L 4CL7A 3OGCA 4Z78B 2NX5B 1KEGH 3PWUB 3EO9H 4N8PA 4UOW1 4H20L 1DZBA 2BOBA 1A0QH 2XFXA 4WEMB 5I8KH 2NXYB 3CSPA 1A2YA 1U0QA 2VDLL 1YNTA 1FGNL 2DWDA 4J4PA 3BKYL 4NPYA 3CFDA 3RZWA 4JAMA 2AEPL 4KC3B 2PW2A 5FUOL 2ATKA 4HWBA 1PAMA 1I1YB 1EFQA 4DWHA 2L0DA 1A7RL 4BSVB 5IBLD 1CZ8L 5HYSG 2CRMA 4MVBC 5DHVB 1UM5L 3L7EA 2DRUA 5DWUH 3CXDH 3OSKA 2BHZA 5HHXL 3TIEA 1XGRA 1TETH 5ENWA 1JNLH 4GQ9H 3PDDA 2AV1A 1NSNL 1Y6MR 5KAQF 1AGEA 1FZMA 1SJHB 1B0RB 4QXTA 5CIPB 4BUHA 4XX1E 5J57B 1ADQL 1NC2B 1EXUB 4ETQA 4OJFH 5HDBE 4WGVB 3IFLH 4OM1L 4KRNA 5DHXB 1YEFL 3X11A 4WY7L 3U2SB 3UZEA 4EDXA 4S0SD 3O6LH 1CS6A 4Z7QF 4E41A 4POYA 4PRBA 1T7ZA 4KK9C 1X5GA 2VSDA 5H35A 1WFTA 1QSZA 4FQXB 4DVBB 1A4JA 2JF1A 3H9HA 1A4KA 2A1WH 1EBPA 1UM6L 4G80B 5TE4H 3MXVL 4MA7H 2F53B 3TN0C 3U9UA 5FHBL 2FR4A 1F11A 5D1QD 2NR6C 5F97E 2ZPKH 3MROB 1HIMH 4WNQA 4PPTA 4APQA 4Z7OF 1N2RA 1A21A 4QHLA 5KANG 3OR6B 3RGVC 5ADOH 2D2OA 2HP4A 3VWJA 3EHBC 4W81A 3SKJH 4LASH 4YHNB 1JGLL 3UROR 3ME0A 2AJXH 5EBLB 2VDPH 4FNLL 3BEWA 4XCYB 3P77B 5IFAH 3H3BC 4Q2ZB 4GRLD 2F19L 4PJ7A 3SCMD 4Z7VA 2GJ6E 5F89B 3MV7D 3VRLE 3ZDZF 3ULUH 4NJAL 1A9EB 3C6LA 5KOMC 4HK0A 2ADGA 2ZOKA 1XF4B 3IDGB 5HHQB 3FONA 2YKLH 1J1OL 4UINH 4P4RA 35C8L 2A6KB 1EEUA 4MYWB 1DBBH 2JIXA 5CUSL 3WEXB 1MCBA 1FL6A 4GO6B 3FKUS 2AERT 3O4OC 3O3DA 3V6ZB 4HWBL 3WHE1 2E6PA 4UUJA 3QZWG 3HFML 3VXTB 4XXDA 4PJDE 4ZXBD 4MA3A 3VXMD 4AT6A 4FG6C 4KUCD 4HFUL 4R0LA 4YXLH 1P2CB 4CJ1A 3WJJA 4YO0B 4NSKA 2P24B 3TJHC 3BWAB 4YBLB 4RIRB 1LO2H 2YBRA 4TSCL 1CD8A 3UPRB 4AEHH 3W9DB 5DK0B 1NFDA 5IIEB 2EDTA 4YC2B 1EFXB 2HKHL 4KDTA 3SKUD 1IGIL 3SKOB 4ODWA 4U1IA 3LV3A 5MP6H 1BGXL 3HZVB 2VLJA 1P9MA 1JF5A 4FQ1L 3WKML 4HAFA 1NLDH 1IM9B 1GGIL 2DI9A 1Q9OB 1AXSB 3T4AA 2VXSH 1QEWA 2GJZA 4D94A 2EDQA 5IB2B 3W39B 4Y2DB 3MV01 2ITDA 3EFDH 1RI8A 1JGEB 4OLYH 4RWYL 4HWNA 3U82B 1BBJA 4NZTL 5EU4B 3MGOA 4ZFFB 3BEVB 3QIUB 3I85A 1WICA 2IQ9H 2HWZH 2YD1A 5D7LE 3HPJB 3ET9F 5J1AB 3RTQC 1V7MH 4HZLB 4QRRB 3EZ8A 1SYVA 1I9RH 4GKSB 3PABA 3MODL 4JFED 1VESA 3HZYB 5E9DE 2DMBA 5LAXA 1EZVY 4BH7B 1RFDL 3IKCB 1J86A 4M61A 2MQCA 4JGUA 3MR9B 1DEDA 5IOPB 1KCUH 5J6HA 1J0IA 2WWMC 2Y4SA 4PJ8D 4KKNA 5ITBH 5F9OH 1KCVH 2BNUA 5DJZA 1NBYA 1SEQL 4HS6B 5GSRB 5BO1H 4HC1H 3HRZB 5DD5H 4NQXA 1MVUA 2AQ3A 3BDYL 1K8DA 5F3HB 1A7BA 1RZJC 4JDTL 5L8JB 1KTKE 4GMTH 4XGZB 3TLRA 2W65A 5F9WC 1BJ8A 2A9NH 3GSQB 3R06B 3EGSA 3KPSB 5HVWA 1R24B 2E6QA 3PWVA 3FRUA 5FA3A 2KUTA 4W4OC 3VXNB 3DHJA 4FXGA 1JF6A 4F58H 1T4KB 2P8PA 4YGVB 1TMCB 1FSKB 2APBA 3OMZA 3N50A 5DD3L 5GJSH 3AY4A 1F6FB 1TVDA 5J6GB 5DTFA 4BUGA 4QY8B 3KS0H 2NX5E 1UWEL 4PJDB 1A7NL 4HKJA 7FABH 2J5LB 1N6VA 4ZAKD 1RULH 5DRNA 3RQ3A 1G6VK 2IQAA 3F5WA 4WEBL 5I66A 5CD5C 2C3WA 5D7JB 1IT9L 3DX8B 2YPLB 2XA8L 4Z8FH 4KVCH 4Y89A 1AO7B 2AGJH 4HX1A 4GXVH 4L4VD 1EK3A 4NM4H 3KPNA 4NO2A 3LY6A 4Y2OA 2ICEA 5IW6B 2BSTB 5H2BA 4UTBL 3KJ6L 2DJSA 3UAJC 4OFIA 2QHLA 3UJTL 3OF6A 1TDQA 2APVA 3CX5K 4I0PB 4EZMA 5LWYH 2YK1L 3H0TA 1PLGL 4PRHD 1BAFL 5D72H 4FFYH 2YD3A 5HHNA 1KYOK 3SDYL 3D39A 2EECA 1W0VA 3OG6B 5DRXA 4P3DA 2R4SH 4XPTL 1XGQA 3TZVC 5T5NF 1MHCA 1GGCL 4MS8D 1A5FH 1F4YH 3TH2T 3L6FA 4F57L 4JFDD 5ILTH 3TH4T 2YD2A 3M8OL 3RNQA 4IOSD 2EIZB 4JRXB 5FB8B 1QBMH 2O5XH 5BVPH 3AMLA 3TVMD 4WO4D 5FKPB 5IMMA 1D5BA 1HQ4B 4JFXA 3MBED 3FO1A 5HYEA 5IQ7H 2EH7H 4MNHB 4Z76A 1QNZL 1NGZB 1UJTA 4ZYKB 1FE8L 5IFHH 4NDMB 1VFBB 2YUVA 1N64L 3VWKA 5SWQB 4PJAA 5I1KL 2DQUL 3RIFK 3SEPA 2XWBB 3HCVB 4C56A 1NDMB 2P7TB 2P8MB 2ICWA 3QHZL 4M7KL 4POZC 3DXAA 1CICC 3HG1D 4QHMB 4ZDHA 1NAMH 2QSVA 3DSFH 5E4IA 5MEQB 2VZ3A 3WFDH 3VXME 2CXKA 5EU7E 2YD5A 3Q5OA 1J10A 4NQCA 1KN4L 2EEAA 4I3SL 1Q9LB 4N5UA 3GMRA 1HKLH 4F7TB 3W5MA 1YJDC 2XKUA 2Q86A 3OKKB 3X13A 1E4XL 1U42A 2CDEB 2JJWA 4JKPH 1KT2A 3R0NA 3UTSD 5E8EA 4GS7C 3QUKA 4OF5A 1MHHB 5CJQL 2V2TA 1UXSA 2UWEF 4HF5H 5E1AA 4MJ6B 4IMKC 1S7QB 4FQQA 4QRUB 5DQ9B 4EI5B 4R3SA 4WV1A 1EA9C 3IF1B 4JFFB 4MNQD 5KSVB 1IGYA 4QWWC 1TVBB 2J6EA 1FFPB 8CGTA 1UVQB 2J12B 1S5IH 3KGRA 5ICXA 3OB8A 1GL4B 4Y4KD 3QG6A 1PG7W 3G5YB 3RKDC 3MO1A 1IGTA 1NFKA 5F93C 5K9JL 3QI9C 3RI5K 1JHKH 4FOMA 4NBZB 4LQFH 3TN0A 2ORBL 5EDXA 2NQCA 5D71H 1PQZB 4ZPVA 3MLUH 2J88L 2AJUL 4MB4A 1SY6H 3LQZA 4CN4A 4EN3A 4XC1L 4G42B 1JPSH 3O6KH 5DQDL 2UWEB 3C8KB 3TYGL 4WUUA 1SVZA 4K55A 4MD4A 5BS0B 1E4XI 3L1OH 3FFDA 3AU1B 4D9LL 5GRJH 4YPGB 4M7LL 1QBLL 1I8MA 4CU7A 4DN4L 1QG3A 5DJAB 3VD5A 4U3XA 1S78C 2G60L 5C8JB 4WU5B 5JXEC 1NMBL 4ZNEA 1JZ2A 3MLTA 3ZE1F 1CFNB 1WBXA 1G7LB 1WZ1L 1JWMA 5C0BD 3R8QA 2VC2H 2PYFB 3QUMH 1KCSL 3L3IA 4IDJL 4KZDH 2UYLB 4HGWA 3NIGF 4M62H 3KYMA 2NLJA 5E8DL 3DX7B 4K71C 1I1FB 4MXVE 3LB6C 2OK0L 3WNMA 2XQBH 3MX0A 4ZUTB 3RNKB 4YDLC 1V7NL 5DT1L 2B2XH 3CPLA 5F1OB 3S34L 4R96B 4P2QA 3B9KA 3S37H 3T3PF 1Q9WA 3F7VA 3HAEH 2A0LD 1D6EA 2ZOLB 3MLSH 3B6SB 3E2HB 5SWZD 4GAJH 3QDMA 3KPRD 1TZHB 1NANI 1QPXA 5IK3B 4RWHA 1YEHL 5EZIL 3ZKND 4WWKD 2XZAH 1MAMH 2E9BA 2HLAA 4OZHA 2ZG3A 4O51B 4P2OB 1GIGH 2J6EL 3SDCB 4Z0XB 1FV1A 1EJOH 1UGNA 4QCIB 15C8H 1F3DH 5CFHA 1EGJA 2ICWI 1WIUA 3BKCL 1U8JA 1REIA 1MOEA 2JB5L 1URLA 5HPMA 3MJ8B 5EA0H 4JDZA 3OX8A 4U1KA 2NPLX 1FFOA 5HTSA 4HG4K 4JLRB 3QQ9D 1QFOA 5DS8A 1SBSL 2CRZA 1PKQB 1P7HL 4ENEC 5DMYA 3PV6B 2WIIB 3DSNA 1C5DB 4UI2A 4ODHL 4Q0XL 3V6FB 2BSSA 1V8HA 1YPZA 4LCWA 3HC0A 4X9BA 1I3GH 3L3GA 3JWOH 1DQJB 3TBYB 4OKVA 3FT2B 3ARBB 1YUHB 1BF2A 3WE6A 3V79C 4EXPX 2SEBB 1JVKA 4CNIB 3ZE0F 3WN5A 1AO7E 2CDFA 1YQVH 2HJLB 4ZFZA 2VYRE 1UA6L 4JEGB 3P0GB 2FD6L 1IAMA 1KN2L 2ESVB 3GM8A 3V4PH 4JN1L 4XMKH 2AJVL 4WI4A 4QNPF 3HE7C 4LARH 3K1KC 3QEGL 3LRSB 5F88A 3KS0J 1D7FA 3P4MB 2BVOA 2GY5A 2QR0A 3GJEA 3OG4B 5TQ0L 2O93L 3O3BB 3LS4L 5J13C 5JHLH 1AH1A 3O2WH 3QPXL 4MZ2A 4I13B 3JTSB 3TWCL 3IJSA 3WXVL 1FZKA 3MRIA 4JFYB 2GI7A 2D7PA 1I1RA 3W0WD 1HXMB 1B3JA 1P6FA 2IEPA 4XT1C 4K23H 3DMMA 4NC1C 4HKXB 3VGFA 1HK6A 1HSAA 4FQLH 1ZA6B 4JRXE 2H8PA 3UTSE 1UKQA 4W4OA 4XCFH 3DTXA 1CE6A 1E4JA 1BFVL 2X4OB 4JO2L 4WVRA 5CLTA 3ILQC 3GSXA 1KJMB 2ZP0T 2D9QB 4WHCA 2ZSVA 3RIAK 3WUWA 3PHSA 4PG9B 5GGRY 1YY8A 4IRSB 1A14L 3C8HA 4KHXL 1MCLA 4MNQE 2YD9A 4Y5VA 4ODTL 2C3XA 4FFVD 5IVXE 1YN7B 2EC9T 2D7MA 3EYOB 4LHUA 5K9QG 5KSUA 3HUJE 4NYLB 4X9HA 1AIFA 1YNLL 5JW5B 3NCJL 3G6AB 5DVOA 3Q6GL 5CP7B 3Q48A 5KTEH 1DFBL 4Y88A 1DVFD 5HHVL 1VDGA 4I2XA 3NACH 3MUGB 1EGJL 4U3CA 2VJXA 4I3RH 4XP5L 1CGSL 2FJGA 3MJGX 4HJ0C 5A2IH 3ISWA 1XIWB 3FB5B 1OQXA 3F58L 3FB6A 1EUTA 5B38G 3RUGA 2AK4B 1NCWH 3GO1H 1JPTH 5I6XB 1ZWIA 4PLJC 4RRPA 4MX7A 1LK3L 3VXPB 4W6YB 4YPJA 1DTUA 2YZ1A 5JOPD 4NKOA 3X3FL 3DLQR 5T1KA 5E8PB 3ILPA 1LO0L 2J8UF 3MRLB 4P4KB 4N1EA 3KPTA 2Q6WA 1S9YB 2VERN 4KRPD 4HKZA 2BK8A 2VMFA 3GIZH 3TZVA 4Q9QL 4HQQL 1MLBA 1MFAL 1FN4B 2VABB 3JBG7 4MJ5A 3EYSL 4DN3L 2OMBA 2EE9A 4JDVA 2Q8BH 1AC6A 3VXOA 3FT4B 2EYSB 1LE9B 3T04D 2NY4D 3NA9H 5F96L 3K3QA 1AI1H 3RPIB 2E27H 3GNML 3OAZK 4JFZH 3OB0K 1ZA3A 2ZCKL 1UACH 5FKAA 3INUH 4OIIL 1K9TA 4OLUL 5HVHC 2VR5A 3TCLA 1KCLA 4FTVA 1J1PL 1NEZG 1OWRM 2CK0L 2G75A 1CGVA 3TV3L 3IDNA 5C0JA 4HIJA 1MPAL 2QADB 4QXWA 1MAKA 5TF1L 5GGSA 1RZJL 5HHMB 2J8UB 2UWEE 3V0WH 3DIFB 2XN9D 1T2JA 1D3CA 1CZ8H 2AXJA 5E8NB 1AP2B 1UM5H 3RGHA 4ODXB 5E00A 3RVUD 4BQCA 5FAAA 2AEQL 2JJVA 3UBXI 4X4YB 4DAGL 3B9VA 4PRIA 4AMKH 1J8HA 4Z77B 4PJFF 4PTUA 4F15C 2WWKO 3RVTC 1TLKA 1OSPH 2K9UA 1S8DA 1HOCB 3AREA 4JZOA 2EE2A 2Y06L 2FWOB 2R9HD 4LLQA 5IGXL 1IMHC 5D7IA 2W0FA 4MQ7B 3SDXF 5IJVB 2OI9C 1YEFH 4GSDL 1EMTH 1PW3A 2CGRH 4IMKA 4KGJA 4WY7H 4FFWC 4HUXA 3O6FD 3QEQD 3T77B 4NHCL 1MCNA 3QA3A 3TT3L 3QAZB 5E5MA 1CDIA 1AD9B 4TTGA 3DROB 1NBVH 3N1PC 3CUPA 3T0WA 1UM6H 5DJ2B 2XXMB 5IB3A 3FB8A 3P9LA 4OGAC 4O9HL 4B5EA 2OP4L 3K81A 3CX5J 1ZVYA 3LKSA 1S7XA 4ZOEA 1XFPA 3QI9A 1KYOJ 4LSRH 3CMOH 2AJ3B 4DUWA 4PJFB 4BA8A 2CKBH 2VDQL 4NC2B 5EULV 3ZE1E 3D3VB 4N68A 5GS0L 4R7DA 3ROLA 4L8SC 2GK2A 4R8WL 5K9KB 2IC2A 4GLRI 3ARDC 3SDXB 1GH7A 1P7QD 3SY0A 4HWUA 1Q8MA 4F2MB 2MQ3A 3QNXB 3NIGE 4PTTB 3WS6A 4YX2H 3ZKMD 3EYUH 4G8GA 1FIGH 3T4YB 2F19H 5DJ6B 3PL6C 1OTUD 5DEGB 2BC4B 3SDDC 3SDAB 2P8LB 3GMOB 5F44A 2DM3A 1P6AB 3E6FA 2ENSA 5JXEA 3C5ZA 4L3ED 3T3PE 1Q1JL 3NGBB 3F12A 4CN6A 1M6OB 3BW9A 4LCCC 4WFFE 3PJSB 5AD0B 5KJRL 3A6OA 3JZ7A 4Q6IC 1PKQE 5ESVB 3W0WE 1RZKL 4F9PC 35C8H 3ARGD 3X14A 2OS7A 5CUSH 1ORQB 4MQXC 3S96A 2NNAB 5KVFH 5F7HA 1IC4H 1FZJB 1T0MA 4CADB 1F3DJ 1FDLH 3HFMH 4H25A 1PY9A 1R3JA 1G7QB 2MCPL 2R0WH 3UPAA 4UT9L 3OAZH 3MLVL 1QLEL 4HFUH 3VGHA 1G7HB 1HEZB 3HPLB 4H1LG 4WHTA 5E9DA 4XHQA 3RZCB 1YJDL 2XNAA 1WFNA 1IARB 5A1AA 1F6AB 4LCYA 4XAWL 5ESAA 1P84K 2DBLH 4NM8L 4TSCH 3EYQC 3L95A 4EQ3A 5SWSB 2NXZC 4YDJA 4K9EC 4KXZI 1I1CA 1VGKA 3EZJB 3VFRA 5CILH 2HKHH 1PYWA 2XG5A 2GUOB 4XBPA 4J23A 4HUKB 1X5AA 1T66D 3MRPB 3FL7A 1CN4A 2AQ2A 3FFCB 1KTLB 3CIQA 5HGBA 3GIVB 5E6IB 3QIWD 2VDOH 4FQ1H 5B39G 5I76A 2E7HA 3ZE0E 5JOPE 2BMKA 2D7TH 3TEUA 1W72A 4LLUB 5EN2A 4OF6A 4U1MB 1MQKH 3ROOB 3MOAL 1CE1L 2UY7A 3KPLA 5TQ2L 4AK1A 4RWYH 2ZJSL 4QNPE 4GXUN 4NZTH 3WKNA 2RBLA 1U3ZA 3CVIH 2P44B 4EUPB 4BSWB 1AGCB 3BUYA 4GRMA 5DURD 4X8XA 3U7YH 2ARJA 4Y8DC 2C7UB 3QH3B 4EVNA 3VD7A 1FYTA 4XVJH 3BRDA 2EDXA 5T3XE 4BSVA 2BXZA 4IIQB 3G08B 5DHVA 4NKDB 3CFEB 3FOLB 1HDMB 5HGHB 1A7OL 5IB4B 5KSAC 2E9IA 3HE7A 4GAGL 4R4BB 4EIZC 2Z91A 2HTLD 1ZLSH 4DKFL 1SEQH 3MTRA 1JZ3A 3BP5B 2IAMC 3BDYH 3LIZL 4NJ9L 4XNMA 3SGJC 2WV3A 3TT1H 1SJHA 4JG1L 4L9LB 1OSZB 3ARFB 5DFVC 1BX2B 4MSWA 1NC2A 4M6AA 1GAFH 4D3CL 4NQDD 1X3DA 4PLKC 3U2SA 3U46A 4QRPD 4J3SA 5JZ7C 3C60B 3L5XH 3MGTB 3QUYB 5DD3H 5IV2B 2FSEA 4FQXA 4DVBA 4FP8L 4OV5A 3G6JF 5FHAH 4KHTH 4PGDB 3BPOC 4DKDC 1J05B 3QG7L 2JB6B 1UWEH 2F53A 4RMUA 1A7NH 4P46B 2E9WA 5I8EA 1HI6B 2B1HH 4NKIL 2AXGA 3WSQL 1MHPL 1AKJB 2DBJA 4XVUC 5DMJB 3BQUD 4IOFC 2J8UE 1CTOA 5INDB 3FQNB 1LEGB 3BOVA 4Y5YC 5CGYC 1VGEL 4YHNA 3C09B 3RJQB 4HG4J 5EBLA 2W9EH 1BIIB 4LDLB 1G84A 1LD9B 3T0AA 5EBWA 3CGTA 4UTBH 4X6FA 1AGDB 2DL2A 2AV7A 3VRIB 1MRDL 1QO3B 1W72L 4YFLF 4PRPB 2YK1H 1PLGH 5F89A 3G6JB 1XF5A 3ORJA 4XPGL 1A9EA 3SDYH 2HTKD 4JQIH 5FGCB 1XF4A 4DUXA 1HCFX 5I19H 1F8TL 4KKBC 2PXYB 3IDGA 1GGCH 4NN6C 1TQBB 2B7DT 4YHYC 5BCAA 5E2TL 2VO5A 4DGVL 5GGVL 4CDHA 1U36A 5DC9B 3UXFA 1H3VA 4OIAA 3B2VL 1SHMA 4WUKL 2WBWB 3V6ZA 1KB5B 4PJ9B 4TVPL 5D2NC 3S3PA 1QNZH 2WBKA 5I1EH 4LGRB 4YGAB 1FE8H 2H41A 3MRBB 2DQUH 1OAYL 2BRQA 5IF0B 4DTGH 3QNYB 5C0FB 5DJ0B 5JMRA 3DVFA 2CIKB 2NY1C 2W1NA 12E8L 3AM8A 1P2CA 2X7LB 4UIMA 3K46A 3QHZH 4PJFE 4WFHD 2OM5A 5GRUH 2P24A 4YQXH 3O3AB 3BSZH 3BMVA 5D2LE 5E99H 3TBVB 3X17A 1N3NA 4KK5C 3HKFA 3I6LD 3U0TB 1A6VL 5C2UB 4MXWH 2G9HB 4U1LB 5IIEA 3FJTA 3SDXE 1PSKL 4HWEL 4M43L 1EFXA 3H9SB 3PP3K 2D3VA 4I3SH 4JZJB 4P49A 4JQXA 5E94B 5EU6B 3SKOA 3RWEB 4JKWA 4TNWF 2EKSB 4LLVB 1MIEL 4UMGA 5A2JH 1OAXH 3I9GL 1FIEA 2R1XA 3VMPA 2DI8A 3HZVA 5C0AA 1E4XH 4K3JH 5HHOB 4KJYA 3NN8A 2UZIL 2X40A 4J6RL 4LVNC 4JZNB 4Y0GA 4ZUUB 3FQWB 4L3CB 3B8YA 3NCCB 4GKOA 5F7DB 4NFCA 4MD0B 1S7SB 5C0DB 4LEXL 5IB2A 4Y2DA 4P5TD 4UAOC 1JGEA 1XH3B 1GC1H 3WUZA 5CHNB 5C9KA 4G7VH 4F33A 4GW1A 4ZFFA 3BEVA 4G9FD 3THMH 3U79A 1WITA 3O8XB 4WFGE 2H26B 4JY4B 2VLLB 3RDTB 5BVJA 5J1AA 1D5MB 3OAYK 5KW9L 4P3WA 5JIHA 4HZLA 4QRRA 2ZKHL 4GKSA 2I9TB 2GFBA 3HZMA 2ORBH 2EICA 4CUCA 2QQKL 2VN4A 3PWLB 4BH7A 3U0WL 1E0OB 3IKCA 3KLAA 1JZ6A 4FMFA 1EEYA 5D70L 1OAZL 2VE6B 3MR9A 4PV8B 4H88L 1JIBA 5IUSA 4Q9CA 1M7IA 5DQDH 5BZWB 1EX0A 5I30L 3DUHA 5IW1B 2GCYB 4HS6A 5GSRA 4LLDA 2VKXA 4G6AC 1VEPA 1G7JB 1QLFB 4L8SA 3U4BL 5F3HA 2DM7A 1NANH 2OL3H 3MACL 4XGZA 3PF2A 1FO0H 4DN4H 3MRKB 3R06A 3KPSA 2IPKB 1KG0A 2G60H 3FFCE 2ZCLH 5EU5A 3MCLH 1NMBH 4JQVC 5GSVA 6CGTA 4YR6B 1EAJA 1JHLH 5IHZB 1Z9LA 3PL6A 3PGFH 2X4SB 1T4KA 3SDDA 2V5MA 2JELH 1B4RA 3QHFL 1KPRB 2Z92A 5DF0A 5DZOA 2PN5A 5T1LB 3CDGB 3I3EA 4GMSH 4LCCA 1KCSH 5J6GA 3U48A 4Q6IA 1SMAA 5F7KC 3IJHA 5DUML 4AL8L 5LBSL 1DBAL 2VTFA 5HVGB 1RAMA 4UQ3B 1KCRL 5J12B 2YPVL 4C57C 2YPLA 5BV7B 2VDNL 5KVGL 1YEEL 2YA0A 4IRJB 4PJEF 2VRAA 2EH8L 3ZYZA 4X7DC 5IW6A 2BSTA 5CINH 1YEHH 5EZIH 3LEVL 1D9KC 4EDWH 5DO2C 1JZ4A 1UENA 3PXHA 5J89A 3P11L 3SO3B 3EJZD 4XMPH 2J6EH 1DBKL 3BGMB 1X5XA 4XH2A 3QEHA 4I18B 1DEEB 2BNQB 1MFBL 1QSFD 1N4XH 3NCMA 3BKCH 5EIIA 1LO3H 1AQKL 2A6JB 1TJIL 2JB5H 5BOZG 4ORGB 1G0XA 1MCEA 4OKDA 3TESA 3ESUF 4GBXB 1U9KA 4LPTA 3STZB 3RY6C 5GHWH 1X5YA 1HQ4A 2QKIB 1LP9E 1T03L 4MXQC 3M07A 1CBVH 4PJEB 3LN5B 3J8F7 1EEQA 5DLML 4D0CB 4LRNH 4MNHA 3GI8L 5L2KD 1ED3B 2QJDA 5EC1B 5DMGC 4ODHH 1VFBA 5SWQA 1VKXB 4Y4FC 4I5BB 4RAVB 2XWBA 3QUXD 1R3HA 5D1XC 4G3YL 3UCRA 3PHOA 4FQPA 4BQBA 2ZG2A 3FQUA 1GVIA 1GGTA 1MY7A 3ULUD 3LSOB 1ACZA 1F3JA 1WUNT 4X6EB 2FIKB 3QIBB 4XNYL 1G7MB 3OAYH 2Q8AL 2FD6H 3N85H 4M5ZL 1IQDB 5TE6L 2AJVH 2WWKT 4IMLB 4LK4A 3W2DL 3ZYIA 1Q9LA 3DGGA 3U30B 2IMMA 3C6SA 4KMLB 5JDJA 1BWWA 2FYYB 3P2TA 5CJOL 3QPXH 3G6JE 3CDCA 4G6FB 5GGSY 5D96C 3IKKA 1XGYL 3QJFB 3TIDB 4PJCF 2IAMA 5FGCE 3SGJA 1MHHA 2P5EB 2A9MH 2V9RA 4JN2B 4O2FA 3GDBA 3CSYA 3IDUA 1S7QA 4QRUA 2WBJB 4EI5A 3U7WL 3QWRD 3IF1A 1MJ7L 2Q20A 4JFFA 1LDPH 5KSVA 3QPQC 1Q9KA 3UTZA 5JORA 1AR2A 1FFPA 4MD5B 2R2HB 1Q94B 2OYPA 5F6HI 2D0FA 3PDOB 3G5YA 5TPWL 4JJHA 2VQUA 3OJ2C 1P84J 5L8KB 5GGTA 2LU3A 3TO4D 1AC0A 4P0DA 1QBAA 5HI3C 3TBTB 2W92A 4RGNC 4BH8A 1EJ6A 4CW1B 3LEXA 3MOQA 2EXWC 5B4MC 2F74A 3WIIH 4RA3A 1WISA 1VADB 3Q6GH 5B3JE 4G42A 1U8LB 5I2IB 4PJCB 1Q72L 4ZG1A 1J1XL 1BFOA 4XP5H 2DDQL 3MFGB 1Q38A 1YNKH 3REVB 2EYRB 5BS0A 1A7QL 2OR7A 1L4IA 3GMLA 3H9SE 5DD1H 4Y5YA 4YPGA 2MCG1 5EUOF 2CO6B 1T5WA 5EU6E 3NBNA 1JN6B 1Z0MA 4KY1H 5DJAA 3ZT5A 4LIQE 3SDAC 3VFWA 3UO1H 5C8JA 2BVPB 5C7XH 1LK3H 1E6JH 3DARA 3AS2A 4ZTPL 3R8BB 3LD8B 4X98B 4L4JA 4OM0H 3D1MC 1XGTA 2DQEH 5DR5L 1G7LA 1NJ9B 4TTDC 3AXLB 2AEWA 5SV4A 4Q9QH 4OIBA 1RZIB 1MFAH 2D03L 4RMWA 3EYSH 1T04B 5E2VL 2HH0H 3DX7A 2Y6SC 1I1FA 2Y5TB 3HE6B 4X6DF 2EDJA 2ZUUA 4ZFGH 5JUEL 5D2NA 2PW1B 4U0RB 2OTUB 3WCYA 5EUOB 5LGJB 3ZKXC 2ZOLA 1DBJL 3B6SA 5JHDB 1UCBH 4PY7B 1P7KB 1L7TL 1J1PH 1U92B 3EOTH 3QEUB 4H5SB 2NY6D 3TV3H 1MPAH 5IK3A 3HG1B 3QFJA 4N9OB 4U6XB 5TF1H 3CFIC 3P40A 2CDGA 3BDXA 5C09D 6FABL 4N5ED 4LAQH 3ULVC 5ISZD 3SDCA 4Z0XA 5J3HD 2OR9L 3T3ME 4QCIA 1AXTH 5GGTL 1HKFA 1I7ZB 1FLTX 2AK1L 2VL5B 5ETUA 2VITA 3GMMA 4KI5F 3MJ8A 4GLRH 4X6DB 1RZ7H 4M7ZB 1H3XA 2YEZA 4XI5D 2O61A 1KJ3L 4KI1A 2WP3O 2HG5B 1KPUA 4JLRA 3IGAA 2V7HA 2DB8A 4G6KH 3ECBB 3PV6A 4GSDH 5MENE 2X9XA 1C5DA 1QFPA 1HSBB 3TBYA 3P9MB 3QUZB 1WFOA 2XZQL 1ND0B 2CUMA 1YUHA 3TA3B 5C2BH 2SEBA 1UWXH 2C9AA 4PJGE 2X4PA 5KZCD 5FDYA 4O9HH 5B8CB 2DLFH 3OKLA 3ARPA 2RCSL 2HJLA 5FK9B 1JK8B 4ZUSB 4AYFA 1NC4A 1KULA 4OZFB 2ESVA 2PO6B 4U6YB 1YEKL 3P73B 2ICWJ 4OLXL 1I85C 1KXQE 4M7JL 3GGWB 5GQBA 3LRSA 5FXCH 5GS0H 3P4MA 3D0LB 3SQBA 4Y19A 3BPNB 5GGVY 2FBJL 5I16A 2VIRA 4HIIA 1MF2H 3E1F1 3RWHB 2BNQE 4JFYA 2NZIA 1BZQK 4KKLD 3AB0C 4OZIE 4YHZH 4HKXA 3VMOA 3QDGD 1ZA6A 4OSUL 2ARWA 3C60C 4F7EB 4JQVA 1Q1JH 1DN2A 4FQIL 5EZLB 2X4OA 4PJEE 4RISH 1KJMA 5DVNA 1WAAF 4N0UE 4HWZB 2QV2A 5EFIA 4IRSA 4J3UA 1BMGA 4YHOL 1YN7A 3EYOA 4J3WA 1BQLL 4M93C 5DHYA 4N8VB 5JW5A 3NFNB 2MCPH 2RFXB 4UT9H 4RZCA 1D5ZB 3OJDB 4RX4A 3DUSB 5DQJA 1QLEH 4X7FC 3MPCA 5AYUL 4AZ8A 2BZDA 3L3JA 4D0DA 1BP3B 3AUVA 4ODUB 4OAWB 4M8VA 4V2CB 2VLKA 4R2GB 4XAWH 4JGMA 4ODBD 2AK4A 4HV8B 3P0VL 5DMKB 4YIQB 2CRYA 1D9KA 4CMHC 3VXPA 4O2EB 4KDVA 1TQBC 2P5EE 5E8PA 3UTTA 4P4KA 1ZANH 4XWGL 4S1SH 5ANMB 1J0ZA 3MNZB 1AY1L 1OLLA 4JO4L 3RVWD 4HBCH 5AEAA 3ZE2F 2B4CH 2FECL 2V17L 1CDCA 3RY6A 4TOYL 2EYSA 1QVOB 1YA5A 4OLZL 3GUTB 1CE1H 4M6OH 1T6VN 5TQ2H 2NY3B 4WTZG 2DQHL 3PIQB 3VXUB 1BHGA 4Y4FA 1A6TB 3QQ4A 1S9KC 3VFOB 5C0EB 1EUUA 1UH4A 4EI6B 5JOEA 3SJVD 2FO4B 1MJ8L 3L3DB 1ZGLP 5MERA 3OJMB 1N26A 4MLIA 1JNHB 5D6DC 3T2QA 4KDWA 3MLRL 2MHAA 3VXSA 2YUWA 1OY3B 5FM4A 5LQBL 5E8NA 1ONQA 1G7IB 4V1DA 4Y4HB 2WIMA 3MRFA 2BSRB 4GAGH 5I15L 2DIBA 4X4YA 4XRCB 4Z7WF 4FQ2H 1F97A 1F58L 3VH8G 1HOCA 4P9MH 4A6YA 3Q5YA 5M7QA 5IESL 3LDBB 4KV5E 4XXCC 1UH2A 1OWWA 1KJ2B 2WM0A 2CJUL 2FWOA 3BGFB 1QRNB 4ZUWA 5GRZA 4MQ7A 3PWPD 4AENB 5IJVA 1FBIL 1IGFH 2M1KA 3DNKA 5E8OB 2MJWA 1OVZA 1PVHA 2X1OA 4IHOB 4GUPA 5EORL 3PXJA 3DROA 4M1CD 2CUIA 3OWEA 5DJ2A 1ZEAL 3QG7H 4MWFB 5EUOE 3CK0H 4OZGF 5D1QC 2VLRD 4P9HH 1F90H 2VR4A 1I4FA 4BK5A 5JHDE 1BD2B 1I9JH 5C08D 1L0XA 4DCQA 5BZDA 1F6LL 4Z7WB 1IZJA 1V3JA 4KK6D 2DLIA 1ZHKB 1BWMA 4NN5B 1CDGA 3D3VA 4X5WB 2IH3B 1SEBB 1UYWL 1KNOA 5K9KA 1MCPL 3K8MA 3ULSB 4YH6A 3U4AA 3QNXA 2HN7B 4GRLC 5KSBF 1KXTB 3SCMC 2FX9L 3PGCA 5DJ6A 4C83B 3LKPB 2BC4A 4X6DE 4XPGH 2P8LA 3SDAA 3EOAA 3D0VB 2BNRB 4OZGB 1IVLA 5E6ZA 5EOTA 3RWDB 1H5BC 1M6OA 1CVRA 1FNGA 1RZ8A 1TXKA 5E2TH 3U1SH 3VRJA 3MLZL 5ESVA 4DGVH 5C92A 1DE4A 2GSIA 3BZFB 3QDGE 1T1WB 3B2VH 2M26A 4WUKH 1CLZH 4HKBB 3LN9A 3O9WD 3RBSA 1MI5D 4JR9L 4ZXBC 1R5WA 3CSBA 2ADFH 2D31A 3CC5B 3BH9B 4JFQB 2X5PA 2Z31B 4PJ5B 1XT5A 4ZTOH 5KSBB 1AR1D 12E8H 4OCMC 4Z5RB 1HEZA 1MFEH 3PP4H 5HYFA 4KI5E 4P2RB 2JJSC 2OR8A 3MOBL 4LVOC 4NN7B 3WIHH 3G6DL 4OCSH 5CIPH 1K4CB 3IXAB 3V8CA 1M05A 2PYEB 4QKXB 4RAHA 3TBSA 5BW7C 4JFHD 5SWSA 1NL0H 1PSKH 3X12B 4HWEH 4TPRL 4M43H 4Y1AD 1QACA 4KROB 2K1MA 1IKFH 5GS3A 3V5HB 1CFQB 3RL2B 1MIEH 4UT7L 3OKEB 4WTWA 3HR5A 3GIVA 4WI9A 4J6RH 4Y16B 4N0FB 3O6ML 3M45A 1WCBB 3D18B 3N1FC 3T0VA 3S4SB 2GQHA 4LLUA 4TUJA 3MRDB 2VAAA 4U1MA 2QBWA 4CMMA 1DQDL 2MPAL 5ACZB 3MRNA 4OCYL 1W2KT 5EOCL 3PWNB 4S1RL 3WHXB 2DM4A 2GKIA 5T1MA 4BSWA 1AGCA 4NO0B 4ISVA 1OM3L 4P23D 3K2UL 1BQHG 1NGQL 3L5WB 2ZKHH 5E08H 2PTTB 4Z7NF 4KJWD 1U8KB 3NPZB 5C86A 3IB4A 1A1MA 2QQKH 4PG2A 3RY5A 2JK5A 2VOTA 3VE0A 3OAUL 4PJ8C 3EO1A 4NKDA 2FZ3A 5I74B 1QTYT 4OFVA 1HDMA 5IB4A 1NGXB 2BP3A 1CF8L 2I07B 3BP5A 4XWOD 3N06B 1U3HB 3RJDA 2NY7L 4OF7A 2GSGA 2NW3B 1MCCA 4PREA 1BFTA 4IJ3C 3ARFA 3ARZA 2PUQT 2W59A 1IGML 3O3EB 4GOSA 1BQSA 4MAYB 1WZMA 2Y36L 4OI9A 4M1DL 4ZPTB 3MUY1 2WINB 4M02A 3G5ZA 1FVEB 1ITCA 3C60A 3MGTA 2HKFH 4FQHB 3DV4A 3QUYA 5ALCH 3JUZA 4M4RA 5JXAH 4NT6B 3PWPE 5DUMH 4AL8H 3BT2L 5LBSH 4U49A 1DBAH 3IFOB 3MUJA 4LSUL 3KYKL 4ZAKC 3VXUE 1ROWA 3BYYA 3KHOA 3KYAA 3IXTA 3GSRB 3V9FA 3MA9H 5C0GA 3QDJD 4MJID 5IB1B 3WFBH 4XVSH 5EH1A 2DKSA 1VERA 3QRFM 2X9WA 3ULVL 5KVGH 2GK0B 43C9A 4UT6H 32C2B 1UG9A 3O4LB 3QB7C 2P47B 2DTMH 2CMRL 3B4NA 3OGCB 4EKXA 3JWNC 4MZ3A 5BMFL 3H7BA 1HCVA 2VH5L 2XKNA 3ZE2E 2H1PL 2BOBB 4RQQA 3VRIA 1QO3A 2A6DA 2DQFB 1MJJA 3KAAA 3T65A 4PRPA 4X6CE 1QP1A 4V2BA 4TUKL 1A3QA 4NPYB 4G8IA 5ID0A 2PW2B 4MS8C 4JPKL 4AEFA 1QRNE 4LVHB 1TJIH 4HZAA 3TVMC 4WO4C 4RDQG 3L7EB 4OCWL 1RV6X 3MBEC 4O4YH 4J3XA 4MGXA 1INDH 5DLMH 1FNHA 4ODVL 2AV1B 3RBGA 5GGRB 3GK8L 1CD1B 3I84A 1HH6B 5IF0A 4QXTB 5C0FA 1BD2E 4G3YH 2CIKA 4OGYL 4ETQB 2X7LA 2C26A 1DBML 4EDXB 3S36X 4E41B 3O3AA 3TBVA 2P4AB 1GHFL 5FYLE 4PJ7F 3ABZA 2XPGA 3TC9A 1A4JB 1MFDL 3H9HB 3TO2B 5JA9A 4QTHA 4J4PD 3V52L 3W2DH 2FEEL 4BK4A 5EU6A 3OKMA 5E94A 3U9UB 2P45B 2WP3T 2XWJB 3RWEA 4XNZB 1I7UA 4LLVA 1H3PH 1TFHA 1TPXC 4WNQB 4APQB 1RIHH 1EVTC 3F7YB 5HHOA 1BOYA 1DANT 1N2RB 1RIUH 4QHLB 1IZKA 4JZNA 4QRTA 2BNRE 1UFUA 2EE3A 4L3CA 3VWJB 3T0BA 2GTWA 5C07D 1S7SA 4G8EB 4XXCA 1WSST 1Z5LB 3GI9H 2MSPA 1VACB 1MJ7H 1FAKT 3OKDB 2OZ4H 4JGJA 4Y4KC 2XWTA 4JM2F 3IYLW 4LPVA 4P2YA 5TPWH 4PJ7B 3VFSA 1FNEB 2VLLA 3RDTA 3S36H 1D5MA 3AMKA 3C6LB 4HK0B 1E4KA 4PJ5E 3IU4L 2DLGA 4YEEA 5KSBE 3N1MC 2I9TA 1NFDF 3TFKD 2R1YA 3PWLA 3Q6FA 4IBLT 2FEEI 4P2RE 4QRQB 1QR1B 4S11A 1FL6B 4PV8A 1Q72H 3BKJL 2A74A 1MNUH 5I1JH 5EPMA 2PYEE 3IDYC 5BZWA 1JHTA 4XXDB 3NTCL 5ESQA 5C6TL 4L1HA 5TFSL 2DTSA 4AT6B 3MRKA 1FG2B 1KB5L 1PG7X 3NMEA 4R0LB 2NY2B 4JM2B 2Y72A 3SCMA 5JOFA 2VISA 3MV7A 4ZTPH 1U8PB 4B53A 2X4SA 3S5LG 5F6IB 1N0XL 4YDVB 5JDSA 2R8SH 5T1LA 3CDGA 1BREA 1NFDB 3ZHKA 4LLMB 5CD3A 3PHQB 4AG4H 1FPTL 3SBWC 1GOGA 4ODWB 3MV9D 4E5XB 2FLRT 4S2SA 2JIXD 4HS8H 3VXQA 4K7PL 4CVWA 4YUEL 4X4XB 4NNYA 2A0LC 3KLHD 4ZXBA 1FH5L 1TTFA 3T4AB 2FATH 4WU7A 1XAUA 2CD0A 3HI6H 3D2UD 4IRJA 2GJZB 4ONFL 1L7TH 5B38A 4Q74A 2ITDB 4DKAA 1LNUA 1MFCL 5CZVL 3ZKNC 4L4TD 3QQNA 1BBJB 4WWKC 1PG7H 3IFNH 2X1PA 3K74B 4MA8L 6FABH 3ZDYF 3GMQA 5BW7A 2Q7NA 1NCBL 4HXBH 4L5FL 1JP5A 2W9DL 1G7PA 4YFLI 3H9YA 1JRHL 2VKWA 3LPGA 2MKLC 3M17A 1OAKL 2A6JA 5GGTH 2R29L 5I1DA 4M61B 4UIKL 1RJZB 4N1HB 3QXWA 2C5DC 3GM0A 4QHKJ 5J6HB 2WUBH 4OCRL 2E8ZA 3QQ9C 3SOBL 1GCFA 2CIIB 2YZ8A 3GZKA 4ZNCD 1NBYB 3LN5A 2VLJD 3HAEG 4D0CA 1ED3A 1K8DB 3VFNA 1SMOA 4HAGA 1FNSL 4MQSB 1IEAA 4PJIE 3D69B 4RAVA 3EGSB 1NEZA 2XZQH 3PWVB 4XPAL 4MNGE 1T1YB 5FA3B 1W8OA 2P1YA 2DAVA 3PV7A 4FXGB 2RCSH 4O00A 2FIKA 2AP2A 1G7MA 4JFEA 1CCZA 4H8WH 4YHIB 4OLXH 1T2QH 2F58H 3MV11 3S7GA 5F7NC 3ZKSD 1ORSA 2QHRL 4I48A 1HYSC 1JRHI 1YYMH 4HKJB 1U41A 4DW2H 1ZKAA 5C6PB 4GW5B 4HT1L 1JV5A 2D7QA 4W4NA 3B3IB 2IQAB 2LFGA 2ED7A 3F5WB 1MCHA 2FBJH 1LO5A 2FYYA 3DI3B 1TVHB 3FO2A 3LDBC 5D7KD 2XXCB 2A6IA 3TIDA 3QJFA 7CGTA 4Y8AA 3BGFC 3O2VL 2HFGL 4JN2A 1AGFB 1VA9A 3KPNB 2WBJA 3DWTA 4NO2B 4JVPA 5L8LB 1A7PL 2C4XA 3GBLA 2Z8SA 4ELKB 4PJAF 5BRZB 1A6AA 2ICEB 5H2BB 2R69L 5BV7L 4MD5A 3SGDI 1RZFL 2R2HA 2XTJB 4FQIH 1QSED 5D93C 3R1GH 4J12A 4DEPC 3H0TB 1QR4A 4WW1A 4QTIL 4ZS7L 4JPIB 1P1ZB 3TBTA 5HHNB 4NCDA 4FFVC 3D39B 5I17B 4P3DB 4YFDB 3KXFD 4BZ2H 5IFJA 4RSVA 5T1DL 5DA0B 2W0KA 3BPLB 2FHCA 5DJXA 1VADA 1DVFC 1F4WL 4E41E 3HNTH 4PJCA 1D5BB 4JFXB 3GSOA 1WTGT 5JIPA 3FO1B 1IQWL 3REVA 4L4VA 4Z76B 1E4WH 4XP4L 2LQRA 1CQKA 4PJAB 1UH3A 2F5BL 4ZODA 2ZUTA 4WHYH 5F6HJ 3C2AL 3DETD 4PRNB 2BVPA 3DXAB 2ZZUT 5FO9A 1YY9D 4ZDHB 4PRHA 4OFDA 4KK8D 5E0QA 5JW3L 3CLFL 4KRPC 3OF6D 4F3FB 4HH8A 1QA9B 3AXLA 1AY1H 4JFDA 1RZIA 4GJTB 1J18A 4DQOH 2X1XR 4Z7UA 2FJHA 1ZHNA 3VA6A 4JO3L 5E2UL 5DD6B 3TVMA 4M5YL 5D7SL 4PJ7E 4Z7VE 4TOYH 1WWAX 3MBEA 2Q86B 3X13B 2Y5TA 3HE6A 4XCCH 1OAQH 1RZGB 4GKZA 1KT2B 4I4WB 4RFEA 3L3HA 4QXUL 5EUOA 3QUKB 4AEIL 2DQHH 1UXSB 2C3GA 5I1IH 3HC4L 3QUXB 4FQQB 4PY7A 5CZXD 5JHDA 1F00I 4OV6F 2E7LA 4R3SB 2CLZA 4U6HA 1AJ7L 3VWKD 4QGYA 1RQ5A 4RNRA 3HG1A 3GBNL 4KJQD 4DUVA 4U6XA 1RY7B 1VFOA 3C87A 4HDIA 5ICXB 3QG6B 4M8QB 1CFVH 1L9MA 4LSQH 1JZ8A 1CG9A 3MO1B 4CJ0A 4PP1D 1IGTB 5LQBH 1FYHB 4KQ4H 3T2PA 5CKGA 2Y07L 3TN0B 1B2WH 3NFPB 4NQCD 1JNNH 5EZOL 1I7ZA 1F58H 2IH1B 2IANB 3LQZB 3K4AA 5ELIA 1R3IL 2G5RA 4NUGL 1C12B 2R9HC 4JHAL 3RGVB 2CJUH 1QRKA 1NFDE 4NZJA 2BDNL 1DN0B 3O6FC 5DUPH 1FFNA 1BEYH 2CLRA 3BP4B 3QCVL 4N0YH 4RFNC 1CI5A 4LLAA 2F54D 1I8MB 5EORH 1HINL 4QF1B 3QUZA 4WW2C 2I27N 4Y4KA 1Q0YH 2FB4L 3QISA 5T3XH 4MDIA 2FL5B 2VLJE 1XEDA 4XB8A 2LV4A 1ZEAH 1KGCE 3MLTB 3UX9B 4E9LA 5JQ6H 1A02N 1WBXB 5HD8D 1ZT7A 5FK9A 4ZUSA 3JVGC 4OZFA 4U6YA 4OZHF 3P73A 5EO0A 3MYZA 4FZEL 5IB3B 1JZ5A 3KYMB 3H3PL 2R2CA 2D7OA 1NUDA 1U3JA 3D0LA 1C8PA 1U3HC 3K7UA 3O4OB 4EN3D 4JHBA 2R4RL 3P0YL 1I9IL 3E0GA 3ZKMC 3V7MA 1D6EB 4WUUD 2FX9H 2N4IA 3A6CL 3ALXA 1ZTXL 3QDMB 1LE5A 1OTUC 1FRGL 2D0GA 2VDKL 1B6DA 1RURH 1IC1A 3GBML 4F7EA 5BXFA 3FN0L 3O0RL 5EZLA 3GSNB 3MRMA 1GGYA 1RU9L 4N9GB 3WXWL 2PNDA 3MLZH 2HLAB 2CO7B 4HWZA 3ARGC 4OZHB 5C0BA 3VXRD 4YZFE 4ZOBA 1YQ2A 5ERWA 1FV1B 1FLRL 3SGKC 2BCKA 1GPOL 1OB1B 1AQDB 3QXDB 4JR9H 5HPMB 4N8VA 4JDZB 2M2DA 4NBXB 2B20A 3NFNA 4U1KB 2EYTB 1FFOB 1XGPB 1D5ZA 5DS8B 3OXRA 3T0DA 1R6VA 3LN4A 1UQSB 3MJ6A 4NQED 1HWHB 3N9GH 2D9CA 5SWZA 4F8TA 1HZHH 4P2QD 3TM6A 5JLZA 4ODUA 3B9KD 4OAWA 3KPRA 1EO5A 5KN5A 1QZ1A 3G6DH 3HC0B 5JO5A 5C0CD 5DJDB 3QXAA 3T0ED 4OKVB 3F6IA 3EIFA 1NCTA 4WWKA 3ES6A 1WAAA 4NP4H 4TPRH 3WE6B 2B0SL 3A67L 1O5DT 1H8NA 4TUOB 3TJHD 2NY5C 1CU4L 1N7MH 1YECL 3RTQB 1T66C 3G5XA 4ZFZB 3MV8D 5ANMA 2EO1A 3MNZA 3CU1A 3QIWC 2AJZA 5KOVC 4I9WD 4OD1L 2UZYB 1C7TA 2WMPA 2DS4A 2XTJE 1MCOH 4Q9RL 1FC2D 3MLYL 2BVOB 2QR0B 1B4JL 4K8RH 3JUYA 4FQCL 1DQDH 3GUTA 4OCYH 5EOCH 3ARVA 4JRWA 3D39E 4LLYA 3IJSB 1K5NA 2X41A 3RAJH 3PIQA 1ZS8B 4G5ZL 3VXUA 1ZT4A 2DM2A 5F9WB 4HW6A 2VDML 4PB0L 5C3TA 3VFOA 5C0EA 1QKZL 1HNGA 1HSAB 2FO4A 2W0PA 4LCWD 4Q7DA 3K2UH 4KTDH 1NGQH 2H8PB 3L3DA 4L9DA 3RUGF 1A6UL 5C1MB 4LSTH 4O2CA 2JCCA 1LO4H 4LGSB 4XNXL 3GSXB 2GAZA 4KKAC 3ZHDA 2ZSVB 1M7DB 5F3BB 4PJAE 5FM5M 4C56E 2HTLC 3T8XA 4LHUB 2BSRA 5KSUB 1CF8H 2DN7A 3E3QC 5TGBA 3V0AC 4JY6A 1J9CT 2YA2A 3DXAE 3OXSB 4OGXL 4ZD3H 3UZVB 3IVKA 3QFDA 1A6ZB 3F62A 2H32B 5LCVL 4I2XB 3RU8L 1KJ2A 5GRXG 4K2UL 1IGMH 2Q1EA 2X4RB 2RHEA 3RWJB 1PGRB 2YWZA 5HGGS 2FJGB 4ELMA 2X4QA 4NQSA 3FO9B 1FG9C 4NQCE 4KJPD 3CNKA 5E8OA 4M1DH 1AE6L 3RUGB 4NWTL 2O5YL 4LF3A 2VR9A 3RRQA 3NIDF 3DMMD 4HULB 2IFGA 1MFNA 2LU4A 2DMKA 4YXKL 3TP4A 1WBYB 4K3EH 4NWUL 1DL7L 2ZUWA 4NKOB 4NGHL 5T1KB 2C1OA 3ILPB 2ARJQ 4LSUH 5A40E 2DQTL 3LMJL 2Q6WB 4DK3A 4HKZB 3LKNB 3TZVB 4EBQL 4Z7WA 1MLBB 3E8UH 5ACLA 4TSBL 3BQUC 3HN3A 4MJ5B 4X7EC 2VXQL 4X5WA 2IH3A 1SEBA 3VXOB 3O3UN 3GSWB 3WNLA 1JYXA 5B22A 3VFMB 5LG1A 4G7YL 4U1JB 2CMRH 4YXHH 2HRPL 4XMLH 3IFPB 1ZA3B 2I60L 2HN7A 2VH5H 3E6HB 1G0DA 1UWGL 5D7IF 5DEZA 5DXWA 4FTVB 4C83A 4AQOA 3LKPA 2G75B 2X1QA 3IDNB 5C0JB 2RIKA 2HTKC 3FRPA 1G9NC 4TUKH 3C08L 3DVNA 1CICB 1IAOB 4OZGA 1JTPA 3VDBA 5DYOB 4EUPH 4WUUE 3RWDA 3D48R 4JPKH 4J8RA 2WLZA 5DZNA 3HNSH 2KZWA 1TJHL 3LH2H 1CLYH 4NIKB 3D85B 3BZFA 1ZAGA 4HCRH 4OCWH 5E00B 5IT2H 1OL0A 5GS0D 1IAKB 3MRGB 3QCUL 1J11A 3LCYA 5JNYB 4HKBA 1J8HB 1NDGB 4NUJB 1ZLWK 4ZNEE 1RUAL 1V3MA 3V6OA 3BH9A 4JFQA 2AJYH 4PJ5A 3RVXD 4KWUA 4JZOB 5KSBA 4GS7B 4LLQB 3RIFF 4RFOH 5D7IB 2W0FB 4HGKC 1I1AD 5CMAA 4HUXB 1NUGA 3MMEA 1U8MB 1K4CA 1KJ2L 3F8UB 3QA3B 5HYQB 2BRRL 2PYEA 5MI0B 5E5MB 2XN9A 3DO3A 4O5LH 1MFDH 5FOBB 3X12A 3CUPB 4P2QE 2FX8L 3GJFA 3V52H 5FYJE 4CVZB 5IG7A 3PQYB 3P9LB 4S10A 1TTUA 2DQCH 3O2DH 1MJUL 3V5HA 1S7XB 4YHLL 3MBXL 3QDME 3QI9B 4XPBL 3OKEA 4JRYB 2DQGL 5F1SA 2R1WB 4TNWK 4OQTA 4JHWH 4Y16A 5JMOC 1WCBA 4ODSL 4PRID 1BQUA 3ROLB 1MVFA 5EU3A 2GJ6D 3S4SA 5CJ5A 4PJBA 1KTDB 1CT8B 3K2MC 3W9EA 3WO4C 4OZHE 4P5TC 3MFFB 3SY0B 4JVWA 1WT5C 3ARED 3O6FA 1T21A 4G8GB 5FYLL 3KPPA 4LMQE 2GEEA 4NO0A 4U6VL 4WW2A 5GGUB 2QSCL 1G1CA 4DOHB 3L5WA 2OXHA 2R0KL 3KYNB 1VSCA 3F12B 3BW9B 1U8KA 3RI5F 1CXLA 4DGIL 1WZLA 3JVGA 4K7PX 3RKDD 1YPZE 4LRIC 3S96B 3L5HA 5IEHA 4N0RA 1OGAB 3H7LA 2I07A 4K71B 1CLOL 3VFUA 3I2CL 4I77L 3NTCH 3HRPA 4YDLB 3BIKB 1U3HA 5A16B 4C54A 2N7BA 2NW3A 1MIML 4O02H 1B0WA 1KB5H 3BHBB 3NFSL 1OP3K 5L2JB 4YE4L 3A0OA 2V2WB 4WI2A 1ZVSA 2XA3A 3GRWA 4LCYB 5H94B 2NTFB 3VCLA 4ZPTA 3F7QA 3QRGL 4KZEH 2BVQA 2DWEB 1FVEA 4L3EA 3OPZL 4FQHA 1QFHA 4W6WB 1A3LH 4YDJB 4GRWF 5I71C 1L9NA 1IC5L 1S78D 4NT6A 1FPTH 1P4BL 3VFRB 3C5ZD 4M6NL 4P3CH 3ARGA 5EUKA 4TRPH 1UXWB 3IFOA 4A2MA 3SGKA 3CLEH 3JWDL 2E3VA 4K7PH 5FO8A 1H3GA 4YUEH 2LTQC 1ZLWH 1FH5H 4QXGL 5D1ZD 1D6VL 1AHWC 2GK0A 4MB5A 4LIQH 3NH7H 32C2A 4ONFH 3A6BL 1W72B 1CK0L 3GMPA 4XHJD 3RHWK 3O4LA 5DMIL 4PS4H 3QQ3B 3KPLB 4OQTL 5HGAB 5CZVH 2EE6A 1TTGA 1QBBA 1DQQA 3RWIB 1IAIH 5E9DD 2DQFA 3BUYB 3EJZC 3P4LA 4I8DA 2OMNA 4GRMB 5CSZB 1NCBH 2EIDA 4GRWB 4QOKB 4ZO8A 2ARJB 4I2XE 4EVNB 1S9WB 1JRHH 4WTXA 1FYTB 5IBUG 1OAKH 3S88L 1EERB 3EW3B 1KFAL 4UIKH 3MXWL 4P2CG 4EXKA 3QIWA 1X44A 3RUGE 4OCRH 1OHQA 1S9VA 4WEUD 5T5FL 5GPRA 1RUML 5CLWA 2HAZA 3HE7B 5FIEA 2Z91B 3VFTB 1HE7A 4OB5L 3DVGA 3Q3GA 4XNMB 4FRWA 4XP9H 4LPUA 5J13B 5GGRA 2ZUVA 3QUXC 1CD1A 1HH6A 4X5XB 4C59B 3MLWH 3STBA 4MSWB 4OUUA 5FA4A 3QO0B 1AFVH 4R97C 3ULUC 2NX5D 3U46B 1JI1A 3DYPA 5TJWK 4TNVK 4XAKE 1YEDB 5DVLA 1JPST 4ZO9A 5DZLA 4BKLA 3JXAA 2YWYA 1B9ZA 2FSEB 2NXYD 2ED9A 4OV5B 1AD0A 2YUZA 3TO2A 5A2FA 3GRWL 4F7MA 2EEDA 2R56H 2XWJA 5I8EB 5H37H 4HT1H 4YHKL 1U6AL 4LSVL 4FTVE 4TVSa 3BFOA 2AXGB 3QXUA 2FRGP 3F7YA 3W81A 3S3SA 1II4E 2Z4QA 3RL1B 1VHPA 4YNYB 1G6RH 1B90A 3BP7B 1RSFA 4XCNA 3OTTA 5ICYA 4G8EA 2RQ8A 1Z5LA 4D8PB 2BY3A 1VACA 5IBTL 4U1NA 3OKDA 1OP3H 3L3OA 5EBWB 4NQDA 4G43A 5BV7H 5EIVA 1SVCP 4CBPA 1RZFH 4PLOB 4QRPA 4X6FB 2AV7B 3Q1SL 4PRIE 1J8HE 2AW2A 4JG0L 3TNNA 1FNEA 1XF5B 5F8QC 4EJ1C 4FHBD 1PEWA 1U91B 4OLVL 5HPOA 3G9AB 3BD3A 4FQXD 1BM3H 1U8QA 5FECB 5D7IE 4XBEL 3MRQA 2DQIH 4QRQA 1QR1A 2F53D 3KJ4C 1F4WH 3KG5A 2GHWB 3AFLA 2W38A 1MWAB 5FGRA 4F7CA 2YD6A 3W11C 1IQWH 3REWB 3S6CA 3NIFE 2WUCL 1TCRA 1OCWL 1WC7A 1H3UA 2F5BH 2MFNA 1A3RH 1FG2A 4XCEA 2BVYA 2G5BB 4X9GA 5DUBA 5AAWA 4JM2A 3FAXA 5KVDH 4UIMB 1T7YA 5HVHB 3CFBB 5ALBL 1QYGH 5IW3A 2MOVA 4HJJH 2MTPA 4HS3A 1BBDH 1SQ2N 2P48B 1U8PA 3WBDA 5JW3H 4KFZC 1N3NB 4FABL 4YDVA 1A47A 3LKOB 2DLHA 5KVMC 1G1YA 2DYPB 1IKNC 4PR5A 3MZTA 1M4KA 3HMWH 2F9BT 4LLMA 2HT4D 3C5SA 1MRCL 4ONGH 4U2YA 2J8OA 3PHQA 2CLVA 3LQAH 1A9BB 5CP3A 4YWGL 5GGQL 3WDHA 2X6MA 4G8GE 5E2UH 4NRZB 1PFCA 4M5YH 4E5XA 4K07A 5D7SH 3S98A 2R1XB 1R0AL 2HJFA 2J4WH 5C0AB 5F7MC 4KJYB 2FGWH 3NN8B 4X4XA 4OLWH 4XPHH 4DOHE 1QQDB 4AEIH 4F15B 3ZZ1A 4K94L 1DQML 2IF7A 4ERSL 3ZO0A 3NZHH 2NY6C 3MJ7A 1KIPA 4KPHL 3GBNH 2OI9B 1ZK9A 4UZGA 4Z9KB 4F33B 4GW1B 1PZUB 4Z95H 4N5EC 2GTZB 1MCRA 4TULL 2A77H 5J3HC 5AZEL 5BVJB 4OD3L 3UBXG 1KIRA 2XY2A 4IEFB 4PY8I 2Y07H 1SJEB 2GW5A 2GFBB 3HZMB 2OQJB 1EFXD 5EZOH 3KLAB 4WENB 1EEYB 3MCKB 4DZBA 1RJZA 2V5SA 4XI5C 5B21A 3WNKA 2DQDL 1ACYL 5JPNA 3GKWL 1M7IB 4R7NB 1DR9A 2Z8RA 4G6JH 2CIIA 4JHAH 1J0HA 2BDNH 4LLDB 2ZG1A 4L8SB 2FBOJ 4TSAH 3DRQB 3VG9C 3MNVA 4WGWB 4PLNC 1IM9D 1MAJA 4P5TA 3ARDB 4KTEL 3D69A 5HJ3B 1HINH 1KG0B 4Y2DD 1WVZA 4GQPH 3WLWD 2FB4H 1RIVH 1T1YA 5EU5B 5GSVB 3CH8A 5F9AC 2QSTA 3PL6B 3UPCA 3BE1L 4UU9B 3SDDB 3KR3H 2ZCHL 2Z92B 3QIUD 5TDOA 1ZMYA 2NY0D 4LCCB 2XOTA 4YHIA 5D8JL 4Q6IB 4C4KT 3IJHB 2V5YA 4QRRD 3WUWG 1ITBB 3U9PL 1T0PB 1CL7L 5MEPB 3B2UD 1G9NL 2YMXH 2O5ZL 4UB0L 1MCFA 3UTQA 2HT2D 4GW5A 1ULVA 3B3IA 1UM4L 4XPFL 3SE8H 4GRWE 3LHPL 1TVHA 2R4RH 1KELL 2MKWA 5F9JB 3VGBA 4DVRH 3MYJA 1K6QL 1FYTE 1AGFA 3A6CH 4KKLC 5CEZE 4TVPE 2W9LA 4PJXF 3RWCB 4MJ4A 4ELKA 2BVUA 5BRZA 3KPSD 4UOW0 5GJTL 5C70A 5JR1H 1KACB 5DRZA 4G8FA 3SPVB 2OBGA 4RRPG 4RGOH 2NXZB 4JPIA 1P1ZA 1FLRH 4KQ3L 4XH2B 3QEHB 4NRYA 5I17A 4R26L 1G9ML 2HFEA 1A1OB 5EIIB 4NO3B 3VI3F 4XX1G 1CL7I 4NC1E 4YLQT 2NTSP 4HSQA 3LKRA 2VDRL 5D7JD 1K4DA 2YPLD 4PJXB 2J3SA 5DFTA 1BF8A 4AM0B 25C8H 2F53E 1AO7D 1WQVT 2C4FU 5FYJU 1R3HB 5EBGA 3HTLX 3PHOB 1S7WA 1EO8L 3FQUB 3D9AL 4PRNA 2B0SH 3D25B 1F3JB 3VFGL 5DVMA 1CU4H 1TJGL 2HFTA 5KS9F 1RUKH 4I0PD 1C16A 1QSFA 4F3FA 3RVWC 1QA9A 3CXHK 4R90L 3WFZA 3VI4F 5L9DL 1I75A 3VDCA 5I75C 5J1TC 3DGGB 4Z7QE 5I1GL 1U8IA 5DD6A 3C6SB 5L7XL 3MLYH 5EO1B 1B4JH 4KMTL 1GOHA 4OZFH 5KSAB 1P5UA 3C8DA 5E2WL 3UC0L 4DGYL 4JM4L 2GT9B 4JRXD 1RZGA 4I4WA 1G9EA 2AJSH 4KVNH 2VUOA 2IAMB 2EDYA 1GRWA 1ZLUH 2XI9A 4O2FB 3QUXA 5GRVK 4OUOA 3CSYB 5T3ZE 4BQ6A 4HUNB 1WIPA 4H0GA 2VDMH 3U4EA 2D4FA 3CVHB 1EZVX 1Q9KB 3UTZB 1F2QA 4Z7OE 5JORB 1NQBA 5DJCA 5MI0C 3O81A 1CFTA 5KS9B 4LCIL 3C9NA 4X99A 1A0QL 2AI0H 4M8QA 4XNQB 5I8KL 4TQEH 5LXGL 3IS1X 4BH8B 3BPOB 1B6UA 2VXUH 3LEXB 1OD7A 3NFPA 1NAKL 2QQLL 4OGXH 1T2XA 1YN6A 2F74B 2IH1A 3DX6B 2IANA 3FQRB 3H9ZA 3KPMA 3ZDZE 2CR3A 1NGWA 3RWGA 3J7HA 1C12A 3CXDL 1BFOB 4MA1C 4K2UH 3RGVA 2I5YL 1TETL 3RA7L 1R3KA 3WHE0 3GMLB 2XZCL 1DN0A 3EJYD 4Y5YB 5GISL 1KBGL 3BP4A 2EIEA 1AE6H 1T5WB 1O7SA 2UY6A 4NWTH 3HLAA 4EI5D 4OJFL 4QF1A 4M1CC 3VFWB 4AIOA 5C0AE 1BQHA 3IFLL 2FL5A 4YXKH 3DPBA 4MDJA 5HI5D 3WFEH 3O6LL 4OTXH 3WD5L 3FZUD 1XGTB 4LL9A 4P59H 5FGSA 2P46B 1ZT1A 2Y5EA 2IWGA 1DDHB 4NN6B 4YHYB 3R4DA 3CCHB 4KK6C 5TE4L 3TPUA 3WDIA 4HLZH 4PJHF 4U0QB 2ZPKL 2XY1A 4GG6F 3RX7A 1DJSA 2HRPH 5DFWH 5DRWA 5D2NB 3JWOC 3EO0B 5AZ2H 2I60H 4D9RE 4NFBA 4QRRE 1PY4A 1JGDA 5BS0D 5HYJB 4HPOH 1N8ZA 2NY1B 2AJXL 1RJYA 1N6UA 1FORH 3QFJB 1HILA 2QQNL 5IFAL 2CDGB 3GSNA 4N9GA 2XIDA 1KIQB 5CEYA 4LKXA 1RUQL 3OR7A 4DFIA 3DJ9A 3UJIH 1OB1A 3TBWA 3KPSE 1T6WA 4PJHB 3ZLQC 1AQDA 3O9WC 3DUUB 3T2NL 1NCAL 4GG6B 2QTEA 2YKLL 3QXDA 1RUAH 5ETUB 2VITB 3GMMB 5IM7B 1RHHB 1DBBL 5FUCC 2YEZB 2EYTA 2O61B 1QLRA 1XGPA 1AR1C 1KPUB 1Z2KA 5CSBA 3IGAB 4LVNB 1GZQA 1UQSA 2V7HB 1DQTA 3OKOB 1NCCH 1L6ZA 2XACC 1KJ2H 3CH1A 1YEIH 4UAOB 5ADPH 5DJDA 2BRRH 4LPYA 1T83C 4YXLL 1E27A 3ZKQD 5C09A 4CGTA 1KEMH 2QL1A 2V7NA 2YPLE 2X4PB 4KMQA 4WFEE 3OKLB 4TUOA 1MJUH 5ISZA 4Z0BH 5BQ7A 3RTQA 2L7JA 1LO2L 3MBXH 5HYSB 1NC4B 4NHUA 4AEHL 3L7FB 4P2OD 5DA4A 2DQGH 3SDCD 2AAVA 5JIKA 4WRLA 2W0LA 4OFYA 1XR8B 3OHXA 4Y19B 5I16B 2VIRB 4HIIB 3BKMH 8FABB 1G0YR 1NLDL 1BOGA 2VXSL 4WFFD 1ZS8A 5FYLH 3HMXA 3PWJA 1PZ5B 1GXEA 3OJVC 3ELAT 2XYCA 4P23C 4JREC 1X5LA 4U6VH 5FYJL 1OTTD 4OQ1A 5TDNA 2BFVL 3DYMA 4OLYL 4S1DD 4CVUA 3F65A 2R0KH 4KJWC 2YD4A 2X4NB 3GSVB 5MHSE 2IQ9L 3ARBD 1YMMB 1M7DA 3G9VA 2IADB 1WWWX 1X4ZA 5EFIB 1RMFH 4PJXE 4N90E 4M9PA 5F3BA 1V7ML 4JO1H 1I9RL 3GSNL 4HIHA 2ESVD 3FQTB 4HIEB 4QLRA 2ZSWB 4XWOC 5DHYB 4I77H 3OXSA 2B5IC 2D0HA 4E0RA 1KCUL 4U1HB 1A6ZA 5DGRA 1I3UA 2H32A 4RZCB 5ITBL 5F9OL 5MEOA 4XC3H 3I6GB 5DQJB 3NFSH 3RWJA 1KCVL 2X4RA 5KAQG 3L3JB 4D0DB 5BO1L 3ARTA 3FO9A 2VLKB 4KAQL 2DD8H 5D5MA 4GMTL 1M71A 1NAMA 3QRGH 1AXIB 2A9NL 2X89A 4F7PB 3EDEA 5J4MA 5EBMA 3O11A 1PEZA 4URTB 1P53A 3HNVL 3BI9X 4R9HA 4QHNB 1D9KB 1WBYA 1P4BH 3GHBH 3ZT6A 4YDKH 4F58L 3UTTB 5TH2B 4OCXH 4UOJA 5GJSL 2VUYA 4LU5H 3LKNA 2YA1A 4IRSD 1E28B 4JFFE 3SKNB 4EQ2A 4QXGH 2X70A 7FABL 3ARWA 3QZWB 5KS9E 2NYYD 3GSWA 1CK0H 3VFMA 5DMIH 3T1FA 2EDKA 5F1KC 4U1JA 5BOPA 4OQTH 4U1SB 5J8OA 3IFPA 4PP2A 1NCDL 4KVCL 3E6HA 4H20H 4LMQI 2AGJL 4XP1L 4GXVL 4Y4FB 3EOBA 3RX8A 3QQ4B 1YMHB 2COQA 2H6PA 3BX7C 1XIWD 2YC1A 5T3XD 5D1XB 5IHBA 2JE8A 2VDLH 4ZUVA 5EIQA 1FGNH 2VQ1B 2AK4D 4XNUL 3BKYH 5MERB 1CICA 1IAOA 2AEPH 5DYOA 5FUOH 1JJUA 3HMXL 2MHAB 5BS0E 3VXSB 2DIJA 2EKJA 5LWYL 1KFAH 3WV0A 1A7RH 3MXWH 5C71A 5D72L 4ETYA 1SY6A 1ONQB 4V1DB 3D85A 5HY9A 4P4KD 5JW4N 3MRFB 5HHXH 1IAKA 3MRGA 4IOIA 5JNYA 1A5FL 1NDGA 2EDDA 4NUJA 4OB5H 5ILTL 1NSNH 4A6YB 1QBML 2O5XL 1YC7A 2YD7A 4JHZA 5D96B 1ADQH 5FUZL 2Z8WC 5F7EL 5HDQL 5IQ7L 4ZUWB 2EH7L 4OM1H 4NQVB 3P4OA 2A38A 1PX4A 5IFHL 4LSPL 4UV7L 2H9GA 1I9EA 1U8MA 3WO3B 5HYQA 4GUPB 1KLUB 5FOBA 2APFA 4LP4A 5J56B 4J4PC 1JWSA 2QADD 5E7FA 4CVZA 5D2NE 3PQYA 2ATPA 1GGBL 1I3RA 1NAML 3MXVH 5H8DA 5HHMD 5SX4I 2FGZA 1QUNA 1IM3A 5FHBH 2YR3A 1I4FB 5HGDA 4ZOAA 4DCQB 4RGNB 4YHKH 5HYJE 3S3JA 1U6AH 4KU1A 1LEKB 5BZDB 5IWLC 4JRYA 2R1WA 3SE9L 3QFJE 3QHTC 5JIIA 2CK2A 1I3VA 1HKLL 3HAEA 5DK2A 1CDHA 1KNOB 1KTDA 1CT8A 1JGLH 5IBTH 3MFFA 4JKPL 4FNLH 3S35L 3SQOL 1I8KA 5CEXB 1Y0LB 4HF5L 2KBGA 3PGCB 4NJAH 5TDPB 3EOAB 4D9QD 2IBZY 3TYFB 4MAUL 5GGUA 3KYNA 1S5IL 5EOTB 2VLRA 5F8RC 5E6YA 4HXAL 1FNGB 1RZ8B 4L8BA 3VRJB 4QRSB 4XBEH 1J1OH 5C08A 1DE4B 2GSIB 4HGMA 4LBEA 4LAJH 1VPOL 3BZ4B 3ULVF 5DJYA 4MB3A 3CXHJ 4LLWB 1JHKL 4M48L 1OGAA 4HWBH 4K8RD 2DKUA 4LQFL 3V0VA 2V2XB 4QHUA 5IMOA 3WL9B 5J11B 5KBNC 2R2EB 2WUCH 1R5WB 1SY6L 1FVCB 2GY7B 2D31B 3BIKA 4UV4L 5A16A 1OCWH 5ICZA 3D3VD 1EIBA 3UZQA 1RHFA 2X44D 4BSJA 2ZUYA 1V3KA 1ZXQA 5F21B 5IKCA 3BHBA 3UTPE 5L2JA 1U8NA 3ZKXB 2ESVE 3L1OL 1T5XA 2V2WA 1EDQA 4QYOB 5GRJL 5H94A 2NTFA 1UT9A 5HI4D 3OV6A 4LDEB 4FABH 4HJGA 2DWEA 1M05B 3TBSB 1MEXL 2HVJA 4Y19E 3SDAD 1UXWA 2Q7YB 1IGIH 3VD3A 5AG8A 4YDIL 3HR5B 5IHUL 1BGXH 1MI5A 3KLHC 4KZDL 3WKMH 1O0VA 3ARQA 1GGIH 5DC4B 1LVEA 3TH3T 4ZFOA 4K94H 5JPMB 2OXGA 4RGMC 4WFGD 3QYCA 5I8CA 3EFFB 4U2ZA 1ES0B 4TUJB 4UQ2A 2VAAB 5F1IB 3VRLF 4CMMB 4FXLA 2B2XL 3QDHA 3MRNB 3QQ3A 4KPHH 1K3IA 5HGAA 3S37L 3BPCA 3MLSL 2UUDK 5T1MB 3RWIA 3RZCD 2BXYA 1HN1A 5CSZA 1T83A 3BIAX 4ISVB 4QOKA 5F7YC 5AZEH 1BIHA 2EDEA 4Y1AA 3ETBF 2FNBA 1S9WA 3MODH 3S9DB 5SWSD 1A1MB 1MAML 5KVEL 2EDHA 3EYVB 2JK5B 1RFDH 1HYRC 4LVEA 2VLKE 3VE0B 5T5NG 2Y7QB 1GIGL 3TNMB 2DQDH 1ACYH 3EO1B 4LOUD 3RVVD 1EJOL 2FZ3B 2AK4E 15C8L 1INQA 4HEME 3VFTA 2GITB 3FFCD 1EO7A 5E6ID 2J7LA 5M94B 3ALWA 5EA0L 3ZTJH 1FGVL 2GSGB 4JDTH 5I73C 3IU3B 4KTEH 4X5XA 3UTTE 4PREB 3BUTA 2E8YA 1HHHB 1LHZA 3QO0A 5FYKL 2N1KA 4UILL 3RKPA 1ZOXA 3AB0B 4P23A 1YEDA 3GHEL 2WK2A 3G5ZB 4ZOCA 1U58A 3T2OA 3DV4B 5INCA 1CIDA 2VZ1A 5D8JH 5I1CL 1CL7H 1X5HA 4JFOA 4CDGC 4GKNA 1A8JH 4UB0H 1JYVA 4OFKA 5D6CB 4BQ8A 5C9JB 3IXTB 4ZO6A 1UM4H 4WEBH 5GS1C 4MCYB 3V4PL 5C0GB 3LHPH 2JLLA 4XTRD 1IT9H 2P5WB 1AGBA 1IE5A 4M93B 2W60A 4OZ4B 2QQQA 5E7BA 4LARL 2XA8H 4HUWA 5HHME 1MCDA 3S97C 4DK6A 3RL1A 43C9B 1K6QH 4YNYA 3BP7A 3GSUA 3VXSE 5JHLL 1QPPA 4D8PA 2APWA 5FM8A 2AABL 4V1DE 2AXFA 3H7BB 1BVLB 5EZJB 2YUXA 3LRHA 3ARFD 2XKNB 4ZFOL 1IGCL 4RQQB 3KJ6H 3PDGA 2A6DB 5GJTH 3EJJX 1W0YT 1MJJB 3T65B 3UJTH 5EOQL 1TIUA 1DLFL 4K23L 1VEOA 1BAFH 4FQLL 2IGFL 5HDOA 3V6BR 4CMHB 4G8IB 5ID0B 1CYGA 1U91A 4XCFL 3C60D 4R26H 4XPTH 3QUYD 1G9MH 1HHIA 5FECA 4F57H 1T0NB 3JV6B 3M8OH 3QDJA 4MJIA 3MUZ1 1U2HA 2X4UB 4P46D 4D9QE 4X8JB 1OF2A 1MWAA 5CEZL 2HMID 3DO7A 1BZ7B 1TZIA 2WW8A 3UDWC 1T22A 2VDRH 3REWA 4DFHA 1A6WL 5D7LB 1GC1C 1AKJD 1N64H 5I1KH 5KTEL 3WJLC 2XT1B 2CUHA 3NACL 2V9TA 3QCTL 4I3RL 1NUFA 2G5BA 4YHPB 3DETC 2PR4L 4M7KH 1YY9C 2UUDH 3CFBA 4KK8C 3O41B 3D3VE 1NCWL 3GO1L 1JPTL 3LKOA 4PB9L 2DYPA 3JV4B 4PRPD 2XPGB 1UB6A 4MHHI 3VFVB 4QTHB 5GRYA 1IEBB 1KN4H 3JV5A 2CKBA 2VZOA 1A9BA 3OKMB 2PXYD 1I7UB 4NRZA 5I0ZA 2FLBT 3PNWB 1RK1B 4E42B 4DGYH 3GIZL 4AIXA 4X9IA 3BYTA 3LOWA 1X5JA 4QRTB 1QQDA 5CJQH 2GTWB 5CZXC 1XR9A 4PRAB 4PJ9D 3VWKC 3NA9L 1MCJA 3IDJA 4KJQC 3MZGB 2FHFA 4JFZL 4W68A 4U05A 2KKQA 4LCUA 4WHYG 1XZ0A 1JYWA 1UACL 3INUL 4LCIH 2XWTB 4PGCA 4B41A 4X7TA 3VFSB 2GTZA 4PP1C 1H15B 5LXGH 1S5HA 3WNOA 5K9JH 4OCLC 1F4XL 3NABL 4X7SL 1IGJB 3V0WL 4IS6A 1SJEA 1JYNA 5F1NB 5D1QB 1OOAA 5DI8A 2R1YB 2OQJA 2YXMA 4GW4A 3W5NA 1NAKH 2QQLH 3H9SD 3Q6FB 2J88H 2AJUH 3MC0A 3MCKA 5IWLA 4XC1H 5EU6D 1MCWM 2A74B 4R7NA 2BY2A 5EPMB 3TYGH 4B7IA 5ITFA 1JPGA 5T3ZL 2I5YH 1JHTB 5C07A 5SWSE 1J7VR 3RA7H 2EDOA 4AMKL 5HHOD 4D9LH 2XZCH 2VWEE 5GISH 5ESQB 3DRQA 4M7LH 1KBGH 1OSPL 3CZFA 3V5DA 4QO1A 1KB9K 1QBLH 3ARDA 1MWAL 3ULVE 3UMTA 4WV1C 3OGOE 5HJ3A 1CGTA 4KUCF 4GRLB 1KTRL 3IT8D 2EC9U 3SCMB 5JOFB 3WFCL 1EMTL 2CGRL 2VISB 3MV7B 3WD5H 4O58L 4UU9A 5J0BA 5HD8C 5JDSB 1WZ1H 3O8XD 1H5BB 3RDTD 4PY8J 5CD3B 1R5VA 1EHNA 1NBVL 4D0BB 4IDJH 2CXGA 1ZGLA 4F9PA 1HHKB 3I02A 5MEPA 1NMCC 1JTTA 5T33L 2YRLA 5E8DH 3BD4A 4HH9A 3IDIA 2OK0H 1L0YA 1ETZB 4EN3C 2GIYA 1V7NH 2NZ9D 4LSRL 5DT1H 4S2SB 3CMOL 4BFIA 3S34H 3VXQB 4PV9A 4L8CB 2CKBL 4WDIA 4NNYB 4ZSOB 4ZXBB 2PTVA 4WU7B 3GB7B 2XV6B 5F9JA 4X6BB 1RUPL 3VXMB 1L7IL 5B38B 3RWCA 1LNUB 3FB7B 1KXVC 1VENA 2QQNH 4YX2L 1F4HA 4LVOB 3EYUL 2RAMA 1FIGL 4JJ5B 3M1BB 4YK4C 1DLHA 4M1GL 3GMQB 1GZPA 2XKSA 2HJKB 3SPVA 5F7FA 1RUQH 3IAQA 3KDMB 3ZYJA 2EEBA 5T1LD 1G7PB 1A1OA 3M17B 1NCAH 3T2NH 3MV9A 2K7QA 4NO3A 5MEND 5I1DB 3KYOA 3AC0A 4JPVL 5CGTA 5KVFL 1SBSH 2E7CA 1IC4L 3D2UA 3FAWA 3B9KC 1FDLL 5IB5A 4NKMB 3VFNB 4PJXA 3CFKB 4Q0XH 4YBHA 1NEUA 4AM0A 1IEAB 2R0WL 5A2KH 4IRJD 3T0EC 4L4TA 1NEZB 2DI7A 4DKEL 3MRCA 3L3KA 3U6RB 5DJ8A 2X9YA 3D25A 2P5WE 4YBQD 2DBLL 4NQUA 1F2XK 1UA6H 3AS0A 4MXVF 2LU7A 4JFEB 4R4ND 3JTTA 1KN2H 4JN1H 2FEDD 3RP1A 5CILL 1ORSB 4I48B 5I8OL 3QEGH 2BNQD 3V5KA 4PJ8B 2H3NA 1OT1A 5EO1A 3BP6A 1JV5B 3KLSA 2LVEA 5TQ0H 3LS4H 4PRPE 5KSAA 1LO5B 2GT9A 3FO2B 2APTA 2A6IB 4GBXD 2VDOL 3TWCH 3V4VL 3WXVH 5IMKA 1CDYA 4P5KA 2D7TL 1C08A 3MLXL 5FFLA 1RVFL 4IJ3B 1MQKL 3EOYG 1ODAA 5FYJH 3CVHA 2BFVH 1A6AB 4J2XA 4RMSA 4H0IA 5I9QC 3FHQA 1BFVH 4JO2H 3CVIL 3FMGL 4OD2B 5KS9A 4P48A 2XICA 1NGYA 4XNQA 1UWXK 1FFQA 4WW1B 2E7MA 1A14H 3WN5C 2NY0B 4UDUA 1FFRA 4KHXH 2CR6A 3OKNA 3U7YL 2X10A 4GAYA 4ODTH 3QIBD 5IFJB 3GSNH 3U7AA 2P42B 4ZAKB 2R0LL 4F8QA 1YNLH 4XVJL 4J7RA 5DVKA 3DX6A 5DJXB 3FQRA 3NCJH 1MUJA 4K9EL 5GS1A 2RJMA 4Z7UF 4HUUA 1DFBH 5HHVH 1K3ZA 2H2SD 3NCBB 1EGJH 3GSOB 1YEGL 2HFFA 1ZLSL 1CGSH 4L4VB 1FL3B 4G6FD 4KJPC 2CH8A 4QT5B 4KAQH 3JV0A 1EHLL 1EEZB 3F58H 2P5ED 3TT1L 2WBJD 3DMMC 1QSEA 1GAFL 1XCQB 3HNVH 5HHOE 5FO9B 4PRHB 3X3FH 1LO0H 1TQCC 1Z3GL 3L5XL 3KXFA 2AKRA 2OSLB 5CJXC 2ZUQC 1CDUA 3IAGC 4Y5VC 5FHAL 1DDHA 4KHTL 4HQQH 3CCHA 4JFDB 4ONHB 4Z7UB 3VGAC 2FJHB 4DN3H 1ZHNB 1JMXA 2OX5A 2XRAL 4WO4B 3TVMB 3D6GA 5J11C 2GJJA 2B1HL 1WEJL 2BY0A 1JGUL 3MBEB 5F96H 3NCEB 3UDWA 4GKZB 3GNMH 4RFEB 3L3HB 5IR1A 5LKNA 3EO0A 4C58B 1NCDH 1YYLL 1FVDA 2ZCKH 4H1LB 5DEFB 4XP1H 3Q0HA 4OIIH 4POUB 4OLUH 3WJLA 2WQRA 4U6HB 2CLZB 5HYJA 4PGBB 3BO8A 3UJJL 2CK0H 3LZFL 3FCTB 2W9EL 4RNRB 4XNUH 2IPTL 1RZJH 5JTWA 3X3GL 5IVXF