2VDQL

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqL01
1NLBH 1FH5H 4LLVB 2XZCH 1EA9C 3TO4C 3FT3A 1NEUA 1OAKH 5D2NE 1LK2B 3BZFB 5FDWA 1RK1A 3LAFA 4Q9RH 4ZD3L 1H3XA 4CBPA 3S88H 4QHUB 1BOYA 4R97C 5C0DB 2Y6SD 4KJPC 5E9DB 5F44A 5HGHB 2DM7A 2E9IA 3FFDA 3QDGD 4KHTL 1KC5L 3KVQA 2P49B 3TVMC 3OR6B 1A4KB 1FNHA 2DQUH 3LS4L 1A6AB 2AQ1A 1D5XA 4UINH 3SGDI 4KVNH 2YD2A 3V7MA 2B1AL 1YEEH 5EU7C 2FHCA 2BOBA 1RUKL 2MHAB 1TENA 3X13B 3RL1B 1A3RH 3AU1A 1OTTD 1J1PH 2BSTA 2G2RA 2LAAA 2DYPA 1KPUA 1WLHA 4KHXH 4R4BA 4MCZA 2IADB 2BRRH 4LLYB 5HYEA 4RMWA 4LSRH 5IHUL 2DWEB 4UIKL 3VFSB 2ZUSA 5HDQL 5GGSB 4C56B 5F21B 1T0NA 1J88A 4EI5C 1XZ0A 4QYOA 5K9JH 4C4KT 3BP7B 1BWWA 1I3GH 4Y19B 3A67L 4PD4K 4JFPB 1P7KA 3IDMB 2O5XH 5FYLH 2HKFL 1IKNC 2LU7A 1CFNA 1PKQA 4NN7C 1J12A 1MFDL 2VDRH 3V7AE 5ETUB 1CF8L 4XCEA 4Y2DB 5FEBA 1MEXH 2AK1L 3LN5B 1HOCB 4FQ2H 1F3JB 2IAMA 3VD5A 1HDMA 1A0QH 2FLBT 4L8BB 3ZKXB 1X3DA 5D1ZC 1JGLH 4LGRB 3IJSA 3MOQA 4OZHE 3RVUD 2MFNA 4K71C 2JB6A 3KPRB 1F3RB 3F6IA 5L88L 3UAJD 5BV7L 3LV3B 3KR3H 1JWMB 1KGCD 4WHCA 3FB8B 5E8EB 3CK0L 4U1NA 3TN0A 2LTQC 3QJHA 1E4KC 3D87B 3FRPG 2XWTA 3T0XA 3ORJA 5LJYH 4UOW1 4WO4B 3VRJA 5KBNC 2PW1B 2P24B 2WM0A 5EN2A 1AD9A 2CUIA 2CIKA 5EUOE 4NCC2 3MNVA 1DQML 3PWLB 1BM3H 2WMPA 1MREH 3RWFA 3CSYB 1O7VA 2KQNA 3NAAL 4ENED 4XGZA 4OT1H 2O5YH 2KZWA 1IQWL 5I17B 4R8WL 3ARTA 5F7KC 4MDJB 1Z0NA 5IVXF 4QRRB 1A7OL 4NWTL 2ENSA 2JJVA 5DHYB 1XF4B 4RCAA 1QLFA 3QO1B 5IP4A 12E8H 3C2AH 1F4YH 3FQWA 1YY8A 5BZWB 3BIKB 3VCLB 3EO0A 2P8MB 5F1KC 3GJFH 3PE9A 3UPRA 2X7LB 5D93B 2QR0A 3DSFL 4UDTA 4ZTOH 3WO4B 3L6FB 5FK9B 5HHNA 2A74A 5FKPB 5L6YL 5F3BA 3WIFB 3UROR 4LNRB 4NQEB 3OJVC 4D8PB 1R3LA 3O41A 2DIJA 1I3RB 3F7YB 4OIAA 4HX1B 5JW3L 2D9CA 4FZ8H 4NRXB 1K3ZA 3IXAB 4S2SB 3SKUD 1IGFH 1JV5A 2EC8A 1NGXB 2VLKB 4CL7A 3HAEB 4NUJA 5LGJB 3QHZL 4OUOA 2WLZA 2C26A 1V7NL 3MXWH 1E0OB 3G6JA 5IJVA 5L2KD 2BX5A 1L7TH 2XN9A 2ERJB 2XWJA 1BFVH 1UWGH 2YPLA 1CDBA 5EIQA 1A4JB 2PUQT 1XGUA 4PGBA 1G7HA 5IHLB 1E6JH 5AG9A 4NHUB 3KLDA 2V2TA 3VFVB 3GDBA 4MLSA 4PJFA 1KJVA 3D9AL 3VFMA 3VXSE 3WXVL 4NKIL 3PQYE 1QUNA 3VXOB 4PJXA 3WS3B 2PO6B 5BO1L 2CK0H 4W4OC 2KL6A 1TNNA 4NOFA 2Z91B 1HEZA 3ZYZA 4JGUA 3N85H 4DN4H 3MRRA 5SX5H 2H26A 3SEPA 3EYFB 4S1RH 1RURH 3W11D 1FNGB 1EHLH 1IC4H 4O5LH 4PG9A 1XGQB 1EAJA 2ZCHH 5F7NC 3HNVH 5C0BD 1NDMB 5C0IB 1QLEL 1P7QD 4OD2B 1F2XK 4KXZI 1XH3A 1JF1B 2NZIA 2VXSL 1UB6B 4DJMA 4HJ0D 2CLVA 1UB5A 3DXAA 3GJFK 1J8HD 1MPAH 1S9WB 1KTLA 4NO2B 3AGVA 1ZTXH 1K8IA 1JN6B 5DJYB 5GGVY 3V4VH 4LASH 1B0RA 1U8KA 3MJ9H 1MFBH 3JWOL 4JPKH 4PRIA 4R3SB 5T3XL 4RQQB 4Q9QL 4J8RA 4PUBL 4WTZG 1HQRA 4TSAL 4LHUA 5FUCE 1NC2D 1K4CB 4YPGA 2VQTA 3IXTB 5KSAC 5DF0A 3ZT6A 3BKCL 3LN9A 3IFNL 1CL7I 3QEGH 2X4RB 3EO1A 4BJLA 1IC5L 4XAKD 4JG0H 1ZLVH 3QXUA 2FO4B 1YNLL 2B1HH 2M1KA 3BVNA 3HG1B 1OM3H 2XZQH 5AG8A 5MP6H 3UTSB 5HPOA 4YDIH 3K4AA 4M93B 3VWJC 1Z5LB 4HS8H 4TNWK 4XPHL 2NZ9C 1LK3H 4KXZH 4IOFC 5DGRA 4KGLA 1REIA 4NDMB 2A6KA 4QT5A 1HNFA 1KTDA 3SDXF 2R1WA 4WWKC 1PG7W 2ESVB 4N8CL 4HGKC 1N6VA 5DEFB 4RSVA 5JQHC 3L5WB 1C08A 1BFOB 4ONOA 1E4WL 3FFCE 3EDKA 5HI3D 5EPMB 4HAFA 2FD6L 2I5YL 2PW2B 5SX5K 2HWZL 1NFKA 2XTJD 1OWRM 3LKSB 2OR8A 3CMGA 4CDGC 2CDFA 3O4LE 3PGDA 4DK6A 1MCPL 1DVFA 4MX7A 1CU4H 1M6OB 1MI5D 2CK2A 3PV6B 4WI3A 5I66B 2BHYA 4L8SA 1TZHA 2IPKA 3NCMA 3ESVF 3L7FA 1U41A 3MRMB 3DUHA 2ZNWA 3O6FD 4FTVD 6FABL 3TNMA 3I6LE 1QLRB 5IVXB 4GKSA 1TDQA 1MRFH 4JKPL 2NXZC 3B8YA 3PGFL 3UTSE 2EIZA 3BQUC 4NQCD 5IWLC 2V7HA 1KXTB 4PB0L 3GB7B 3QWRD 1P7HL 5GZND 4JANB 1LDPL 3MRKB 1RZJH 3MGTB 3KJ6L 1W0VA 2XRAL 1L7IH 4ZNEE 4L9LA 4EN3B 4LU5L 4ZS6D 3LRSA 3GZKA 1MCKA 2JLLA 2VXTH 5E1AA 2VH5L 5GIRB 1MIEL 3DO7A 4OTXL 5EBWA 5C0FA 2I27N 1G9MH 4J3WA 4LAQL 1DBKH 3NCEB 3HI6H 4JG1L 1MHCB 1EO7A 1ZLVK 3LEXA 3FAWA 1RAMA 3DVFA 4NNYA 3C08L 35C8H 3MYJB 3WDIA 1RZKH 2YD7A 1OAUL 4YIQA 1HHJB 2GIYA 3CVIH 5MEQB 2V2XB 1RJYB 3DI3B 3P4NB 5F1NA 3MX0A 1T1WB 1FL6A 3MRIA 4MQXC 3LS5H 1YNKL 1S9XB 5I8KL 1UXSA 5H8DA 2A1WH 4MXWH 4HUWB 5C07A 4I4WB 4FQXB 1WWAX 1S5IH 2I60L 3B9KA 4G6KH 3EBAA 3RUGA 3VGDA 1JF5A 3DTXA 3I6KB 1U8NB 2Y23A 5B4MC 2ZCLH 2PXYB 5C70A 1T20B 5IFAH 4HJJL 1CZ8L 2D7TL 3UTZB 5DURD 3LY6A 4ESKA 5M94B 1UM6H 2EIBA 5HPMA 4OKDA 1QD0A 1GJIA 1MAJA 1XCQB 1KIPB 3LD8C 1JWUA 1CD1A 3MLUH 1G7MA 3MV7A 3REWA 5I1CH 2X4TB 5GS1A 5LGHH 1CLYH 5TPWH 4JPWH 3MCKA 3AAZB 3TT3H 4P3CH 4HV8B 5E7FA 4UTAH 4HUVB 25C8H 4IIQC 3UBXG 3QFDB 3N1GC 3MRFA 5KSUA 5B21A 1AQDA 3BISA 3WLWC 3K1KC 4WW2A 1CICA 3EDFA 4WDIB 3MGOB 4HH9B 1RIVH 5I71B 1TJIH 2MPAH 2OP4H 4ELMF 4WHYG 2H9GA 4PJ5B 2A9MH 5E6IC 4KU1A 4J6RL 5KVGH 1GGTA 5I0ZA 1MAKA 2DIAA 3HZKA 2J6EL 5DD3L 1ZHKA 3I3DA 2FIRT 4OUUB 5E95B 3WDHA 5IIEB 2ADJB 4LDOB 1MWAB 1GZPB 1I75A 4F9PA 1FO0B 2J8UA 1E27A 4KJWD 3VFRA 4JM2B 1GGCL 2IAMD 1FYTB 2AJVH 3EDJA 3WJJC 5IESH 5J13B 3OWEA 4LVOB 4YGAB 1A1NB 4ZYKA 3QPXH 5DZOA 2NY4C 2EDEA 5KSBA 2UY7A 4JDZA 3SJVE 4E0RA 4GRWH 1BREA 1K6QL 3BZ4B 4JLRA 3G9AB 3DETC 2FIKB 5LWYL 4XWGL 1HXMA 4NO3A 3GSRA 4IEFB 1J8KA 3BWAA 3TN0D 3T8XB 3L5IA 4X99A 4AEHL 2AEQL 3UXFA 3S6CA 3BT2L 1T03H 3A6BL 1S78C 3G5ZB 4TVPE 4P9ML 2N7BA 1ETZA 4C59B 5A16A 4FQ1L 4JPVL 3VGHA 1YEHL 3U0PA 4M61B 3Q6GH 2C7UA 1ZLWK 2DTMH 3SDXB 9CGTA 3NZ8B 3GMMB 3QEHB 1FNFA 4ZXBB 1JL8A 3RVXC 3QH3A 3VD3A 1ZGLM 1SJHA 3PV7A 3EDEA 1FBIH 4XP6H 4LRIA 2BC4B 4ZO7A 1FGVH 1FYTE 5IMKB 5LXGH 1RZ8A 4MD0B 1K5NB 3MRGA 3GGWA 1F02I 4Y1AA 4E9LA 3WHXA 1TJGH 4OM1L 5J6HA 1EHNA 3V7AG 4JHBA 3GMOA 3N1QC 3ZE1F 4TULL 4FMKA 4PGDA 4JM4H 2CDEB 1H3TA 5SWZB 4R90H 4OD3L 1W72L 1AO7B 4D9QD 1GHFL 3K81A 4NGHH 5J3HC 1S8DA 1VEOA 2QL1A 3O0RH 4YC2B 3N1FC 3U2SB 4P4KA 4G9DA 4Z78A 5FUOL 4RWYL 2FX9H 4GKNA 4GAYA 4F7MA 5INCB 5B22A 1T7ZA 3ZKXC 1NAMH 4WFHD 4YUEH 3H7BA 2XT1B 4GRLC 5F9AC 4JRYE 4YNYA 3UC0H 2Y06H 1R24A 5E2UL 1OAYL 1BHGA 4MAUH 1T6WA 3OKDB 1TZIA 2EZ0C 1Q0YH 2WWKT 2YPLD 4HXAH 4JFEE 5ITFA 4U49A 4AZ8A 1PX4A 1F4XH 2WV3A 2C1PB 1MHEA 4HQQL 5MHSD 2ICEB 2Z92B 4L29A 4FFVC 4WO4C 4U7KA 3IS1X 2Y7QA 1SY6H 3IDYB 5DRXA 3AUVA 1UWXK 4PJCF 5DQ9A 3V5KA 1PLGL 4PREA 3RTQA 4UT9H 3BGFC 1ONQB 4JZNA 4M48H 5C0RL 1HYSC 5FKAB 3VWKA 4MDIA 3QCUL 3OJMB 2FR4A 2A6IB 3B83A 4YXLH 4BZ1L 3NZHL 5EIIA 3OKOB 1FAKT 3B5GA 4PJIA 4PJ9A 1N3NA 3LOWA 1YPZA 2APVA 2R69L 4PJAA 1JPGB 2Y9RT 2VO5A 2EIDA 3V5DB 1V8HA 4QXWA 1WAAA 2FHBA 1EIBA 3RX8A 4WGWB 4EI6B 3L3IA 3OKMB 2ATKB 4FNLL 2NY5L 2YUWA 4PRHA 4DKFL 4PS4H 2GTWA 3ABZA 2VISA 2J6EA 3D25B 4XCFH 3P9MA 4ZO6A 5D93C 3U82B 3MROA 5JW4M 1Q0XH 3T0EA 3GHBL 4U0QB 3EHBD 1ZA3A 3TYGL 3T2OA 1G6VK 3QNYB 1TCRA 5IMLA 2DF3A 3CCHB 5I1DA 5IBTH 5HHME 3ROOB 4U1LB 1IKFH 5B8CA 3CDCA 2CRIA 4MS8C 3CFKB 3DHMA 4NJAL 5F7FA 3FO0H 5KAQF 3ZKMC 4ELMB 4LHUD 2E7CA 3QUMH 4AM0A 5DVLA 3WO3B 5ICXA 3KDMA 2HJLA 5JIPA 5DJCA 4FQLL 2YD5A 3U0TA 3RWDB 1T7VA 4RRPA 3BPNC 2QQQA 2ICWJ 2LABA 3T0AA 1QYGH 3NMEA 5CJXA 4E41E 2GCYA 5D7IA 2CGRL 4OF7A 2DQFA 1NCAL 5C0JB 4BZ2L 4MQSB 4OM0L 1NGWA 3EJZC 4JN2A 4JO1L 4XTRD 4DK3A 3U0WH 2GTZA 5LQBH 1MJJA 2PO6C 3P2TA 3GM0A 3S5LB 4JO3H 5JOPE 5DA4A 1VB9A 2W1NA 4R0LA 4WHTA 3BW9A 4FFYH 4Y4FB 4D94A 4D3CH 4KUZL 2WUBH 1HH6A 3VG9C 3CFIC 3LKRB 3CFCL 5GRUL 3PHSA 3V4UH 1UZ8B 4EDXA 1AD0A 5JIHA 1DVFD 4PGJA 1VEPA 3WFCL 2E5EA 4PY7B 1ACYL 4G7VL 4QRTB 2DS4A 2Z8VC 1CDGA 5C3LD 1NFDF 1W72A 2YMXL 2F5BL 4IRJC 2AERT 2PN5A 1LE5A 4YXHL 4N8VB 4YO0A 5JHDE 3TFKD 4P5MB 3C6SB 2CIIB 5FHAH 3G08A 1P4IL 3DUUA 2XYCA 5KVDH 4OFYA 2HJKB 3KS0J 4X6FB 1OP3H 4QNPE 4UQ2B 2A6DB 2DOCA 5BVPL 4HFWB 1EEZB 2Q86A 2GKIA 2NLJA 5AAMA 3GMRB 4POYA 1H0DA 1NUNB 3OSKA 4IS6B 2HFGH 5IG7B 2ORBH 5IW6A 1DJSA 3TT1L 4Y5XC 4X7SL 4NFCA 1JGVL 4M6AA 2X1PA 3KYMB 1HINH 1UWEL 3E3QE 2GSIA 2VXUL 4XNUH 5CSZA 4AEEA 2BXYA 3RU8L 5IOPA 1M05A 2W0FB 3NCCB 4G6FB 1NDGB 3PABB 5C0CA 2P5WB 4P59L 4WNQA 1HKFA 2BNQB 3TBVA 4H1LB 3AS0A 3ZE0F 4HULB 4OZGA 4Y5YC 4Z7VA 3E2HC 2AJUH 4GW4A 4L4TD 1NUFA 4YDVB 1DANU 3PWJB 4ODUB 1A7RL 5IEHA 5EDXA 4WY7L 1E4XL 4WI6A 4KI1A 1RY7B 2VZOA 5BQ7B 3F7PC 4CADA 1LP9F 4IMLA 4PJDE 2ITDA 5FYKE 5C07D 2FJHB 2YSSB 2YWZA 2ZOKB 3QDMB 2EEAA 4GOSA 3ZDYF 1XIWB 3E8UL 3LQMA 4XNXL 2C1OB 3ZLQC 2EDYA 2EDFA 2Z31A 4HKBB 3MLRH 2H32A 1AY1L 1EMTH 1QZ1A 3OBAA 3R1GH 2BSRB 5DD5L 5FOBA 1VGKA 1NCCH 4KI5C 3ZTJG 1AGEA 4U6YA 4ODBD 1KB5H 4PJCB 1EHAA 3ZE1E 4P5KB 4L3CB 1GC1C 3B9EA 3MV7D 4GG6F 1A21A 5IQ7H 4YHYB 4X4YA 1XGTB 5F9JB 2YUVA 4JQIL 4F7EB 1V3LA 4GJTB 3LDBB 2P5WE 1F97A 5T3XD 1A6VH 2BNQE 3W39A 1FLTX 4KKBD 4MNGB 1Z3GL 1V3MA 5D2LA 4KK8C 1CICD 4JHAH 3GSUB 3OQ3B 4WTXA 1A3LH 3IKKA 3MJ7A 4AT6A 3CXDH 1EPFA 5GRVL 5T33L 1TCMA 1QRNE 3TO4A 5JXEA 1CDUA 1FE8L 4M7ZC 3AS1A 4L8DA 4GBXD 2O26U 1OCWH 3CXHJ 1G7PB 4K8RH 3TEUA 5EG6C 1BGXH 3SE9H 4GG8B 5I16B 3C5ZC 3Q1SL 3C6LA 3SGJA 4L4VD 5AD0B 3QDME 3QCVH 2G9HB 2WBWB 2NYYC 3UYRL 2AJ3A 3X12A 5HGAB 2V2WA 5KG9B 3MLPA 1JYVA 1EV2E 3TVMA 1H3WM 5CUSH 3BEWA 3I85A 5E00A 4JCLA 3VD4A 3X14B 4PJCE 4PGEA 5E2WL 1D9KC 5IROA 3RNQB 2YPVL 3RKDC 1N59A 1B0GB 3RVVD 3HZYB 5C2BL 4PLKC 1CK0L 2F5AL 3TJEL 5A40E 2Q8AH 4UIMB 3NVQA 4KKAC 1EHXA 5FYJH 3R0MA 2ZG1A 3QDGE 2C3XA 4POUB 2CLRA 4QXGL 3OGCA 4M5ZL 1U8HB 1OD7A 1UYWH 2OX5A 4MD5B 4EI5A 4HG4J 4V1DA 1RVFL 4XVUD 5F70A 5I8CB 5DJDA 1DL7L 1MY7A 4YBQC 4YDKL 3B2VH 3PP4H 2VZ1A 1HK6A 1OL0A 3FRPA 4MNHA 1I8KA 2FX7L 2JCCA 5EZIH 4LIQE 4U6HB 4YHOL 4Q6IC 4FFZH 1T83C 1IKNA 4UAOB 1T5WB 5CD3A 4HF5H 1M71B 1FRGL 4QRQA 2OJZH 3LZFH 5IW1B 3TH3T 4ZFOB 5D1ZA 1KEML 1U8LB 2JELL 5I71C 1RI8A 4H8WC 4A6YL 3MFFB 3S4SG 3RHWK 1NFDB 4YWGL 3GBNL 3KWWB 2WBJD 4GXVL 5EOTA 4HZLA 5C0GB 2VIRA 3KJ4B 5DJ2A 4HEME 5DK2B 1EUTA 1CFVH 2YBRB 1I8IB 4TUOB 3WNPA 3LKOA 1J11A 3P3YA 5IMOB 4OFPA 2P8PB 5C0AA 4JM2C 43C9B 4ODTH 4QRUA 3DWTA 3FOLB 1P9MA 5D7LA 5J13C 2NPLX 1JNLH 4ZAKC 2UWEE 3EYQC 2R2EA 1G7JB 4ODXA 4LQFH 2W65B 1CR9L 5I19L 4XH2A 2IEPA 4JO4H 4MA8L 3WKNA 4N0UB 2WIIA 2AK4D 4JFYA 1KGCE 4IJ3B 1XR8A 3EDDA 3E0GA 4C54A 3EAKA 5DUPH 4KVCL 4BSJA 2QKIA 2DD8H 1M1SA 4RFEB 4MVBD 1R3JB 1U91A 4D0CA 3X11A 3QIBD 1I8LC 1FNEA 4ZUUA 1AP2A 3SDDC 3IDGB 1IAKB 2BJML 4MNQD 5B38B 4BSWA 1MHPH 3RTQD 3K8KA 1I7ZB 4YHZH 4PJEB 4QHKJ 1G7QA 3LN4A 4GT7A 3NABL 4LCWB 4I0PA 2FB4L 4LCCA 4ZXBC 4Y4HB 1KTKE 3DROB 1U9KA 2VLME 5HHPA 4PJ9D 5FB8B 1QRKA 4O51B 1PAMA 1LP9B 3O9WA 3FCTB 1MLBA 2DI7A 3WFDH 4KY1H 2FJGB 3WIHH 1YEGL 2OXHA 1AHWC 1QVOB 2V7NB 4JDTH 5HHXH 1CFBA 1KCKA 5I15H 4N0UE 1MCIA 2EH8H 1BWMA 4FQJH 1J5OL 5LBSL 2CDGA 4NKDB 3QFJD 3MCLL 3T0ED 4GG6B 4DEPB 1AH1A 3BSZH 4LHQB 3LKPA 5TJWK 2CO7B 2E9WA 3A6CH 5EZOH 2W92A 3P0GB 5E6YA 2HFFB 3S34L 1KPRA 4CMMB 1A6UH 4XCCL 1HXYA 3K1DA 2F54A 3PJSB 4PJ8A 5C0BB 4FQPA 1P7QB 3ZE0E 1GOHA 1WC7B 1MCOL 5H37G 1A7PH 3DX8B 5HYJE 3PNWA 4RMQA 5F7DA 3ILPB 4U4BA 1ZSDB 3LCYA 1KEGH 1ZLSL 3RVWD 4P99A 5L2KE 2F19H 1IM9B 1J8HB 3HCVA 1SYSA 3SBWC 3TZVB 3DX9A 4HD9A 4MXQC 4KDVA 4KK6D 1L0XA 1PZ5A 3G6AB 2R0KL 1CT8A 2QQNH 5AZEL 1FL3B 3KHQA 4Y88A 3U7WH 1CFTA 4WTZA 3RWIB 1QBML 3D0LB 5AYQA 4L5FL 2QSCL 5T3ZL 2BVEA 2NY0D 5I30L 2R2BA 3DUSB 1JFQL 5J56B 3EFFA 5DVNA 1T1YB 4X83A 4APQD 3P77B 4LCYA 1UCBH 5EU5B 5CJOH 1DEEA 3UTTA 5LCVL 4JB9L 4LPTA 1ZANH 5HYSB 5JR1L 1WBXA 1NMCB 5FYKU 1INEL 4AYFA 2H8PB 2E9BA 3MZGB 1A7QH 5ANMB 1JHKL 5EU4A 1QBBA 3IFLH 4X6EB 4PRDA 5L0QB 5EBLB 5C0BE 3R0NA 5ACMA 4A6YA 1D5ZA 4QHLB 1MLCA 3Q48A 1RIUL 2XA8H 1UH3A 2YA2A 3RGVD 2CLZB 1DQQA 1IL1A 1J8HE 1WK0A 4GW1B 3S37X 5KTEL 5KSAA 5CIPA 4K3EH 2J88H 3MRDA 4TOYL 5ESVA 3WDJA 3CFDA 3M17B 3GK8L 1JPSL 3P73B 2XTJB 3HFML 4OFYD 1NMBL 3IDJB 3RX5A 3MRCA 4HIXL 3MJGX 5FDYA 2DKSA 4IBLT 1JYXA 5HVGB 1TVHB 1MI5B 3K7UA 3MOBH 1KLGA 1I3UA 3EYVA 3V0WH 2FEDC 2DQCL 4U3CA 3EYOB 3HPJB 1JBJA 1NFIA 3VFOA 4XC1H 4G8IB 3NA4A 3QG6A 4X6BB 4B7LA 3O6FB 1QSFA 3QEQA 4FTVB 2OXGA 1GGIH 3SQBA 4XAKE 5FUZL 5JHLH 2E8ZA 4ZQKA 4XNQA 1LO2L 4OQTH 3GO1H 5DHVB 4EOWL 2DKUA 2QSTA 5C0CD 1YDPB 4R2GD 5D5ME 5E0QA 4WUKL 2B4CL 2PTTB 1KJ2H 2ID5A 5D96B 5BRZA 3FO2B 1F8TH 3OF6A 4MWFB 4ZSOB 1MJ8L 2AGJH 1CDYA 5I1GH 4O4YH 4PRBA 1WWCA 3QJFA 1HH9A 3GM8A 1NCUA 4GRWF 1Q94B 4PYGA 4GQ9H 4Y4FC 3L5JA 2I07A 3LVEA 5JZ7D 2OJEA 1UM4L 2J4WH 2XTJE 4XZUB 1VCAA 1U93B 5ENWB 4XC3L 1VSCA 4MJ6A 1X7QB 4LSTH 2DDQL 2Z31D 1TVBB 1X5FA 3BQUA 1HI6B 3HNTH 1MI5E 5IWLA 3T09A 3E6HA 4O02H 5IVZA 5IV2A 3EJYC 2R0LL 2GK2A 3IU4H 2H2PC 4ODHL 5EZLA 3LMJH 4JKLA 5KANG 2RQ8A 4TUKL 3C5SB 4FTVE 5CZVH 4POZC 1F4WH 3NIDF 3S35L 4FA8A 4LPXA 5GJSH 2Z93A 3IKCB 4CMHC 3BPOB 5T1MA 4BH8A 2D31A 4NQCE 4H0GA 1FC1A 1RUML 1T4KB 1NGPH 3V8OA 4YJZL 4TTGA 1LHZA 2YA0A 2R0WL 5J12B 4K94H 3S35X 5K9OB 5KS9F 4Q97A 2OK0L 4ZSOE 3TO4D 3VW3L 1FFQA 4M6OL 2APXA 5I1LA 4OKVA 3VH8B 2XV6B 5H2BA 4WUUA 4LBEB 4X4ME 3RFZC 2YEZA 5EO1A 3C6LD 2ILLA 1WSST 1NEZA 3MRHA 5I1HL 3GMQB 4RMUA 5K33A 4KJPD 2ZKHL 5TH2B 1GSMA 3H42H 1BBJA 4N8VG 4OFKA 2DBJA 3TVMD 4XPAH 3Q3GA 3BP4A 2Y07H 3L1OH 3MUHL 1F6AA 1INDL 2IMNA 4PTTB 4DUWA 1WTGT 1AIFA 1RZGB 1YQVL 3ROLB 4G9FB 2ARWA 3NN8A 4ZUWA 2XFXA 3DV4B 2BXZA 3HZVB 2JB5H 2Q7NA 2OSLB 1W8OA 1D3CA 5BZDB 4QY8A 5ICZB 4K7PL 4XPFH 1RFDL 4PJHA 4IIQA 3IDNA 3RIFF 5ADPH 1G0YR 2C3GA 1I1CA 4EI5D 3QI9B 3FT4A 2IANB 3I9GH 4DVBA 4CVXA 1FZKA 2ADFL 5JORA 4O2EB 3KPSB 4B53A 1KN4L 5E6IA 1JIBA 1RU9L 5JTWA 4K7PX 1A9EB 2EKSB 3NPZB 5D70L 1ORQB 4PGCA 4EUPA 1FVEA 4M1GL 3S7GA 3UJJH 3TESA 1WEJL 1J0ZA 5DUBB 1BEYH 3LDBC 3QXAB 4AJ0A 2JIXA 3WJJA 2CXGA 5D1ZD 5C7XL 4K07A 2D7PA 4X7CC 5LKNA 4Q0XL 3QYCA 5IB5B 3EYUH 3BJ91 3INUH 1G9NC 3VDBA 4NPYB 4KDTC 4LLVA 3ZDZE 3MUGB 5TE7L 1PKQE 2WLYA 3QNZB 2P1YA 1LK2A 4NQSB 3BZFA 2C4FU 4IDJH 3S36L 4RFNB 4MJ5B 2D7MA 4KMQA 1QEWB 1KLFA 5IR1B 3OKLB 4KZEL 4QHUA 4UDUB 3WEXB 2X41A 5D7LD 5C0DA 5E9DA 4Y4KC 5HGHA 3ZSTA 2IBGA 5D71L 2EYTB 3GRWL 3VG0H 2X4PB 5T1DH 3VFWA 3VJ6B 3OR6A 1A4KA 2VZVA 3S36X 1A6AA 6CGTA 4DUXA 1F13A 3W9EB 1QNZH 3FQUB 4OFIA 1DSFH 3V4PH 2FYYB 3BH8B 2MHAA 3X13A 4HBCH 3CNKA 3RL1A 3VFNB 3LB6C 2SEBB 5TQ0L 4XWOC 4ZOCA 2XZZA 2Z8RA 5ESQB 1YNTB 2IADA 4LLYA 1SM3H 4JFZL 3NA9L 3UJIH 4WEMB 4LAJH 2DWEA 3VFSA 5GGSA 4C56A 3CPLB 5I1KL 4XP4H 1BBDL 3G5XB 4K2UH 4R96B 3H9SD 3BP7A 2FL5B 3ARXA 2H6PB 2AEWA 3OB0H 4N0RA 7FABL 4Y19A 1C5DB 2NY2C 4JFPA 4GRWB 4QWWC 1WZ1H 4J1UB 3IDMA 3IRPX 3N9GH 4QF1B 5KAQG 4X9HA 4ONFL 4UAOC 3SGKC 1OD9A 3RUGF 5ETUA 4Y2DA 2E3VA 3LN5A 4FQIH 1HOCA 1WTLA 1F3JA 1JHLL 5D72L 5E70A 4L8BA 4X5WB 3PWVB 1N7MH 1EO8L 4R7DB 3HC4L 4N0FB 2O5ZL 3KPRA 2YN5A 1H8NA 3CLFH 4LLMB 4D9QE 1UXWB 1WZLA 3LV3A 2Z4QB 2NY7H 1HQ4B 1JWMA 3KJ4C 2WQ8A 1GGBL 5DJZB 2VOTA 3MRNB 1AE6L 3OX8B 1ZT1B 3Q5YA 3FB8A 5E8EA 4DGVH 4Y7MA 2F54D 2D4FA 1FSKB 1T7YA 4WW2F 5BXFB 4WFHE 4WO4A 4G8FB 4JGJA 4LLUB 2PW1A 2J5LC 2DQHL 2P24A 4KQ3L 5BS0B 1Z9SA 3QXVA 3CZFB 5KS9B 3PWLA 1DBAH 1TETH 4RGOL 5B39B 2BMKB 1OWWA 4HUKB 3QR2A 4P46B 4NNPL 3D39B 4IJ3C 1MRCL 3CSYA 2YPLE 3FKUS 1JUFB 3B4NA 3Q5OA 1PFCA 3ETBF 5I17A 4U7MA 5MHSE 4MDJA 4LSQL 1AXTH 4PG2C 4QRRA 3O2DL 2BVPB 3M07A 5KSBF 5CEZL 3C8DA 5DHYA 1XF4A 5FO7B 3ZMRA 3MA7B 3QO1A 1SBBA 4I5BB 5ALBH 5BZWA 3BRGC 3BIKA 3F58L 3VCLA 2H1PL 2PETA 2P8MA 1ZHLB 1NAMB 4LPUA 5DQDH 1HZHH 2UUDK 2X7LA 3UTTD 3OB0K 5F6HJ 1WCQA 3QIUC 3NIDE 3WNKA 1JJUA 3L6FA 5FK9A 3JWDH 1GC1L 4U6XB 2B1AH 4HLZH 3UJTL 5FKPA 3WIFA 1P2CB 5DWUL 3MFGB 4LNRA 4NQEA 2R56H 4D8PA 2CH8A 2R29H 1I3RA 3F7YA 1WFNA 1IQDB 4HX1A 3UDWA 4YHNB 1V7MH 4HFUL 4NRXA 3IXAA 4S2SA 4Y8AA 5KS9E 4Z8FL 2VLKA 1NGXA 4R6UA 3HAEA 2FX8L 5LGJA 2VDMH 4ZFFB 1HIML 5KSAD 4XP1H 5B38G 5D7KD 2XIDA 3KPTA 2XY2A 1SHMA 1LNUB 5FF6B 4RZCB 4MAYC 4BQ8A 4G43B 4RIRB 1A4JA 3BX7C 3GRWA 5ERWB 3SQOL 4GMSL 3TV3H 1SVZA 2X09A 3PXHA 4NHUA 4NOBA 2HKFH 1OLZA 4U1SB 3UZQA 3VFVA 3VWJD 4YX2H 5KVEH 2NZ9D 3MV9B 3GKWH 1MFDH 1NMAL 4IOFD 3P4MB 1KN2L 5E8DL 2AK1H 1A7NL 4QKXB 4Z7UF 3VXOA 1FNAA 3QISA 2Y25A 3WS3A 2PO6A 4WWKD 3WKML 1QSFD 4U1HB 3ZTNH 2GAZB 2UYLB 1R5IB 3TZVC 3QB7C 2WUCL 5J1SC 2Z91A 2YN3A 2NQCA 4DUVA 5L88H 5CBEB 1G9EA 3ZKNC 3EYFA 1DFBH 2EO1A 3WNOA 1FNGA 4CGTA 3CK0H 1EERB 4GSDH 1XGQA 3OF6D 5BW7C 1NDMA 5C0IA 5J1TC 4OD2A 5KJRL 3HA0A 3VE0B 1JF1A 1RJZB 1UB6A 4NJ9L 1LEKB 3BMWA 3FQTB 4PTUB 3VGEA 3RAJL 4CN1A 1S9WA 5EU6B 3QUMB 1T0PB 4DZ8B 5DGQA 4NO2A 1JN6A 5DJYA 3RIAK 1DCLA 3QRFM 2NXZD 1RZFH 3BQUD 5IGXL 1NCBL 1JZ5A 1YECL 5L0QC 3VXTB 4ZUTB 1Y0LB 4LDEB 4P9HL 1NQBA 4TVPL 1BIHA 4R3SA 4JFFD 1FV1B 3LPGA 4L4TB 4RQQA 4ZS7H 3WD5L 2B0SL 5L8LB 1R3HB 3O4OB 1S9VB 3RKPA 1K4CA 3IXTA 4PJIF 4RAUB 3WYRA 1YPZF 4FQCL 4PJAF 2X4RA 1KCVH 2FO4A 5TDOB 1I1YB 4IOIB 1U92B 3P40A 3HG1A 3W5NA 3UTSA 2XQYK 3SDYL 1QBAA 1Z5LA 4M8QB 2BY3A 5IJKC 5TF0A 4IRSC 1LO5B 4PRNB 1T1XB 4NDMA 5AWNL 1MCJA 4Q6YA 2ESVA 3DMMC 5DEFA 2FEEL 1Q9WB 3L5WA 2BOCB 1BFOA 4MQXD 1EZVY 3O2DA 4AIOA 2JK5B 1N26A 5EPMA 4XVSH 2PW2A 1CGYA 2FBOJ 1PW3A 1CDJA 2OTWB 2J7LA 1JGUL 5T3ZD 3LKSA 3HI5H 5LG1A 3VXNB 4F57H 5B4MD 1XF2B 2QEJA 1IILE 1M6OA 4KRPC 2D03L 5E4IA 4L4TE 3MACL 3I50H 3PV6A 5EFIB 3D69B 4MCYB 5I66A 1B2WH 4GBXB 4OLXH 3TGXA 3MRMA 3EO9L 4HWUA 5AYUL 3MLSH 4ZTPL 5GS0L 4MYWB 5C07E 4L4VB 2IG2H 4NQVB 4Z7NF 3RUGE 5LVEA 1QLRA 3TA3B 5IVXA 4UZGA 3RIFK 2EDQA 1T5XB 4H0HB 2YD8A 2X4SB 3GB7A 1H3GA 1YMMD 3F62A 3WLWD 2XKNA 4JANA 3FN0L 4IHOB 1YY9C 3MRKA 3OPZH 3U4BH 3MGTA 3LHPH 4ISVB 3IJYB 4OCYH 5F6IB 1T80A 3MV7E 3L9RB 5E6ID 5ILTL 5CEYB 4EN3A 3ARGB 1YEFH 5IFJB 4Q9BA 2GJZB 4OCSL 5GIRA 4OGYH 4RGMC 2VXSH 3HC3L 4PY8I 1FZJB 2XXCB 4FZEH 1OT1A 3EYSL 1MHCA 4YBLB 5T3XE 1UACH 2JIXD 4KWUA 4J4PA 3VA2C 2I9TB 1ZEAL 5J12C 2NY4D 2XWBB 4ZFZB 4QOKD 3QUYC 4P5TC 3MYJA 1A6ZB 1IVLA 4NQDB 3EJJX 1UQSB 3ARFB 4LVHB 1HHJA 3MNZB 5MEQA 3O3AB 2V2XA 1RJYA 4S1QH 1KB5B 2EYSB 3P4NA 3HUJF 1DLFL 5DTFB 3QG7L 5FO8B 1T1WA 4XPTL 4NKOB 1OARL 2NXYC 3GI9L 4MJIB 1S9XA 1WIOA 1S78D 5CP3H 2Q20A 3GGWB 4HUWA 4I4WA 4FQXA 5KSBE 1W0WB 1XGYL 3VXRB 1NCNA 3I6KA 5GS3A 1U8NA 3RBGA 4PGDB 1QFUL 1DBBL 2PXYA 1T20A 3STLB 3UTZA 4TSCL 4Z7UB 2Q6WB 2HVKB 2WBJB 4LDLB 3FONB 4XPHH 3TH2T 1CE1H 4U0RC 3RVXD 1XCQA 1KIPA 1RZJC 5GGQL 3T77B 2X4TA 5E03A 1T83A 3TLRA 4KTDL 1T6VN 2OR9H 1AI1L 3VH8G 1CGSH 3F65A 1Q38A 3AAZA 1T3FB 4HV8A 4GAGH 2KPNA 4HUVA 4C56D 4OLWH 2E7BA 4X9BA 3QFDA 2ZCKH 3QI9C 4Z7VF 3NGBC 5DVKA 2I5YH 2NTFB 4WDIA 3MGOA 4HH9A 5EORL 3P9WB 2AK4B 4UTBH 3REVB 4J3VA 4PJ5A 4S1SL 4AG4L 5GHWH 2AJZB 4Y19D 4HK3J 3BD3A 2F74B 4XNZC 2G5RA 1U3HC 3BHBB 1RZKC 3BDXA 1N0XL 3DARA 5J3HD 3GJEB 2X4QB 1MCWM 4OUUA 3RX7A 5IIEA 1I3VA 2ADJA 1GZPA 1FO0A 1IMHC 1X6NA 3QIBB 4G7YL 4JM2A 4MNQB 2HN7B 4WGVB 5DD1L 3MLXH 4G6ML 4GRLD 2HMID 1KSRA 1UA6H 1A1NA 2GUOB 2N4IA 2DLIA 1S7SB 5LGKA 3KPRD 2VXVL 1NAKH 2NW3B 4P23B 4PGZA 4Z7UE 3BZ4A 2A77H 1LEIB 1T22B 1QHPA 2HYMA 2EZ0D 2FIKA 5HGGS 4WU5B 5DMGC 5E08H 1MAML 4YHMH 5JXAL 4X9FA 1IZKA 5DVOA 1KYOJ 4RFNC 2AJXH 5DEZA 5DMIL 4OI8A 3KJ6H 3T8XA 1X4YA 1FN4B 4LU5H 5IFHL 5D2LF 5E5MB 4HWBL 4FFVD 4WO4D 3G5ZA 2HRLA 4JKKA 1I8LA 4OTXH 3WSQH 1SBSL 3GHEL 3BAEL 3BKML 4YHLL 2XOTA 4JG1H 3MBXL 4LEOB 1V3KA 1L4IA 5ACLA 3EOTL 2AK4E 4M61A 4D9LH 5CKGA 1HYSD 3QFJB 1DE4B 2J3SA 2P4AB 3SDXA 1PEZA 3NZ8A 3GMMA 3QEHA 5E99L 2RR3A 3OAYH 4CJ0A 4ZXBA 1BQSA 1A2YB 1OB1B 3MMEB 1OAUH 3H9HB 2X2YA 4QRRD 2HT4C 2BC4A 1YJDH 5IMKA 4HUMB 3VRIB 4M43L 3KLSA 2R0ZH 4MNQE 1SYVB 1TXKA 5FHBL 3TC9A 3BP6B 2Y5TB 4MD0A 1GPOH 2DQTL 2KZ1B 2P45B 1K5NA 1CFQB 4CDHA 4WRLA 4M1CC 3DRTB 4N90E 3ARQA 3PWPD 3RJDA 1WISA 5L7XH 1FJ1B 1HHIB 3WUZA 3W2DL 4LARL 2X44D 5J0BA 2CDEA 4RGNB 5SWZA 3KPQB 4WI4A 3GBLA 4PJIE 1AO7A 1YA5A 1YPZE 2D0FA 2EIEA 1FPTH 4PJAE 3RI5K 2Q87A 3SDCB 5IKCB 5CWSB 4NQED 1WAAE 4OD1L 3U2SA 2PR4L 3W9DB 1NLDL 4U6VL 5INCA 4YK4C 4YFDB 3IDXH 2X1OA 3U30B 2VLKD 1V05A 3ZKMD 3BDBA 1FAIL 3PWNB 4U1GB 5F97E 3GI8L 1T7XA 1A5FH 4QCIB 4EBQH 3T0EE 1A6PA 4K23H 3MJ6A 4APQB 4I3RH 5DMJB 3QXWA 3OKDA 1B9ZA 4LFHD 1HH6B 4NZJA 1BQLL 2YUZA 1X4XA 1OPGL 4XXCA 1HHGB 1RJCA 4M03A 2C1PA 5A2FA 3JWNC 1N4XH 4HT1L 2MNUA 2ICEA 4Z18A 4NWUH 2Z92A 3U79A 3CH1B 4MXVF 4XMPL 3TCXA 3FT2B 3M8OL 3ULUH 3EJZD 1VFUA 3RGVB 4I8DA 1NGZB 3MRPB 3PWUA 15C8H 2PO6D 4FXGB 1ONQA 3QQ3B 4G42B 5DQJB 4P46C 3BZEB 4G3YL 1K4DB 5FKAA 2A6IA 4K3JL 3GIZL 3HUJB 1T2XA 4MA7L 5TFSH 3CX5J 3OKOA 2YD9A 2IQ9H 4OGZA 4Z7NE 4I2XB 1IGIH 1LO0L 4XWGH 1A7BA 3W81A 2OTUB 4IMKA 1JPGA 4PLOB 3V5DA 4F3FB 3LEYH 4HUXB 1S3KL 3WFEL 3LQAH 3MNWB 4EI6A 3OKMA 2ATKA 3UTQB 4DVRH 4UILL 2HKHL 1FGNH 2UVEA 4ZFGH 1BJMA 4H0IA 4NC1E 2R4RL 3AROA 3I02B 2I9LB 3D25A 3QQNA 4JPVH 5CJQH 1QKZH 1QHOA 3GSNH 4NQXB 2XQYG 4EQ2A 3QNYA 4BSVB 5B39G 2DI8A 3BP5B 1TLKA 4LRNL 2NY6B 3CCHA 4R2GB 3W0WD 2EDKA 2VLJD 4NZRH 4U1LA 3ROOA 3AMLA 5CGMA 2BFVL 3T1WA 2DQGL 2Z8WC 1CLOL 4P49A 3CFKA 4DW2H 1RHHB 4M7LL 3SKNB 4ELMA 5ISZB 1JRHL 4YLQT 3VXUB 4N5EC 1KT2B 3T2NH 1DN2A 1G9NL 4UI2A 2X4NB 1UC6A 4DAGL 2APFA 4OM1H 4LHUG 4WI9A 1LD9B 2R8SL 4RAHA 4XMKH 1I7UB 3RWDA 1ZVYA 3MPCA 5BVJB 2NX5D 3ISWA 3TH4T 3HG1D 1PJ9A 4LCIH 1RMFL 3QUKB 3BDYH 3RPIB 3F8UB 2VTFA 3A6OA 3HRZB 3WS6C 1J0IA 2VLLB 5C0JA 3O6ML 1CWVA 1KENH 2W60B 4YXKL 5D6DC 4KTYA 5C86A 4RWYH 5FUOH 3NFSL 4FQQB 1TQBB 1S7VB 4DOHB 3QUZB 2ESVD 4XP5H 3S5LA 1GAFL 1QA9B 4AMKL 2BY1A 4QTIH 3K74B 5DJXB 4OCWL 1TNMA 4Y4FA 3VDAA 4X6DF 2I26N 3ULVH 5BOZG 5C0CE 5E2UH 1YEIL 1OAYH 2P5EB 5CEZD 1Z9MA 2Y4SA 3LKRA 1XF1A 3IFOB 3VFUB 2E27H 4HC1L 1F58H 1N5AB 1UZ8A 3MJ7B 4OZGE 1MF2H 4I77L 4NIKB 2VLRD 3BN9D 4Z7VE 4KI5D 5IB1B 4MA3B 5BMFH 4PY7A 4XPGL 3L5HA 3FO1B 3O6KL 4QRTA 2VKWA 2MQ0A 5FM8A 3NOIA 3OZ9L 5F89B 3P11L 3OKYA 4RBPH 4OF5A 7CGTA 4JY6B 2EKJA 4PBWD 4X80H 3IETB 4U31A 4N8VA 5C0NC 2YKLL 1PLGH 1JZ6A 4P5MA 5GGTH 4R97B 1XMWA 3C6SA 1O7SA 1NLBL 2CIIA 4H8WH 1FH5L 2XZCL 3SKJH 1OAKL 3WV0A 2HJKA 4KK8D 3VXMD 4PJGB 2X40A 4X6FA 4UQ2A 4Q9RL 3BGMB 2A6DA 1WFUA 4HFWA 1EEZA 2W38A 3S88L 1EXUB 3GMRA 4ZFOL 4DOHE 3UYPA 3OKEB 3F12B 2AJYH 1UZ6F 1UADC 4IS6A 5IG7A 3DNKA 4Z9KB 2YZ8A 2XZAL 2VDKH 3D85B 1RPQA 4O58H 1U8JB 3C5ZD 2H32H 1ZHNB 2DQUL 3KYMA 4LEXH 4UINL 5CINL 2MCPL 3SO5A 4KVNL 5D2LE 2F8VA 2NYYD 2VWEC 1YEEL 2W0FA 4J4PD 1NDGA 3PABA 2VKXA 3GHBH 3TYGH 3R4DA 3UPAA 2BNQA 2C3VB 3S98A 3MA9L 4LSVH 1A3RL 2G5BB 4H1LA 1J1PL 4HGWB 4UUJB 1D9KD 3HE7C 2NMSA 3U9UB 3RBSA 3RKDD 3S8WA 1RZ7H 2BRRL 1D7FA 4YDVA 2NCMA 4LSRL 4ODUA 5F8QC 2RFXB 4KKAD 3BKYH 5EBMB 4NN7B 4OAWB 4PYHA 5BQ7A 1VFOA 1DTUA 2DLTA 5K9JL 3JZ7A 4OBSA 5D1QC 5HI4C 4QEGA 1U6AH 2FJHA 2YSSA 3JSSA 2ZOKA 3NIFF 3QDMA 1I3GL 4NBYB 4ZOAA 3GMPB 4HMCA 1XIWA 2C1OA 3OV6A 3C60C 3QQ4B 4HKBA 5IM7B 2O5XL 4K71B 4DKEL 5CD5C 1EEYB 5FYLL 3VFPB 1VFMA 2PXYD 2BSRA 5A2JH 4PJCA 1TMCB 2VDRL 1QSED 1G7IB 4YBQD 4P5KA 2VB5A 1MEXL 4L3CA 4FQ2L 2ZSWB 2ADIB 4RBPK 1YEJH 1A0QL 2VL5B 3UP1A 1U2HA 2LTQB 3CFBB 3GSWB 1JGLL 5I1IH 1XGTA 5F9JA 1G1YA 3TA3C 4F7EA 4ZOEA 1HSAB 2GEEA 3KR3L 2VRAA 4V1DE 4JHWH 4MNGA 1MFEL 4KUZH 5HDOA 1A6TB 3GSUA 3WHE0 4PJ5D 1NGQH 1I7TB 5F6IC 5JW5B 5GRUH 3HRPA 4KDTA 1HHHB 4BM7A 1NANI 4NUGH 3ZYOA 3ARGC 5HVHB 1ACYH 1F3DH 1G7PA 5I1EL 3DX6B 5GGUB 4GG8A 5GGSY 5I16A 3E3QC 2CJUH 4BH7B 5GZOC 1BM3L 2D4DA 1F5WA 4JM2D 4XI5C 5AD0A 1X5JA 4A2MA 2G9HA 4YXHH 4MXVE 5HGAA 2AXHA 4OT1L 5KG9A 4Z0BL 2O5YL 3EYQD 5AUMB 5FA3B 5I2IA 4K3GA 1IT9H 4BFGA 3K0WA 3B6SB 4YBHA 5HI5C 5M95B 1NUDA 1UM5H 3X14A 2P48B 2DQIH 3H9SB 1J05B 3ARFC 3RNQA 2P43B 1XF3B 4LVHC 1B0GA 2OZ4H 3HZYA 3HS0B 3S3SA 2IQAB 4FHBD 4NRZB 4PV9B 4UIMA 1CDHA 12E8L 3C2AL 1Q8MA 5D7LE 1VADB 3TT1H 4HC1A 3CU1A 3H0TB 3ARPA 5A2LH 2EICA 1VKXB 1J86A 4JZJC 3SDDD 1P1ZB 1B4JL 1U8HA 5F96H 4PP2B 1PVHA 1IEHA 3EFDH 2A0LC 4MD5A 2Q8BH 3PP3H 5I8CA 1NANH 5GS0D 5FAAA 4ZXBD 1M7DB 4UB0H 4FZ8L 4J3TA 5HHOD 4U6HA 4X6DB 1T5WA 3P0YL 3NBNA 5TGBB 3VGFA 1NGYB 4JFXB 1M71A 4K8RC 3GBMH 3MXWL 5DFVC 2YS4A 1BQUA 5IW1A 4ZFOA 3WNMA 3BIBX 1U8LA 1UWGL 3H9SE 4XNYH 3MSPA 1KCRH 4XNXH 5GXBB 4TSBH 3MFFA 4X7FC 5SWZD 4IRZH 3QUXB 1NFDA 1E6JL 1AO7D 3KWWA 5DD5H 1TJHL 5C0GA 4HPOH 5DK2A 1I1AC 2X70B 2YBRA 1I8IA 4TUOA 5DUMH 2WANA 5IMOA 4JN1L 2P8PA 4NT6B 4OSUH 2BVTA 5JO5B 43C9A 2V5MA 2CK0L 4CU7A 3FOLA 2AQ2A 1FFOB 4WCYH 2R2BB 1TPXB 1G7JA 3BD4A 1D5MB 4DN4L 2W65A 4P23C 4TN9A 3ESUF 2BNUB 4N0UA 4XPBH 4DZBB 4S1RL 1S7UB 3D5OF 1SVCP 1RURL 2YA1A 4JFHD 4E5XB 2ZUWA 1IC4L 4O5LL 3QCTH 1GRWA 2ZCHL 4MXQD 5DRWB 4F58H 1MCLA 2E6PA 5T1LB 2F54E 5J57B 1U8PB 2CPCA 2X89A 5DD6B 4RFEA 4PG2A 1R3JA 3NH7L 4M7JH 4B50A 1D6VH 3IF1B 3WE6B 3HMXH 3KXFB 3OHXB 1MPAL 3IDGA 1IAKA 5B38A 5JMOC 1AGDB 4F80A 1I7ZA 1ZTXL 3KLAB 1DLHB 4PJEA 5JPNB 1ZHBB 3U9PH 5FFLA 3V4VL 3PP3K 4LCWA 2GT9B 4LASL 3MJ9L 5ALCL 1MFBL 1CS6A 1NCWH 4Y4HA 4ETYA 4JPKL 1D5BB 3DROA 2BSED 5FB8A 2YPVH 4O51A 1LP9A 3FCTA 1OSPH 1T66C 3VWJB 2YZ1A 1LO4H 4ALAH 1QFWH 2FJGA 4I48A 3CSPA 1QVOA 2OMNA 2V7NA 3QEGL 1EGJA 3OAZK 3D2UB 4JG0L 4WWKB 3UTTE 1UZ6E 3DV6B 2IH1B 4M5ZH 4RGNC 2XZQL 4NKDA 5MP6L 4YDIL 1O5DT 1OLLA 4GG6A 5FCUH 4HS8L 4JQXA 4G5ZH 5BCAA 3LRGA 4TTDC 4KFZC 4AIXA 5ICYB 1ZOXA 2HFFA 1QR1B 4CMMA 5IB2B 1GGUA 4YHOH 4X5XB 3U30C 5C0BA 4U1JB 1P7QA 2W9EH 1WC7A 2FEDD 3DX8A 4U1GC 1P4BH 2QV2A 3ILPA 1ZSDA 3CUPB 4P2QB 2P46B 3O45B 4OCRH 5D7KE 4XBGB 3D18B 3TBYB 1IM9A 1J8HA 2PF6A 2JELH 3PIQB 3TZVA 1CU4L 5GRVK 4A6YH 4GKZB 1S7RB 2V9RA 4X9GA 3QULB 4O9HH 3G6AA 4X4XB 4GXVH 1FL3A 4XCNB 2AKRB 1AGCB 3QIWB 4RRPG 3THMH 2CUMA 3RWIA 1K8DB 3D0LA 2HFEB 4JFFB 3MGAA 5I74B 5BW7A 3C8KB 1HKLH 4YAQB 1QSFE 4KUCD 3DUSA 1MRFL 5D6CB 1T1YA 4LGSB 1BECA 1C1EL 3P77A 4Y4FD 5I9QB 4FN0A 5EU5A 1IBGL 1VA9A 5KVFH 3T0DA 5HYSA 4P2RA 5IT2H 1RZJL 5DC9B 2H8PA 5J06A 3AFLA 5ANMA 3KPLB 2JTDA 5E2TH 3UYOD 3QDJD 4JR9H 1I9RH 4X6EA 5TQ2L 5DC4B 2VXTL 5HDLA 5J11C 5EBLA 1JHTB 3OGOE 4KVCH 3EJYD 2ICWB 3KYKL 3DURB 4QHLA 1G9ML 3HI6L 2H2PD 1I85A 3FQRB 2CLZA 3CJJA 2E7LC 2DLFH 2IGFH 1MELA 4H88H 4ZO9A 3OAUH 3DYPA 2DIBA 4GW1A 4POZD 5MI0C 4LSSH 1I8MB 3MZTA 5JDJA 3M17A 3R8QA 35C8L 2NY6C 3P73A 2FB4H 4M1DH 2PTVA 3IDJA 3CVIL 3MR9B 5C9JB 4CRPA 4OZFB 5CKAA 1TVHA 1MI5A 3O3BB 1BQHB 2A6JB 5D7JB 2IF7A 5IJKA 4CJ1A 3EYOA 1MIML 2A1WL 1AQKH 3HPJA 4MXWL 1YEGH 1ZWIB 4G8IA 4X6BA 3U7YH 4G6KL 3O6FA 4Q74A 4FTVA 1RK0B 4JFQB 5ITBH 1DQJB 3QT2A 1T21B 2XACC 3JVGA 1HE7A 5DHVA 4G6FD 5IFAL 2R9HC 5HYIA 1UM6L 4DQOH 1YDPA 5CLWA 3QPQC 5ECJE 1YMMB 3C8HA 1PSKH 3MLUL 2PTTA 3UO1H 5C6WH 2EEDA 2LAGB 5LGHL 4MJ4A 1CLYL 1TQBC 3FO2A 4GH7B 3DIFB 3WN5C 3MJ9A 4MWFA 4WUUE 4ZSOA 5TPWL 3QUZC 4BUGA 1IGCH 3TT3L 4P3CL 5GJTH 25C8L 2AVGA 4MD4B 1Q94A 1FVEB 1E4JA 3D1MC 1AKJB 1KIRB 1RIVL 1TJIL 2MPAL 2OP4L 1ZLSH 1KTRL 5EO0B 4XZUA 3AM8C 5T3ZE 1U93A 5ENWA 2BHZA 1X7QA 1TVBA 5KVGL 2NY4B 1HI6A 5SX4I 4KRLB 4QXUH 4QOKB 3IU3B 1IAII 3H9ZA 5FGSA 3T4AB 1JWSB 1KUMA 2DM2A 4FQHB 3QP3A 2AJVL 1CXIA 4KV5F 4J2XA 2XQBH 4JVWA 1KCUH 3K3QA 4WHYH 1ZK9A 5IESL 3C5SA 1LDSA 3T2PA 2GQHA 3QPXL 1X44A 1FLRL 1NL0H 1QBLL 2QJDA 3IKCA 3UEZA 4PJHE 4M5YH 3KPMB 3VFWB 1YMME 1T4KA 2RBLA 4YGVB 5T1KB 1PY4A 1FVDB 1RUQH 4Z7WB 3VGGA 1CD8A 2N1KA 5DMKB 1J87A 5K9OA 3S37H 1B88A 1J0JA 3QAZB 3DRQB 1D6EB 3ARVA 2VDQH 3VH8A 5CFHA 1MFAH 5E94B 1M7IB 1ORSB 2EC9T 2BCKB 4LBEA 4WV1B 4D0DB 4ORGB 2R1XB 3Q6GL 3GMQA 2Z9TA 1KXVC 5INDB 4Y4KD 3I6GB 5TH2A 2DTML 3GUTB 5SX4H 4DKDC 4I3SL 4QOKE 3GMNB 1IAIH 1ACZA 3IJHB 5FECB 3HFMH 1X9QA 3DHJA 2LU4A 1FBIL 1DUZB 4XP6L 4AL8L 4HIXH 1FGVL 5KVMC 1MVFA 1ROWA 4PTTA 5LXGL 1RZGA 3LB6D 3ROLA 4XWOD 4G9FA 1G0XA 1IGYB 5E9DE 3DV4A 2NNAB 1OAQH 3HZVA 1WGOA 4PJBB 1P84J 2OSLA 4Z77B 4JM4L 1FDLH 5BZDA 5ICZA 4NHCH 4ZOBA 2VZ3A 1GGYA 4X6CF 3TYFB 4GRLB 2B2XH 4U3HA 3D3VD 3SGDH 4JY4B 1LO2H 2EDDA 4NGHL 4EOWH 3QI9A 2MKLC 3BRDA 4NKMB 2IANA 3O0RL 4F37K 3TPKA 3DYOA 1H5BB 5GGRY 3V5HB 2MOVA 1EX0A 3HE6C 4K94C 2AXJA 2FX9L 2WIMA 4O2EA 1EJOH 2NY2D 1CFSB 3KPSA 4QWWD 2DM3A 1A9EA 1NAML 2EKSA 5GRWA 4KQ4L 2AP2A 4GW5B 1ORQA 3AY4A 4YQXH 2WP3T 1NCDH 4I13B 2Y06L 4YFLF 5DUBA 4MAUL 4C56E 4ONGL 3F5WB 3QXAA 4H26B 3Q0HA 2F8OA 1Q0YL 4KI5F 1ZKAA 1UGNA 4HXAL 1KOAA 1UM4H 3OB8A 3BGFB 4Z0XB 5IB5A 3CC5B 1F4XL 1ODAA 4Y19E 2DDQH 1F2QA 4NPYA 2BDNH 3MTRA 3MUGA 2YOCA 5IQ9B 5JIKA 5HVHC 1S7QB 3QNZA 3AREC 3RZCB 4NQSA 4YFEA 4KRNA 5KSVB 3T65B 4MJ5A 5EOCH 4ODHH 1QEWA 5IR1A 3OKLA 3X17A 3LIZH 4M48L 1WITA 1EFXD 4UDUA 3WEXA 1UKTA 4F15B 2C5DC 1JNNH 2CMRL 2FSEB 2EYTA 4YXLL 4ZMAT 4QXTB 2X4PA 3VJ6A 3KPRE 3Q2CA 32C2B 3PWPB 1FFPB 4PIRF 1X5IA 3P0VH 4B41A 3W9EA 3FQUA 5HHVL 2R0WH 5I6XC 3GMLB 2YHGA 2FYYA 3BH8A 3AVEA 1Y6MR 5SWQB 2OK0H 3CMOH 1RD6A 3AC0A 1KIUA 1QG3A 1WV7T 1J0YA 2SEBA 3VFNA 3WUWB 4X9IA 2X89D 1AJ7H 3VRLF 1JPTH 3LKQB 1V3JA 4PS4L 5ESQA 5FYLD 1YNTA 2B20A 3TM6A 4XCFL 1QFHA 3VDCA 3ZHDA 2ZUXA 3IT8D 1LWRA 1KACB 3PGCB 5K93A 3CPLA 2ZKHH 2JJSA 1I4FB 4ZUSB 1T0MB 3G5XA 4JY5H 5IBTL 4R96A 4LCWD 4CVUA 3K46A 3T0VA 3HLAB 2FL5A 2H6PA 4YEEA 4Y4HD 3KNBB 1C5DA 5F3HB 2A73B 4J1UA 3BPNB 4QRRE 1FIGH 3CSBA 4OFVA 5EUKB 4QF1A 1NC4D 3TBWB 2R2HB 4KROC 1BJ8A 3QUML 2FWOB 3V52H 1WFOA 4NC0B 4I18B 3PWPE 1YN7B 4X5WA 5F1IB 3PWVA 4R7DA 4K7PH 4N0FA 3QUXC 5JQ6H 2B8OT 1QYGL 5KOMC 4LLMA 1HILB 1UXWA 3WFHB 3KYNB 2Z4QA 1HQ4A 3RWHB 5DJZA 4ERSH 3MRNA 3VG9B 5HGDB 3OX8A 4MAYD 1ZT1A 2ADFH 4NQEE 4B0MM 1OGTB 1SEBB 5LQBL 2VAAB 1KN4H 4JFDD 3T0WA 4R26L 5I1AB 5DYOB 4JO3L 4URTB 5BXFA 2VLKE 4G8FA 4HIHB 4LLUA 1H3PH 1VGEH 5BS0A 4O00A 3TIEB 4FFYL 1TPXC 2VXQL 4UOJA 3CZFA 4D3CL 2AV1B 5KS9A 1I9EA 1S7WB 5FCSH 4IRJB 5B39A 4JRXD 2BMKA 4P46A 3D39A 1IM9D 4LSPH 4MLIA 3V4UL 4QHNB 3TZVD 1KIQB 1JUFA 5I75B 3CXHK 3ARSA 4JM2F 1BAFH 3W0WB 1GIGH 2VLJB 3FB5B 4OF0A 1BZ9B 1IFHL 1J0KA 3ZKND 5ACZB 2BVPA 1DBJH 4KZDH 2JJTC 5FO7A 4N0CC 3MA7A 3T08A 1A8JH 1FYHB 3MLWH 3HR5B 1WFTA 4I5BA 1CXLA 4Y5XB 4HGMA 1ND0B 3GRWH 1ZHLA 1NAMA 4WEUD 5KVDL 5KN5B 2QQKH 1Q9OB 5C9KA 3GFUA 4P2RD 4ZDHA 1I9JH 3EOAB 5DDHB 1MCQA 4U6XA 1FNSH 2NX5B 3DVNB 1P2CA 2HFGL 2ORBL 1N0LA 3BD5A 1FL5B 3QBTB 2CXKA 1K9TA 4X6CB 4CU8A 3I84A 1IQDA 2YD4A 4NN6B 2R15A 4YHNA 2DQJH 2HRPH 3WBDA 4Y5YB 4HBQA 4GLRI 1HINL 2DAVA 3E2HB 3E6FB 4OJFH 5GS2H 4XNUL 3E1F1 4HG4K 1AR2A 4JFZH 1UEYA 4ZFFA 2IBBA 4W68A 1CDCA 1XGPB 1T04B 4HWZB 4PRAB 1NKRA 5C6TH 2X10A 1LNUA 5FF6A 3W0WE 3OTTA 4RZCA 5ADOH 2VLJE 4G43A 4RIRA 2AJUL 5GSVB 4ORZC 1WT5C 5ERWA 4QRPD 1AXIB 1KLUB 1ZXQA 2ZWLT 2VLRB 4U1SA 1UT9A 3U4EB 3MV9A 1L9NA 3WS6A 5F9OH 1J0HA 4PRPB 2R2CA 3P4MA 2E6QA 2KUTA 1EEQA 1CL7H 1CN4A 4U1HA 1LGVA 2GAZA 1R5IA 2UYLA 3MLRL 3R1GL 3OKNB 1FCCA 1NCCL 3DYMA 2NX5E 1KB5L 3FQNB 3HG1E 1G6RH 5CBEA 3H3PH 4UT6H 4X7EC 3GSNB 3QIWC 2XKNB 4OZIF 3R8BB 3JWDC 3PG2A 3VXMB 1AE6H 2V5SA 5EU3B 5HVFB 5IQ7L 4GLRH 4KRPD 4WHDA 5GRZA 1KCSH 5ID0B 1JK8B 5F88B 5I74C 3IAQA 2Q1EA 2NR6C 3GSVB 2ESVE 3VE0A 4M7ZB 1JGEB 3ZTJH 2J2ZA 1RJZA 1LEKA 3I3EA 3FQTA 1A6VL 1N64L 3ARZA 4PTUA 3UPCA 2ZSVB 5I9QC 3C5ZB 1C5BL 3L3JB 2AXFB 5CEZE 1A3LL 5JUEH 2IFFL 5EU6A 3CXDL 3QUMA 4DZ8A 3AB0C 4OF3A 3L3OB 1VFBB 4MZ3A 1SQ2N 3WCYA 4PLJC 5DHXB 2VLRE 4KI5E 4LF3B 4XT1C 3WIIH 3ARRA 3VXTA 1OCWL 4K8RL 3MC0A 4ZUTA 1BGXL 1Y0LA 3SE9L 1D9KB 3S96B 1FV1A 4L4TA 4NZUH 3QCVL 1R3HA 4KK5C 4WU7B 1DUYB 1S9VA 3LKNB 1A1OB 2H2SC 4RAUA 5CUSL 5IVXE 4RAVB 1AGFB 3IAPA 2H1PH 3ET9F 3MJ8B 1LILA 5TDOA 3VXME 1EVTC 1I1YA 4IOIA 1U92A 2ZP0T 4YHKH 1E6OL 3U1SH 4M8QA 5D7JC 1ZLWH 4CW1B 4P5TD 1KJMB 1QSEB 5FYJL 1LO5A 5HY9B 2M8XA 4PRNA 1T1XA 3C9NB 3S9DB 1UFUA 2WAHA 4AY0A 4HFUH 4Q6IB 1KELH 4Z8FH 4XBEL 1R6VA 5DJ8B 2QHRL 2D9QB 1Q9WA 1UYWL 2KH2B 2NXYD 3HB3C 2BOCA 4QLRA 2JK5A 1F4HA 2FZ3B 2YRPA 1NEZG 2AEIT 2OTWA 3CLEH 3T3PF 3VXNA 3BN3B 1X4ZA 2F53B 5EZIL 4AENB 3B9AA 1XF2A 4FFZL 1GXEA 3LSOB 4AIZB 4GMSH 5EFIA 1I9IH 5I18H 3D69A 4HF5L 4IM8A 1MJUH 4OZFG 4MCYA 5MENB 4NQTA 2I24N 5CJBA 5D8JL 2OJZL 4GBXA 1NMAH 3LZFL 4G9FD 4GXUM 2EDJA 4JPIB 3WFZA 2XG5A 1A7NH 1FORH 4L4VA 4EXPX 4NQVA 2QADB 4HZAA 4NCDA 3TA3A 4ZAKB 1X5HA 1T5XA 2YK1H 4EIZC 4D9RE 3T3MF 1VPOH 2X4SA 3QI9D 1Q9KB 2IAND 3P4LA 1CFVL 1RJLB 5CP7B 3WJLA 3SE3A 1QSEE 4IHOA 1XR9B 3P30H 1DN0B 4KUCF 1FFNB 2ICES 5FGBA 4MHHG 1RULH 3IJYA 4ISVA 4ODTL 3KPSD 3L9RA 5CEYA 2X42A 4F33B 4OBRA 1U3HD 1JNLL 3ARGA 3TFKC 5IFJA 5GGRB 3FMGH 2GJZA 3B2UC 4TPRH 3NACL 3LPWA 4NJ9H 4KK9C 5ESAB 5HXMA 2YD3A 2ZPKH 5GRYA 1FZJA 4JO4L 1ZT7B 5I73C 3SDDB 4JGMA 4QRSB 1UWXH 4YHPB 5ELIA 4EUPG 1IAOB 1ZA6B 1C16B 2FEEI 1K3IA 1NJ9B 1HCVA 2GITB 4CAGA 2I9TA 5DUPL 4PJ5E 4L9LC 2XWBA 4ZFZA 5CCKH 1HNGA 3QAZC 1A6ZA 4NQDA 4F9LA 2EEBA 1UQSA 5IEKB 3ARFA 5DMGD 3MNZA 1OP5K 3O3AA 2HLFC 3CFJB 3FO9B 4P9HH 4TVPH 3TBSB 4LP4A 1KB5A 5HHOB 4NYLB 2EYSA 5LAXB 4WV1C 3FB7B 1MHPL 5DTFA 5TE6H 4AH2B 5FO8A 1Y6KR 4OCXH 4GS7C 4NKOA 4HW6A 4I9WD 1ITCA 4MJIA 3IDUA 4KMTH 1AHWB 1W0WA 3SDAB 5JW4N 3VXRA 3NPSB 2A2QT 1B0WA 3VGAC 1MWAH 1MRDH 2YC1B 1FO0H 4Z7UA 3STLA 1QPXA 2Q6WA 2DJ4A 2HVKA 3CAFA 3WFDL 2WBJA 4KMLB 4KY1L 3F7QA 3FONA 4XAWH 3WIHL 3CDYA 3SY0B 3RGHA 3DGCR 2CKBH 4JDTL 4LSUH 5HHXL 3T77A 2HT4D 5I15L 5A2KH 1GVIA 4L4JA 3B9KC 1JTOA 3DX7B 2ZG2A 4OZIB 3WFBH 1T3FA 3G5YB 1MCCA 1A6WH 3MV8B 5F9WB 4M1CD 4U33A 4F7TB 3BSZL 1X5YA 3A6CL 4Q7DA 4U1MB 3PDDA 2NTFA 5EZOL 3SDXE 4DN3H 2DN7A 2AK4A 1H5BC 3A0OA 3GNML 4QGYA 3REVA 5F7UA 1A6UL 2DQEH 5GSRB 2AJZA 3AXLB 3GSXB 2DLEA 3H3BC 2F74A 5HHOE 3RWEB 4C4KO 2VC2H 3BHBA 1SEQH 3MACH 3MXVH 1A7PL 4TRPH 3GJEA 2X4QA 2EDHA 3O2VH 3Q5TA 3JWOC 3NTCL 1KV3A 1Q9LB 4L1DA 1ZT4B 4YHIB 3QIBA 1KEGL 2XY1A 1CICC 4MNQA 3IVKB 2HN7A 1Y18B 3PWUB 5TE4H 4C83B 5JOFB 2MSPA 2GUOA 1S7SA 4WFED 5SWZE 2NW3A 4P23A 1LEIA 5H37H 1T22A 3MYZA 1AO7E 2N56A 5DK0B 3I3BA 4WU5A 2EXYC 4BFIB 3RZCC 1ITBB 4Z5RB 1KCLA 3U83A 1FN4A 4N1EA 1T1ZB 3PUCA 4YE4H 1N2RB 4FABH 2ZUVA 5E5MA 2F58H 4PR5B 4OZIE 4F15C 4JO2H 3PL6B 1LE9B 5JNYB 5BS0D 5CJOL 1XGRB 3G6DL 1ZANL 3EW3B 4HHAB 3HNSH 4LEOA 4GKOA 4P46D 3D39D 2LU3A 1A7QL 4JFHE 3QFJA 4MSWB 1DE4A 1ZEAH 4G6AC 4WFFD 4YDJB 1ZV5A 3BI9X 4LKXB 3IFLL 4OCNC 4NRYB 3V0VB 1OVZA 2RCSH 2FRGP 1DQLH 1ZGLP 1A2YA 1OB1A 3MMEA 1YYMH 2Z35B 3H9HA 3QRGH 3VRIA 4WFGD 1FG2B 1YUHB 1SYVA 1R3KB 3QG7H 3BP6A 2Y5TA 4K3EL 1CFQA 3ES6B 1OTSC 3GI9H 2VL4A 1S9YB 3RWGB 3DRTA 3MLYL 1EFQA 2R4SL 1FJ1A 1F90H 1HHIA 1MY5A 1IGTB 1C5CH 3KPQA 1DBBH 3MOBL 4WWID 4HIJB 2VYRE 1BFSA 3SDCA 5IKCA 1EZVX 5CWSA 2W9LA 3MODH 3W9DA 3UZEA 3WUWG 1A9BB 4I18C 3HR6A 4BK5A 4CVWA 4KTDH 4WJ5B 1YYLL 1T7WA 4J3OC 5JHLL 1AI1H 2QTEA 3PWNA 4OQTL 4QCIA 4K3DH 5FGCB 4Y5VB 4N5ED 4TQEH 2QLVB 1QQDB 4APQA 3HAEG 2O93L 2PYEB 3SE8L 5KANI 1CGXA 1CLZH 4P4KC 4AG4H 1AFVH 1F8TL 1UJ3B 1HHGA 4LFHG 2AGJL 3WNLA 5I1GL 2CR6A 4KKCC 1AGBB 3IGAB 3QDJB 4O4YL 3SKOB 3T3PE 1S5HB 3MV9D 3CH1A 1VDGA 1AC0A 3FT2A 4ELME 1GL4B 2DWDB 5CS7A 1YJDC 4G7YH 2J4WL 3RGVA 2V9TA 1NGZA 3MRPA 4FXGA 3WIHA 4G42A 3QQ3A 4JVUA 2V17H 3BWUC 5DQJA 4ELKB 3BZEA 1K4DA 2E7HA 3ARYA 4G8GB 3QSKB 5DRNB 3HNTL 4N68A 1J1XH 5I75C 5F6HI 4O02L 3WXWL 4M3KB 3HUJA 5DLMH 5GGVH 4CMHB 2PTUA 2EDWA 5E8PB 4KTEH 3IU4L 4LLQB 2ED8A 4I2XA 1MAMH 2OTUA 3LMJL 4DFIA 5JXAH 5DMIH 2VDLH 4CKVX 3T3ME 4F3FA 1II4E 4HUXA 3MUJA 5CZVL 1NSNH 1U8OB 4K9EH 1F4WL 3RTQC 3MNWA 3UTQA 2QQLL 5GJSL 2BNRB 3VWKC 4LHJB 2OL3B 2YD6A 4P48A 4FXLA 5BOPA 3TF7C 2GJ6B 3I02A 2I9LA 3BKMH 4FFWC 2E7LA 5L2JB 1NGPL 3MBXH 5C0ND 5EU6D 4NQXA 3EOTH 1XAUA 4BSVA 2OMBA 4JJ5B 1BD2D 3BP5A 2JE8A 5IVNA 3QDJE 2WNGA 4M7KH 4NN6C 4PJEF 3EIFA 5C09B 5E8OB 4CN4A 2QBWA 1RHHA 3SKNA 5ISZA 4M6MH 2VUOA 3VXUA 3H42L 3ULUC 2VABB 1KT2A 3O3UN 4XPAL 5F8RC 1RUAH 2X4NA 1YEDB 3EOBB 1LD9A 2Y07L 1FP5A 1DP0A 1JPFB 1I7UA 4X98B 4QHMB 5BVJA 4MB3A 3QUKA 3RPIA 5E4EC 3HRZA 1BJ1J 1NBVH 2VLLA 4Q58C 3HE7D 3QWOB 1CG9B 2W60A 1FG9C 1JI2A 2JB5L 3I2CH 2X4UB 2EDTA 5E2JA 4FQQA 3VFGH 1S7VA 3LQAC 4FP8H 2LQRA 3QUZA 5FYKH 5CLTA 1D5IL 5SWSB 1QA9A 2G75B 4JZOB 3SOBH 5DJXA 4YR6B 5ADPL 1CBVH 2BY2A 5HI4D 3I9GL 2P5EA 5CJXC 3BESR 2ZJSL 3L3DB 3AM8A 5J89A 1OAZH 3IFOA 3VFUA 5JOEA 1CIDA 4OIIH 1N5AA 3NCJH 1SJXA 5CD5D 5K9QG 5J4MA 5IB1A 1WIPA 4MA3A 1ZLUK 1RQ5A 2F8XC 1MFCH 3WL9A 3FO1A 3UJJL 3ZHKA 3TWCH 4M6NH 1X5LA 1OSZB 4NC1C 1BEYL 5F89A 1QFOA 4JY6A 4P2OB 3F7VB 3F7RA 3IETA 1YMHB 4BFBD 3OXRB 3EYUL 1JRHI 4Y4KB 2DQDH 3INUL 5F72S 1JE6A 3TA3D 1U8QB 5SV4A 1EO5A 2WQRA 5I2IB 5F7WC 4PJGA 4OQTA 4LVNB 4IDJL 5C08B 1IC7H 1MUJB 3BGMA 1SJVA 5CEXB 2UY6A 1EXUA 4OLYH 3OKEA 3F12A 3V6OC 1FZOB 3ARGD 2G60H 3U46B 4UILH 1T89C 3VG0L 3GSQB 5T1DL 3D85A 1U8JA 4WI7A 2K7PA 1ZHNA 3V6FB 5JLZB 4XI5D 4OCMC 5DO2C 1EDQA 1QNZL 4MNGE 1G84A 1DSFL 3V4PL 5EC1B 3D3VB 3ULVC 2C3VA 4HBCL 4XRCB 4LLWB 5E2VH 5HI5D 1MCRA 2G5BA 4HJGB 1J9CT 4HGWA 4UUJA 4LRNH 4TNWF 3BH9B 4NQDD 8FABB 1UCTA 1U95B 2ENYA 3U9UA 1MQKH 3ARFD 2BFVH 3RWCB 2NY2B 1SM3L 1JPST 1K2DB 3UBXB 3UJIL 5D7SH 2RFXA 5EBMA 3V9FA 4OAWA 4M7LH 4N0YH 4XP4L 4B5EA 4HWEH 2FH8A 4MJID 4K2UL 2Y5EA 5L9DH 3MO1B 3B9DA 2VDPL 4L3ED 4KRMB 3GMPA 2OTPA 3VXRD 4F8TA 3X3GH 2WBKA 2R8SH 4R9HA 5H94B 1WZ1L 3QQ4A 5IM7A 1EEYA 3N9GL 3VFPA 2A0LD 4M62H 1U0QA 4LIQH 1JYNA 4UT7H 1WICA 1G7IA 4L8CB 5D2NB 4FQIL 4BQ9A 2ZSWA 2ADIA 3O6MH 3VXPB 2XICA 2VL5A 3BXNB 5KW9L 3CFBA 1J7VR 3GSWA 2NW2B 1E4KA 4Z76B 2QADC 1EFXB 3MV11 4K8RD 5EO9B 5K9KB 2LE9A 3CLFL 1HSAA 3D3VE 2J5LB 4PFEA 2NY7L 5E5RB 4LLDB 1A6TA 4FRWA 4GMTL 1XFPA 1QFPA 1EVUA 5TDNA 4DGVL 1FZMB 4J7RA 1A3QA 3BE1H 1I7TA 5JW5A 4NKQB 4HC1H 4JRWA 1HHHA 3QO0B 2BSSB 4ODVH 2P8LB 1RUPL 4HXBH 1I1AD 1RV6X 5IB4B 3DX6A 5GGUA 4OLUL 3MOAL 1W8NA 2Y1VA 1DBAL 4BH7A 2VMFA 1UH4A 4WENB 1PG7L 3O11B 5FYJD 2EH7H 4XNMB 4NBZB 5AUMA 5FA3A 4OQ1A 3RVTC 3B6SA 1NFDE 4P23D 5JXEC 3PHOB 3H9SA 1J05A 1AXTL 2WWMC 2E9JA 3LQZB 4DGYH 1XF3A 3QIUB 3HS0A 1PG7X 5EOQL 3C6LC 1KB9J 2IQAA 4NRZA 2QSVA 4R4FH 1NC4B 4PV9A 3SGJC 5ALBL 1VADA 2AAVA 5F7EH 2XZAH 4UV7L 4XHJC 4I48B 3H0TA 3R06B 5DQDL 1VKXA 1HZHL 3L5XL 3SDAC 1LO3H 2M26A 1P1ZA 5HD8C 1T2JA 2NY1B 3NPSC 4OZHB 2MCPH 5CINH 5IROC 2ED9A 3JWDL 4PP2A 1U8MB 2IPTH 2R56L 4FS0A 3MA9H 4HIEB 1M7DA 4X8JB 2R29L 2BZDA 2DJSA 4MAYB 1V7ML 4X6DA 2OR7A 5FYLE 1U8IB 4JFDB 1MSPA 1T66D 5TGBA 2VDML 1NGYA 4JFXA 5HYFA 4XP1L 3O3EB 5F9WC 4N9GB 5EUOB 2V6HA 4PJEE 5EB9A 2FECL 4LCWE 1RZIB 4ODSH 2EDRA 4J23A 4JRXB 4UNUA 1GH7A 2XKUA 4RGND 4W4OA 3QUXA 3TV3L 4DKEH 4YX2L 2A9NH 4Z95L 5KVEL 1U58B 3GJFB 1LP9E 3GKWL 5E24E 3SDCD 2X70A 1H15B 3ZDYE 4TTDD 3X3FH 4NT6A 2NY3B 5JO5A 4P3WA 3OL2A 3RY4A 4OGXH 3ZTNL 5HJ3B 4KDWA 3MUY1 3UZVB 1FFOA 5C1MB 3LEVH 5CHNB 3WHE1 4G8EB 1D5MA 4H20H 3BUYB 4GG6E 1R3IH 2BNUA 4DZBA 1MFEH 1S7UA 1DFBL 3O2WL 5JW4R 1BX2B 4P2RB 4E5XA 2VERN 4JREC 5EBGA 2AABH 4GSDL 3KG5A 2MTPA 5DFTA 5C8JB 5DRWA 3VI4F 4JFDE 5T1LA 3ZKQD 2WWKO 1ED3B 1P9MC 1U8PA 1EGJH 3CVHH 5DD6A 1CXHA 3F6LA 3PL6C 5I1EH 3IF1A 3WE6A 3KXFA 3OHXA 4OLVH 3O3DB 2JJTA 1A14H 1AGDA 1BF2A 4PV8B 3S3PA 1KXQE 4JRXE 2JJWA 3KLAA 4BZYA 1DLHA 5JPNA 2DL9A 1ZHBA 4PJ7F 1RZFL 4Z0BH 5DJ0B 2GT9A 5MERB 2CSPA 2VLMD 1D5BA 3Q6FB 3RDTB 1O0VA 4ZS7L 2FGWH 4HPYL 4QRPB 2W9DH 4ZUVB 4PB9H 5EC2B 3VWJA 3CIQA 4X5LA 4IRSB 3VXSB 4GAJH 4OB5H 5A3IC 2OBGA 2VDOH 3K2UH 5JIIA 1ZS8B 2GFBB 3PQYB 2X6MA 4I0PC 4LCCC 4WWKA 3D2UA 1KCVL 5TF1H 3DV6A 2IH1A 1FQ9C 1B4JH 3DMMB 4P2RE 4NBXB 3LH2H 3C5JB 1OQXA 1OGAD 1BMGA 3O9WC 2R23B 5ANME 5AZ2H 2NY6D 2B5IB 4FMFA 1YEKH 5ICYA 4HUUB 4KPHH 1WT5A 1QR1A 1C8PA 1BLNB 5CZKA 5IB2A 1IGMH 3N1PC 4KRPB 4X5XA 3T2QA 3KPPB 1XT5A 3P0YH 4U1JA 2EYRB 2HTKC 5HYJD 1KFAH 5ISZD 3MLVL 3G9VA 4U1KB 2BHUA 1T2QH 4Y5VC 4XVSL 3VXUD 3ILQC 2Y36H 3CUPA 4P2QA 3O45A 1Q72H 4W70A 1JNHB 4XBGA 4ZODA 4F57L 3D18A 3HI5L 3TBYA 3PIQA 4WW1B 4F7PB 4GKZA 1S7RA 3I50L 2R9HD 1UJ3C 3QULA 4QRPE 1JP5A 1V5JA 1UEMA 4X4XA 1TJHH 3QPQD 4PJ8C 1JCKA 4XCNA 1B2WL 2AKRA 1AGCA 3QIWA 4OLXL 5B3NA 4JQVC 5CILH 2FJFB 5F7YC 1JMXA 1PKOA 1K8DA 2HA1A 4S0SD 3MLSL 2HFEA 4JFFA 1L0YA 4JN1H 2IG2L 1PQZA 3C8KA 5JA9A 3QUZD 1N5YH 4YAQA 1OP9A 5D6CA 2VZTA 3BO8B 4RGMB 3MREB 1KYOK 2P5ED 3S5LG 1S9KC 3TPUB 3IB4A 3OPZL 3U4BL 3LHPL 4OCYL 4KAQH 4FXKB 4LKCB 1JZ4A 3KPLA 3HMWL 1QACA 1YEFL 2HG5B 1TIUA 1DEDA 3O8XB 3QUYB 1JHTA 4P5TB 4OGYL 2ICWA 2OM5A 3DURA 4FZEL 5F7LB 3NH7H 3FQRA 5DHVH 1UACL 5DD0H 2IALB 1XF5B 4EZMA 3DGGB 1I8MA 1PGRB 2MQ3A 2NXYB 3FFCB 4MZ2A 4OCLC 1FVCB 1OW0C 4OI9A 2AJSL 2FATH 4M9OA 1ADQH 5ALCH 3O4LB 3MR9A 2FBJH 1EEUA 3S97C 5C9JA 4S1QL 4OZFA 3ZE2F 5I1JH 1G6RB 3O3BA 1BQHA 2A6JA 5D7JA 2OLDA 4RMRA 3ZT5A 1UVQB 4LPVA 2M2DA 3G04B 4U0RB 2AXGB 1ZWIA 2BK8A 3D85D 5IF0B 1WBYB 3TO2B 3VD7A 2IFGA 1RK0A 4JFQA 2YD1A 1DQTA 1DQJA 1KBGL 1U3ZA 1CYGA 4YH6A 1T21A 1VACB 4XVTH 5FIEA 2P7TB 2ZOLB 1CE1L 3NGBB 3OKKB 1YMMA 4OI7A 3CD4A 3W5MA 5EA0H 2X1WL 3P9LB 1I1FB 4XX1E 4PP1C 3H8NA 4G6JH 4Y16B 3DIFA 4H1LG 2OR9L 3U36B 3N50A 1CGSL 4XNZB 1U3HB 5FO9B 1CGTA 4GAGL 4LOUC 4OLWL 4MD4A 1BFTA 2ZCKL 5T5FH 3VI3F 1AKJA 1CQKA 3FRUB 1KIRA 3MRQB 4UTBL 4XHQA 5EO0A 5GHWL 5DEGB 5J6GB 2ATPB 5CGYC 2HVJB 5GISH 4QOKA 3IU3A 3QHFH 4U1IB 1KNOB 3T4AA 2MMXA 2Q7YB 1JWSA 4JDVB 2MKWA 4PBVC 3VGBA 4R7NB 3HE6D 3IDIB 4UV4H 3WLBB 3ZL4H 4FQHA 1F3DJ 4G9FE 4P2YA 4PJ7B 4NM8H 4P2OC 3MLXL 2FGZA 1J1OH 1UA6L 4HMDA 4DGIL 5SV3A 1BZQK 2DBLH 4RFOL 4AEIH 3CX5K 1NAKL 1HSBB 4XMLH 4XP9H 2A77L 4LSDA 4BQ6A 1C1EH 3JUYA 3KPMA 5E08L 1IBGH 1Q1JL 4YGVA 5T1KA 4YHML 3PHQB 2IANE 3SPVB 1FVDA 4Z7WA 2Q76B 4LVNC 2AJXL 1UENA 3T04D 3BKJH 1F4AA 2VQ1B 4NZTL 1BZ7B 5IMMB 1EBAA 5DMKA 1MJ7H 3KPSE 4M9PA 3QWQB 3RL2B 1DQDH 3DRQA 1D6EA 5TQ2H 1DANT 4I0CC 5I76B 5E8NB 3VMPA 1WBZB 1VENA 3KYKH 1MFNA 3ARED 3WSQL 5E94A 1M7IA 1ORSA 3B3IB 2BCKA 4XB8A 3VI4E 4WV1A 3FJTA 5EWIH 4D0DA 4ORGA 4D9LL 2R1XA 5INDA 5F1OB 3RA7H 3I6GA 2IBZX 1RIHH 4OGAC 3GUTA 2VJXA 3GMNA 1ULVA 4K3HA 4KJQC 4TVSa 3IJHA 5FECA