2VDQL

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPSRFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdqL01
1EGJL 3P4MB 4P57A 4UIMB 1G1CA 3T3MF 1Q0XL 4QT5B 2NYYD 3MRRB 3TO2B 2DQFB 2HN7B 1XR8B 4GW1B 4CMHB 2AXGB 2VJXA 2X05A 5A2JH 4U6VL 2VABB 3CH1A 4S1RL 4ONHB 5DSCA 2EDEA 1JTOA 3D9AL 2JLLA 2UZIH 4KKBC 3VXRE 4O5LH 3HE7B 4ZPTA 4WEBH 5JA9A 1XR8A 1PBYA 1JZ2A 2FRGP 4J2XA 3WFEH 4M6MH 3HC3H 3S5LB 3ZE1F 3MRHB 5FYLL 4X99A 3LQZA 4L5FL 3P4MA 4YDKH 5FUOL 4OKDA 4LSSH 1RUKH 5TDOA 5FO9A 4TQEL 4OLVH 2A74A 3MA9H 2ZUUA 3ARRA 4RA3A 1PKOA 2WLYA 4U6VH 1LE5B 2P8MB 4B53A 2VDNH 2W65B 2NYYC 5DEGB 3QH3A 3DX9A 3F12B 1J8HA 4BKLB 4JM2B 1I4FB 3HE7D 2WUCL 4EOWH 5HTSA 5I8CB 5F7DA 3K8MA 1J1PH 1RPQA 3MODL 4FXKA 3QCUH 4NQVA 5DMKB 4HS3B 1JYWA 4L4TB 1MJ7L 1N0LA 3CPLB 1RZKL 2CMRL 5HDBE 5I1KH 3Q5TA 2J5LB 4N0YL 1YEFL 4L4TA 5CEZH 2CK2A 1B9ZA 4LHUG 4NZRL 3BO8A 4X6CA 1EX0A 3OXSB 5B39A 5EO9B 3QEQE 5E00A 3F12A 3VXTA 4BKLA 1J05B 1R3HA 3PJSA 3MV7B 5DT1H 3CVHA 2QQKL 3X14A 4B5EA 3IDYC 1NGZA 4OFKA 4RCAA 2NY1C 2ZCKL 3G5YB 2SEBA 4YHLL 2IMNA 3MRCB 2ICWA 2XICA 3RDTA 1FO0A 4UOW0 3QO0A 2Y5TA 3CFKA 1RAMA 1NMCB 5HHVL 2BXZA 4Z0BH 4H88L 1JHLH 3SY0A 5GS1A 4XRCB 3ZKQD 4JFOB 4QYOB 5E03A 2B1AH 1JNJA 3CZFB 3LN5A 2GTZB 3WFEL 1MCEA 2FZ3A 2WWMC 5C2BH 1MNUH 5JIIA 2BX5A 4X7TB 3K81A 2HRPH 3EOBA 4OZIA 1AR1C 2VO5A 2VZOA 5AYUH 4QOKA 4OFYA 4WO4B 3U9PH 2P5EB 4Y4KC 2ZKHL 1U8LB 3L3GA 4NJ9L 4XCNA 2ZSVB 2IADB 3G6DH 3OHXA 4PJXB 3FB7B 2R9HD 2YUXA 2Q87A 1N3NB 2C3VA 4R4NC 5IG7B 2X4OB 4HT1L 3BVNB 5IFHL 3ULVL 3KPPB 32C2B 5BOZG 4DN4L 4QCIB 4HH8A 4RGOL 4U31A 3MV11 3GSXA 4MA3A 5I30L 4K7PL 5DVOA 4E5XA 4YEFA 4BSVB 2A6DA 3T0EE 5EA0H 4FQQB 5EZIL 4PJEA 4RIRA 5HHPA 4ELKA 5DJXA 4IIQB 1CIDA 2JCCA 3FQNB 4IEFB 3C60C 4NJ9H 4JY5H 4WUUD 3EYUL 3LV3A 1TJGH 3KWWB 4FZEL 1XH3A 1Z5LB 2C4FT 4LLVA 4ALAL 4C56B 4R2GC 4DKDC 4MJID 2IPKB 1NPUA 3HA0A 4M6NH 2HKFH 3WFDL 4JVUA 4X6CE 1A2YA 1ROWA 2QL1A 4ZNEE 5I1LA 4OSUH 3QEQA 4OI8A 5D5ME 1XZ0B 3O6FD 5MI0C 4ZXBC 1PG7X 3SDAA 3JVGA 3IGAA 1F4XH 3BP5B 1FYTD 2OCFD 1HHGB 4P49A 4H88H 1A3LH 5DR5H 3V52L 1T20A 4BQ8A 4UI2A 3NH7H 1YY9D 2WWKO 4P9HL 5DHXB 1KPRA 3CDYA 4CN6A 3MRBA 2GHWB 4WW2F 4JAMB 1D5BA 1AD9B 3MTRA 3S37H 5DQJA 3HUJB 4JN1L 4F7PB 3EYUH 4RMTA 3R1GL 5DHYB 2ENSA 1CICA 3BH9A 3SDAC 3UJIH 3WD5L 3THMH 1I3VA 2X41A 4HS6A 3SGJA 2CDEA 3O2VL 4U1MB 2EIDA 4N0RA 1EEYB 2APFA 5TDOB 2W1NA 5IIEA 3QIUA 3BD5A 3ZE0E 1CXFA 4LHUB 5FDWA 2VLKD 1HEZB 3QH3B 1BFVL 3VJ6B 2ZUYA 5BRZA 5T1DH 4F8QA 5I8CA 3EO0B 2X9XA 2EXYC 2NY1B 3CU1A 3EGSA 1T89A 3PWPD 2DQEL 5INCB 2R56L 4XMLL 4PLKC 4PJFB 3QNXA 4IJ3B 1NMCC 4U3CA 5IIEB 1YEDB 1CGVA 5HYJD 2BNUA 1ACYH 2Q3AA 1A4KA 4HEME 3CDGA 4I3SH 4I3GA 2CIIA 4YDJB 5D1QA 4M5YL 3SDCA 4RRPA 1NFIB 4EXPX 3U2SB 5IW1B 4I18B 5BVJA 3QG6A 3JXAA 5DJYB 3A6CL 2G2RB 4YHZH 1NBQA 2ADGB 4X7EC 4HUKB 3VFOA 2AS5M 4IRZH 2HN7A 2PYEE 4GW1A 4WU5A 2AEQH 5D2LE 2J7LA 4FFZH 4X4ZA 3UTQA 4DKFL 3SE9L 4FG6C 4ZNEA 3DHJA 3BW9B 5D1ZC 5ABDE 1OP9A 4Y4HA 3QJHA 3EYSL 4I8DA 4YFEA 1JF1B 4HXBL 4QHKI 2KPNA 2G5RA 4RRPG 5HI5D 4BQ9A 2BCKB 4H25B 4Q6YA 2EXWD 5EU5B 1UA6H 4CU8A 1UZ8A 3KHOA 5JOEA 4CMHC 3WFBH 2JIXA 3G5VB 3MGOA 5C09A 4FMKA 5D96C 5EO1B 1S7RA 5IM7B 4WJ5B 5GJSH 5GJTL 1K5NB 4XVJH 1LNUA 1JI1A 4BM7A 3OPZL 1MJUL 5F3HA 3FFDA 3EYSH 1D5IL 3MRDA 3W39A 2GITA 4G5ZH 4O2FB 4ETQB 2NY7H 1JTPA 4R7DA 3SE9H 4HFWB 2NY0D 1OAUH 3PNWA 5D2LB 1BZ7B 4XT1C 4MDJA 3CLFL 4KI5F 1A6VH 2V9TA 1UVQB 1NGWB 5EBWA 5IB5B 3L3DA 4JDVB 4K23L 1B0GA 2QR0B 4OD3L 1A9EA 2VLME 3G6AA 2OYPA 4JKKA 4EN3C 2DYPA 4LMQI 1PQZA 4JKLA 1QVOB 1FNEA 1IM3B 4NO0B 1X5GA 3MV9D 1HKFA 1UYWL 3CGTA 3MRQB 3U6RA 3U1SL 1KJ2H 2ICWJ 4BZ2H 1B90A 1ITCA 1GGCL 3MLXL 1MJJB 1Q72H 1X5JA 3ZMRA 2J5LC 5IGXH 4UTBH 3DVGA 2O5YL 1L6XA 1H5BA 4PGDA 5BMFH 3RHWK 4TNWK 5I1LB 2P8PA 4GKOA 2NX5E 1C16A 2IANA 3M1BB 4HJ0D 1K2DB 3CJJA 3SY0B 4U1LB 1UC6A 2OZ4A 4ELMA 5HHOD 4U1MA 4DVRH 4G42A 4NRYB 3LQAH 3GKWL 2ADJB 2VZSA 3DETC 4L8SA 1ZT4A 4B41A 1DR9A 3BZFB 5EDXA 4I2XB 4H26A 3WS6C 2ATKB 3FQWB 4KVCL 4FQCL 1NLBH 2E9JA 2YRLA 4XX1G 3ZZ1A 2JB6A 5JR1H 1HHKA 2YXMA 3MJ8B 2R1WB 1JPTL 5TQ2H 3JV6B 2CDFB 3FOLB 4PJ5A 5DYOB 3CX5K 1V7NL 1MFEH 1QA9B 3LEYH 3LPWA 4NDMB 5FECA 3LQAC 3WFZA 3VMNA 4BK5A 1ZANH 3MBEA 2HT3C 4GRLC 2VDML 2QQQA 3QNZB 5IMMB 4LGPB 2ZJSH 1NCWL 2BY2A 1E6JH 3CIQA 3N1MC 1U58A 3D2UA 4JGJA 4TRPL 4HX1B 3C5ZD 2FJHB 1TVBA 3D39A 1QUNA 4CNIA 3PQYD 1EDQA 3CXHJ 2AQ1A 2DLGA 4WTZA 2FWOB 1RU9L 1QRNA 4EVNB 1JTTA 1ZGLA 4S10A 3VXMD 1YN7A 1B4JL 2ITDB 5I17A 1I1CA 2A74B 4YXHL 3ROLA 5EC1B 4YDLB 2OTPA 4U0QB 4WI3A 4TULH 1YMMD 1NCWH 3WXWH 5GRJL 5EBGA 3ARQA 2QQKH 1JGLL 3AAZA 2EKJA 1U8OA 1JWMB 4DKEL 3D39D 2X2YA 5K9QI 5D6DA 3FQTB 5ESVA 1I9RL 2FSEA 1KXVC 4TTDC 4MHHI 4WW2C 1R3LA 3SDYH 1A7RL 1YEKL 2XI9A 4HG4K 3AREB 3P11H 3MRJA 2GJJA 3NCYP 3OX8B 4WHYH 3MOBH 1TZHB 2VE6B 4ZQKB 5GGTA 3W2DH 3MRPA 2F8XC 5BZWB 4JPIB 1ZKAA 3CFCL 5MEPB 1F90L 5E8EB 1IILE 4KK6D 2WUCH 5HD8D 4YWGL 3BRDA 3NPZB 4MXWH 4X9IA 1UM4L 2EDDA 4FG6D 2EDOA 2P5WA 1Y6NR 3HLAB 3QO0B 4ZMAT 3DXAD 3BSZH 3OKOB 1SMOA 2AJ3A 1NBYA 4XBEL 4POZC 4JR9H 4P2RB 2E9WA 2X4QB 4G8GD 5JW5B 3GMLB 3W81A 3QT2A 1FRGL 3BZ4A 4G9FD 1DEEB 3HZVA 4Y4KB 4U1HA 4Q7DA 4OZGE 2Z35A 2L4OA 4S1QH 1YEGH 4JN2B 4XAKE 4JQIL 2EDFA 2B0SL 5E94A 1I3RB 3VD3A 2JE8A 4K2UL 3NIDF 5FM5O 4S1RH 5DEFB 4JZNA 2MKLC 3O6LH 4P2RD 1QHPA 2A9MH 4XVTL 2GY7B 1NBYB 3DV6B 5HHVH 3P9WB 4CMMA 1NSNH 3O3EB 1CBVH 5HGAB 3QIBD 4X98B 3JWOH 2IAMD 4PB0L 1EEZB 5EC2A 4Y4FC 2J4WH 4LK4A 1FGVH 2YOCA 3PWUA 4U1HB 1EEUA 1MUJB 1ZWIB 3HE7A 1RUAL 4ZPTB 5C7XL 1OOAA 3SCMC 1DVFD 3QI9A 3ULVF 1QSEA 2D7NA 1DBJL 3HRZA 1EGJH 5DFVD 2LAGB 3VG9C 3VU2A 4AH2A 2HVJB 2HP4A 5CEXA 4YLQT 4JM4L 3FQNA 3QI9B 3SO3B 5FKAB 5DRZA 1S7XB 4EN3A 4KKCD 1KC5H 3ZT5A 1ONQA 3DURA 3SGKA 5D7KE 4OIBA 4M62L 2NNAA 3DBXA 4JFFB 4OF3A 5DJ2B 4XVTH 4QNPF 32C2A 1NC4D 5JPMA 4P3WA 2M2DA 1EVUA 2IALA 2X4TB 3WKML 4HZLA 2MCG1 3MBXL 2AXGA 4DWHA 3QCVH 4GW4A 4OZFA 5DJXB 5JXAL 4JN2A 4MD5A 4K7FB 5T3ZH 5B4MD 4XZUB 4HLZH 4XP9L 3LRHA 4F37F 3FZUC 5CHNA 1EO8L 3PABB 5MEOA 2B4CL 3QCTL 4ZUWA 3KPPA 5IHUL 2BVOB 1F13A 3S9DB 3PWPE 5IEHB 2HT4C 5ELIA 5GGRA 5CBAA 3WFDH 3I6GB 3P4OB 1YEIH 3MUHL 3AS0A 4MAYA 4NKMB 4EI5A 3JTTB 15C8H 2ZG2A 1RUMH 4DCQB 4PTTB 2JIXD 5EB9A 2AGJH 2Y5TB 2FR4A 2VLKE 3MRFB 4YFDB 4P2OD 4KUZL 2W9DH 3V6ZA 5HYFA 3BWUC 4LDLB 3ZDXE 2YA0A 1OSZB 1PLGH 3THML 4KI5D 4LHUD 3T1WA 2G5BA 3ETBF 3VXPA 2VLJB 4KJWD 4MD0A 2H26A 2ICWI 2CLRA 4RGMB 1OLZA 2KUTA 3KXFA 3RWHA 3K0WA 4RMRA 5F1IB 3GJFB 5IW3A 1F6AB 3KLAA 1U8LA 1D5XB 5C0IA 3UTTA 4UT9H 4MNQE 4IOSD 3UBXA 1EK3A 4G9DB 3VWJD 3QIUD 3TPKA 1OGAA 3BQUC 4NSKB 4HUVA 3ARZA 3H9SE 3OF6D 4I3RH 2F54D 4YDVA 3U4AA 4MCZA 1QTYT 2A83B 5DO2D 1T22A 4HGWA 4M1DH 5T5FH 4D0BB 4WI7A 2DQDL 3DSFH 4JFHE 1A6WH 3QAZC 3PUCA 3P4NA 1M4KA 4XPAL 5JXEA 2X10A 2HFFA 4KMQA 1F00I 1X6NA 3FCTA 4M43L 2HKFL 5IBLC 2D9CA 2WBJB 5JW4Q 4WV1C 1C5DA 2YD4A 2Q6WB 1GC1C 3JV4A 5L2JB 3J8F7 2Q76A 4N1HB 5D1QD 2F54A 5E8OB 3RKDD 1HOCB 4BUHA 1YNTB 4ETYA 1BOYA 1MQ8A 5CMAA 1RJYB 2CPCA 3C8KA 4MQ7B 1S7RB 3FO0L 4LIQL 4JJHA 4HXAL 4NQEA 4FOMA 5DRWA 2VDQH 4H20H 3CK0H 1A8JH 3PWPA 1UZ8B 5E8NA 4FNLH 3N06B 5I8KL 1JN6A 1FCGA 3RVVC 1EFQA 1SYSA 3CH8A 3MACL 4XBGB 3S97C 4DEPB 3W82A 2NTFA 3WDJA 1EV2E 1I9IH 1I7UA 4Z5RB 4HXBH 2DS4A 5C6TH 4GXVH 4XVSL 4ESKA 2AKRA 2B39A 4NRXA 3VRJA 5FM4A 2VNCA 4QRQA 1UVQA 1CVRA 3SKUD 4LEOA 4OLYH 3W9DB 1TVHB 1Q72L 1FLRL 3QQNA 4R8WL 4HMCA 1S9KC 4WO4D 3IRZA 4WW2A 3SGEI 2HTKC 5F9WB 3TBTA 3QDMB 4PRPA 1QBMH 3BP4B 3WIFB 5I0ZA 2R0ZL 3ESUF 5AD0B 5IB1A 5HHPB 3HC0A 4ORGA 1OCWH 2EZ0D 2ZUXA 3S4SG 1QP1A 4JCMA 5J12C 5IB1B 5CP7A 2X4UA 4YE4H 1JZ4A 4FQXC 1SEQH 3O4LA 4OLYL 1FV1A 5EORL 3MGTB 1CFQA 1GHFL 2VSDA 1ZLWH 4CADA 3H9SA 1IAKB 3O9WC 4J1UB 3KYKH 2VKWA 1QD0A 1HEZA 5M94B 4X5WB 4M8QB 4MD5B 5T3ZE 2AEWA 4OI9A 2FD6H 5FKPB 1MCSA 1RMFL 1X5IA 2QSTA 5MEND 2DQUH 5MHSE 4KRLB 4HWBL 3C5SA 4OFVA 3HE6B 3SKMA 5C71A 5F7HA 2BDNL 1AFVH 4NT6B 5FGCE 2OI9C 1XGRB 1HDMB 4HJ0C 2XA3A 4LRNL 3RTQB 4K3JL 1GCFA 1YYMH 4LVHC 4S1DD 1W72B 1UEYA 1G9NL 5SWQB 2VXTH 1BOGB 1DBAH 1MVUA 1ZEAH 2F54E 3LKQA 2PF6A 3TO4B 2HTLC 2OJEA 4F58H 3WIHH 1ZT1A 4LDOB 5ALCH 1DQQB 6FABH 1XIWB 1RZ7L 2P42B 2Z92A 3LN4A 4I0PD 4E42A 4P2OB 1ZT4B 4PG9B 3TWCH 3TBTB 3F5WA 4J6RL 1OAKL 3VD5A 5DURD 1D7FA 3NCCB 3VFOB 5E6IB 5D7SL 5F7EL 1HHGA 2WBJD 4BQCA 5IV2B 1IGJB 3IDXL 1PKQB 1Y18A 3RY6C 1W8OA 4X6DB 4NN5C 2ZJSL 3DOSA 2AK1L 1K4CB 5C07D 1J9CT 2J88L 4HIIA 5CWSB 5BQ7A 2CK0H 2P5WE 3BOVA 3RWDA 1JZ7A 4JFHD 1OAUL 3QNXB 1JF5A 4PRID 4JFZH 4XXDA 3LH2H 3VFUB 1S7SA 4WWKA 1E6JL 4WHDA 1K85A 4QHMB 4X9HA 2ID5A 2VXTL 4XI5D 3TWCL 4CVXB 3I50H 1CE6B 2X4SA 4GRWF 4WHTA 5FA3A 1UM4H 3CX5J 3P9MA 3BEWB 1WV7T 2KL6A 4UIKL 3FONB 2DTMH 2FLRT 1LP9F 3RGVD 4QRUB 1QG3A 4QRRB 3WV0A 1A1MB 3WFHB 4OM1H 1G7QB 3ARFB 4TUKL 3EKCA 3VXMA 2ITCA 3QUKB 4LVEA 1H8OA 5F9AC 5D8JL 4L3CB 2FX8H 3IJHB 4WGVB 1NC4A 4YHML 1G9NC 1K6QH 1X6LA 2FO4B 4OGYH 5C1MB 1REIA 3STBA 1K5NA 1DUYB 3S35X 2HJFA 2AABH 4ZPVA 2ZOKA 1JPGB 1BLNA 2A1WL 2D0HA 1QRNB 2PO6D 2OTUA 1N59A 4D9QD 5AWNL 2YD8A 4KV5F 2NW2A 1RZFH 5C09B 5JDSA 3HAEG 5FGBA 3I85A 2X4NB 5JO5A 3TBYB 1DUYA 3RY5A 4JRWA 4MWFB 3BDYH 4XP6L 2F8OA 1L9MA 4J6RH 2XKSA 1WCBB 4Y4FB 4GXUN 1J5OL 1H3PH 1V8HA 1OW0C 2R4RH 3MV8D 4NQTA 5EOCL 3F6IA 1J0ZA 4CRPA 5BV7H 3DYPA 2AJUH 1CTNA 1DDHB 3ISWA 4FQXB 5C08E 4TSCH 1MFDL 5D8JH 2XRAH 3RWJA 3UBXG 2EXYD 3N0PB 5KN5A 5C0DB 2BNQD 3MRIA 2VZTA 2VOTA 4G6JH 3HAEA 4GRWB 4NKDB 1P7HL 4M62H 4LASH 1G7IA 3ZKMD 3B9AA 4BFEA 5FYKE 5DFVC 1F2XK 25C8H 4JRYD 3ZO0A 4PP2B 4Q9RH 5IJVA 3IDJA 3QXWA 1YEFH 1MFAH 3PDOB 5DVNA 4KHXL 4F8TA 4U3XA 2FWOA 4NC1E 1AXTH 1NCCH 1AO7B 4JPKH 1TNNA 5ILTL 5JMRA 3ZT7A 1U2CA 4HKXA 4Z78A 5I71B 5C0RL 3TZVA 1S7TA 3DROA 3ARBB 5L8KB 4GS7C 5EC2B 5DHVA 2DMKA 4OZGB 1WWCA 2Y36L 5DJZB 5MP6H 2YEZB 1AGCA 4K55A 3CXHK 1G7HA 5JQHC 4X4ME 4WEBL 1MPAL 4JZJA 1KIUA 3GMRA 3GBLA 3MRGB 3EUUA 12E8H 4TRPH 2UWEE 1GC1L 2DIBA 4Q9QL 3DTXB 3OKNB 1D6VH 1A3RL 4AG4L 2P45B 4POZD 3KNBB 5J1SC 2VTFA 4MXVF 3SDDB 3ZDYF 4JR9L 3LKPB 1KTDB 4QGTA 4ONHA 5C0JA 2YD5A 1MHPH 2VXSL 2V5RA 3IB4A 3EW3B 4HIXL 2EDWA 1N4XL 4QHMA 1HQRA 4UV7L 3ZE2F 1A7OH 1RI8A 4H1LA 2CR6A 1CDIA 1OGAE 2M1KA 5GS0L 3JTTA 5GGVH 5BXFA 5GRYA 1B2WL 1UXWA 2HWZL 4XP4L 2OLDA 4NZTL 4N1CA 3Q1SH 2OXHA 3GZKA 4JRYB 4J3SA 4MVBC 2CMRH 3C8HA 1A7RH 2AGJL 4LU5H 5IFHH 1J88A 4OZIF 1HHIA 3ZDYE 2H2PD 4PJAF 4BH7A 2YXFA 3VXUE 1YEIL 5CSGA 3CPLA 4Q9RL 1MHPL 3AMKA 1D3CA 1Z0NA 4Z7VA 4YBQC 4NZRH 1FV1B 2X1WL 1CGSL 1PG7W 1CGTA 4OIIL 3VXNA 1U3HA 2QADC 1QFUH 3GI8H 4OCSL 2FO1A 2FBJH 4P23B 4WNQA 5E2VH 4GRMB 3LDBB 3OXRB 4PJ8B 4NC0B 3UROR 1N4XH 4F7TA 3JSSA 4LEXH 1P2CB 4UUJA 5B8CC 4S1QL 4JVPA 2Z93A 1KPUB 1VFBB 3OKEB 1YN6B 3O11A 2Q8AH 1AGBA 5DMJB 4N90E 2DWDA 3PF2A 1T0NB 3DXAA 1BFTA 3MYJB 1EZVX 2J6EL 3MX0A 3KLHD 3MRHA 5C09D 4G3YL 1FYHB 43CAB 3ULUC 3WHE1 2ORBH 3SQBA 1JNHB 5HPMB 4X4XA 1JZ8A 5DJAA 3WUWB 4M00A 2IG2H 1Q94B 4RMVA 5DTFB 3ALPA 2G60H 1M7DA 5GSVB 2XN9A 5DMGC 4H1LB 3RWCA 2WK2A 4Z7OE 3RTQD 2DQTL 2VLRD 5IT2L 2Q86A 4HUWA 4PRPE 4RGOH 5DQ9B 1SVCP 1UXWB 2V5SA 4NQEB 1RK0B 2R0WH 3IS0X 4R4ND 1MHEA 4H8WL 1I1AB 4FN0A 1RUAH 1FL3B 2DI8A 4BZYA 5C7XH 4G43A 1AE6L 4CDHA 2OSLA 1F58H 3RHWF 1OTTC 2W38A 3A67H 3H0TB 1H0DA 2ZUTA 3VH8G 3CSPA 1YNKL 4A6YA 1IZKA 3O8XD 3ZDXF 4PTUB 5KSAA 1BF8A 3PWNA 4K9EC 2QHRL 5FV1L 1X7QB 3CU7A 1CD1A 2VLMD 3QXDA 3ARBC 4NC1C 1ZLUK 4YE4L 3HS0A 2IG2L 1O7VA 1MREL 5DHVB 3C5ZA 3IF1B 3GRWL 1QYGH 1HYRC 3EOTL 5L2KA 3LB6C 2R29L 43C9A 5ADPH 3U0WL 5F1OB 3RAJL 1FORH 4M6NL 3PWPB 1BHGA 4YHIA 3PDOA 3WYRA 2X4PB 1FAIL 4PJGB 3DO7A 3RGHA 3KLSA 2MHAA 3HZKB 2AV1B 1YY8A 1Q9KB 4PGDB 1JPFA 4G7YH 1Q1JL 3AU1B 5JPNA 4ODSH 3MV9E 4MSWA 3KGRA 5DD0H 1BWWA 2FJGB 3BYTA 3JV0A 4WDIB 2FECI 3LHPH 2G75B 4N9GB 2DF3A 4YHNA 5EA0L 5GGUB 3GB7B 4IIQA 3VDCA 3ARFC 4P48A 3OGCA 2NY3C 5C0AD 3WIHL 4EJ1C 2XFXA 3ZSSA 4U0RC 1NMAL 2YA2A 4Y2DC 3GK8H 1N5YH 2ICES 5EZIH 4W6XB 2OSLB 1FFQA 3FTGA 3GSNA 3JTSB 4FABL 2X4OA 5DD1H 5IF0A 4JO2L 1JYXA 1HN1A 4LLQB 3LHPL 3GSNL 3K8LA 4ZXBD 5DF0A 2Z92B 3LN4B 4E42B 2WNGA 5DR5L 5CZKA 3F7RA 4X7SL 3ARXA 1SJEA 2I60H 3ZT6A 1IC5H 3U82B 3U79A 4X8XA 3MJGX 3TCXA 4Z9KB 4JO1H 4OTXL 4PR5A 5LVEA 1INQB 5J6HA 3A6CH 1A3LL 3DO3A 1G0YR 1FBIH 1NGQL 4HFUH 1KGCE 2XPGB 2C4FU 3RWFB 1K3IA 1MAML 1O0VA 4F9PA 3U7YH 2ICEB 1WIPA 1IAMA 43CAA 3GHBL 4CVXA 1OPGH 4TVPH 5GRVL 1UXSB 4MQXC 2KBGA 3ULUE 4ZUVA 3RVWC 4LKXB 4W6WB 4FQIL 4NUGL 3MV7A 2G2RA 2R9HC 2I60L 4J4PC 3TBVA 4MA8H 4RQQB 2EDBA 2CLVA 4YUEH 5ESQB 3QEUA 3T0AA 4U33A 2YC1A 4XNUL 3VFSA 5I1JH 4FNLL 1T1YA 3VJ6A 3IETB 1UH3A 4M7KL 3BW9A 5GGSY 2EDKA 5T1DL 1BJ1H 2GAZA 4ONGL 5TF1H 1M6OA 4H0HB 1S9VA 4PLJC 5C08A 2DLIA 5INCA 1CFNA 1RZ8B 1MCNA 4R90H 1BREA 4NNXA 5BS0A 2YMXL 1CFVL 2Y7QB 4NUGH 3MROA 4JFYA 4Y2OA 5I1GH 5TE4H 1VADB 2BERA 4L8BA 1WZKA 3WXVH 3ULUD 5EBLA 1MFDH 4R6UA 5DC0A 2PW2B 3KLHC 3FQRB 3BJLA 1S7QA 5GSRB 5BVPL 1U36A 5JXED 1MCFA 2BVUA 2DL9A 2NY1D 2AJXL 4CJ0A 5EBLB 2YD9A 1PFCA 4HQQL 5D93C 3VH8A 4H5SB 4R2GD 1FBIL 1NGQH 2X5PA 3QRFM 4XPGH 3BZ4B 1ZOXA 3VFPA 3IS1X 4XAKD 4KV5E 3EYFB 1I3UA 3IJSA 3TV3L 5FA4B 2OM5A 3MLWL 3OPZH 1BD2D 4P5MB 3TPUB 1JWMA 4PBWD 3MCLH 4MJIB 1U3ZA 2UYLA 4LHJB 4HWBH 1I8KA 1GZQB 1L0YA 1Z9OA 2VQ1B 2Z31B 4OM0H 1XGUA 1NLBL 2UWEA 4ODVH 4ZOCA 3U0TA 5E2JA 2V7NB 5DQJB 2E7LA 5JA8B 2HLFC 4QTIH 4XNUH 2FX7H 3K3QA 3LRSA 4OFYD 3WSQL 2VLRE 2X40A 5D4QA 5J1AB 2IPUG 3FRPG 1VENA 4X83A 4LEOB 3H7BB 4LASL 4JLRB 4AL8H 4Z77A 2VAJA 5KVDH 4MNGA 3BAEL 1F11B 4LCWA 2Z31A 4X5LA 1BVLA 1KJVA 5IESH 4Y0GA 1Z6JT 3KPTA 4L5FH 4LL9A 2I9TA 1ZA3B 4QXTA 2E6QA 1ZV5A 4HDIA 4JPVL 4MB5A 4J3VA 5DD6A 1IAOA 2R23B 1BVLB 1KJVB 5DSCB 1SM3H 4KJPD 4XXCA 4PLOB 3DRTA 1XF3B 3MUZ1 4F80A 5BVPH 1ZE3C 1N3NA 2C3VB 4Z7VE 3I2CH 4Z77B 3PWLB 5EBMA 5MP6L 2FJHA 4OCRH 5L9DH 3BEWA 1MPAH 1QR1B 4HQQH 1CF8H 2A1WH 1UH4A 2A9NH 4YHKL 1VDGA 3PGDB 4TOYL 4YAQA 3QNZA 2JB6B 4ODTH 5IK3A 4C4KO 3QR2A 3UZVB 2WW8A 2Z91B 3ZKNC 2DIJA 4JFPB 4UNUA 5GRZA 4OF0A 4NOBA 1HHHB 3G5ZA 4ZUWB 1T83C 2XKUA 4HIIB 3SE3A 2H2SC 1CG9A 4ZSOE 3DVGB 4FQCH 5FYLD 5F7MC 4Z7VF 3GSOA 4BK4A 1P4LA 3HB3C 1S9YB 2OQJB 2CGRH 2JJWA 3HCVA 1XGYH 4OM0L 2ADIA 3GMOB 3VXNB 4HIXH 4UDTA 3AM8A 4PY7B 1CE6A 3C9NA 3KLAB 3O2DL 4RA0C 1BQHA 5HHOB 4ODTL 2HG5B 3P4LA 1Z0MA 2I26N 1JHKH 4NZDA 5HGHA 2HT2C 1INDL 2Z4QB 1UT9A 1J05A 1R3HB 5A2IH 1LO5B 5HPOA 5DGRA 1UENA 4RZCA 4KQ4H 4R2GB 1S7QB 3I3EA 5E2UH 2DWDB 4TULL 5EU4B 5C2BL 5D71H 1KYOK 3PQYE 5D1XB 5BOPA 3U4EA 3BDBA 3WNLA 3BDYL 4XP6H 1T80A 4ZS6D 1JNHA 2ADFL 4HS3A 2WIMA 5D7IA 3QEHA 3QUZB 3B9KC 2XYCA 3C60D 1JHKL 4L3ED 3T3ME 3TFKD 5EN2A 3RVTC 5E00B 3DX9B 4AM0B 4P9HC 1JGDA 1LO3L 5DHVH 5SV3A 3OZ9L 1KPUA 1V3KA 2HT2D 1CZ8L 5INDA 3B8SA 5JLZB 1KACB 2QHRH 5J6HB 4F57H 2EDHA 2QQNL 3L3JA 2PYFB 5CEYB 3TNNB 3N1QC 1RK1B 2O5XH 3W2DL 3HMXA 3L3GB 3OKEA 1VFBA 5F7KC 5JDJA 4M9PA 4YWGH 2GCYA 3OAYH 1I1FA 4PJ5D 1NMBH 1T83A 2DKSA 4LSVL 1IGYA 4KUZH 3L7FA 2W9DL 1IGIL 3X3GL 3BESR 3CCHA 4EUPB 1L7TH 3DPBA 3MRLB 2GCYB 1IE5A 2LU4A 3P30H 5INDB 1T1ZB 1NFIA 5GS0H 2Z8VC 2BRQA 2VZVA 3IDJB 1CDGA 2PYFA 3BEVB 5I1HL 1WITA 1IEAA 5IB3B 4PV8A 4HH9B 1S7WB 3HPLB 5TQ0H 4ZG1A 4XP9H 1J8HE 2ZKHH 1JHTB 4O58H 3W9EB 4OZ4A 5B38A 2Y36H 3CVHL 2CRZA 5B3NA 3FQXA 2BVQA 2ZCHL 3QCVL 1CFNB 1RZ8A 1HQRB 5JXAH 1FC1A 1LD9A 3D25B 2XZQL 4JFQA 3NBNA 5KS9B 2MHAB 4NQDB 3MRGA 2WBJA 4J7RA 1C1EH 4M48L 1IGCH 2AEPL 3T0EB 4B7IA 5FO7B 2CXGA 5I1AB 4U4BA 1T66D 4X7SH 3HMXH 5ITFA 1JL8A 4IRJA 5K9KA 4LFHD 1JPFB 2NY4B 1QO3B 4QRPA 5C0EB 2E6PA 3ULUL 4AMKH 4HGKC 4DQOL 2YPLE 4JREC 5C0JB 1PZUB 2P5WD 5GGSB 3O9WD 4EOWL 2NTFB 5D5MB 4QGYA 5IVNA 3CDFA 4OLUL 3VGGA 2DQTH 3CFJA 2AEPH 1G7MB 1MJ7H 4PBXA 3TT3L 3MV7E 1TTGA 1ERNA 1LEGB 4KJQD 4GG8B 1G7LB 5T1LB 3WCYA 5AYUL 4PY8J 4RNRB 4ZDHB 3EDDA 3TVMA 4WWKD 2NZ9C 1X4ZA 3U9PL 3L1OH 1DANU 1MWAH 4M48H 2KDGA 5C0EA 4GG6F 1LK2B 2AXFB 1D5BB 4MNHB 5LJYH 5ANME 5C0CD 3QQ9C 3QDGA 4N68A 4D9RD 4CJ1A 5KSBE 5CGYC 2NXYC 2X9YA 1L0XA 3MRFA 1KEGH 4A6YH 1OP3H 5C0IB 2WUBL 3X12B 5IVZB 3BRFA 2DQCH 5DWUH 3KPRD 1AC0A 1IC5L 3NABL 5FHBL 3RIFF 2OR9H 3BPNC 1TJHL 5SX5H 2BY1A 1MCOH 1VFOA 2KZ1B 3ZE0F 4X6FA 4OTXH 3T0EA 4R90L 2X6MA 2HKHL 1MWAL 3ULSB 1K4CA 1YJDH 2NY5H 4XP5H 2EH7H 3H42L 3NACL 1CD1B 4R96A 4JY5L 1O5DT 2MCPL 2P5EE 4PRHA 2PTTB 2FYYB 3EJYC 3JBG7 3E6HA 4WCYH 5E95B 1MRDH 1NJ9A 4XWOC 3ZKXB 1FIGL 3O6ML 1AE6H 4PJIE 5KSBF 5I66B 1W8NA 3NFPB 5D7LD 3BDXA 3H9YA 1QBLL 3M8OL 4OFPA 1XF3A 5A43C 5HVWA 3MACH 4OQ1A 1YNKH 2YZ1A 2YD6A 5IHLB 4PTTA 3KPLB 4E5XB 2FR4B 1BOGA 1F4HA 4Y7MA 2VISA 3Q48A 4ODUA 5GGQH 4HUXA 5BZDB 3G5VA 5ACMA 4BH8B 1EAJA 2EH7L 5JDSB 1XF5B 4RFNB 4F7TB 4I4WB 2VXQL 3IFPB 1MIMH 2AEQL 4XB7A 3AS1A 2E9BA 5TPWL 4KGJA 5EUKA 4GAJH 2R0LH 5FKAA 3QJHB 1KELL 3LB6D 5GRXG 4M3KB 2DQDH 1FVCB 3DSFL 2F58L 3SN6N 4P59L 1MFNA 1KJ2L 2ZOLB 1M7IA 2GFBA 4PTUA 5KSAB 3KPSD 1VACA 3GGWB 5E70A 3TBWA 4KDTC 1F4AA 3IDXH 5HGDB 4Y16A 4CBPA 2HVKB 3ARDC 1KJ2A 2PW2A 4P5KB 1S7SB 1ZVHA 4PJHB 1L0QA 3BMVA 4CAGA 3WO3B 1M1SA 3O3DB 4K94L 4P5TB 1B6UA 2A77H 1S7UB 4QXGH 4KRNA 3K46A 5KZCB 2H8PB 2VDQL 3U30B 1EXUA 5BS0D 5C0BB 3ZL4L 1XAUA 3C6LB 1OWRM 3I9GL 4DFHA 1VGEH 4LNRB 3WBDA 2P8PB 5FKPA 3V4PH 2VLJD 2W0PA 3VRJB 3GIVA 4JCLA 1JZ3A 4PJ9B 4OFIA 3UTOA 5FHAL 1JYVA 4LQFL 4FXLA 4Y4KA 1A9EB 1D9KB 3G6AB 3X11B 4I77H 3O0RL 3IFPA 1WVZA 1QEWA 3C5SB 4Q6IC 5D1XC 1U3HC 4OZHF 3KPSA 2CLZB 3ZL4H 5D2LA 1QFWI 3VGAC 2ESVE 3SJVB 3P0VL 4M4PA 1NAML 2Y9RT 3KPRE 3OR7A 3FZUD 1FFNA 4F7PA 1B0GB 4JFFD 1RIHL 3VXSE 2ICEA 4QOKD 2ZOLA 2CLVB 5ESQA 5GGRY 1WTGT 1MAMH 2EYSA 4HF5H 1XGRA 3O4LB 3RQ3A 3CSGA 4HKZA 1T5XB 4LF3A 1KN4L 2XKNB 3G9VA 4MLSA 4PJ8D 3IT8D 4KTDH 3H7LA 2CDGB 2DLFH 1JWSB 5C09E 3TZVD 1FVDA 4D0CA 1ZGLM 2EDQA 5C70A 4I0PC 4HIJA 1G7IB 4UT6H 1ZGLB 1G9NH 1HNFA 3QUXB 4Z7QF 4UOW1 3I75B 3RKPA 2GK0A 4U2ZA 1VPOL 3SGKC 5CLTA 1ORSA 1BP3B 4FQ2H 1PVHA 5IUSA 4PGBA 3CSYB 2K9UA 2VDPL 5E5MB 2LFGA 4HUNB 5TF1L 1RZJC 3L3KA 2EC9T 4TUKH 3QO1B 1S7VB 2IH3B 1N0XL 3O8XB 3CDGB 1U58B 3EYQD 3B9DA 2KQNA 4Q6IA 3IFNH 4ZQKA 3C60A 4L3EA 4W81A 4PB9H 2CH8A 35C8H 2E9IA 3JV5A 2Z9TA 2A6KA 3V6BR 5IMMA 4Z7UF 2DM7A 2GW5A 3X17A 3EGSB 3NFSL 1GZPA 3WFHA 1KIPA 3FRPA 5I1DA 1J1XH 4M5ZH 3W0WD 5I71C 1IQDB 4CU7A 2IANE 8FABA 3DVIA 2PUQT 5B8CA 1MI5D 4EUPH 1ZTXL 2RFXB 4RGND 4ZFZA 5HGHB 3GSUB 4ELME 1ZA6A 1DBMH 4PJ8C 4HF5L 1YN7B 2X4NA 2UYLB 3UYPA 5B8CB 1T89C 1YEEH 2MTPA 5DJDB 3KDMB 4NQSA 2FHCA 3DUSB 2Q3ZA 5E8NB 5D96B 3RVXD 3UJTH 1FN4A 4LDEB 4X8JA 4FFYH 4H5SA 3VXSA 4MXWL 3TVMB 5FYLH 5CKGA 4QRRA 3Q2CA 2FX8L 5GHWL 4GKZB 3INUH 4MD0B 3RU8L 5A2KH 5AAWA 4LLYB 3QUXC 3VRIA 3MMEB 1T3FB 2VAAA 1C08B 3IVKA 1I9JL 4FTVD 4NHUB 1PSKH 4I9WD 4ZS7H 5GS1C 3RWJB 1R5IA 1IAOB 1KC5L 5KW9H 4HK3N 3JUZA 3MRNA 1MCWW 3IDGA 2QR0A 4NKQB 2HWZH 4GMTH 4XP4H 4NZTH 4NGHL 3RNQA 5DQ9A 4F15C 4HUVB 5HI5C 1JJUA 3C5ZB 1P9MA 1RJCA 2I5YL 1FSKC 4NFCA 4QHLB 5D1QC 3RU8H 1T22B 4HGWB 4FQXD 4Z8FL 5HHXH 1VEPA 1T1ZA 4Y89A 5IVXB 1OTUC 2DI7A 3FFDB 1I3GL 3HRZB 1RUQH 5I2IA 1ZMYA 4ERSH 5B38B 1EUTA 1EH9A 5TDPA 2WWKT 1DQDH 5HVGB 4HCRH 1D6VL 4HWNA 5DK2A 2IPKA 2A73B 2EDYA 4HGMA 3OXSA 5B39B 1ULVA 2B1HH 4PJAA 4DK6A 3D25A 2B5IB 2OJEB 3FN9A 1RZIB 4U6XB 1SM3L 2NMSA 4L3EE 3L3JB 1OGTB 1XEDA 4G8EA 2Q8AL 1IFHH 4ZO8A 2ZCKH 4PJXF 3R8QA 3QXAA 4Z8FH 4WRLA 4P46A 3NTCH 1LD9B 5JMOC 1NDGB 1BQHG 4Z7WA 3U6RB 1JHTA 1IVLA 3HC3L 1IGYB 4JM2F 2AJVL 5AAMA 5DRZB 1NDMA 1NCCL 2BSED 5DUML 3VFMA 3C09C 4NWTL 2WLZA 2GTWB 5I73C 1LO0L 2XKNA 3TYGL 1KEML 2D7OA 5HDQL 1CL7L 2YUVA 1KBGL 4PJEF 2DM2A 2MKWA 4XZUA 3V6OE 1OARH 1EBPA 3L6FA 1F58L 5HJ3A 5BXFB 4N8PA 1Y18B 1QLEH 1I85A 4PRIB 2X7LA 2AK4B 4Q9QH 2DQCL 4MMZC 3KPNB 2E8YA 4HHAA 1R0AL 4GSDH 1EHLL 2BY0A 3C9NB 4HUMB 4U6YA 5FFLA 2VDRL 4XMKL 4L4TE 5E1AA 3CFIC 5K93A 4LVNB 1HH6A 3S3JA 4AG4H 1AY1L 1NH6A 1YEDA 2EE2A 1A7NH 4Q74A 1RZIA 3B43A 1G1YA 4JFDA 2BC4B 3X3FL 5MERB 1Q9WA 2WANA 4YFLI 3UBXI 3NCJL 2B1AL 1TJGL 4G9FB 3TNMB 5KVMC 5FUOH 3VFNA 4NP4L 3T2NH 1AGCB 4FQHA 5I1HH 5K9JL 4XP1H 2ADGA 3B8YA 4OAWA 1IZJA 4RDQF 5DLML 3DHMA 1P6FA 5FYLE 5JOPD 2A0LD 4X98A 4UT7L 5D72L 5HHME 3TEUA 1MCLA 3MCKA 4KI5C 3KAAA 4OCXH 1Y6KR 1YQVH 5EOTA 5F21B 2QSQA 4F7MB 4MJ2A 2BSSB 4MAUL 5BV7C 2ESVD 1FJ1B 5BCAA 1QRND 3ZHLA 1IGIH 3X3GH 5DHYA 5I73B 1TQCB 2ZUQB 4Z7WE 1AH1A 1AHWA 3ULVH 4M7JH 4OT1L 5DD3L 2Z8SA 4LSPH 2AVGA 3O6MH 4DK3A 4MCZB 4QOKE 1AR2A 2R1XB 4XBPA 1SYVA 1KPVA 2OI9B 3EJZC 2D03L 4JN1H 3GM8A 1OGAB 2MCPH 2X1OA 3T2NL 3WO4B 5EUKB 5I6XB 2A83A 4MD4A 1ZLVK 2J3SA 2VITB 2VN7A 5D1ZA 3GFUA 5MHSD 1VB9A 4KGLA 3T4AB 5KVFH 1S9WA 3LS4H 4M8VA 3H8NA 4PJIB 3CVHH 4RSVA 1M7DB 4HWEL 4UBDD 2FCBA 1W0WA 4WW1A 1YYLL 5DI8B 4L9LB 1NUNB 1CGUA 4PGBB 3MRMA 4I0KA 1D9KD 4JY6B 4KHTL 4NN5B 4LVOC 5H8DA 2XN9B 1TZIB 3SDDC 1BFOB 3ZYZA 5I66A 5T33L 5CJBA 1U8KA 1KCVH 4QCIA 4LSQH 2PO6A 3OKMB 1L6ZA 3LV3B 3EAKA 4NN7B 3O41B 4UNVA 4QOKB 5ISZB 2EEDA 4PJ9C 5JQ6H 3X13A 2DJUA 2ZSWB 4PJ7A 2ZSVA 2CXKA 4NQCD 5H2BB 1P5UA 3PGFL 1ITBB 4Y19D 1B6DA 2E5EA 4FABH 5IEKB 3RP1A 5E2TH 3HUJF 3UTTE 1SY6L 3GB7A 4N0FA 2XY2A 2BFVL 1MOEA 4X6DF 4NRZB 4PJ9D 4MAUH 3SDAD 4NO5B 1GOGA 4K7FA 5FK9A 3G6JB 5D2LF 4LP4A 4EIZC 3BGMB 4K94H 3QFJD 1AIFB 4ZFOL 1XFPA 4JZOA 4I2XA 1QFPA 2A77L 4QXGL 4NN6C 4FQQA 3R1GH 4G6ML 4NM8L 3O6FB 1JBJA 4NQXA 2DICA 2R1WA 5TH2B 4YJZL 4YGAB 1S9WB 3QUXD 4QY8B 3PL6B 3RWEA 1MCHA 3HE6D 1EXUB 3TIDB 5JNYB 3DBXB 2BCKA 4H25A 4TTGA 4M7LL 4GG6E 3IDYB 1UB5A 5E9DB 3L1OL 3MRMB 1IC4H 3EO9H 4GQPH 2HMIC 4JG1H 1F45A 5E6IA 4WY7H 2WINB 1LWRA 3H6JA 4AYFA 3VFPB 5SX4I 1NQBA 3UMTA 5TPWH 4HMDA 4MA7L 1CFTB 2DRUA 4LRNH 2RBLA 3CVHB 3O3BA 4APQC 5IWLC 5DDHB 1F8TH 4NM8H 1GIGL 3BUYA 1ZEAL 1I9IL 4NQCE 3QFDA 3L3DB 2YPKA 3CLEL 4RGMC 1VFAA 4FMFA 1HYSC 1DLHA 4ONGH 5SWQA 4HC1H 1AGDA 3C5JB 3TBVB 1H5BB 3ET9F 4TTDD 1FJ1A 2M26A 5GSVA 1IGJA 2PYEA 1P2CA 1HDMA 4UUJB 4KRPC 3RTQA 3MV7D 3BE1L 4R97B 2Q1EA 2YEZA 1X4XA 3S3PA 5E2TL 1NGYA 3LOWA 5DJCB 1QZ1A 4PGCB 3CH1B 3MYZA 5ENWB 2WSKA 3T04D 4KKAC 1K8DA 3U7YL 1OSPL 1YEEL 3SQOH 1P84J 3BKMH 3L3OA 4L1HA 4WUUA 3LZFH 1JF1A 2XPGA 2XN9D 1CLOH 2DLEA 2HVKA 3REVB 3RZCA 3KS0J 1EEQA 3DV4B 1FC2D 4RGNC 2I07B 1EUUA 4I2XE 3MUJA 2HRLA 5EO1A 1UXSA 4OD3H 4ORGB 2WZPD 5C6TL 1D5IH 3H3BC 1J1XL 2VL5A 3OAYK 1UJ3B 2Z0BA 3TC9A 1WCQA 1NEUA 4PY8I 1V5JA 2FBOJ 4G6KH 4OLWH 1AC6A 2Q7YA 3BKML 1JMXA 1CXEA 3DARA 3FB5B 4WU5B 2IEPA 4DKAA 1DLFL 1MCRA 2VL5B 3OMZA 3MGTA 1MIEL 1W72H 2H6PA 3VDBA 3P9LB 3IDMA 5CJOL 3E8UH 4XHJD 3DUUB 1BVKB 1Y0LA 4OUOA 2FJFB 4ZPVB 2HYMA 3QUZC 5ALCL 4N8VB 1QSVA 5LBSH 4OJFH 1FSKB 4IHOA 4YDJA 5D1QB 1U3HD 4U1GC 3MRNB 1T7VA 3ILPB 2IFFL 1A6TA 1AXIB 4PJBE 2P24A 3OSKA 5EZJA 2VLLB 1TVHA 4KJQC 1X9QA 3WIFA 2C9AA 4R0LC 5JOPE 4QHLA 2FSEB 4QHUA 3WHE0 4NQCA 2BOBB 2V5MA 4NCDA 3MNVB 3LRSB 3NMEA 3BQUA 2EE3A 2NX5A 3B2VL 4RX4A 4XVUC 3HZKA 3R4DA 4DAGL 5BV7L 3NTCL 3VWKA 3V7AE 5F7UA 1SBSH 4MZ2A 1DEDA 4DGYH 5DJ6A 1B0RA 5E8DL 1RY7B 5D1XA 5F7WC 3UYOD 3NA4A 1LP9E 3I2CL 4HUUA 5GIRB 1GC1H 3S36X 1SJVA 1P1ZB 4P4KA 1CWVA 4Z7UE 1XGQA 3MGAA 4PYGA 4JJ5B 1WAAF 4Y5XB 5D9SB 2OL3L 1A4JA 1L9NA 4NZJA 3BZFA 3OL2A 1I75A 2JB5H 4PGEB 1DQDL 1ORQA 1NAKH 4KKBD 1RIUH 1SJHB 4U1IB 5I2IB 1ES0A 5TH2A 2B1HL 3ARGB 1ZANL 5IHBA 3LKOA 4HZAA 5CCKH 4KXZH 5ID1B 2NY2D 4NDMA 4ZUTB 3AB0C 3LQMA 4GKNB 4WI5A 4OGXL 3ZTJH 4ZTOL 1KLUA 3B2UC 3IXAA 1VFAB 4NCC2 5FYKH 4FFWC 2FX7L 2GY5A 5IQ9B 2JJSA 4LU5L 1KTLA 1IEBB 1X5AA 5TFSL 1KOAA 2QQLH 1JPST 2YRPA 2FGWH 1QRNE 1VERA 1HSBB 3VI3E 1P4IH 5IV2A 4CU6A 4CKVX 2F53D 1JI2A 2X7LB 3G5XB 4UIKH 3S98A 4ZSOB 2H26B 3V7MA 3BWAA 2UWEF 1T4KA 1CE1L 3HNSL 3QQ3B 3FT4A 3D85D 4XWOD 5F1NB 2UY6A 3OB0H 5ID0A 3HI5L 1ORSB 8CGTA 3PGCA 2VXUL 5E24E 1WBYA 4YDKL 3T4YB 1U6AL 4JRXD 1GAFL 4LSSL 5GS0D 4ZYKB 3RVWD 1HK6A 2W07A 1T5XA 4K3GA 4HPYL 1MFCH 2HFTA 4E0RA 2VDRH 1KSRA 5E8DH 2ORBL 4M5ZL 3K80A 3PP3K 2XA8H 1KIPB 1UWXH 5A16B 4LPCA 1UJ3C 1OAXH 4UBDC 5C86A 1MAJA 3EDFA 5IMLA 1YMHA 3FQUA 1EHXA 3VG0L 3B9KD 4R4BB 2OMNA 1H15B 2EKSB 5IKCA 3S35L 4XMPL 5CHNB 3C2AH 4ODHH 2FIKB 4DUWA 3RWDB 4HZLB 1AXTL 1KLUB 4BH7B 4I13B 3IXTB 1P7KB 2BK8A 1SJXA 2UVEA 3RDTB 5KW9L 4JVWA 3A67L 2LE9A 3WO4C 2VN4A 1OF2B 4WFED 3ESVF 3P9MB 5TE7H 1Q0XH 2HA1A 1YDPA 1I9JH 1OAYL 4MA1B 4OIAA 2PW1A 2FEDC 3MRQA 1EAPB 3VD4A 4X4YA 4AT6A 2MQ3A 3HCVB 1S9YA 2J4WL 2OQJA 5B3JF 4Y88A 1SYSB 1CGYA 5AZEL 4CMMB 2YPKB 4HK0B 4H0IA 2E7CA 4JFOA 5CSZA 5K59F 4LSQL 1J8KA 1DQLH 4YHPB 5I1EH 3TA3A 3FN3A 1QSEE 3VFGL 3D0LB 4M9OA 3WN5A 1FORL 3UYRH 5K9QG 3U46A 4EI5C 5J56B 3L5JA 2Y07L 1WTLA 3IDNB 3VXTB 2SEBB 3D0LA 1IFHL 2EDTA 1TETH 2J6EA 3BD3A 4KAQL 3ABZA 4OSUL 1F02I 1IGFH 1KJMA 2UY7A 2B20A 1N6UA 3T3PE 2AJYH 1XF4A 4H8WC 1J8HB 4IMLB 5D1XD 1ND0B 1EBAA 5E6ZA 3CMGA 3PHQB 1CFSB 4S0SD 1OQOA 4MS8D 3WDHA 4YHOL 4UT9L 2R15A 4MJ6B 1VACB 1QRKA 4JRYE 3UTTB 5I75C 4KRPB 4LBEB 1A6PA 3K4ZA 4GKSB 1NMBL 4HIHB 5CKAA 1DEEA 4L8SC 4KPHH 5F71A 4NQDA 3IJYB 4F9LC 1HH6B 3T09A 5CJ8A 3HTLX 4D0BA 4UILL 1A2YB 1S7TB 4K8RD 4N0YH 2C1OA 1UCTA 1BX2B 3T3PF 1MLBB 1KN2L 1CICD 3M8OH 5E4IA 2MPAH 1XCTB 4M43H 4PP1D 1U8HB 4G9FA 2ZCLL 1NCBL 2DBLL 3G5ZB 1A7OL 3DXAE 2AQ2A 1T20B 3FTGB 5CP3H 3GHEL 3HR5B 4HK0A 4G3YH 4JZOB 4NUJA 1TPXC 3BT2H 3PGFH 3ARDD 5DZLA 3GRWA 1G9EA 5CBEA 2VLKA 3HE7C 4BSVA 1IAIH 1BBJA 5C0AE 5C8JB 5FB8A 3O81A 2P46B 2ERJC 3EZJB 2BSRB 4LAQH 3NZHL 3OKDB 5HHMB 1F4XL 4AEIL 3S3SA 2XN9E 3I6GA 4A6YL 4G6FD 3GJEB 3PXJA 5DRWB 2XTLA 4X6CF 3RBGA 1KG0A 5IF0B 4LARH 3NA9L 2FJGA 1U91B 1JGVL 1JHLL 2VUOA 1RJLA 4DCQA 1CDUA 2AXFA 2E7HA 3DI2B 3FO9A 3WS6A 2AJSL 1ZLUH 4M5YH 3SO5A 1S9XB 4N0UB 2VLJE 1TETL 4X7CC 2AAVA 3GJFH 5T1LA 3PP4H 1AD0A 3RL1B 5JHLL 1T1XB 1LHZA 4TUOA 5IVZA 3PIQB 4WUUE 5LAXB 2DBLH 3OKDA 4MNQA 1NANI 4LF3B 2YHGA 4OLUH 5CJQL 1P7QB 3BT2L 5J13C 1WJ3A 1OY3B 5JXEC 3DMMB 3TJHC 2D7TH 4LSRH 5F9JB 4R9HA 2VRAA 5EN2B 1AD9A 5FGSA 2QBWA 5KG9B 4PJHE 2WBWB 2AI0H 3LCYA 3X12A 4WNQB 2COQA 4JHBA 3T77A 4Y4HD 4K7PX 2ATKA 2JJTA 3FQWA 4LIQH 1WBZA 3MOQA 3WJLA 1NJ9B 4Y2DD 3MV01 1ZVSB 1TZIA 5I76B 3AY4A 2D7QA 3MCKB 5FECB 1ZSDA 1PX4A 3HG1D 3ZSTA 5DWUL 3MRCA 1Y6MR 5A2LH 4PJGE 1A47A 1MLCA 1FO0L 3LD8B 2YPLB 3BKCH 5CEZE 4WTXA 3V4UH 2P49B 2JF1A 4PJBA 1FLRH 2N7AA 3WFCH 1KT2A 4LLDB 3BP7A 5FHBH 4PUBL 4LAQL 5HGBB 3OJVC 4RISL 1YNLH 2F58H 4PJ7F 4PG9A 3GSRA 1Q0YH 4I3RL 4J3OC 1FL3A 4F33A 1T0MA 4X8JB 4L4VA 3SJVE 3VXSB 1ZT7B 3HPLA 1FG2A 4W4NA 3VFSB 3TO4A 4QEGA 2FATL 5F6IB 3KYAA 3LIZL 5FYJH 3WLBA 4HD9A 4LOUC 3PL6D 3VWJA 1LO4L 3GGWA 3GSUA 3FQXB 1JK8A 1IGML 4AEEA 4EQ3A 3MRDB 1J1OL 1CXIA 2NTSP 3VFVA 4O2FA 2H6PB 4ZTPH 4PRAB 2XZAL 4WO4A 1T7WA 1NGWA 3CAFA 1T6VN 5AD0A 5F3HB 3WSQH 4HH9A 2GAZB 1NC2B 1WFOA 4KDVA 1FVEA 1U92B 2DQUL 3ARWA 3GSQB 1UQSA 1OT1A 2GITB 4LLUB 3O4LE 2XTJD 2P24B 4HAFA 3IFOA 4YPJA 1CR9L 2H9GA 4NZUH 1J11A 2DM4A 4MDJB 2FJFA 3CLEH 1V7ML 2WBKA 1FDLL 1U93B 1R24B 1IGMH 2FHFA 1P53A 4JPWL 4Y5XC 3ROOA 5CGMA 2AJ3B 4PD4K 4DOHE 4Y2DA 3H3PH 2H9GB 5F6HI 3UPRA 4C55A 2D31A 1IGTA 2ERJB 1ZHLB 2VC2H 1IC4L 5DUPL 3KPMB 1DZBA 4KI5E 3HC0B 2Q7YB 1UYWH 2DAVA 5MI0B 5ETUB 3TN0A 3T2OA 1SHMA 3U2SA 5J1AA 2NXYB 4WDIA 4G6AD 5L7XH 5DJYA 4P23D 4M6AA 2MFNA 1F2QA 2V7NA 1G7PB 5GZOC 4OBRA 4Y2DB 1D5ZB 3WJLC 1XGUB 4PJGA 1A22B 3K1DA 4Y4HB 4CVUA 2C26A 1XT5A 2CDGA 1OAKH 4Y4FA 4NZUL 4ISVA 3L5IA 2YK1H 5F9DC 3TPUA 3B9VA 4AL8L 3ZKXC 4PRDA 2G9HA 3KG5A 3BPCA 2YPLD 1CU4H 1FGNL 2EYSB 3D85A 5HHMD 1XGYL 3WNNA 1E4KC 1DTUA 4F9LA 5CD5D 1FVEB 2ZZUT 4YK4B 1TJIL 3U4BH 1PAMA 2HLFD 5L88H 3TVMC 1BBDL 4GJTB 1FZMB 1MCJA 2H8PA 2PXYB 4HX1A 3EJJX 3JWDH 2XWTA 4G8FB 4NKIL 3QDGD 5CINH 2Z8WC 1YEKH 5DDHA 3HPJA 3P11L 2CDEB 2X42A 2Z91A 3ZDZE 5CGTA 1NCNA 4XH2B 1JZ5A 5LG1A 7FABL 1HZHH 2HH0L 4G42B 1YPZB 2EYRA 1KN4H 1CICB 2DTML 3OJ2C 3VGHA 3O45B 4LHUA 2VQUA 4DKFH 4Z7UB 1QSFB 4TOYH 4F15B 2DQGL 1KXTB 5TDNA 5J89A 5IMKA 4BA8A 2F54B 2GSIA 1I8LA 3GMNB 4JM2C 1HHHA 3TT1L 3UC0H 3O9WA 2DQFA 4W70A 4F2MA 4CL7A 3F6LA 5ESVB 5IJKC 3P77A 1AO7D 2BNRD 4M1CC 4XXDB 3F62A 1MFCL 8FABB 5I76A 3WJJC 5L7XL 3V8CA 3RDTC 2IAMA 1LEKB 4GAYB 1E4XH 2LAAA 5F1KC 2APBA 5IBUG 5F6IC 1AJ7H 1UM6H 2ZPKH 4JY4B 4DGYL 2V7HB 1W2KT 3MC0A 4JHZA 1R3JB 3RVUD 3UTZB 5HHNB 2XNAA 1QFOA 3UX9B 5HHOE 5L8JB 3R0MA 2NW3A 2JJUA 4GMTL 4OBSA 1WWBX 4XTRC 4G8IA 5HY9A 3MNVA 1G6RA 1NUGA 1EHNA 1FN4B 2UWEB 3AROA 3ECBB 2NW3B 3FO9B 3NN8A 4M93B 1H8SA 4KY1H 3TV3H 2XRAL 4Y5YC 2W60A 3O2DA 2IJ0C 5CCKL 1J8HD 1KLGA 5L88L 4U05A 3C09B 5IFJB 1RV6X 3ECBA 4J4PD 3T2QA 1GOFA 4GRWH 4XNXL 4JRYA 1N59B 3AMLA 3QJFB 4N8VA 3NCYS 2XXCB 5SWSA 1IQDA 1HINL 3RJQB 1MFBH 2XQBH 1BZ9A 3O2WH 4XPBH 2CSPA 5H37H 3L5XH 2J8OA 2UZXB 2AP2A 3D3VD 3QUMH 3RIFK 3MLSH 4TN9A 4JQIH 4FQ1L 1UWXK 4R26L 4TPRL 2GJ6D 4PJDF 4LLAA 5CEYA 3TNNA 2JB5L 3MLPA 4ERSL 1FNFA 2XZQH 3X14B 1NEZB 1N5AB 1HHIB 2BZDA 2OBGA 3QUKA 2W9EL 5DA4A 4UQ2B 3RWGB 3VE0B 5I74C 2PTTA 2VR5A 3EHBC 1UACL 1MI5B 3TYFB 4HWZA 3GSVB 1WK0A 2Q8BL 5JHDE 4F3FB 1YMME 3W0WB 3X13B 4DFIA 3RX8A 4LFHG 4GMSH 2NZ9D 3HI5H 3IDMB 3QHFH 5F89A 5F8RC 2V2TB 3MOAL 2APVA 1JMZA 2XWJA 4NGHH 2ICWB 3O2DH 4GUPA 4XC3L 5F8QC 2VZ1A 4U1IA 5DT1L 5DEFA 2J2ZA 4GQ9H 4HMEA 3PXHA 3CX2A 2EE6A 3LKOB 3MXWL 3F65A 4XRCA 1FNEB 2IALB 2VQTA 1N2RA 3KYMA 1XF4B 1OAQL 1ONQB 4NNYB 4PS4H 2N4IA 4JANA 4XNMA 4EDWH 3ULVE 4XWGL 5CP3A 3NFNA 4IM8A 2E27H 3CNKA 4NWTH 3WN5B 3T0DA 4G8FA 1ZLVH 4IMLA 4DZ8B 1QNZL 1E0OB 1U0QA 1U8PA 4OKVA 5GZND 5HHOA 4WUKH 1LMKA 1CICC 2QSCL 4ODXA 3ARFD 4RMQA 1CS6A 1TQCC 2HVJA 2ZUQC 3R8BB 1QFWL 2YSSB 1EFXA 3BP6B 1GSMA 4QNPE 4XHJC 1P1ZA 2OP4L 4P4KB 5D70H 4FXGA 3V6FA 1U8NB 3S34L 3HZVB 5LXGL 3L5HA 3QP3A 4IRSB 1YEGL 4PJHA 4TQEH 4OLVL 1EFXB 4UDUB 3OJMB 2OX5A 2VDKH 5ITFB 5D7JB 3RIAK 5IOPA 1G7MA 3QUML 3A6BH 4OKVB 3QSKB 4AEIH 3GUTB 5DK0B 5EU7E 5DFTA 3LKRB 2ARWA 2FBJL 1RIVL 3H3KA 5SWSE 3NA9H 4PRNB 4J3XA 1DQLL 3D9AH 1QFWH 4OLXL 4J12A 3QEQB 4Y16D 4X99B 3C08L 1QNZH 5D70L 3QUMB 1KTRL 1ZHBB 3TT3H 2RIKA 3BP5A 4N0CD 1VGKB 3BIBX 1PLGL 4M7JL 4OT1H 4JDZA 4J3WA 1OAYH 1Q9WB 4UIMA 2FL5B 5CJQH 1YMMA 3MBED 4OCXL 4PRNA 5JW3L 3KYNA 5T1KA 5FK9B 3RA7H 3NAAH 4DEPC 1QQDB 5JORA 3ROLB 1BD2E 1JV5A 1RZGB 4NYLB 4PS4L 2QEJA 3S5LA 3RI5F 1AGBB 4C57C 4EDWL 4XNQB 2XTJE 3C08H 1UEMA 3FT4B 4GBXB 2GTWA 4ONOA 3LS5H 4F57L 4RFNC 1WBYB 3NABH 3RL2A 3ZYIA 4NP4H 3GMQB 4AEFA 4OF7A 4JFEA 5F97E 3LIZH 5D7IB 4JKPL 3CXDL 5FYJL 5BW7A 2ZUSA 3L6FB 5HJ3B 1OWWA 5T3ZL 3S37L 2P48B 2IQ9H 1FFPB 1MNUL 1C5DB 4ZODA 3HRPA 3FT3A 2O5ZL 1K8DB 5LXGH 1IBGL 2Y07H 2Y06L 5C0GB 1MEXL 5J12B 4L3AA 5F93C 3EO9L 4LCUB 4P9MH 4ZD3H 3LN5B 3L7FB 1Z2KA 5B4MC 4HPOL 1CK0L 2A2QT 1Z9LA 4LCCC 4Z0BL 5IBUB 5FDWB 3QUZA 4YZFF 2PYED 3LS5L 4WFHD 4NNPH 4U1NA 5L2KE 1WBZB 2F5BL 2PO6B 3SE8H 4M02A 3KR3H 4MZ3A 4K7PH 2H3NB 1NKRA 1SY6H 3BKJH 5GS0C 4UILH 2CRIA 3SKOA 1PY9A 1ZT7A 1NGZB 2PXYD 1ZSDB 5GRWA 3T1FA 4I1NB 3AREC 2XWBA 4XTRD 4KROD 4FP8L 4P5KA 3U7WL 4FQLH 5FYJE 4JKWA 5I1CL 3JV4B 1MWAA 3O3AA 1RMFH 5T5NF 4H8WH 1N7ML 1AQDA 4HPOH 3DUHA 1FG2B 1K8IA 1IGCL 5CD3B 3IAPA 4Z76B 3U0PA 1KGCD 4DW2H 1AFVL 2C5DC 4HWUA 5EPMB 2BRRL 4OB5L 4A6YB 5ECJE 1PW3A 2F5BH 1UKTA 3SE8L 1MLBA 1EO8H 5HHNA 4HT1H 2BHUA 4LLWB 3QZWG 4D0DA 4XNZC 3IGAB 3E6FA 4ELKB 5K9OB 4C54A 4FFZL 1HCVA 1U3YA 2NCMA 2JJVA 3H9SB 4JB9H 5HI3C 3DO7B 4X9GA 2JIXB 2GEEA 2VDLL 5C0GA 1U42A 5C0CE 1JYNA 4NIKB 2VC2L 1D5ZA 4XCYB 5I1AA 3HE6A 1P4BH 3SKMB 5M95B 3BQUD 2EYTB 5TE4L 2C3WA 3KPOB 4OGAC 3SDXE 5A40E 4NRZA 5GS2H 4H0GA 3SBWA 3UAJD 2G9HB 2PTVA 4JJ5A 5FIEA 4JFQB 3JWDC 2BSTA 2BRRH 3DUUA 5FAAA 2ATPB 4TNVF 5DFWH 4X6DE 4YHLH 1RJLB 1SMAA 3QYCA 3CK0L 4H20L 2BVOA 2NR6D 4PG2A 2BFVH 4HIJB 1DE4A 3CD4A 1I7ZA 1VHPA 3QUXA 4YUEL 3BKJL 1NMAH 4MJIA 3CC5A 5D7LB 1YJDL 2YK1L 4XP5L 4PJBF 5DMGD 2C7UB 4OD2A 2DQIL 1ZK9A 2FEEI 3GEWB 3U7AA 1K3ZA 2ARJB 4WCYL 2HRPL 1FYTA 2YUZA 4XGZA 3BGAA 1GGBL 4WGWB 4D9RE 4XHQA 3GJEA 3MLXH 4K71B 5LGJA 3T0ED 1S7VA 2IH3A 5F88B 1AQKH 1I7TB 4EEEA 2V2XB 1ACZA 4GG8A 3MZGB 1CYGA 3CSYA 1ZTXH 4RAHA 4PGCA 2MQ0A 3KYNB 5T1KB 4FA8A 1CLZL 3TCLB 4KXZI 4XH2A 4HKZB 4OLWL 5F1SA 3RNKB 4CGTA 5BS0E 2B5IC 2NZIA 5FUZH 5IKCB 3NZ8B 1NL0L 4PIRF 4RISH 4LLUA 4KZEH 3MLRH 5LGHH 4Q2ZA 3QG6B 4YDVB 4PJDB 1TZGH 2VDOL 3V2AR 1MJUH 5T3ZD 1R5VB 3ELAT 4GAGH 2R69H 2V17L 2UUDK 5AG9A 5C0CA 3LEYL 2DMCA 1FZJB 3ARGC 35C8L 3O4OB 3KPSE 4MVBD 1CFTA 3GNMH 2DBJA 4L4VB 5BW7C 4YEEA 3OKLA 4MA8L 4K3JH 4ZTPL 3RIAF 1NFKA 1A9BB 2AERT 3UAJC 3LEVH 4OJFL 1IC1A 2X1PA 3IXTA 4ODVL 5E8PA 2FH6A 3EYQC 3QEGL 1C7TA 3MROB 1YNTA 4JFYB 1YEJH 3VI3F 2C3XA 1UACH 2QHLA 3MCLL 5CIPB 5ETUA 3TN0B 3FKUS 1CQKA 1QEWB 3M45A 5LGHL 3DLQR 1U41A 3TBWB 1WC7B 5T3XH 4PJBB 3WS3A 3QHFL 1U8OB 5IVXE 1C7SA 2VB5A 2GQHA 1L4IA 5H94A 5CZVL 3CDCA 2OL3H 1XCQA 1G6VK 4UT6L 4AT6B 4KTEL 4MJIE 1NUDA 3H9HA 4A2MA 5KSAD 1H3PL 4BZ2L 3T8XB 1T21A 4C4KT 1AQKL 2X1XR 2D3VA 4AIOA 4JQXA 4WENB 1TZHA 2VE6A 3WL9A 4XCEA 1H3TA 3OJDA 3SKNB 4XAWL 1R5IB 1H3VA 3BPOB 4XNXH 5C3TA 2Y6SD 4KKLD 4MAYD 3RWGA 3VE0A 1EJOH 1GYAA 1UH2A 5C0BA 3TIDA 4BFGA 1MFBL 2XQBL 2DQGH 4LCWE 4DN3L 2O61A 5D2NB 3CLFH 1OD7A 2UZIL 4J8RA 3V8OA 2CKBH 5JR1L 3QZWB 2L7JA 5BZWA 2V2TA 5IP4A 4PJDE 4UINH 1NEZA 1WUNT 3F7VA 2IFFH 1LO0H 4MDIB 5IFJA 3BZEA 4MNGB 4A2LA 1RURH 3GBNH 4XCEB 1I8IB 1P4IL 4J4PA 3SKNA 4BFBD 3SDCC 4MQTB 2MQCA 4F7CA 3HE6C 1QLRA 3VFWA 1LEIB 1NGPL 1RUPL 3HI6H 2BVYA 2FX9H 4MDIA 3RDTD 2QTEA 5C0ND 3MFFA 3GNML 3U4BL 3REWA 3BXNB 1EMTH 4S2SA 1C5BL 4QKXB 3KPOA 2YD2A 4UTBL 1WWAX 2NLJA 3L95A 3Q1SL 3QA3A 4XC3H 3UPAA 2P5ED 1JUFB 4ZFFB 1HSBA 2CKBL 5ID1A 4WW1B 4L8SB 5HI4D 1IARB 2EE9A 3MODH 3PV6B 2D2OA 3GSXB 1WISA 4MA1C 4JQXC 5I8EA 1JPSH 4P5MA 1OTSD 2A9ML 1CN4A 4NQDD 3PWJA 4ZSOA 3TGXA 3GSWA 5EO0A 2E8ZA 2IAMB 4HULB 1RU9H 3SGJC 5KAQG 5HGAA 2E7BA 3S36H 3BWAB 1VA9A 1CDJA 5HGGS 4MJ5B 4JPVH 4LEXL 1BD2A 1MJJA 2DLTA 4ZAKC 5IMKB 2RJMA 5L6YL 2PO6C 4PB9L 1OLLA 3GMNA 2HTKD 1UADC 5F6HJ 4U1LA 3SGDH 3VFRB 4MSWB 5D2NE 2V9QA 1XGQB 4BJLA 3BUTA 3BFOA 1PJ9A 2GJ6E 3EDKA 3D85B 4JFDD 3UZEA 5FA3B 5D7JA 3O9WB 4OF5A 3MOBL 1ZAGA 2P4AB 1FNGA 1FH5H 3ARGA 1RHFA 4OAWB 1FZMA 2AK4E 4LLYA 1T1XA 4TUOB 1ADQL 1FNSL 4FQHB 1BX2A 4W6YB 5IOPB 1NBZB 4KI1A 1IQWH 4QRRD 3ARPA 4F7EB 5EOTB 4UZGA 2BNRE 1RFDH 3RGVB 3P9LA 1J0KA 4JFDB 4Q2ZB 3ILQD 3L3IA 4PJAE 3WXWL 4PJDA 3INUL 2H41A 5I1DB 1JFQH 4CN1A 2X4SB 3VFNB 2HFEB 2RB8A 3TN0C 3OKYA 2ZP0T 3V9FA 4GBXA 1HWGB 2VDNL 5HPMA 5K9JH 1LE5A 5MERA 1R3LB 3QG7L 1RVFH 3RX7A 1UJ3A 3OQ3B 1J87A 3PWVA 2AV7A 3Q5YA 3UJJH 1CK0H 3QAZB 5IHZA 5HHQA 1A3QA 3C60B 4L3EB 1NSNL 3BIKA 4LPXA 5J6GB 4LGRB 2FIKA 2WBJC 1HHJA 5DS8B 1VSCA 4ZUSB 1Y0LB 4FQ1H 1PX3A 2XTJC 4NWUH 2R29H 4BSJA 3U0WH 1WZMA 2CRYA 4KWUA 1CFBA 2Y5EA 1EGJA 3BSZL 1I3GH 1H0DB 3QG7H 5KS9F 2IAND 2PW1B 3CXDH 4YHPA 3UJJL 2C1PA 3S34H 1QHOA 2J8UA 2NXYD 1KIQB 1KYOJ 1V7NH 4L8CB 1JFQL 5J6GA 4IOFD 1QLEL 4WJ5A 5C08D 1MHHA 5I9QC 4LCYA 5B22A 2FEDD 4OB5H 5ILTH 3W0WA 4XPFL 5EUOB 1JWUB 1QSFD 4MJ6A 2F53B 2IQAA 1X5YA 4XWGH 3RUGE 3OV6A 1F3RB 1WT5A 2FEEL 2W0KA 4AZ8A 5J9PB 5CZXD 1U95B 3IKKA 2E27L 4NNPL 4NBXB 4PRIE 4KQ3H 4XNZB 5ICXA 1RZKH 2XACC 1KXQE 1OAQH 4KKCC 3L3IB 3IU3A 5MENB 3UO1L 2J8UB 4PJAB 3QRGH 1GH7A 4JFDE 3H42H 3NACH 3Q0HA 1BZ9B 1IEAB 3CZJA 3I6LE 5IB3A 5L0QB 4LQ1A 2AV7B 5EPMA 4YXHH 1C12B 1KB5L 4UB0L 3RPKA 3DJ9A 3GJFK 3MO1A 4Y4FD 2IMMA 4HUXB 1NANH 2NR6C 3O3AB 2NNAB 4QRPE 1KENL 3VFTA 2IAMC 3C8KB 4MQ7A 5IQ7L 2ZG3A 3U9UB 2BNRA 1KCUL 5JW4M 2PR4L 1T66C 4WY7L 5ITBL 1DL7L 2UZYB 3MJ9L 3S88H 3SDXB 2XFXB 1Q1JH 4M61A 4LAJH 4F33B 4L4JA 2OR8A 3P73A 1BJ1J 4LLWA 3T0VA 5HBBA 2XTJB 4CW1A 4GUPB 4O9HH 3TZVB 1EHLH 1QSEB 4JKPH 1BQHB 2X4RB 3SCMA 4WI9A 1A14L 5HYQA 5A3IC 1MWAB 1U2HA 2D03H 2YA1A 3HI1B 5K9OA 4OIIH 2O93L 4YBLC 1AQDB 3DTXA 3EOAB 3M17A 1QFUL 3GI8L 4KUCF 4OCSH 1N2RB 3KYMB 4XBGA 3H9HB 2DYPD 2DD8L 3PL6A 3RY6A 1ODAA 3QDGE 4Z6AT 1KN2H 1AGFA 5JW3H 3TH2T 3BE1H 2DL2A 4HC1A 5HVFB 3ULUF 1MRDL 5LQBL 2G75A 4FRWA 3U4EB 1A6AB 3DX7B 3B2UD 2J8UE 1G0XA 2APWA 3D69B 4AMKL 3L7EA 5DLMH 4YO0A 3O6FA 1A5FL 4MNQB 3IDIB 4UMGA 1DQTA 4UT7H 1PD6A 5D9SA 4QTHA 4O9HL 3GDBA 4YK4C 2KH2B 4YQXH 1JP5A 3O8XA 1SY6A 4LARL 1ZA3A 2PXYC 3RL1A 3PABA 3AXLB 3V0AC 4M1GL 3SOBH 5DO2C 3ORJA 5DD6B 4ZFOA 4KZDL 4N8CH 4O2EA 3CMOH 4JO4H 4AENB 5DUPH 3LMJH 3V4UL 2F19L 2EDJA 3O0RH 1VKXA 1DL7H 3RL2B 5LKNA 1CLZH 4C56E 4PUBH 1FNHA 4OFDA 1P7QA 1ZHBA 4G5ZL 5KSVB 5KSBB 3P0VH 3SDCB 5IK3B 3E6HB 3K1KC 1K4DB 4O51A 3RZCB 4EI6A 2V2WA 2OL3B 4KJWC 4LHQB 3TCLA 1G6RB 3VA6A 3ULSA 5FYJU 4UTAL 4GRLD 2Z31C 2DQEH 5C0BD 2ZSWA 1FL5B 5LCVH 3UTQB 1I1AC 5F96L 2EIZB 3VMOA 1BWMA 1MSPA 2P44B 5DQDL 2W0FB 4GAGL 1CU4L 3EO0A 3I6KB 4M03A 5ICXB 3MREB 4RMSA 3O2VH 4WUUB 3EFDL 4PJFF 2I07A 5DRXB 1J0YA 5ICYB 3W5MA 2I25N 5IGXL 4KUCD 3REVA 2O5YH 3VRLF 1DQML 1BEYL 3LRGA 3WS3B 1E27A 1JN6B 4N5ED 4XI5C 3VFVB 4QHNA 4Y1AB 1NAMB 4Z7QE 3BX7C 3IJSB 1OCWL 5FV2A 4C83A 1T21B 4NFBA 5I16A 4HAGA 2VUYA 4UNTA 4GAJL 4RBPK 3GSQA 4RFEB 4PJFE 5K9KB 1NAKL 2EH8H 4QLRA 1ACYL 1EEZA 1UWEL 5L2JA 1A7BA 3KPQA 3C6LA 1EFXD 4PRHD 4P59H 3VWJB 2EDXA 4WV1A 4ZAKA 4Z0XB 2R56H 2VLLA 3MNWB 1MFEL 3RWIA 2DMBA 3GI9H 4PGJA 4QRSA 3JVGC 4AIZA 1OGTA 3ILPA 5E99H 5TE6H 2ESVA 4WWID 2VDMH 3N1PC 3QFJA 5BO1H 3KPRA 1DBKH 1DQMH 3ILQC 1HILB 1YPZE 3FT2B 1BVKA 4NNYA 3DMMC 1EAPA 2IBGA 3TYFA 1BBDH 3O3DA 3B2VH 5LGJB 4U0RB 1FFOA 4KROB 3WIHA 4G7VH 1MCBA 4MQXD 1KPRB 1A7QL 4S1SL 4NKIH 5AZ2H 3S6CA 1D6EA 2PCPB 3LKNA 3RWEB 1XIWA 1FPTL 4XPHH 1AHWC 2DYPB 1RSFA 2DQJH 4K9EL 5ICZA 4HS6B 4MCYB 3BJ91 5BO1L 1NGPH 1G6RH 1DBKL 1ZHNA 1T7ZA 4JDVA 4L8BB 1JGLH 2QLVB 3QNYB 1OPGL 5B39G 3T77B 1YECH 4U1SB 2AK4A 4JFZL 3BIAX 2BJML 5HSFA 1T6WA 3W9EA 5C6WH 3PIQA 2E6JA 3L95B 4WVRA 1Q9OA 3P0YH 2IH1A 1QR1A 5A1AA 4DJMA 1NEZG 3MLSL 2GJ6B 4LNVA 5DVLA 2AJZB 5F9JA 5D71L 1FYTB 4XGZB 1NFDA 1JPSL 4ZS6C 1WT5C 2EH8L 1R3IL 5BJTA 5HYSA 4M4RA 1RZ7H 2VISB 5CD5C 3E3QE 4WFEE 1AGDB 1IEBA 3BISA 3UCRA 1FNLA 4EVNA 4FFWD 1J7VR 4ZUVB 5HDLA 5EFIB 2CDFA 3FOLA 4PJ5B 4U7SA 5DYOA 2OL3A 2ZG1A 4NPYA 1MAKA 5JHDB 4WHYG 5FCSH 4E0RB 1T4KB 2DJ4A 4W4OC 1GZPB 4NKOB 2XG5A 3H9ZA 3PWLA 5EBMB 2X09A 3T4YA 3FFCE 4JHAH 4OD1L 1KTDA 2GI7A 4V1DE 2E7MA 1R3JA 1TTFA 4OQTH 4G7VL 5BVJB 2O5XL 2P47B 2XNAB 4Y5VC 3QFJE 4DVRL 4PJCB 3FMGH 3CFEB 3IKCA 3IYLW 1TVBB 3D39B 4Z7UA 3A6OA 1AHWB 1CBVL 5C9JB 5GHWH 6CGTA 4EI6B 4ZOBA 3VG9B 3DUSA 3FN0L 4LCWB 1A7PL 1R3IH 3K2MC 3DIFA 1YMMB 2YWZA 3W0WE 2AJUL 3LVEA 4ZDHA 3VG0H 4F2MB 3VWKC 3ZYJA 1WIOA 3ARFA 1BM3L 1J5OH 5EU3B 1D9KC 4XMPH 1XGTA 4PRBB 5T1LD 5E7BA 2JTDA 5E08L 3HZMB 2P43B 1LEKA 1JRHI 4UDTB 2BJMH 4QXUH 3RVUC 1F4WL 2HJLA 4F7EA 5TDNB 4O58L 3G08A 5DI8A 1TFHA 2CKBA 4TYUA 2PN5A 4HJJH 4NHUA 3FN0H 3ZE2E 1YC7A 3QIUC 5EZJB 4GBXD 2ZUWA 4K07A 3ARUA 2YD7A 3STLA 4YIQA 1A6VL 4BSWB 2YZ8A 3E1F1 3W11C 2NY4D 1DBAL 2XY1A 3W39B 1MFAL 3U46B 1KJMB 4WI4A 3T0XA 2DKUA 1CGSH 1T3FA 1JNNL 1L7IH 1UCBH 2D0FA 4KVNH 3RTQC 5AZEH 1CG9B 4FHBD 4NC2B 5ISZA 4ODWA 3I84A 3T65B 4K3DH 3OR7B 2PNDA 4TSBL 2NY2B 5I15L 2DTSA 4KHXH 1I1AD 1NFDE 2MPAL 1C5BH 3P40A 4OCNC 1OM3H 3MXWH 3ARGD 4NQUA 3EBAA 1KB5B 4LCIL 3IDNA 5H37G 3STLB 1RZGA 5CZXC 5DRNA 4PJCF 4OQTA 1DUZA 4P2OC 4IIQC 4F7MA 1K2DA 1J1PL 5FCUL 3L9RA 4HJJL 5KANG 2J6EH 3O6LL 1PGRB 2EIEA 1A3RH 3T08A 3GMQA 3LH2L 4QRTA 4ZFGH 2R2BA 4IBLT 1KF9B 1Q38A 2BNQB 4U6HB 1OQXA 1MCIA 1PY4A 3QWOA 5DJ0A 2W9EH 4KFZC 4KKAD 2EIZA 4YNYA 4HDIB 3PQYB 4UV4H 5DTFA 4JLRA 4E41A 4Y4KD 1F4YH 2R4SH 4KJYB 2R0KL 3V0WL 3HNVL 1CXHA 4NO0D 3V6OA 1MHHB 1IL1B 4QXWA 3R0NA 3HR5A 2CRMA 4LBEA 5EH1A 1RK0A 1CE1H 3HNSH 3B6SA 3BEVA 4U6XA 4FTVA 4YHYC 1R0AH 5EUOE 1U9KA 1YMHB 3SE3C 5IQ7H 5J3HC 1EO7A 3KPNA 3DURB 5DZNA 1NBVH 4OLZH 1Q9OB 3L5WA 4APQA 1NDMB 4JO3H 4P0DA 4DTGH 4LSVH 5DK2B 5DVMA 1IQWL 3BIKB 4GH7B 1I1FB 2YPVH 5DK0A 3P4OA 5I1KL 4LCWD 4R7NB 1B4RA 4K3DL 3VDAA 5DUBA 2XOTA 4HV8A 3U7WH 1OM3L 4PYHA 4UV7H 4R0LA 1U8NA 1NGXB 3L7EB 3T0WA 4DKEH 3F7YB 2F74A 3H2WA 5ISZE 2MNUA 4NM4H 1INEH 2ED8A 2AQ3A 3OGCB 1LO5A 2X70A 4OCYL 4YNYB 3GMOA 1AR1D 2OXGA 1MEXH 3A6BL 5BRZD 3TBSB 2J8UF 4PV9B 1MHCA 2VAAB 3WEXB 1TITA 3FAXA 3GSNB 2IQ9L 4HV8B 5F9OH 4JB9L 1WQVT 1SBBA 1YYLH 1AY1H 3SGEH 1WGOA 1XGPA 1IKNA 2WP3O 1UB5B 4GT7A 4N8CL 3RNQB 1ZVYA 3CFBB 1YC8A 5DURB 2CIKA 5KS9E 4PJHF 1T5WB 4M1GH 3SOBL 2GSGB 5JTWA 4ODUB 4JPKL 3V95A 1J0JA 1J86A 3IAGC 3U30C 1FFPA 5E9DD 1CDBA 3SDXF 3QUYD 4OCMC 4U6TA 4GG6B 2L0DA 2W0FA 1CLYH 2DN7A 3V7AG 3HMXL 1KV3A 5C0AA 4NOFA 3O3EA 4G9DA 3SPVA 1KTKE 4I0PA 4MXVE 3ULUH 1GXEA 2BOCB 5E5MA 2QADD 4KQ3L 1F6AA 4FP8H 2YPVL 1ZVSA 4PREB 4IOFC 2APXA 3HC4L 4L8DB 2MWCA 15C8L 3FOMA 5IB2B 4Q6IB 2JCCB 5ERWB 1B88A 1CT8A 3VGAB 1MI5A 4PJ7E 5JIHA 3O41A 2VLJA 3GI9L 3KPLA 4O02H 3CUPA 4XB8A 3C2SA 2XZCL 2BNQA 4U6HA 2VDLH 3MLVH 5GS3A 3B3IB 5FF6B 4UAOB 1IBGH 1EHAA 4OI7A 1DDHA 2NY5C 2BSRA 1KEGL 4JY6A 3MA9L 1BMGA 4NHCH 4L8DA 4YZFE 2VR9A 3U36B 1IMHC 2IADA 3OHXB 1JPGA 4BH8A 4X6BB 5FDYA 2D7MA 1RHHB 5IEKA 5FO8A 5E6IC 2RR3A 4OV6F 5CJ5A 5AUMB 4MNQD 4LKCB 3TN0D 1I85C 4MXQD 3BZEB 4J3TA 4LP5A 3B3IA 1U8HA 5D1ZB 2DQJL 4MB4A 1ES0B 3K4AA 3OKMA 5FGBC 3T4AA 4GG6A 1HH9A 4JG0H 1FDLH 1QBLH 1FCCA 5IB4B 3GSNH 3MQIA 1TJIH 5D6DC 2EIBA 3WNMA 4X0KA 4FQLL 2BVTA 1LDPH 2ZNWA 4JKMA 4X6BA <