2VDRB

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, lggakqrgdv
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 129
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdrB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdrB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdrB03
3K72B 1MQ8B 1V7PC 3ZDYB 3M6FA 4HQLA 2VDQB 1ZOPA 5KYWB 1FNSA 4G1EA 5E6SB 4HQFA 1M2VA 3EH2A 3PPVA 1RTKA 4WJKB 1MJNA 3NIGB 1JEQA 3ZDXB 1PT6A 5KYWA 2VDLB 3EH1A 3AFCA 3HXQA 4F1JA 3K6SB 1RS0A 3BQNB 1XUOA 1BHQ1 4K3JB 3TCXB 4G1MB 4UM8B 3RAGA 3ZE2B 5ES4B 1OAKA 5E6SA 1TYEB 4MMXB 4GZ8A 1U0OC 1RD4A 4XW2A 1NA5A 4WFQA 1JV2A 4MMYA 4Z7NB 2IUEA 4UM9B 4WK2B 3OL2A 2WINI 3PPXA 2XWBF 4O3TB 2ODQA 4NEHB 1M2OA 2VC2B 3NVQA 4C2BA 1OLZA 4UM9D 2VDMB 4JDUA 4O02B 1JEYB 1AOXA 3TVYA 4CNBA 1YVRA 3K71B 1L5GB 4G1EB 1JV2B 1M10A 1XDDA 4O02A 1DGQA 3IJEB 3EFOB 4HQKA 2ADFA 5LN1A 3EOAI 3K72A 1Q0PA 1RRKA 1MQ9A 3FCSA 2XWJI 1U8CB 1CQPA 3N2NA 5KYUB 4C29A 4MMZB 3T3PB 3V4PB 1QC5A 3AL8A 1AO3A 2I6SA 1ZOOA 5KYNA 3HXOA 1M1UA 2O7NA 3IJEA 3EFOA 3EGXB 4HQNA 4MMXA 1YVPA 1ZONA 4MMYB 4G1MA 4Z7OB 4M76B 5BV8A 1PD1A 2NUTB 2ODPA 1SHUX 3F74A 4JX0A 1AUQA 3EOBI 4MMZA 1CK4A 2VDOB 2NUTA 3OKWA 5KYXA 3AL8B 1SSLA 5KYYB 3FCUB 3OL2B 1IDN1 1MF7A 1QCYA 1T6BY 5E6UB 2VDNB 2P28A 1IDOA 4IXDA 1SQ0A 2WW8A 1PCXA 3TXAA 4BJ3A 1U0NA 4NENB 1DZIA 1LFAA 4WK0B 3OKYB 1BHO1 3NIFB 3VI4B 3ZE0B 4O3UB 3NIDB 1JEYA 5KYXB 2X5NA 2I91A 4NENA 1MQAA 1M1XA 2NUPA 2B2XA 1MHPA 2VDKB 3Q3GE 4FWWA 2M32A 3EGDB 2QTVA 3T3MB 5E6UA 2VDRB 5HJ2A 3EG9B 3TW0A 1IJKA 1M2VB 2P26A 5E6RB 3VI3B 5KYUA 1T0PA 1N3YA 3FCSB 4CN8A 3EGDA 1XDGA 3AL9A 1N9ZA 2I6QA 4F1KA 1QC5B 3ZQKA 1M1XB 3PPYA 3EGXA 3HI6A 5HGJA 4CN9A 3V4VB 1JEQB 1SHYB 1L5GA 5HDBB 2NVOA 3EG9A 5KYYA 2VDPB 4C2AA 3K6SA 1SHTX 1IJBA 4HQOA 2ICAA 3E2MA 3QA3E 4FX5A 1U8CA 1JLMA 4IGIA 1FE8A 3PPWA 3ZE1B 3BQMB 4A0QA 1PD0A 4Z7QB 4DMUB 3BN3A 3GXBA 1YUKA 4PN7A 2NUPB 3IBSA 1ATZA 2XGGA 3K71A 3ZDZB 2UZYB 5E6RA 3F78A 4IHKA 1UEXC 4WK4B
chains in the Genus database with same CATH superfamily
5CEZD 2B4CC 2UY6B 5T5NF 2HQSA 1X7DA 3WLBA 1T13A 3OPNA 3BWUF 1LE5B 5JS7A 5J2UF 1G42A 1DLHA 1H3GA 2W5UA 4PEVA 2ZT7A 3UJNA 4JD5A 3VXSE 2L04A 1XRNA 1RD4A 2E4XA 4L9AA 2W65B 4JHVA 4QYOA 3DZDA 1KQOA 3TJEH 1QFYA 3CZFB 4I55A 4PINA 2VNAA 1ZLUH 2OMYB 3UZVA 1U11A 2YJLA 3MMEA 1J2JA 1YB7A 1RYBA 3O4LB 2JJVA 4GKNB 5FYQA 1A50B 2GAAA 3QDJA 1NPNA 5DF0A 2CJPA 5EO9B 1V3JA 3HI1B 4HGWA 1RHRA 2DEUA 4LCCC 3HEMA 3GB7B 3EOAB 1ID2A 4B4WA 1ACCA 1C30B 4JX0A 1DELA 3BRCA 4GPIB 1V11A 5AO9A 1VGEH 3E3NA 1FMTA 4OGQC 4APQC 3A4LA 2CW5A 3NTRA 2CCVA 4WI0A 5HZGA 1GAXA 4QOKE 2QNBA 3ZY7A 2CHQA 3NP4A 2W8BB 2C96A 2QKSA 1OGTB 3SMQA 3RURA 3CVHL 5GISH 3D7MA 3RGVD 1E1DA 3Q72A 3Q98A 1F4WL 1QIKA 1YGPA 1JZGA 1TQSA 2WIGA 1PZCA 4FFWD 3BIKB 2AR7A 3OETA 2KZBA 4M89A 3CTMA 4OQEA 2NO0A 4HWZA 3FRHA 1E2IA 3G1WA 2FN4A 2OC9A 4C20A 1VE3A 2HRPH 4JC4A 4UZFA 3WLIA 1UP7A 2BFOA 1LNUA 1RUAH 1SDDB 4WV3A 1GNSA 2H3NA 4I18C 2W11A 2E6PA 2P11A 3F6BX 3DS8A 4O2AA 3FZGA 2AI0L 3HZYA 3EXEB 4N25A 1MJHA 3FWPA 5DTFB 3P9RA 1RH8A 1MB9A 3MSXA 3UROR 4MLSA 1U4NA 5ANMA 4P57B 2B69A 1U7DA 2AAVA 4X6DE 2I66A 2HHHB 2QJWA 1YUNA 3HFJA 2VDMB 1J8RA 3SGEI 4UTOA 3NPMA 4MGEA 3V8EA 3VXRE 2NY2C 3SSOA 4L6CA 4BO0A 1UM9A 4LPTA 1IU9A 3KG5A 4FZEH 3F62A 5SX4I 3DGGB 3HUDA 1GL7A 2J67A 2OW6A 4BMPB 5ICZB 4OHBA 2QR0B 3HYTA 3UT0A 1V1JA 1V25A 4G5XA 1GSKA 1GQSA 3O8XA 5K0TA 4OJDH 3W57A 1K4CB 4GVXA 2OLEA 1QO3B 2PU5A 3CGWA 5FWNA 3H2WA 4DOHB 5DJXB 1U7UA 4KUGA 4CBZA 2HH0L 1F8UA 3HMWL 4M8VA 1O95C 2DRIA 1IXSB 1TSHA 5DYYA 5DLYA 5EINA 4MO2A 2GAZB 2QQGA 2VUUA 1GYCA 3DT8A 1U7OA 2RHRA 3MJ9A 1XIWD 3A4YA 3SXUB 4DIKA 3AS0A 5J3JA 2E48A 1AGFB 2FZ3A 4ENWA 1F7UA 3RIFK 4WESB 5JCJA 3DZHA 2Q9OA 3O1HB 1A7OL 4E68A 1QHNA 3L5XH 2BY4A 4XGRA 1ICEA 4YE4H 3G6JA 3QORA 1S7TB 1SC4A 4JDZA 3N2ZB 2FJFA 1X7XB 2BZ1A 3Q85A 5FNZA 3NOIA 1VCIA 3PKJA 5MENB 3WE6B 3O8DA 3FTZA 2QTAA 2AYZA 4G7VH 1ARZA 4OGYH 4PJAB 3O4GA 1NMYA 2EGUA 1BQRA 5AOVA 3IUPA 3KVNA 5IASA 1E3SA 2W2TA 3DNMA 2KQMA 4Z5RB 4M0LA 5TQ2L 3ONNA 4UT9H 1TTTA 5JI3E 1VIAA 4XNMB 3SDDB 1E3IA 5IFKA 3IURA 1MDAA 4FEYA 3D48R 2FWIA 3LX6A 4PO8A 2V2TA 3V8NA 3HI4A 3EXHA 3SJVD 3VNAA 4A0HA 2CLZB 3UF0A 3A4DA 3IL2A 3HN5A 4HV8B 5DJZB 5CN3A 3PFCA 1E5BA 3A1VA 5HX7A 1CY6A 2XIBA 1E4XI 3ZJYA 1CEEA 3TD2A 3I32A 2VEOA 2NNRA 4PGBA 1RPUA 3E61A 1WEJL 2KI6A 1JFTA 1UBTS 3D3JA 5FC9A 4B8YA 1DL7L 2Q2EB 2RH8A 1ETHA 2E9WA 1KI9A 3RAJA 4LL4A 1ABBA 4BV2A 4YRKA 2C9VA 1F8GA 5FS5A 1JE0A 4EA7A 2GBUA 2X40A 3I50H 4U2KA 4YQYA 1SC9A 4WKZB 5TMPA 2IUFA 5JYLA 1E79D 4TQEH 2AOTA 4IOFD 4BSVA 1FVXA 3NRBA 3V5NA 4WLNA 3X12A 4XQ0A 1ELOA 3C3CA 5U9CA 4B97A 4HWEH 4HXFB 1NMXA 4HNAB 2VAPA 1MXHA 3FOLB 3G0CA 1K7FB 4Q6WA 3APMA 4LSRH 4RCVA 3AXHA 4G0PA 5AP9A 3OPYB 5TPZD 1R0LA 2OLKA 3JARA 5EIOA 2VO8A 1CX9B 1JDZA 4C2BA 4LJ8A 1LC0A 1AY1H 2BW5A 2QR2A 2PJUA 3BGOS 1FP4A 4PYLA 4NN6B 4PVDA 1R46A 1GQQA 4BGUA 3A1TA 2OR3A 5FFGA 3DOSB 3W6UA 2NVUA 4KQ9A 4KAQH 3N76A 4JUCA 2HT3D 4F1WA 4IRXA 3D0QA 2PCPB 2FEJA 2WQUA 2C34A 2DKUA 5EP2A 2GYWA 5KBDA 1OAQL 2FPMA 3VD5A 1BMZA 2NW3B 2DWQA 2O7SA 2VRQA 3U7HB 1XZIA 1Y7LA 3TTSA 3NAMA 4OKIA 4RVSA 4JKMA 2VN3A 3S88L 3P27A 3VWKA 1J6UA 4G65A 5EPMA 3QMPA 3UAOA 1V8HA 4V38A 2D2OA 2WCGA 4UANA 4KQXA 5EHIA 2CRMA 2GJZB 2CLSA 3U6KA 5E2VL 4EHBA 1N4AA 3G6WA 2ECFA 5AIAA 4A8JB 3MTDA 4H6WA 5K1ZA 3ZHNA 1H5NA 1UD8A 1VA4A 4IIVA 1YECH 5I0XA 2JI2A 4Q9QL 5C6PB 3VO2A 2G9ZA 1Z6YA 4JC0A 3I39X 5DZLA 4P5SA 3C6SB 4NESA 1IVTA 2OR7A 3B8SA 5MDHA 2G5BB 4YSDA 2ICEA 2OBFA 5TJ9A 4OMFG 2VLKE 2BDNL 4MW4A 4G8EA 2GT9A 2AABH 4LY3A 1IBHA 2RHOA 1XSOA 3N8GA 3FPJA 1QNZL 3BGSA 4LMBA 5F33A 5K05A 3B9KD 3AREA 1KK2A 1YTLA 4N41A 3ILPB 4N24A 4P49A 4YGVB 1AUPA 2O6LA 4L8GA 4O02A 3NGXA 1BDMA 1LNUB 1CY1A 3X1JA 2XKSA 1BHGA 1XMWA 1CT8A 1PUJA 4FPXA 4URKA 1AZUA 3QLUC 4W8OA 3EFFA 1BVZA 4PJ9B 1QRND 3Q11A 4JHLA 5JH7B 1ZTMA 4IDFA 4AV4A 2O1WA 2DMBA 4RSVA 4B6OA 4P3DB 5CU7A 4BQEA 4GUDA 4DERA 4LVHC 2NT3A 1OTXA 2V3VA 1KH2A 3TZCA 1X8XA 4HPYL 1Z0DA 4BWUA 3G5UA 1KBKA 1U8KA 1P4AA 3EFBA 3HRZC 2BDEA 3TO4D 3GNTA 3GNLA 4S1DC 5HHXH 1NYLA 1P9MA 1HUQA 3RCBA 2YCBA 1EEQA 3VHXA 4GOJA 2Q10A 5IMSA 2NO1A 3A6BL 5A6SA 2W88A 1WG3A 1ZP6A 2DTMH 2JKXA 2QP9X 2ZRPA 1FX1A 3P0VL 5FDWA 2P2NA 3LHDA 3AQDA 2Z56A 1MSPA 2JB5L 2V0AA 1KTJA 4HH3C 4QG3A 4KY2A 2P9JA 2JLQA 3L08A 3U36A 2GBVA 2P52A 5ABAA 2EDDA 1QSGA 3FH0A 1YI8A 1DDOA 5BV7L 4X71A 1PG7H 1PFQA 3EYQC 1NUGA 3WYDA 3NHKA 2QGEA 3TA3A 2IHZA 4D4GA 1AC6A 2NZVG 4YDNA 1MOZA 4ZVKA 2ZR9A 2VNCA 4O2BA 5EMJA 4YRCA 4HU2A 1W5FA 4FABL 3JWNE 4FCWA 5BQPA 4N0DA 1QNFA 6LDHA 1CFMA 4M8QA 4XNMA 3TJRA 3EFDL 5D6NA 1MFVA 1UODA 2XJ4A 4ME6A 3CBJB 4LLYA 1XJWA 5FTMA 1KI6B 8MHTA 3R74A 2CBTA 3BO8A 1XP5A 3RS4A 4BA8A 3V46A 3QULB 5EKUA 3LG2A 2AFIA 4LE1A 2RA1A 5MN4A 5C8DA 4L3EB 2B9VA 4Y0AA 4Z3IA 5CCJA 4JDZB 4D26A 5JHLA 2EJWA 4B9FA 3I34X 3VC7A 2GN8A 1ZD9A 1RUML 1TCBA 5ALEA 4K0OA 3DW1X 1YQQA 2ZJ3A 4IQHA 4QLRA 4Z3FA 3K1KC 1Q0EA 3D50A 1MGPA 5FWAA 3OKMA 1CUJA 4K3EL 4IJVA 1SXBA 1QYGH 1U0TA 3HJEA 2BGUA 2A35A 1FZTA 3KCWA 3GJTA 1BCSA 1Q0YL 1ZV5A 3FKUS 2VBGA 4RBNA 2UZ4A 3D54D 1FMLA 5JORB 4XB7A 4PV8B 2AMUA 1SCIA 3RU8L 1HEZA 2VJDA 4B4DA 4UNNA 2W9LA 2CALA 4OZHF 5I8CB 1GPAA 3QHFH 3N7AA 1DKLA 1QM5A 5F7WC 4OZGB 5DGIA 4AJWA 3WXVL 1HFWA 1P2FA 3L8DA 4JC8A 5CPFA 2R4RL 3CZQA 2CVZA 3JRWA 4GG1A 3S8GB 2K87A 4X6DA 2WA1A 3GJ5A 1OSZB 4Q47A 2IF0A 1AZWA 3QH3B 1GA1A 3H99A 4EUKA 2V7NB 2AQ8A 1M0WA 2B0SH 2NY6D 3KPSB 5DNYB 2XN2A 3I04A 2VHTA 1E8NA 4BBZA 5AVVB 2YD9A 5CB4B 5H2BB 4C4SA 2E9GA 3C6LA 4PE5B 1Z5ZA 2EZ4A 5BRAA 2A3NA 2JFXA 3IKCA 1JR4A 4MWCA 3A2LA 2ZRKA 3ABKB 1NBYB 3A2NA 1F90H 3BF7A 2HG5B 3NXSA 3PWNB 3FNGA 5DBEX 4LJSA 3Q01A 1DQPA 2O1AA 1F1GA 3EUUA 5LBUA 5COAA 3DE3X 5E6YA 4PM4A 4P4KD 5BV8A 3IDYC 2XVBA 2PEYA 4ZV7A 3HLAA 4CDGA 1MVFA 5B3KA 1QATA 2V2WB 3CE9A 4RZHA 4NWTL 1AG9A 2AQNA 3NW9A 4R8WL 1BEEA 4ADGA 2XBTA 1JB9A 1PK9A 2PAAA 5E0FA 4Z7UF 4F7CB 3AGQA 3GH3A 1RFDH 5F3HB 3PDOB 4EBQH 2IC2A 2R8EA 3EO9L 5H68A 3WFDH 3LIZH 5HHQA 3NOQA 2JPDA 3E9MA 3MFGB 5TLSA 2OHHA 4UUPA 2W8CA 4BE6A 4N0YL 3UB2A 1T6BX 3VKVA 3NVMB 2ZIXB 4OFKA 2AI2A 1NXSA 2B4QA 1V3MA 4P22A 2G0AA 4HS8H 5I1AA 3NV7A 1H9BA 4WY7L 4BKTC 2QTMA 4RF3A 3DRQA 3FRUB 1O6GA 5I17A 5E2VH 2X1HA 1V7NH 1N8KA 2ICEC 3CUKA 4ZAYA 5CVDA 1NCJA 1E50A 2MQCA 2WHRA 3KO8A 4G1EB 3EFFB 4PJ9A 4BLPA 3G6DH 1Q7EA 4DLKA 2A83B 4R90H 4P2OD 3B1YA 3NI2A 2EJBA 1AO3A 4A68A 3VO1A 5AOKA 1RPNA 1Q1GA 2X0WA 3HO8A 1M33A 3N0XA 4MI1A 4G5ZL 4XCXA 4ZW7A 1G60A 4XCNA 5IB2A 1A6TA 3NIDB 3F7MA 3OIUA 5JFGA 5C0EA 2HPVA 1G8GA 1JGLH 4JKPH 5G1OA 3PQYE 4B80A 3DL7A 4JFDE 3UPRA 2A59A 2Q1WA 3IJ5A 2B4CH 3CNQS 3Q2VA 2R8XA 4QPCA 3DDGA 3IETA 4YMGA 4ZK6A 1JFHA 4PJDF 3GT6A 5H9WA 2I9LA 4XWOD 1JYNA 2VZVA 2DQTH 4UAOB 1UBGA 2P77A 4B3JA 4APQB 1E2GA 3VU2A 2QD4A 1AO7B 2W59A 1YB6A 5EPMB 1FBNA 1TJXA 4EQZA 4XNAA 1PR0A 2GASA 3RNQB 1MOEA 1ZJ4A 2NPFA 1TTAA 4DUYB 2LGJA 5ELIA 4LSUH 3JWOC 4F8QA 4IDNA 3EGEA 3MWYW 2ORED 5A7GA 2I1LA 1F2TA 4Q82A 3IB3A 1WUKS 2YHGA 2CRYA 2BGTA 1PU0A 3MOIA 5DE3A 1G8PA 4Z9FA 4AS2A 1ORWA 3MPOA 1RQ5A 3D0LA 3M8OH 2MNWA 2PIAA 1J09A 5KWJA 1A9EB 3NPSC 3CZAA 1SEQL 1H2FA 2X6RA 1BJ8A 3ZLBA 4AROA 1U3WA 4YSOA 3TN0D 1TMYA 4I18B 4GNKB 2HP4A 3P4XA 2YLHA 1D2RA 2IPKB 1SB8A 1OWRM 1H4TA 2AN9A 4ETNA 3OKDA 3MWKA 1E2LA 4W6WB 1ULUA 4W9EC 1CGVA 3SDCB 3SQBB 3D3EA 1B16A 1K5WA 1J18A 3FT2A 3SQRA 4HCFA 1PX0A 4R3WA 2XFXB 2OSXA 4MYUA 5FM8A 2QHRH 3TH5A 4KQCA 3BO8B 3FF1A 1L7NA 1P7BA 1Z8DA 4JS0A 5DS2A 1Q19A 4J0KA 3RVTD 1G6RA 4M0MA 4G4JA 1IC1A 4IHOA 1MJ7H 1E7MA 1KK1A 4S0ZA 4JR2A 1UKSA 1VA5A 3V0FA 2X9GA 1Z06A 4L0CA 5LQCA 3MBEC 2E37A 1R0AL 2O2DA 3SQLA 3GTVA 3JZ7A 3T3GA 4QRTB 1WIOA 4FFZL 1RJEA 3GCWA 4BFFA 3D7NA 2WWFA 4UU8A 2PXYA 5CTJA 1DVYA 5FYDA 1YVUA 2HI0A 5AW6A 3SYOA 1YEJL 3RUHA 2JJ1D 2W2MA 4IKKA 4HKZA 4I0PB 3RGHA 3WXWL 1LP9A 1XXLA 2VHXA 1A6VH 4Y16C 4L5AA 4HEPG 3MV9B 4ESVA 1JWSA 1KORA 3D0AA 2K4MA 5JQGA 1G0NA 2W43A 4IDEA 1L9XA 4QRHA 5IKOA 4TYYA 3GR6A 1ET5A 1TIUA 2X09A 5HVHC 3LT1A 2EEAA 2LVEA 1ECGA 4LHSA 5EORH 3H84A 1ZCAA 5A6SB 4IEIA 3TNNA 1P9LA 4KQ6A 1OT5A 5JCOA 3O9WB 2LR0A 3KKLA 1QYXA 4OSEA 1PX8A 3X3HA 4BVFA 2FZ5A 4V0OA 1F86A 4KUEA 2W95A 4FTVB 2H9IA 3FXIC 5MENA 3FUMA 2PGLA 1G1MA 1E4XH 1U8IA 4U2DA 4OL0A 1Z37A 2OCGA 1OTSD 1T04A 3SHOA 4M7PA 4Y9SA 4BZ2A 1ACXA 3A6FA 2YFKA 2CCWA 4LPWA 4Z3GA 3TYXA 4JBIA 1MDTA 4PJFF 1ZLSL 4R5XA 3T6WA 5I19H 3TPCA 4XRRA 1DAOA 3LGAA 2GIMA 2AC2A 2W4MA 1GKEA 1FNCA 1T6NA 5EQFA 3EW9A 4XNXH 2N01B 2HHJA 4XTRC 3I6LE 3TBYB 1CFSB 3WB1A 2DH2A 2VPXA 1TMGE 5DSCA 3IIKA 4P0TA 2J6WA 3LE8A 1RSFA 1QV9A 1ZM2A 4Y1AA 3DXFA 3HKFA 4BLSA 1YPZE 1WFMA 2ZUTA 1EXMA 3F90A 2XWPA 3ABLB 2HFEA 4ERSL 1OFVA 3AJ9A 4EHDA 2KT6A 5CM1A 4MXVF 3R3ZA 4LQFH 3O5AA 3QIUC 2B1QA 1BE1A 4DADA 5GQBA 3FU9A 5JPMA 2YV1A 2X89A 1Z5UA 1SFDA 5D4QA 1I8TA 5IT4A 4CCYB 3JZDA 3DPBB 1FFOA 3FHCB 4IMKA 4F9LA 2FRVA 4Q24A 5B21A 4RJKA 2NY7H 3JAWA 1UACH 3ULUD 2CUKA 2VA8A 4H7DA 4YO0A 3TBKA 1FNBA 1OGJA 5EMHA 1DC4A 2AZMA 4IW4C 2XZCL 3KOUA 1PZ3A 3FCTB 2NU9A 2C9YA 2DHCA 3TIEA 1AKWA 1DFBH 4ZU1X 2A5JA 3MTGA 4PG7A 4UMVA 4X7PA 3S97C 3I8SA 1Y3FE 2ZUUA 4LOUD 4LXGA 3GM8A 5J63A 2W48A 4Y2NA 4R2MA 3E70C 5ESXA 1IPHA 1HQCA 5CT9A 2WJHA 4ABWA 3STLB 1M1XA 2X7HA 1MO6A 4MO9A 1G8MA 3F4KA 2NVUB 2A3TA 3HB3C 1LNZA 3FUUA 4ACTA 3GP8A 2DMKA 3GC6A 4ALMA 1YEGH 1E1NA 1KAMA 4KTDL 2RHHA 5HHOA 4QRUB 1NGPL 3VNBA 2B8OT 4D6XA 4NBKA 3G5VB 1DJLA 2UXCB 3ARBC 3UJTL 4I7EA 4UTXA 3LHPH 3GWGA 3NYWA 4QBIA 4B4UA 2PWBA 3FQWA 2FHSA 1E6EA 3RNKA 2IY7A 2H2PD 1TVHA 2QTRA 5EO1B 3QKUA 3SDXB 3D2BA 1YBVA 4NNYA 4ZI2A 3MLUH 4QECA 2GK3A 4X6EA 1VKOA 4XPFH 1N5RA 5C52B 2Q29A 5TDPB 1DQJA 4XYLA 2ZRHA 1V71A 3TO5A 4NGHH 1ZX1A 1PN3A 1BAFH 3ER6A 2X5JO 2A7BA 4QRFA 3W11C 2O2SA 4DLBA 4U8GA 1XTIA 2Y0EA 4NQEB 5DQ9B 5AW0B 1ZGCA 2WXOA 3WEXB 5DEZA 1Z9LA 5M95B 2WMNB 2XB2A 1EVJA 4YMTA 3GOHA 2J8HA 3PQ5A 4Y2DC 2VOJA 2AEPH 5TQVA 4A2FA 3PL5A 1T36A 3DOEA 3PWUA 5E4EC 5KNDH 3SDDD 1M9SA 1JG7A 2H32B 2R5WA 2ZSIA 5D2LF 1JFSA 3CLSC 2OQRA 3GP3A 4NHUA 2QTVB 3TXAA 1XGPA 2V2TB 3QXVA 3OA2A 1FH5H 2HJWA 4JJGA 1KB5A 1IJ9A 1X2BA 1ULAA 3RWCB 3QXCA 3TKAA 4B6GA 2ZT9C 2Z93B 1XVVA 1KJVB 5D1QD 4JGIA 3KYAA 3GKWL 2YDYA 3EOTL 3MLWH 3HI6L 4JFAA 3DI2B 4PJ9C 4XOEA 5LAXB 2QR3A 3LS4H 1DJNA 2FMIA 4UM8A 4Y2RA 4BN0A 3QK7A 3VD0A 2GF9A 1J2EA 5DV9A 4YXWA 1OL0A 5FOVA 2NU9B 2ZUQB 3BZ5A 5J89A 2O0KA 1FFWA 3OE1A 3QF7A 3KWVA 5BMVF 3KPLB 1WTLA 4XPIB 4WXRA 3ZBUA 2B2XL 3NDZE 5IF0A 1K92A 2ACEA 3KLDA 4HG4J 2VJ0A 1DJIA 1ZGLM 2HVJB 4NZ9A 3MXWL 4GW4B 3DG9A 3GGPA 2NO5A 3I2CL 3TRIA 5AB1A 3JQBA 3MYYA 2R6ZA 3ZH2A 4X8CA 1IM8A 3MWEA 4XN1A 4GYWA 1WE5A 1VLHA 1JGEA 4MUGA 1KBWA 5CH8A 1N5DA 3HUUA 2PUWA 2XX0A 4ZMAT 5JCJD 1EHLL 2GBPA 4TS3A 4E70A 4G1CA 2NY4C 5CGYD 2D7TL 3ETDA 4CE6A 4LIPD 1WCIB 3WD5H 4KMSA 2X4TB 2JFHA 4BVHA 5KYNA 5I8KH 4FQQB 4N5UA 4LRQA 1UG9A 1HYRC 2EX0A 3F84A 5LJYH 1J0BA 4E94A 3LXCA 2FQFA 5B1JA 2ZX7A 5K0FA 1TFPA 1VZHA 3A24A 3HB3B 3GQBB 4C78A 1WUTA 2FEWB 1AZSC 3R8FA 1LDYA 4U4BA 2GJZA 3GRKA 3A3KA 5T1LB 5DMYA 3H1EA 2WWKT 1ABFA 4J49A 4AXBA 2XX1A 4RTJA 2JCVA 2WR8A 1JP5A 3TM6A 1WOYA 3H9QA 4TULH 4WWNA 3OLCX 3CN4A 1I9JL 2P90A 4EN3C 2J44A 5KTKA 1AMOA 3COOA 4NI6A 3GEGA 3NB0A 1U8IB 3LQFA 1PZFA 2ZTBA 3QIWB 4IDJH 2HJKA 3MTRA 3NCYS 4BO3A 4ENVA 1G1YA 4RHFA 5HR5A 1ATZA 2DL2A 3MCYA 2V74B 5I24A 4KMOA 4DW2L 4QOHA 1EUCB 5SX4H 3ASNB 4KJPD 3LH5A 1DBVO 1XHEA 1TTHA 3GF4A 1CJBA 3I5MA 1PFGA 3AILA 2JFBA 3OZEA 2K7FA 3QTBA 4M54A 4QO1B 4D5EA 1N59B 3BZEA 4G0VA 5DOVA 4JFSA 3HCRA 4M6MH 1U8XX 4U2EA 3MFYA 1RSZA 5E2TL 1EKXA 2YX1A 3R7LA 4HWZB 2C9OA 2OP4L 4C4UA 2PR4L 3KPWA 3FB7B 2VERN 3FVWA 4QCIB 4KGZA 2IYWA 2WHPB 4D3ZA 3WE7A 1JGUL 1GQOA 3T7EA 1AA9A 1RAEA 2J3SA 3EEOA 1OSEA 4Z76B 4URWR 2P65A 4XQGA 3HVNA 2XE7A 1LM8V 4WGGA 1L7EA 3AHGA 2IZZA 3LV3A 3OEED 4YHBA 1NNEA 3W78A 4OL9A 2GR9A 4MQXD 1UWYA 3V1UA 1TQTA 2BFVH 1JI1A 4GYBA 1L0XA 1UYWH 4H0LC 4JC5A 2CDCA 3RC3A 1QVAA 2QQQA 3NBFA 1UZ8B 3VWJC 1KCSL 2IFFH 2BKXA 3HCDA 1AE6H 1O5TA 5HTSA 2PXHA 3TO4B 5KVSA 1C8PA 2EIBA 2PZ8A 2P9RA 3TLGA 4JRXE 1ZIYA 4MXDA 2OENG 1P0QA 3FDZA 2AG5A 1N8ZB 1F8YA 3IPLA 3NOXA 1J9QA 1AB6A 4OH7A 1OFTA 4NAUA 2JKLA 2P3YA 1R3HB 3P4LA 3NCXA 4BQFA 4YDHB 3KH4A 3V4PH 2FEKA 3VM5A 4JJ6A 2YWDA 3U37A 1UMCA 3PEFA 1OP3H 4X3PA 4P2QA 3GOQA 3RUGE 3I9OA 2YJNA 3KOYA 4ETWA 2XUGA 5IK3B 2XA1A 1PNOA 2DIBA 3N6RA 4FYQA 1Z0FA 3TA3C 3E8UL 2NY4B 4KG7A 1A3RH 1G2IA 2H1LA 4RQAA 3ULSA 3KUKA 3D39A 2DL9A 1PS0A 1IN7A 3QX8A 4XJSA 3RVLA 3QORB 1B4RA 5BSRA 3CGTA 3I04M 1EDYA 4IHBA 4KXDA 2HW8A 4Q97A 4G67A 4B44A 3KD2A 1U5CA 3HR5B 4W9KC 4R6WA 4FBGA 2X4UB 3F2VA 1NJ6A 2X42A 2Q5LA 4EIGB 4X7EC 4N2GA 4KN6A 4D3FA 5ITZB 3UG4A 1I5OA 3ARFD 4FQ1L 2J20A 3ND6A 5KBLA 3R7WA 3GSOB 4I6EA 5TEVA 1KJ3L 1BGVA 5D72H 4NFHA 2NTFA 2CCLA 1Y6KR 4OFYA 4L75A 1KYZA 3L1HA 3UOWA 4BL5A 2ZTVA 4UHBA 1RYZA 3R9IA 4K94L 2NZ9D 1WIPA 3RHFA 1ZMYA 2GILA 3UCRA 1KPRB 4OI0A 5E7JA 2VFAA 5JO9A 4DCJA 1Z2KA 3ENVA 2AMGA 3D7RA 4LBEB 3QZWB 4MJ7A 5KVFL 1EVKA 4XWGH 2ETXA 2GJ6E 1M54A 2YY7A 3T5PA 3NBKA 3JSXA 1EFKA 3KSBC 4M9RA 4RK1A 2GA9A 1MW8X 4L5JA 3H7BA 4WEBH 4H8WC 1O77A 3AR3A 4GBGA 3MJ9L 2P9ZA 3COVA 1ET8A 3F49S 4Y6GB 1WZ2A 3SX0A 4OFPA 2R7AA 3ILQD 3V5DA 2WJ4A 3WRVA 3I2IA 1HH6B 4YJ3B 3T09A 1NW7A 1O0CA 3CN1A 2VH5R 7TAAA 4X3CA 1QEXA 4D8TA 2AEMA 2WHVA 5D00A 3SOPA 4Y19D 3NJHA 1J42A 2CA4A 4GP6A 1ZS2A 2Y1VA 3SCMB 2DECA 1NC2B 4MW9A 2ZM5A 4URXR 3C7DB 5J6HA 1LEKB 2AC0A 1CY8A 3U0TA 1YVPA 1HINH 5J3HD 2X9LA 1ZCZA 4KVNH 4RKRA 1AUQA 4YN3A 4JRYE 4KI5F 3K3QA 2BTQA 1H5BB 1WEHA 2HSEA 2W0SA 4LYYA 2HHCA 2QQLH 5BWCA 1ED3B 4HEA6 1HDXA 3IAXA 1Z3GH 1SHLA 2BRUC 5E6UA 2PYEE 3KOOA 4K5LA 2ICWB 2ZXDA 2P78A 3A21A 2ZPTX 4ELMB 3DVGB 3ATEA 2ZRMA 2EXWD 3BE5A 4REOA 2VT2A 3D6FA 4LXFA 3BP6B 1CR0A 3TX6A 2NYUA 2FQ1A 4ZT7A 3HG3A 2WF5A 5IDQA 3PJRA 4MQEB 3QEBZ 5CAYB 1B8NA 1ZKDA 3MCUA 4P32A 3S27A 3P11H 3JQ9A 4X6EB 2QV7A 2BRQA 1Z7WA 2REQB 2ONZA 3AUJB 3OSVA 5I16A 1J5OL 1BXKA 2CNKA 2WU3A 4G1MB 3IOBA 4KDCA 5JAPA 5GM1A 1SKQA 3X1EA 4R2LA 3BMXA 2V0NA 3QVLA 2YRLA 3VTFA 1GSOA 4UU0A 1OQOA 3AGWA 2GZ2A 1YNLL 1VJRA 2EABA 2J30A 1BIIB 2OR8A 2AXGB 2Z35B 3PP3H 1NXTA 4KIWA 2B1AL 5LAXA 3DX8B 1V6SA 3E8SA 4R7GA 4NERA 1W88A 3KQPA 1ZANH 4WUUA 1L5LA 2WYVA 2VJQA 4GVPA 4OHCA 1XGKA 1YACA 1N67A 2JLAA 4GLLA 1LBTA 4AP9A 4R2GB 3AT9A 4NYLB 3KS0J 5F2NA 2XHNA 5IDXA 5EIVA 5LBSL 4OZIA 2LXNA 1ZA3B 3VZBA 4BKMA 2VAMA 3OZFA 4Z3JA 3AEYA 4EKGA 2D8MA 4WEMB 2W2PA 1FCCA 3I3BA 4EZEA 2B20A 2RGNA 3ZW8A 2F9BT 2QVFB 2EVHA 5HVHB 3WS6C 3SGKC 1NUUA 3OQPA 1EO8L 3ZZSA 3ZMRA 3HJUA 3TNMA 1QC5B 4ZYYA 3IDMA 5AK6A 3FU5A 1ZRMA 1VKNA 2EE9A 1BF5A 2NUBA 4K9SA 4G2AA 1DDIA 1HE2A 2C83A 3MRLB 2D2XA 3HW7A 5EJIA 1GL6A 1HKLH 1OH7A 4JIGA 4OQZA 2YD0A 3KU4A 5I7WA 1Z39A 3NPZB 4UQPA 3KSZO 4HLUA 2YJ5A 1RIHH 4ZGGA 3IDAA 2LTQB 2X44D 3ZRCC 1Z66A 2O8VA 3I53A 1ZHOA 4MR7B 5HYSB 3BK2A 4MMZC 2OFWA 4CC4C 3LKNA 2ETWA 3HG1D 2JJ2A 1FCJA 5AVUB 4W1TA 4Z3HA 4YPGA 5AALA 3DP7A 1TKBA 2DYPA 5JR1L 1W80A 2XQ0A 3L54A 1L5MA 4XW2A 2DLGA 3K0AA 1FRVA 4CVZA 3B7WA 2G08A 4EGAA 5DWQA 1Z2EA 2BSSB 1Z4QA 1XSKA 2QVBA 1INDH 4OLXL 1U8LB 3I02B 3CPHA 4D7BA 1O96B 1L7QA 5C7ZA 4MAYD 4GSRA 3C43A 4YXHH 3MCKB 4KKRA 3O6LH 1NLUA 2H57A 1IGYA 1COWA 2QMOA 1H8ED 1A1OA 1FQWA 4X4YA 4BKLA 5HI5D 2J3KA 5C7LO 1DBKH 4LLDB 3T6ZA 1YZUA 3JQ9C 3VJKA 1T1ZA 1USZA 3AIOA 5KQGA 5I9TA 4Q03A 3NSJA 4E03A 3EAQA 3ROOA 3ES6A 1VYTA 2JIOA 1XGUB 3CYFA 1A1NA 4LLWA 1SOVA 3KZMA 2A9DA 2XUFA 5D7NA 2GLTA 3CH1A 1XELA 3B85A 4ONHB 1QK4A 3NHRA 5GZNA 3DPDA 1NVAA 4NXNB 4X95A 4FGSA 5IVOA 3LZOA 4JBXA 4EG4A 4RH4A 2ZG2A 5FJIA 4IOLA 4U7JA 3QFDA 4QSHA 1U3DA 1ZGGA 4PG6A 1R3UA 2O19A 1RQGA 2WVGA 1A7AA 3PB3A 4IV8A 4FC3E 2QSVA 4CCYA 5JH7A 4DV7B 4ORZC 4FKHA 3TZVA 1BREA 4TTDC 3LTVA 5DJDB 3QUTA 5HK8A 1OCCB 2DLEA 4M7LT 4CCSA 4HIPA 1AY0A 1K97A 1SM3H 3ECVA 2AJYL 3ANLA 4H4NA 1VDMA 1OLSB 1XF3A 3U0TB 3E1GA 4OGWA 2BGWA 3HBMA 2IEPA 3UTQA 4ARZB 2F1EA 4HTAA 1RZFL 2UZIL 1GTNA 3MCVA 3KEQA 3F6IA 5E8JA 1G5TA 1QR6A 4LF4B 1Q0UA 2F67A 3CNLA 4D8XA 1ZDSA 3KAKA 5A5GA 3IJYB 1P7YA 1T0MA 3ARBB 5REQA 3HC4H 1Q16A 1UQTA 1QLFA 5CLJA 2L17A 2NR6A 2K45A 4PGEB 3IVKA 1KXJA 3Q7RA 4I8IA 4QGGA 4RRPA 3L8CA 1U8CB 3F7OA 3DTVB 4ND1A 4XMLH 2XMZA 2V8BA 3BLPX 2F0CA 2YUZA 2JGKA 3QI7A 1TMCB 3ZQXA 1E9QA 3QBDA 4JT2A 4UIMA 3MVEA 5CP8A 2PX3A 3U1VA 1P2GA 3DBLA 2ERCA 2XQVA 4JLKA 3NR2A 1XOIA 4NKOB 1B8VA 3E7PA 3W5NA 1XKTA 5ERYA 4C88A 1S4QA 3LZFH 4EP1A 5CS7A 5AUMB 2I5YH 3B5JA 2GSWA 4UNTA 3FTXA 1EXGA 4KPUA 2X4TA 4BFSA 2F7PA 3HL4A 2IF2A 3T9BA 2Z2KA 4JJFA 3F04A 2W0FA 1PW5A 4ODXB 5I76A 1U95A 3TLBA 5E7BA 3G13A 2ZSBA 1B43A 2ID7A 3C39A 1UWVA 2WSDA 2ZAOA 3VTAA 4DZ8B 3BWYA 1N1GA 4PCSA 1PQPA 3IE2A 3MSPA 3BDYH 4YZWA 1M56B 5FGBA 3TZHA 4ENEC 4B5LA 5AJWA 1D0IA 1KIRB 2BF7A 4S04A 4YUEH 4V2IA 1NBIA 5FYKD 5EOCJ 5I7UA 3WKBA 1BOYA 3KPOB 1WBDA 4B2PA 1MREL 2J5QA 3D8UA 1KXTA 2EYRA 2XWBF 1DTWA 1BOGA 4YFDB 1V2HE 1N8NA 3OWRA 1E9CA 3ULUL 4MIKA 4F7EA 3NBYC 1A5TA 1OILA 4G0NA 1Y9ZA 1T8WA 3BREA 4M6OL 2JI8A 4HFWB 4AMUA 1FVCB 2HEIA 1KQGA 3L8MA 1I9GA 5DHXB 4LJLA 3U4HA 3E1F1 2YHUA 4GC9A 5BQ3A 1FS5A 1FRZA 4UOQA 2CE7A 2V5RA 1IG0A 2AXGA 4UBDC 5EU3A 5A3ID 2P5TB 4MB0A 3FPHA 5JSZA 3VYSB 1IAKA 5TF4A 1Y6RA 2VSFA 2FZKA 2NXEA 3ETCA 1YD7A 2X8BA 2RFLA 4Q9RH 5EBLA 4AT6B 4RETA 3ETTA 4YR9A 1GZUA 3C5HA 5GGVY 2J1WA 1GKOA 4NCC2 4ZPVA 1H9VA 2H8GA 4BDVB 1H0SA 4K6CA 4TXHA 1UJ6A 5BVHA 1L4GA 4MV7A 1V7QA 3GJEA 3ZE0E 2DYSB 5SYMA 4NN6C 3ADKA 4G5RA 1COBA 2QRMA 3D4OA 5D3MA 5FUXA 2Q9AA 2DRUA 4M8NE 2MHCA 1N7GA 3W0WB 3QVMA 4H16A 1DQJB 3R7DA 4B6RA 2ALAA 4LNAA 2ZCHL 5CYOA 5B37A 3MX0A 5K4GA 1N12A 2PQMA 2PXYD 4LSSH 4RFLA 4EVNB 2AJTA 2RKWA 2OE2A 1S89A 4K9KA 3DBXA 3B6SA 4E5XA 3S2GA 2LNDA 3JVVA 2I6UA 1RYYA 3NZUA 2I2FA 2NZJA 2ORIA 3HS9A 3VKFA 2O5XL 1JHYA 1L1EA 4JI1B 3CKKA 1JQDA 1MFPA 3ZOZA 2GUOB 2V45A 4LZOA 4YIQB 3HE6D 2FPIA 1TNNA 1EX9A 4CQMD 1J99A 4U6VL 3PKIA 3RYFB 3E80A 1GAEO 1ADQH 4BO2A 5EWIL 3X2QB 2QGDA 2HLDA 4BMZA 3D25A 4BRSA 2H6PB 1RKUA 3K6DA 4ZO8A 5DN6D 4MEBA 1EEXB 2LD4A 4IK7A 1Z73A 2I3AA 1SKYB 4DPBX 5K59F 1HMYA 4V0QA 2XN9D 1YIOA 2QZQA 5JW3L 1UH5A 2I4TA 5IVXE 3WY9A 3E27A 4R98A 3LX9A 2R44A 1H2HA 4UEOA 1L9QA 1GZPB 1Q94A 4FQXC 1LK7A 1IN8A 3UZQA 2F3PA 2PSSA 3ZI7A 5LDUA 2XV2A 1GNTA 4HI0E 1O0SA 4MA5A 4DRYA 2WAYA 3S29A 5I17B 3WR5A 1B00A 1DIHA 3ABGA 3OBAA 1NBHA 3SFTA 4NJMA 2Q3HA 1B3JA 4CQJA 1YZLA 1EJ6A 3C8MA 5BT9A 3ORFA 5LL6P 5AD0B 1FHNA 1QBBA 5E2UH 5CA1F 2CJTA 3WNKA 3IF1B 3QZBA 3WKEA 4F4DA 3A0OA 3ZDQA 2VM9A 1HWHB 5IESH 1OSPH 3AACA 2WZQA 3SGKA 2Z2JA 2XWRA 5LPNA 3MV7D 5DD3L 2HMTA 4RTMA 1PX3A 1EAJA 4PBWD 3IN0A 1LPSA 1JWSB 2HTKC 1UMBA 5K01A 3MRVA 1TIPA 2H2FA 5H8WA 2QBYB 2RJMA 1Z2AA 5DD1H 2IP4A 3L4UA 5JNTA 2ZP1A 1NGZB 2IHYA 2UZYA 2P7TA 5IQLA 3RE1A 2ODNA 3VI4F 3OAYK 1THAA 1HH9B 2GC4C 4MWEA 2EIMB 2AERT 5DHVA 1JSRA 3BRWD 2PW1B 3PSAA 3TVMC 1YA6A 2BM8A 4JY4B 4XB3A 2FQDA 5I26A 3N2KB 2J45A 1EAPA 5EE9A 4E09A 1MIEH 3P4OB 4HS4A 3LRSA 1VEPA 2R8OA 3TA3D 1WWKA 1S0UA 3L4SO 4H6XA 2X6VA 2J6BA 3IP8A 1CXHA 2V58A 1UMCB 4P3KA 2XA3A 1QJCA 3UCXA 3D2TA 1PGJA 1ETZA 1J7JA 2L0DA 3PE6A 3RL1B 4U6TA 1BV8A 1QPXA 4J1TC 2TMGA 3WBBA 1C5CL 3AFHA 4HLZH 4HXAH 5AJXA 4EA6A 2H45A 1E7UA 2XY1A 4J90A 5FHBL 4TMFA 1KKMA 1KCLA 2F43B 5F71A 1L7PA 1XA0A 3L4XA 5HPMB 5I0WA 1YB4A 3LHAA 2X8LA 2OTWB 4R9RA 3V4UH 3DAPA 1KENH 3SX2A 3JQOB 1BEZA 3QQ9C 2WQRA 4XRCA 3S1AB 1SUHA 4W6YB 2Y6SD 4DKAA 3KX2A 4WFGD 5EKTA 4YRBA 4RVGA 3WHIA 3VH2A 1C08A 3W04A 2PWGA 2YZMA 4NI5A 3WJMB 5JY6A 4PJ5A 5DJ2B 5C9JA 2WSPA 5ADVA 1FXWF 1EANA 3AUTA 1HI9A 3NPAA 1I4FB 5ITBL 1X3SA 4M22A 4IYJA 5C08A 3H85A 2OTUB 1DQDL 1GUDA 1A5SB 1XX6A 5GGXA 4P3DA 3FOEC 3QC5X 3EH3B 3BFXA 3ZV7A 3MUJA 3WKYA 3NXKA 4FXKB 3AZUA 3L2OB 4HNSA 3F7YA 3H3FA 3LQQA 2CJUL 3MBWA 5IVDA 1QP7A 4QEDA 4F5YA 2H07A 1SEPA 2UVPB 1X5AA 1HHJA 3AJAA 4L76A 4URVR 3RPKA 4EGCB 3TL3A 5IJZA 1Q1JH 1KYOJ 2FQEA 4IIJF 4CKBA 4S1RH 4IHQA 1KVRA 3P4UA 4A6DA 4KN9S 1PQWA 4QY8A 2ADJA 2P45B 4F86A 5BN3A 1FJXA 1BX3A 2IH1B 3P9PA 3QEOA 3KQNA 1ZC3A 1KFBB 2OSWA 1T9CA 3R5TA 2MHAA 3FSGD 3KHKA 5IBRA 5CB4A 1IIKA 5DBGA 2BVNA 4R2WA 4FFRA 2GFBA 3E9TA 4DZ8A 3TEYA 1BEUB 3M82A 4IBVA 1E90A 2XA8L 3GHEL 2IH5A 1KYWA 3L9WA 3Q8XB 1UFRA 3O8NA 4W4OA 1JBEA 3IR6A 3ZTNH 5E4AA 3JTTA 1D2CA 2WIJA 5BSMA 4TSRA 1PJAA 3I9GH 4LJAA 3TVMB 4NRYB 1H3WM 2XG5A 4QKXB 3ULVL 2EG5A 2I6GA 3SG0A 1WLSA 4YUZA 1FDLL 3N2GA 4WUVA 4XGZA 3AQ4A 2K7ZA 2E4AA 3CFCH 1AKUA 1SJEB 2M26A 2A6DB 5J1SC 5KOYA 3ZDXE 2NTFB 4RA3A 3GUVA 1HOXA 1VIYA 4RAOA 1WCXA 3HWWA 1SDDA 2A5DA 3B6MA 3LS5H 4DR1B 4FM9A 4OB5H 5DQJA 1MFEL 2J9FB 3EG5A 2B9BA 2YD8A 4R2GC 4B50A 3AABA 2E0PA 3JYCA 3V52L 1CSEE 3UZEA 3QV1A 1UA6L 5J5CA 4G8CA 2BFMA 2ACVA 3WIIL 2HZBA 2NRDA 3B9RA 4GE3A 2B1HH 4J6EA 2F18A 1Y1SA 2XWTA 1ZPDA 1YDPB 4U3CA 1ZK4A 4ZFFA 5F9AC 1DWQA 3O6VA 4P0PB 4NQVA 2W2QA 4P5KB 3RDTD 4LXHA 1PLGH 2J57A 1N77A 1JXGA 4IGEA 4BSVB 1J0YA 4RSRA 2TECE 3PWPD 1IJEA 5HE8A 5FGCE 4ZUSB 3TBWA 3GFFA 1D5RA 4IJ3C 4PLJD 1ULTA 2EWMA 2YD1A 4S1QL 3RRMA 1U1FA 4PCAA 4FF9A 3TNLA 1FNLA 2A33A 3LCUA 2H2SC 3A32A 3SZ3A 1HKFA 1TD9A 3KD4A 1ZJYA 2NY2D 1X7HA 2CUMA 4HVAA 1YN7A 5CSZB 4JU8A 4MMZB 4MSWB 5AW6B 4YVNA 2J9XB 3MJRA 4JI5B 4DLTA 3VFRA 2ZBFA 3TO4A 3BE6A 1INDL 1F2DA 5L0QB 1GIGL 1WJGA 3H1BA 4ZARA 4MQ4A 1E4JA 2CCKA 4DLNA 1N6UA 5FDWB 7PCYA 3K6JA 1RHQA 2GPSA 3EF1A 3DUSA 5DJCA 3GNML 4JB9H 2J72A 3NHFA 4F7KA 1K2DA 4CU5A 3M4NA 2QPEB 4RFEA 4B4OA 1QBMH 2VTBA 4HX1B 3H7AA 5KI6A 2XMDA 1GYAA 1KHTA 1H3PL 2P5WB 3MRGB 1GZ5A 3LOQA 3PWNA 1QIEA 2D62A 4LLDA 2MH4A 4MQUA 4KZCA 4P4GA 3UEOA 3OB8A 4FJ1A 1S7GA 2R56L 4UT6L 4O4LF 4OAOA 4EYKA 3N91A 3VXUE 5KYVA 3V8CA 3ARDD 1KFAH 3F83A 2DFNA 2HT4C 4X93A 3NPSB 1IGIH 3GXFA 3VZSA 4BMDA 1TJ3A 3HI6H 3M6FA 2ZP0T 2NU7B 3EQ6A 1OWNA 5FPKA 3F8WA 1SJEA 1AKQA 1S4IA 4QQ8A 5IAGA 3HLYA 4RIEA 4DLZA 2CT8A 4LMRA 5IKCA 4EQ6A 1MX1A 4JP5A 3SEFA 3SDCC 1DKNA 5IUCA 2ZYRA 5EBMA 4K73A 1K0FA 5DM1A 4G8EB 3KBFA 5KSZA 2SODB 1FSKB 1IAII 4L3CA 5ERWA 5B39A 4ZU6X 2V8LA 5MEOB 1YUMA 1WDLA 2PFSA 4LNUA 1AH2A 5CU9A 3MA9L 4LOAA 3VI4E 4JLNA 2UZIH 4G5AA 4WHTB 4NEQA 4MMYB 5CURA 2JJUA 2EGHA 2E46A 3MBEB 4JYBA 4UNIA 4HEJA 1VJSA 9LDBA 2NX5B 1ZYUA 1P1CA 1GGTA 1ENPA 1AS2A 2D7MA 3NP7A 4JVPA 1JVLA 4WEUD 3RJOA 3SN6A 1KT2B 3N59A 2OPBA 2CIKA 1ZNWA 5KJFA 4DEVA 4TVPL 3U9LA 3W9UA 3H2PA 1IK6A 4N0CC 2RHJA 5KSBF 3V6OC 2ADFL 1C8BA 3WUWA 5AQEA 2OL3A 1GPYA 3RARA 5HQJA 5I0DA 4Y16B 2OG2A 3KBEA 3NEJA 1YBFA 2HD4A 5EVJA 4J6IA 1W0VA 2QRLA 3DWFA 4BDSA 2F00A 4S1OA 3MBWB 2ADGB 3GSNA 1NVVR 1Y8QA 4L8SC 4QAWA 1IEVA 3DSFL 1GXEA 4YV2A 5KNCD 2EYUA 1F60A 1KB5L 3BUTA 1IVNA 1S3FA 3QCUH 3CDFA 2VO5A 4B3RB 5BQXA 2WIKA 2JG3A 1LZLA 1X1RA 3VBEA 4B95C 3KU1A 4RTOA 3QEQB 1GJUA 4WF7A 2G3XA 1RS0A 3HG1B 3SDSA 5C35A 8FABB 3N8KA 4LJ9A 2WFLB 4BSWB 5E95B 1QRNE 1HX0A 3I85A 3BQVA 4EG6A 3NK3A 2JDIA 3OQRA 2RHDA 5BYBA 1YUKB 4X91A 4M0EA 4A23A 2PTGA 1CFTA 2HX7A 2O6EA 1OTSC 5L0QC 4U1LB 5AW4A 5TH2B 1Q21A 2XB8A 5B58C 2RBGA 3V7AE 4MNQB 2F3TA 4ZQCB 3KLHD 3EVBA 5AVQB 3NUGA 4JQCA 1G291 2ZS9A 5EE1A 1VZ2A 4CVNA 1MC4A 3LH9A 3KL2A 3JT2A 4JSYA 4TMTA 4XYMA 4XVQA 2K70A 4O3UB 4IDCA 4CLRB 4H26B 2XW6A 3H1GA 2KKQA 2NY5H 4UZEA 2GW5A 3LTNC 2VYVA 3HI1A 1IGCL 2YRBA 4OQYA 4JMPA 3OC8A 3E3OA 1I2ZA 3WIHH 5KDDA 4LFHD 1W76A 5KYYA 4YCAA 1RLIA 3ZXAC 5CIYA 1XQYA 4JBNA 4RXUA 1OJLA 3AQXA 1W73A 2WOJA 3IT0A 4Y2OB 4P5KA 5AYQA 5CBPB 2CXPA 1BF2A 4YJGA 1GQFA 1DQNA 4B9PA 4ES9A 1CICA 1U98A 4R71A 4WZBA 1P7WA 4ZMQA 3LN4A 3ZR5A 1SM4A 4KOEC 4HC4A 4PR5B 3L92A 2OECA 4HK3N 4XHJC 2D3LA 4JR9H 4AJEA 5J13B 4DYVA 1PDKB 1XIWA 1KDZA 5ALOA 3OPMA 4PWIA 5HI3C 3DJSA 1HU8A 1EUQA 2C5SA 2EDWA 4CUKA 2J6IA 1W36D 3I58A 1V7MH 1KI8A 1WAPA 1LW7A 3ARBD 2DHQA 3K09A 3EXIB 2NQ3A 1NUHA 2F1KA 4B6PA 4BECA 3QXTA 3QUKA 5ISZB 1E7SA 3F65A 4AMBA 2F17A 3DETC 3K70D 5FD8A 4R54A 4UMFA 1WDMA 1NCUA 4H5SB 1G5HA 4UJ3A 3WMWA 4MTMA 4BEIA 3GX1A 2XMRA 1MJ8L 4FQ8A 3BUQA 4JQIA 2V9TA 4ND2A 1MG2C 3CB4A 3GO4A 1IAOB 5BXYA 3I05A 4AYID 4TSAL 1K5HA 4TPKA 1UDWA 2DBZA 1XEWX 3N40P 3B1ZA 1U63A 3NZSA 1FN4A 5IOKA 2VXQA 3A5VA 1WLYA 3HN8A 2BFCB 5JPIA 1OHHD 3ZHFA 2YC4C 1UR5A 2AANA 1C3VA 3W5UA 1JU4A 1ZI9A 5LMUB 3AZOA 1UC8A 2BNUA 2ZVJA 2Z2IA 3O3UN 1H1TA 4PPYA 4E22A 2G36A 2VDQB 2WLTA 5ALJA 4BJ1A 1AR1C 1J12A 4WWKC 3OZIA 3EJCA 1PFYA 2A86A 3FT1A 2VKQA 1FHGA 3UKOA 1C16A 1DO8A 5CVJA 3EHBB 2PJDA 4GMDA 4FQXB 1K8DA 1A3CA 3QKTA 2AQPA 2P35A 1KJVA 5FGBC 2X1PA 2VAVA 3R0NA 1NMBH 2KLTA 4IINA 2ZJ0A 1MHTA 2QRNA 2OQJA 3NETA 5DRWB 1PQYA 5JFTA 4LCBA 5G4NA 3GVXA 4D9HA 3WTTA 2NSLA 4O2AF 4LF7B 3CNKA 1SC6A 3QXAB 1HXMA 2M6KA 3U0PA 5JU6A 4EK9A 3FT3A 5GRJH 3H5NA 3K0CA 5IHUL 3L1IA 1E1QA 2A83A 2IH8A 3CEAA 3CHQA 1FFCA 1Y7TA 4HL6A 3C8KA 1N2CA 1SB9A 2ZUQC 3ILXA 2EX1A 3FQ4A 3X13B 5BV7A 3U4AA 4WEBL 3CU5A 1DXQA 1C1HA 4ZAWA 4UDUA 5E4FA 1QGUA 5IHXA 1I8KA 2PNFA 1C08B 1UBOS 1EEYA 4B0PA 4BEVA 1AIFA 4J1QA 4RVUA 4JO1H 5I1AB 3PIRA 1ZVKA 1U1GA 4DLUA 4PV7A 4K71B 5EWJB 5J4YA 4MYTA 4OA8A 3WGKA 3I6GA 2EDXA 2VPQA 2OJEB 3TNDA 4JT8A 2EYTA 1EVLA 4DUXA 3DMGA 5GS3A 5DJDA 1BAPA 4AKHA 1BZYA 1H94A 2YH2A 2AFIE 4P07A 1I0ZA 1QHGA 3LVBA 2PT5A 3KPQB 2MMCA 2PUCA 5FPPA 9ABPA 4AEEA 5KW9L 4YT5A 4DO4A 2ZYHA 2FWOB 5C3LD 4L5YA 5AAWA 4CGYA 5CIWA 1SM3L 4AYFB 1XPRA 3UUFA 5TE6H 5HZHA 2CLOB 1D5MB 1R4ZA 2Z31D 3FFDA 4N2CA 4RGQA 4BQRA 5FCSH 1OLZA 4BK8A 2PKQP 3FE2A 3R19A 2EZ9A 4RFNC 3BYTA 2OTPA 2XG4A 1J2TA 2FZWA 1J9EA 5BURA 2DWDA 4P2RB 3BS4A 3JXEA 1C3XA 4X5WB 1LFDB 2ATIA 4RMSA 3O3EA 4K9RA 4FZVA 3OHPA 1HEJC 1T1ZB 3EBHA 4EN3B 2R79A 1CUFA 3AW9A 4WNSA 3ZCXA 4B47A 5CW1A 5JS1A 1Z9MA 1EINA 2G5PA 3CCBA 1TT5A 1W72B 4B74A 1NR7A 3PS6A 4AEFA 5C97A 4OVUA 3QNZB 3S4SA 4OQNA 4PGDB 1NCDL 1NL0L 4NB7A 2B1IA 2VQEB 2QV0A 4A8JC 2VDRB 5CLLA 3NSDA 1XTRA 4ZDJA 4ES6A 3UHJA 1Z2CA 4D3DA 4REMA 4YRPA 3DV4B 4TSBL 4LAJH 1N5YH 3IU3B 4B9ZA 1T3FA 2AJCA 2ZQKA 1OC2A 5IN5A 2AW2A 3J07A 1KBGH 1N8TA 3QJHB 1FOEB 2TSYB 2P3SA 5C3IA 2YW9A 1A8JH 4BX2A 3S36X 4WWKB 1AR1B 4ZVRA 4OGXH 1HHIA 2BFGA 1A7PL 1IZ7A 3EJWA 1IKNA 3AUXA 3QV2A 1WQ3A 4GQAA 2WUBH 4U8HA 3P30L 4IIQC 4ZK2A 2F64A 3PDUA 4ZZ3A 3KJFA 4I4IA 4GUAA 5BQ5A 1HNWB 2BGLA 4P4UA 1FFTB 5C07D 1JDNA 4GW4A 3ISYA 2PX6A 4FT4A 3ZUCA 1E6CA 1FF5A 1R19A 5C0AA 2ODQA 3KDMB 3OE5A 1A4AA 3VWJB 3DTVA 2CVPA 2IP1A 4RBPK 2ADJB 1IWPB 3UADA 1BD2A 2M1KA 4ZW8A 4XAKD 2F7IA 1CDDA 4PCKA 5EPUA 4W5NA 3EPPA 1QD0A 1U58A 3OTOB 4RTRA 1W15A 5J9PA 2BFEB 1L7OA 3OFKA 1PZGA 4I9HA 2X0FA 3K5RA 4IQFA 5FRDA 5F2EA 1F1BA 2YZ2A 2VSQA 4ARUA 1V8PA 3NIGF 3ZNNA 2FE1A 4GAEA 4MDHA 4XVJH 4KKAD 3IDFA 2Y3IA 3ZKMD 5LP1A 4K71C 3MAAC 3QXDA 2FJUA 3O11A 3UC5A 4Z1MD 4ZAKB 5IIEB 3REQB 1FG9C 4QRPB 4JKIA 4LL1A 3H18A 4N8UA 1K8ZB 1RPQA 3TA3B 4NH0A 2H5EA 4OFVA 4BAUA 4I48A 1O4VA 1XQ4A 1VPOL 4NXKA 2CVFA 3G5YA 3DHMA 1NFDB 4DYDA 2WU4A 1JIIA 4LO9A 3I0MA 3K7UA 5B55A 5J1SB 5EA2A 1MEOA 5HUHA 1GUFA 3ES6B 4PHCA 4DGYH 4OQFA 1V41E 3DMRA 4LDPA 4IZHA 2BY2A 4G5FA 3L6FB 2G75B 4KDTA 3GPBA 2KC0A 2WANA 1GPOH 1ONBA 1NEZB 3WO1A 2B36A 5KSVB 1EESA 1SVBA 1MHHA 4AECA 4BRJA 2J0VA 1K75A 5JJBA 5EZOL 4B3GA 1L1RA 3IP9A 4HADA 4KLCA 3Q41A 4LCJA 3LPFA 2QW0X 2ZJFA 5EJ5A 1E28A 5IZCC 5SYNA 1ZV2A 3Q0TA 5F7EH 3VMFA 4B8ZA 1CLCA 4JY6A 1JHVA 2R2AA 5EEWA 1Y81A 4JRLA 3LVTA 4DP7X 4ZQEA 4CTMA 3LRPA 3HDYA 3DEHA 3BP7B 3UX9B 3O8QB 4HVBA 4MA7L 1BN7A 3RY6A 4MR7A 3DSRA 4PJ7E 3FBKA 2ZIAA 4D9NA 5D84A 6REQB 3PAZA 4U7DA 2RCYA 3RVSA 5GGVH 2G5BA 2ZKWA 3MJVA 2D03L 2PGNA 4KVCH 2UZXA 4JI3B 4AJ4A 3FU7A 1XDUA 5B3JC 5EOCL 2DBYA 3KHQA 1MZVA 4UYPA 2PUDA 1JZTA 2C2BA 1YOVA 3AXLA 1HQ4A 3CSGA 3OEHD 6ADHA 4OF3A 2WOBA 2AYYA 4OZIE 3ALWA 2XMPA 3S8WA 4NK5A 2XNCA 1I7UB 1TM3E 5JD5A 4QR7A 2DQEL 2BR4A 3KPNA 1VKXA 4GBJA 3RJTA 5CA0A 2QTTA 5ILGA 4NXMB 3CNBA 2I62A 1PT8A 1RXWA 3DZGA 3NP3A 2VP9A 2Q6TA 3GK8L 4G42A 4CC4A 3NRPA 4JO1L 5LOVB 4M7KH 2FPSA 3L18A 2FYVA 3VG0L 4KITB 3STTA 1IUOA 4FD2A 4KO5A 4N2EA 2B30A 1EO7A 1BVLB 1M8FA 4MH0R 3G82C 2ZB4A 1Y7IA 3L4JA 3JYHA 1WFNA 4R83A 4KFZC 5DS1A 3RTAA 3IDYB 3PEEA 1T2UA 3O9ZA 1UKQA 2RSLA 4F71A 1VAHA 3HFSA 1FSGA 4HIJB 2FWPA 3BYYA 1UD4A 1OV8A 4EY5A 3UBXG 2MRYA 4E36A 3CZPA 1FBIH 4XVUA 1N64H 1GUYA 5GJSH 3UCQA 4DLWA 5TPWA 4M88A 4YRJA 1EDOA 1ZH0A 1I9IL 3GYGA 4WNAB 3VV2A 4OV6F 1E6OH 4EOWL 1VIWA 2NUPA 3HMXH 2B2XA 4G8AC 1FSKC 5FLVA 3W7BA 1WSDA 4P4SA 4U3SA 1NBMD 1E43A 4KBFA 1IQDA 1MCPH 4G82A 1A9ZA 1ILEA 1A22B 2R48A 2F58L 4YJKA 3H54A 4HK3J 1B8UA 3GCZA 5FFLA 4M5YL 2A6IB 3T4EA 4PCVA 1NR1A 3LC7O 2DCMA 4JZNB 1JYVA 2EWVA 4L29B 2ANCA 1KMNA 2YWJA 3LY8A 1OIWA 4IRZA 1JVNA 3G2OA 3KNBA 3LPGA 1UPTA 4RQQB 4D0LB 4F0JA 2ZGVA 1Z2OX 2OD9A 2WBJC 1QFSA 5ESWA 1P1BA 1G7MA 4FQLH 2EW2A 4HEA1 3KBOA 3VMPA 3X13A 2IOHA 2WQZA 4ARCA 1G3UA 4HJUA 5I9SA 4ALLA 1P6WA 2NZ2A 5L8JB 2VYRE 3QEUA 2BO0A 4DG5A 3WS3B 3AT8A 4QYMA 1TQHA 2X3CA 1VCMA 4BZ2L 3KGUA 4F2GA 2V7HA 4N0CD 2BGRA 7REQB 4B71A 2Y1GA 4L8SB 1XEWY 1A8IA 5EXSA 4ETQA 3C45A 1YQTA 3NFSH 3HHRB 1WNTA 1I2BA 4LKCA 2MPVA 1S7QB 3NIFE 1USVA 4QVKA 3IRPX 2YOAA 1KCWA 2AXFA 2C9RA 1L7TH 3R5SA 1WSBA 4WTZG 2C7RA 3AESA 2XVXA 1ZJAA 3BEWA 4XTCS 3DZ8A 1DO2A 3D4BA 3B8YA 3HNSH 1BXVA 3G9XA 2VJNA 3MGOB 1DVUA 3T3IA 2LTQC 4KFSA 4EW2A 2JCCF 3H19A 1OGAA 1BAFL 5AOZA 5GS2D 4AQ1C 4TLLB 2YWEA 3RUGA 2VSYA 2C2WA 1BHSA 3EZ7A 1C5BH 4JLRB 3PXEA 3OCVA 1JD9A 2G60H 2AWNA 4IKIA 2FDXA 4PZPA 1N7ML 2Z09A 1HSAA 5EUKA 4WI3A 3BEWB 1WP9A 4PLGA 2DQJH 4Y4FB 3VSBA 4PJIE 3VTKA 4G0ZA 4XVOA 3LNGA 4F3FB 3OE4A 5LXVA 1A21A 5BW7C 2H2IA 1OXMA 2AG6A 4UTZA 1AGNA 3OEHA 1MNUL 2VJMA 4HPYH 5IHPA 5GADl 4NHCL 2H0FA 3OEWA 1WITA 1ERNA 3F6PA 5EUCA 5CNJA 2VQTA 4DJAA 2VN6A 2FVYA 4DKDC 3O3OB 3L45A 3PIDA 1T5IA 5IABA 1KJ8A 2I76A 4UNRA 3CX2A 4IOKA 1L3BA 4HJGB 5JMRA 2R4TA 3VXSA 4YEDA 4G63A 2OO5A 5TNXA 4ND3A 1FLRL 4DMFA 2ET6A 1VB5A 1U91A 3IDXL 5I6PA 1ABEA 2JI6A 5AVKA 1AQHA 3NX4A 4YR6B 2Z31A 1GN9A 1UM5L 1HCYA 5PCYA 2AGVA 1E89A 3H4MA 3O2JA 1XQWA 4E2ZA 4RLSA 3MBED 3DX2A 2WKOA 1KU6A 5DUPL 4XVSH 3GXUB 3TBTA 5L51A 1LO0H 4JQYA 3RVNA 1ZBDA 5CFAA 3G5MA 1V45E 3FH8A 4FHKA 3SYRA 1MIMH 4NU8X 1ACJA 3DXAE 4M6OH 5LWYH 2XCLA 3RA7H 4P35A 3U17A 3BSZA 5T3ZE 4BOYA 3T4PA 5DHRA 5HYEA 4L0DA 5AW8A 1L9TA 3WD5L 3QPVA 2QHXA 4L8WB 4NICA 2XN0A 3UYLA 3Q8BA 4CETA 3FC8A 1HE3A 3KPRB 3NQKA 2DBVO 1EBAA 4I0PC 4MCJA 3CWQA 4XJTA 4YHZL 1QONA 2AW3A 3G6KA 1ZOPA 2CNDA 2GHRA 4NBTA 2VXSL 3SJUA 1WBYB 1OF1A 2O0LA 5L88H 5CZVL 2J1KA 3HMWH 5AI0A 4IKLA 2GUWA 1QU2A 4Q1EA 4KP7A 4F3YA 1W46A 2B83A 3F58H 5KJ6A 5L3VA 2H2DA 4ZI5A 4XSHA 1QRTA 5EWJA 4WFQA 3SHWA 2YV3A 3BH8B 4XOIA 3B8EA 1MWAA 2BVUA 3R3VA 1TYJA 3TU6A 5I1GH 5LOVA 2WPGA 3GMNA 4QGYA 5TIIA 1ZIDA 1W1UA 4BV9A 4GPAA 4UBJA 1HC7A 3VD2A 1CDBA 1SQ5A 5CCHE 1JKJA 2LDBA 1KO7A 1SUWA 5KBKA 2DX7A 4HOMA 1BMWA 4HDOB 1KEWA 4HB0A 5AMXA 4CT4B 1IM9A 5DHYB 3G5YB 2GD1O 3BGWA 4FFYA 3VXOB 3V7FA 4AQ1B 1TQ8A 4OJMX 2OK0L 4AKTA 1FZMB 2DWPA 1KY7A 1NKTA 3EJYD 1WB5A 5B38A 1KO8A 3RTDA 1OX6A 3ZSTA 4F5CA 3VOTA 2Q8QA 3QWRA 4FZ3A 3DYBA 3O11B 2BCKB 4X9BA 4I2XB 2X3YA 2Y5TA 4Y4KD 3BQUC 2RGYA 3BDIA 3PJNA 5KYUA 3CDZB 3IUYA 4J4HA 4OTZA 1RRVA 5D7IB 4Y4FC 3MOAL 3OSKA 3WLRA 1QWSA 1ULBA 2QGBA 4DSYA 1Q92A 3Q7EA 2UYGA 2VITA 4GP9A 4AJLA 1KGYE 3NAGA 2P9QA 2VUTA 4JG0L 4PSRA 4WNQA 3SVTA 1OKEA 3IMEA 1LX7A 2A9CA 3C8ZA 1PY0A 4LJ4A 4DC9A 4GF5A 1Q1JL 5C0AB 2IPKA 1EDHA 4HMOA 1QVOA 4BCCA 4QYWA 2Q7AA 1BWWA 4PG2C 4Z9BA 3PYCA 4DPMA 3EFEA 4K03A 5HF8A 3ES9A 2M8XA 4PZAA 3T0ED 4Z99A 4A6YA 1A9TA 3URMA 3QE2A 4Y9UA 5GONF 1VRWA 3VGHA 2B1JA 2HSWA 3SY6A 4LSZA 2FSHA 1XF5B 4RPIA 4AX3A 3LUBA 3RVMA 2NY3D 3A9VA 5JVDB 3KSDO 3FTCA 4NOKA 4PRIE 1M57B 1G18A 2FIKA 3HKZA 1SBZA 3I8OA 5A2CA 4Q6IB 2CK2A 1J1OH 3NKFA 4E7PA 5EOTA 3ERXA 1MWOA 4ROTA 2WWXA 5IHBA 4DPCX 3BD3A 5F9OL 3EJTA 1UZ6F 3VU8A 1HSBB 4OP1A 2YD7A 3O2DA 3S8YA 3S0JA 4JLJA 3ISWA 3EO9H 1LK3L 5CFOA 4YNYA 3ZDDA 3HUJA 3ZQKA 2ZT6A 3FRPG 3OCCA 4K94C 1Z5NA 4QLAA 2PG3A 1EK1A 2VYCA 4QBKA 4M5ZH 1Z4IA 2P6PA 3I9NA 2G2PA 1S46A 3JWHA 1BLNB 4AM0A 2JH8A 3BJ91 1B4JH 3CRRA 1K2DB 1BQ4A 1CDUA 3KZNA 4JPSA 4QYXA 3CWGA 3ULUE 1QIFA 3MU3A 3TK1A 4Y88A 2HMWA 5EIWA 1A9BB 4U05A 4CN1A 3BXXA 5A02A 4IRJD 4HC1H 5HTOA 5EC2B 1X92A 4EQ2A 2K0RA 2F3UA 3W0WE 3PWUB 5I1GL 4DBVO 3GUTA 5GS0D 4FE9A 2OGUA 5CLYA 3DR5A 4AL8H 4Z7NE 4ODWA 3V4PA 4TLTA 3KZCA 1TCVA 3DA0A 4WKOA 3ZQ4A 2WB2A 3VFNA 5K09A 3T9DA 4BTLA 3HM9A 3SP1A 4H26A 3KLAA 4JHUA 2H0PA 4DEYA 4EEXA 1JAHA 2ILLA 1MWAL 1A6ZB 4DZBA 2C5HA 1EVIA 4QM7A 4FT2A 5FKJA 5D2NC 1S7XB 1EK3A 4QRPE 1RULL 3USCS 3ILYA 3PQEA 4FYRA 1G5QA 1IWOA 4AGQA 2H2AA 2QNIA 1IBRA 4TRPH 4AL8C 2FFHA 3I62A 3DJFA 4LDQA 3OR6B 4U3SB 1PJSA 3ND8A 3S1SA 5D5PA 5D5ME 1E4XL 5T4BA 4AKGA 1G20B 1WBYA 3FO0H 3VXUB 5DU7A 3PHOA 1AP2A 4H0GA 2IHVA 4NKDA 4ALNA 4QDXA 1LRJA 1I3RA 2SKEA 2JASA 4RD4A 3MDJA 3DVSX 1YZKA 1KDYA 4RF2A 5AW8B 4URHA 3K91A 4QYOB 3OHXA 1ORQA 4ATWA 1ZHNA 2BC9A 5KYKA 1DIBA 3N44F 5HDWA 4X5WA 1Z08A 3OKEA 2AP2A 3D3QA 3EUAA 3FZUD 3PUVA 4XWGA 5D2NE 1YJQA 5LYYA 4NZUL 4F4IA 1A4RA 4YJ3F 2ZI6A 4E4RA 4OXKA 1GSIA 3BZFB 2JLLA 3AXIA 4UM9B 3AU0A 1SD5A 1ZDMA 3UTTB 5JIIA 2DXIA 2Y69B 1IGIL 5CBEB 3GEHA 5IJBC 3QISA 1FE8L 3K71B 3SC6A 4MVWA 1T24A 4Y7MA 4KRXA 4O2CA 1NG9A 3E9QA 4Q6IC 5T1KB 4C22A 3ETEA 3W81A 2JNZA 4TN5A 4P2RD 1NMZA 3C1AA 3HEIB 4Y19A 4GNRA 1XCTA 3CSUA 4ZFZB 4JQVC 4NCXA 5DNWA 3IV6A 3PA6A 3CH4B 4IIFA 3HKCA 4G8JA 2FK8A 5I7VA 3CRZA 1Y0LA 5BOSB 4PJDB 3L8FA 3EPLA 4CG0A 1RZ7L 3EVEA 4M1SA 1DDHA 1MP0A 3FDFA 2VP6A 1T7YA 2Z2YA 3NIDF 3H65A 3DX6A 1VHJA 5DTFA 1GGJA 3X43A 2FRGP 2QY9A 1C9EA 5BNIA 3VR3A 4RY2A 1QDLB 1XDTT 2JK0A 4A39A 4ZUWA 2JKSA 5IBTL 3LHKA 5EUOA 3FT3B 4YFLF 1TYDE 5DGHA 2NSJA 5D1ZA 3UJ7A 4LGYA 5IB5B 3WIFB 4JJZA 5T6BA 5BQDA 3IFLH 1UWGL 3SQDA 4BRVA 4N5IX 3RPIB 4YJFA 2F59A 5T5NG 3F5QA 4DNFA 3SM3A 4AQYB 3D34A 4FLOA 3EZLA 2XGJA 4E51A 2YV4A 3O4IA 2AJBA 5MEQA 5CW2A 3V6ZA 2CPUA 4OOFA 1YIAA 4WKZA 4BD4A 3CS3A 3VWJD 1UBRS 3K8YA 3MJSA 1OREA 4YAWA 2XHZA 5EU4B 1SKAA 3K2BA 2LABA 5CR8A 1S9KC 4WXMA 4DIEA 1ZY2A 2ZAMA 3HFRA 1ORQB 3S2AA 1ZL2A 1VSBA 1DVFD 1NRWA 3BE1L 2V9CA 5BS0B 1GZHC 3V79C 1BDHA 2F8MA 3TAXA 3TO4C 4M87A 4R69A 3EO0B 2XOEA 4OCXL 3N0WA 4U1MA 2YWXA 2LTAA 2Y3NA 1IM9B 1PY9A 1Y4SA 5KANG 2JRLA 1N5MA 1EDEA 3MWDA 5TE4L 1FTSA 4G85A 3D2AA 3N44B 2PBZA 3P9MB 5DLQC 4W1QA 1F3DH 4ZU3A 4JV5B 5IWLA 1I3CA 3PP8A 3R1GH 5K0NA 4FR5A 3KQWA 1HL7A 1OXVA 4IQ8A 4AYGA 4CI0B 3QG7H 1ITZA 1VE6A 1AGXA 2C31A 3WGMA 2FEEL 3BBPA 1KG0A 4C0JA 4NM4H 4XDYA 1ISFA 2XSKA 1S9VB 1QG0A 3V4PL 3MMNA 3O2NA 5A4KA 1ZQ1A 2P46B 3WTXA 4DETA 1OXXK 5ALFA 2X41A 1D2EA 3QYCA 4OXYA 3EVAA 4HLEA 3GMLA 3NNDA 5JQ6H 1ZN9A 4ZCQA 2SCUB 4HNQA 2ZRDA 5HEKA 3LPCA 5F35A 5DHQA 4KQ4H 4JDVA 4UAHA 2XBDA 1HHKA 4R4NC 2A9FA 3AEKA 2WWKO 2WBJB 1KBVA 4NCIA 5F0MB 3ROTA 3KR3L 1J1IA 1OTHA 1HHIB 2CHUA 5I28A 3ZOAA 3DB1A 1U02A 5AOBA 5CP7B 5CJXA 1IFRA 2PMBA 1L8QA 4EZIA 2HCRA 4MP6A 3AOEA 5SX5H 2VP2A 4L95C 4F37F 3IAM1 4NKMB 4GP5B 1VADA 2ITCB 1J7KA 1YA4A 4NCNA 4H9GA 4ROSA 1PWYE 1U9CA 1Z17A 4IXNA 3NYKA 4E3ZA 1NOKA 3FOZA 3FD8A 5CBKA 2IO5A 3E2MA 1YXMA 3PT9A 4Z77B 4GG6F 1FP1D 3PV6B 4L4JA 1KTDA 5ABPA 4FMBB 2NNAA 4XP6H 4BASA 3S2FA 4J3OG 3CFBA 1WFUA 4GRMA 3S36H 2J2ZA 1R24A 5LQRA 1Z6JT 3N5AA 2A5FA 4HXBH 4PZEA 3AWFA 4LSPL 2WO4A 4ZEMA 3SCMC 2WVAA 1XK6A 3W9YA 2EFEB 1Y37A 3QFHA 4M0CA 1W47A 4I9XA 2WOOA 3LOWA 4TT3D 2K3TA 4GPTA 4BFBD 3GZNA 1SKMA 4HFJA 4XSVA 3PXGA 4MUEA 3MKKA 4LVOB 1EEZB 1I1FA 4PS0A 2CXXA 3OFVA 2JGDA 3FQRB 4PRHE 3ABIA 3BVTA 2A57A 1F20A 3WLQA 2W93A 4Y19E 1MIHA 3E03A 4NUPA 1HO3A 1AYOA 4AF8A 5KBYA 2B59B 3SBDA 2ACKA 1IOWA 5DRXB 1FVOA 3SF8B 1G4HA 4WI6A 2X9XA 3QKWA 1IOZA 3JQ6A 3KEHA 1MMFB 2W4IA 4O1MA 4K2UH 1KZ9A 3PTZA 4MI6A 4X20B 4DA9A 5I9IA 4NN7C 1PFKA 4EI6B 3DI3B 2DQEH 1UK6A 4PC1A 1XZ0A 5KNBA 5MEND 1GRNA 5DD1L 1KTVA 2GHTA 3VFNB 3KWWB 2LKCA 4FJ0A 3EYUL 5JSFA 1FL9A 1NZRA 4FLQA 5BO1H 4AB1A 4WHTA 2JFWA 1L4UA 4V0RA 3KWWA 3INGA 3ZK0A 3B3IA 4RX4A 3F7PC 3L4ZA 1F17A 3AUKA 2VHVA 1II9A 5KYWA 1AKRA 1BQLH 4TLAA 3OY7A 3LKZA 1TK2A 3PNPA 3UJ8A 5GIPE 1GRWA 2QU7A 5JO5A 4RPJA 4UQEA 3NJXA 5HGBB 4ELMF 1RAMA 1KKLA 4WUKH 1MLCA 3E8UH 4YDRA 4WASA 1AQ6A 3PVZA 5DS8B 2PZGA 4OAPA 2VW7A 1EG7A 4BLOA 1LJMA 4PS7A 5G0UA 3OICA 3S5ZA 3L9XA 4IDDA 4QDOA 2BGKA 1JHKL 1A0QH 2XZCH 4OGZA 3DNPA 4YGYA 3H83A 1KPUA 3NDBB 1UOEA 2C7QA 4CMIB 1X6LA 3FPFA 3BT2H 3K9WA 4PIRF 3UGXA 2Y1WA 1CLOH 1HFJA 1M1NA 2HZHA 2ZOSA 3HY4A 4HDCA 4ZMNA 3B1WA 4MQLA 5T57A 3VMNA 2AEPL 1JUDA 4IMPA 4DPLA 4QDUA 3OZSA 1OY3B 1MCCA 4BGDA 4NDMA 1J0CA 3CUVA 4HQQH 1KO4A 4MVCA 4AV0A 3FB5B 3QUMA 1OIXA 3DRTA 2J08A 1NINA 3M89A 1TCMA 4Z0HO 1UZAA 4LKXA 5ILTL 1XVLA 2HF8A 4GSDH 5FEBA 2WXQA 1UURA 1WQ1R 4ZQKA 3G0OA 1DUZB 3KPSE 3TAHA 1G9NC 1RULH 3V0HA 2ENJA 1NAKL 3H1ZA 4EKIA 2LW3A 2AVFA 4B83A 5HTKA 3L3HA 4OB7A 3BQUB 1YMMA 3NONA 4UQIM 5AXCA 2K4WA 5FPHA 5FCDA 5I1KL 3U2SA 4H1WA 1WX1A 3CSYA 4QOFA 2OV0A 5A2GA 2CNYA 2K4AA 3ZT6A 1GGUA 4Z7WF 4L3EA 4AY5A 1DWOA 1FNMA 1CS0B 3L6BA 3L7CA 2AMJA 3C97A 3L6RA 1T6WA 4BRUA 1YQWA 2GXUA 2BGGA 1JPGB 2E2WA 1ZT7A 1BYUA 2J25A 2BKUA 3EJUA 4IWXA 3HE6A 1BMDA 1ZK5A 1P7KB 3D69B 2PV7A 1FP5A 4NRXA 1H3NA 1M7XA 5FOXA 1H9CA 3RTLA 2CO6B 2QVIA 1B9KA 5FYKH 4JLDA 4R8SA 1NJ5A 4G1VA 3KEGA 1MDFA 1OBVA 2ISCA 1P69B 4XFDA 4ALAL 3IQDB 4MVJI 4M6NL 1KZQA 3R4DA 3AOGA 4NFCA 3GLFB 1M71A 2I3ZA 2IAND 3QGVA 1OCRB 4P3PA 1I6LA 1NLZA 5FV1L 3MLAA 5EF0A 2YZ7A 3MN8A 2IPAB 1M67A 5KVGH 1LDSA 5J13C 2OI9C 2D5CA 4C21A 1TK3A 1H8HA 4AL4A 4P23A 3PGXA 3QPWA 3RI5K 4FHGA 4HD8A 5FKPA 2RGXA 3FSVA 3EPJA 5BWNA 2GPTA 2DI8A 4OO3A 1FO0H 5KG9B 4RX4D 1YEHH 4O4HA 3G2LA 3PE9A 4U2GA 1MBZA 1LVGA 5DXAA 3G2MA 2PUQT 4L3WA 2AXFB 3AR5A 3KBPA 2B25A 1V48A 1AQDA 4NQXB 3U3DA 3R0IA 2ONJA 1YPZA 4ZNEE 2FD6L 2YIVX 4LARL 4MWZA 3QFJA 4YSRA 3QB7C 1A9RA 3GAZA 4AKOA 4B96A 1QX4A 1UM5H 2K6GA 2WTRA 2QIOA 5I8ZA 3DE0X 4ON9A 4EPXA 4E33A 2YMXH 4PJHA 1T0PB 4OQTH 1AHMA 2Q50A 2DYRB 2DJ4A 3ZKMC 5HJGA 3VJMA 1J25A 2Z3WA 2GEUA 1GPLA 3QXDB 4PC6A 1M1UA 2BSDA 4FNSA 4A4DA 4ZYKA 2ZWOA 1URLA 3EMBA 3JWJA 4N2LA 4HUCA 5D8JH 4XN5A 1LQTA 5DHEA 4XMKH 4CNIA 1IC5L 3GSNL 3WU1A 1U8QB 4Y4HD 3GMTA 4RK5A 4RZXA 4INOA 4ZT4A 4NLAA 1YE5A 4PLWA 1R47A 3D9AH 4PY7A 4S0SD 4RD6A 1BEXA 2QMHA 5EZYF 4M1TA 1AVAA 1R0RE 2YA0A 4KI7A 5EHZA 4G0WA 1RKBA 4RZ2A 2IRWA 3EHBC 1BJMA 5F44A 4JL8A 3H9GA 4V0KA 1QRSA 3SHSA 4H4DA 4NV1A 4A8JA 1JZSA 1AO7E 1UK8A 1DOHA 4ZTUB 4YY3B 4PSUA 3KLOA 1OPXA 1OI3A 1I2MA 4L0QA 5D2NB 3PWJA 5KMGB 3KT6A 2JV6A 3PG5A 2FYYB 3DC0A 1B4TA 1NCHA 1KC3A 4YRRA 5ADHA 4L3ED 2P5ED 4ABQA 2BEWA 1RY7B 3IIIA 2GOYA 1RQNA 3HNOA 4AWBA 3FCGA 4H0IA 3L5JA 1NBQA 4F2ME 2EVWX 2WB7A 3QE4A 2BEWB 2FZ4A 2M1ZA 1UWEH 2GCPA 2NY1C 2VT0A 3S7TA 3PI7A 4CMAA 1Z3GL 1P7CA 2GK2A 1XEFA 3T3PF 4GB9A 4MKZA 2FYYA 4OHMA 1RQPA 5AW9B 4JKKA 2WTBA 4M21A 2BSQA 3IAQA 2NOAA 4GY4A 4N6OA 3RZCB 3F46A 1WW3A 2CE2X 2NUTA 3M3PA 5F7NC 5CTAA 3FCUB 3O3BA 1PL8A 4FE4A 3IGUA 5BN3B 3A1EA 3MOQA 3CN7A 1U65A 2AEWA 5AW3A 5DH9A 3L9RB 4UZUA 1Z13A 4XO9A 4XLTA 4NQDA 2G30A 2VF8A 1JGVL 4PLKD 4YAKA 4R40A 1QLJA 2XG4B 2D7QA 2VISB 3IRCA 4OM0H 2FW1A 3U6RB 1ORVA 1IHXA 3OTQA 3H16A 1AD0B 2VS1A 2W0LA 5ADOL 1W49A 3THOA 3FVRA 2D1RA 4QJ4A 2J07A 2E9IA 4JGMA 2EH7L 4PR0A 1ESEA 4WFJA 3UT5A 2GQ0A 1EFXD 3CVHA 2WUCL 3T65A 2C0PA 3IP3A 1ZLXA 2Y0BA