2VDRB

Integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, lggakqrgdv
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 129
structure length 455
sequence length 461
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 2vdrB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2vdrB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2vdrB03
2P26A 5HDBB 1YUKA 3V4VB 1BHO1 1YVRA 4Z7OB 3AL8B 1L5GA 5KYXA 1U8CA 2XGGA 5ES4B 1SHYB 3EGXB 5KYUB 3IBSA 1ZOOA 1OAKA 1M1XB 1JEYA 1M1UA 2QTVA 1U8CB 1YVPA 1JEYB 3E2MA 4MMZB 1IDN1 3OKWA 3OL2B 1MQ9A 4UM9B 1XUOA 3ZE1B 3EG9A 4IGIA 1JLMA 3V4PB 4WFQA 3TW0A 3K72A 3TCXB 3TXAA 4O02A 4HQLA 2I6SA 3EG9B 4C2AA 5E6RA 3TVYA 2VDRB 3AL8A 1UEXC 1QC5A 2ICAA 5KYYA 3T3MB 1AUQA 4GZ8A 3NIFB 1RD4A 2M32A 1ZOPA 4HQKA 1PD0A 4A0QA 4CNBA 3IJEB 4MMXA 1PT6A 3EOAI 1M1XA 2VDOB 2UZYB 3NIDB 2VDLB 1SSLA 3ZDZB 3EFOA 3IJEA 1JV2A 4MMXB 4NENA 4Z7QB 1ZONA 1RRKA 4F1JA 3ZDYB 1JEQA 4IHKA 4G1EA 2I6QA 1JV2B 4NENB 3ZE0B 4Z7NB 4UM9D 1IDOA 1RTKA 4C2BA 1M2VA 1N3YA 3VI3B 3ZDXB 1PD1A 2XWJI 3QA3E 4XW2A 3F74A 5HGJA 5KYWA 5LN1A 2VDMB 4IXDA 5E6SA 3HXOA 1BHQ1 4F1KA 1MJNA 3NVQA 1QCYA 3PPWA 4WK4B 3BQMB 4HQNA 1L5GB 3VI4B 5E6SB 1XDGA 3K72B 4K3JB 1T0PA 1IJKA 4G1MB 2VDQB 2P28A 3EGXA 3OL2A 5KYUA 4DMUB 3FCSA 1QC5B 2ADFA 2NUTA 4NEHB 3K71B 3EGDA 4O3TB 4O02B 1DZIA 3K71A 4MMZA 5E6RB 1PCXA 2WW8A 1M2VB 1LFAA 2VDPB 4BJ3A 3HXQA 3K6SB 3ZE2B 1T6BY 3EH1A 1SHTX 4FWWA 4JX0A 4HQFA 3EFOB 1XDDA 3K6SA 4MMYB 1FNSA 5KYWB 3NIGB 1OLZA 3BN3A 5BV8A 1CQPA 3BQNB 4G1EB 2ODQA 1V7PC 1M10A 4MMYA 5KYXB 1DGQA 3OKYB 1MQ8B 2NUTB 2NVOA 3EGDB 1TYEB 3GXBA 2VDNB 4PN7A 1IJBA 3AL9A 1MHPA 1MQAA 1M2OA 3PPYA 3F78A 2I91A 4CN9A 3FCSB 3FCUB 4O3UB 1MF7A 3AFCA 3T3PB 4CN8A 5HJ2A 1FE8A 5KYYB 5KYNA 3ZQKA 4JDUA 5E6UB 4M76B 2ODPA 1U0OC 5E6UA 1Q0PA 2O7NA 3HI6A 1U0NA 2WINI 3PPVA 2B2XA 3PPXA 4WK2B 2NUPB 4FX5A 2X5NA 4G1MA 1AOXA 4C29A 1N9ZA 2NUPA 3EH2A 3N2NA 4WK0B 2VC2B 1ATZA 3M6FA 1JEQB 1RS0A 3Q3GE 4UM8B 2VDKB 1SHUX 1AO3A 2IUEA 1NA5A 1SQ0A 2XWBF 3EOBI 3RAGA 1CK4A 4HQOA 4WJKB
chains in the Genus database with same CATH superfamily
4MUHA 1YWGO 4N2KA 4A8JB 1U2QA 4E7OA 2ZT6A 3PVCA 5AENA 2QLNA 4G0PA 4M8RA 3A1DA 1F56A 3OQVA 1PR5A 3W4KA 2DQCL 4CGTA 5B36A 3OAZH 3G0OA 3CFDA 1XF1A 5A7GA 2ZOWA 3HLYA 4AVJA 5BSHA 2EXWC 3PNRB 2L17A 2IKQA 2I27N 1LLCA 1PGRB 1SVBA 2ZRLA 3MYJB 1SG9A 1HFEL 2HX1A 3QLEA 1QI4A 1EE1A 4ZI8A 4BO3A 1ORSB 3QBDA 4HIHB 3ZW7A 1T15A 3NVQA 4DPKA 3RD5A 4Z76A 4ENPA 2VWQA 4ZOQI 1E43A 1FVXA 3PXBA 3P9WB 4FGJA 1FL6B 3P30H 4ZI2A 2GHIA 4CM8B 1HT0A 4F7MA 1E2NA 2NSHA 3VI4E 1TCUA 4JFZH 4CMAA 3GXMA 2VIRB 1REIA 4F4CA 5K45A 3GNMH 3QDGD 1BW9B 3JQAB 4FC7A 3TA3B 1ULBA 1YKFA 3QX7A 3FH7A 35C8H 4WNSA 3OE1A 4YUEH 4HWBH 1WABA 4DLLA 3K1AB 5LSAA 1F1BA 1UPXA 4U1JB 4XPGH 1GJUA 1U4EA 1E3MA 4G6MH 4ZO9A 3IKMB 4UIKL 2ZUBA 4ITRC 2X2PA 1Q0XL 2BWJA 1HNXB 4B6QA 5IVZA 1VG8A 4LHUB 1W19A 3TG2A 1IBYA 5LAXB 1P2CB 3ETNA 4EW3A 1FDRA 4HDNB 3LKOB 1HKFA 2XDYA 3F5FA 1KOJA 1P6AB 4RJIA 3QEHA 3IE1A 4LP8A 2VQ1A 4M87A 2ETWA 3GEHA 8PAZA 4FS3A 3BRCA 5DLPA 2N7SA 3GJEA 5HKOA 4Z7WA 4NOFA 5KUTA 1KORA 2APFA 3M45A 1YNKH 3JD2A 2JLWA 2A0LD 5DI8B 4MQ6A 3IP5A 4HD9A 2RFXA 4XN4A 1NEZG 2V6BA 4NRXA 1KSHA 1LGVA 1J8HB 1S2MA 3BMQA 3FUKA 3IDXH 3ZE2F 3ZTNL 3UB2A 3F4LA 2C59A 3QPVA 4EKDA 1XDSA 2I07A 1X8LA 1Q0EA 5JCJD 2PYDA 2MIZA 5ES3A 3PL1A 3EMVA 5LZ5A 2WUCL 1K75A 2QL6A 2WNXA 4YJ2B 2IEYA 2OQJA 5FYLE 5KQPA 2R4SL 5L8JB 1RIVH 3KB8A 1OPXA 4DQUA 2I3DA 1TT5A 5CCJA 1KVRA 2CXRA 1Y3AA 1S2DA 1E8WA 4PRIA 5F7DB 2IYOA 4PV9B 4TYQA 3KKNA 2AUMA 2C8NA 2ID4A 5EZ5A 4OJMX 4DGWC 4KPUB 5C1BA 5T4EA 3CX5J 5EHZA 1QLHA 4PO9A 4QKTA 4MJIA 2QSCL 1IKFH 4B3FX 1YDPB 5CX4A 1BM3H 2HRLA 4ARCA 4XM1A 3MNMA 4XCYB 1OEZW 4J91A 4Q1DA 4A8JA 3I74A 3VKFA 1HHGB 2W0FA 2IY9A 2BOCA 4E6EA 4QY8B 5B7PA 2CQVA 3KSAC 1PEZA 4YRKA 1Q14A 2OHOA 1G59A 5TD4A 3DBRA 3I1FA 2MEJB 5JYLA 4L75A 4X91A 2GD2A 3A6KA 1QQDA 2V2XB 1DIBA 1KXVC 3FKSA 5IAGA 1L3IA 2B1JA 1LSUA 1OQAA 3MB8A 3WLRA 3NCTA 1DLJA 1DBAL 1IFRA 2C7OA 4MFHA 4WA7A 4MCYB 1VB5A 2JDID 1OAJA 1LNQA 3OJMB 1CXLA 1STOA 2VC2L 2A4EA 4ZUSA 4XZ4A 4HLEA 3D7LA 4LGRB 2G4VA 2P78A 4A8PA 2I66A 4LOAA 2BOVA 1K6MA 3EIQA 2W98A 4XN5A 1BEZA 3RANA 2XTJE 4OHWA 4Q74A 3WNJA 3UJ7A 4LASH 3TZQA 2P8PB 4DE5A 5KQGA 3QQ4B 1EK6A 3G9UA 5I5RA 3DJZA 3QMWA 1KGWA 4H9GA 4TLAA 1DAKA 1CUDA 4HOYA 2JD2A 3HSYA 1I01A 4LT7A 5ALSA 3SYLA 2OL3A 5KHAA 2AMLA 5B58C 1UXWA 3WE6A 4EJSB 3DKRA 1ECPA 5K09A 2O8FB 5DEIA 3B13B 3GL9A 1RE1A 3C2SA 1IPEA 1KIPA 2OOSA 3GMRA 4JFXA 3F4BA 5FAAA 3SZMA 4DDVA 4RFOH 1YDFA 5D5MA 1UC4B 3QKRB 2G3MA 2O6EA 3OMWA 4S35A 1S7CA 2ZQYA 3KH4A 1KEUA 4K5LA 1QASA 1DCMA 3FA2A 3QYFA 3BVDB 2V45A 4K87A 4V0MA 4HGOA 4PJHA 3VO8A 4NPHA 4MD5A 4KVCL 4YIQA 1MVOA 3HU5A 5D5HA 5JIIA 3OKCA 1K86A 4BMNA 3JWHA 3ARQA 4E70A 1KCWA 3UV6A 3WL5A 1S3GA 1BMQA 3COOA 5TPWB 1TZJA 2GBVA 3NHAA 3CVHB 4I1RA 3DTTA 2RGBA 3VPXA 2VP0A 5J57B 1F4WL 1QAMA 2FWPA 1F3DJ 5DQJB 3NASA 3TMAA 3JVDA 3G7NA 4NRYA 1R75A 2CVOA 1UKSA 4TYUA 4DZBA 5SX5H 1FMLA 2B34A 2OORC 1VIWA 3FE2A 1CIDA 1CEYA 4W1SA 3QQDB 5ILGA 4A23A 4BKLB 1CC1S 2R4RL 4XP6H 1XXFC 1A5SB 1MCWW 2BEVB 1TT5B 4KWCA 4OZIE 2HA2A 3JWNG 4NONA 5D7JD 4MR9B 2GBLA 1T3GA 3R3VA 3KO8A 2F3PA 3B8SA 4LXGA 5JMRA 3ODGA 1FFAA 1P74A 3L7AA 5CVTA 5CCXA 4HS3A 2PXYA 4BZQA 3BCHA 2O5CA 5IBCA 2GXAA 2MTBA 1NONA 2A4CA 3QGMA 3ZDXF 5C0DA 2GJ9A 4DDKA 3SQXA 3V7MA 1VFOA 5LLSA 4J16C 3T5GA 1I13A 4JYMA 5KC9A 2WWTA 2O54A 4RENA 1UM5H 2CRYA 1VB9A 3JBG7 3M6LA 1ELOA 2WPDA 4IIXA 2TRHA 5T7BA 1M2EA 1NQVA 3LS5L 2VJAA 4LJ6A 4Y19E 1GPDG 2E9BA 3NDBB 3VNYA 4BK5C 3HEMA 2PWYA 1TPYA 1E28A 2R65A 2ZLBA 2P0EA 4JRWA 3QHFH 5K9OB 4OSPA 3RVUC 4ZQKB 1T6ZA 3VHRA 4AG6A 5D7LE 3R1GL 1N6NA 3UICA 2ZKLA 2VPXA 2BNQB 3L5OA 4ZI7A 5D4HA 4G89A 4QRAA 4TLEA 4EZKA 1Z37A 1ETHA 4OJEH 3PREA 1A9OA 2JJVA 4D80A 2XTJB 4HBGA 4FZ8L 3CF2A 1E6JH 3D08A 1CHNA 2GJKA 3ROLA 2VXCA 3ZVMA 1FZJA 3M7FB 3K7EA 4FQIH 5HKLA 2YUZA 2NRDA 1P19A 3BFJA 3ARYA 4RCYA 5A6MA 3AU9A 2W6IA 3O4VA 3OSVA 3JWIA 1M34A 3W6OA 2PTTB 1GUYA 3OURA 1TTGA 3WYNA 4DT1B 1RXWA 9MHTA 3RVMA 4CQJA 4TS3A 3L3OC 5AHRA 4OQPA 1AGCB 1Q3HA 2Y1GA 5T67A 3MERA 1ZM3A 5HRAA 5J8OA 1L7IL 4QPCA 3T9BA 2WXQA 4EVIA 3RYFB 2WUGA 3T94A 2BSXA 3I23A 1RBMA 3K5HA 3IR5A 2EVHA 4M4SA 3P3TA 5CW1A 3RVUD 2ICES 4YRQA 3BVWA 2VLKE 3LNHA 3VBCA 3AADB 4ARBA 4RZSA 3PNPA 1TA4A 4N1HB 4A10A 1RTTA 2ZRCA 4O02A 4AKIA 3WJLC 5TS2A 1U0SY 1MC1A 5GS0H 5IVIA 1Y34E 3FCYA 3TDKA 3WFBL 4J0EA 2PX8A 2VZ0A 4Y5XA 4MEAA 1Z7BA 5HHNB 5D4IA 4B0MM 2OXCA 1ZN2A 4X9GA 3R8BB 5F5LA 4A8JC 2WV7A 2R2CA 2WWIA 3QW9A 1W8OA 1EEYB 1FFGA 5GRXG 4DLUA 3FUFA 4L08A 2JGAA 2YMMA 3SU8A 1WQ1R 3ORYA 2CEKA 3LA6A 4F7TB 2ED6A 3E9TA 3RWGB 4CSPA 3MJ9H 1ONQB 3RI5F 2IUTA 3FYIB 2YGNA 5GRUH 4TV9A 3DIVA 2OP1A 3NFSH 1AGBB 1KCLA 4D81A 1R5IA 2JB9A 1HNNA 5ICZA 1W88B 3O9WC 1NAKH 3FJ1A 3G2LA 3ZXXA 2Q6VA 4GQ9H 2I6TA 1L3CA 1AFVH 2YJ5A 4FGZA 2R2BA 1TK3A 4RYLA 4HN4B 4JFOA 1EQ2A 3O9WB 5F1YA 3W4JA 3FQWB 3FQTB 1FFXA 1G5FA 4KEAA 4V0KA 4UZUA 5FI5A 2PQ0A 3D4ZA 2X3AA 5TXGA 3RS5A 2UUDH 2EUVA 2FUQA 2OZ4A 4Q9RH 3FUCA 3AGPA 3E48A 5EPMB 1TKCA 3PQ8A 4JHWH 3JVGA 3QXAB 2XCQA 1NEZB 1P1FA 5L6LB 2P5EA 3VUFA 1QGYA 2WVGA 4AQZA 3H4HA 2OTUB 4OGGA 2HREA 1FZMA 1CFNB 4OLVH 4YE4H 2FETA 2WUEA 2J0EA 4EARA 4CF4A 3TJPA 1FPMA 1NVDA 4YV0A 1O0VA 3FTWA 5T57A 5C5CA 5I7VA 1I1AB 3CMOL 4IMPA 3RFUA 2KBGA 2C9UA 2DYPB 4QTTB 3KU1A 2A9KA 2J5RA 4Q3KA 1E64A 3QJTB 1LO2H 5DX8A 5EN4A 4NCAA 4FUTA 5DW3A 2YJ6A 4EN3D 4DKFL 4IO1A 3RYMA 3TGXA 1DBRA 5E8EB 2ZANA 4OL0A 2R9VA 4ZV9A 3AT9A 2Z57A 4U39A 3TIEA 3PT9A 1AGXA 3JV6B 3H0CA 4MJ5B 4B4WA 4AQYB 3T6XA 3A9WA 1RZJC 2YH2A 4DR2B 1EDDA 5AM5A 4KFTA 4GKAA 4JUTA 2AYZA 1VM6A 1OOEA 1RAIA 1KTLB 2H1VA 4NQTA 4BPRA 1HDIA 4B9EA 3TF5A 2H26A 1AX9A 1SOQA 3N7TA 5DNVA 4OMFG 4OF4A 4FEIA 5CP7A 1KBVA 5IVKA 3QDGB 2ZCVA 4F3TA 4WASA 1QTPA 4NE7A 4NM4L 2I7CA 1CJBA 4PJ6A 4TROA 4LOJA 1YYLL 4N8EA 1KJJA 1FZQA 1NUHA 1JGEA 3QXSA 1KYXA 3P96A 2C2WA 5LOVF 2PP9A 4WUUD 5JCPA 3MTRA 5DN9A 3NHMA 2DQTH 5BVGA 1ZXQA 5ERYA 1V3LA 4AZSA 3TUZC 5KS9A 3MODL 2HF8A 1GZHA 4GX2A 2XWQA 1XJ5A 1VCBC 4J7CA 3EDRA 1PSDA 4DR6B 3B3FA 5BZDA 4FZ3A 4P2OB 2NLJA 2AC2A 5J59A 5HJ3A 4CKWB 1J1OL 1VBNA 4P4SB 3AL8A 3SBXA 4RZCA 3P2EA 4N5LA 4HPYH 1JIIA 3KWFA 3LRTA 4JKOA 2B1GA 4LI3X 4R8VA 2VLRD 3MGCA 3L01A 1Q1NA 1QYVA 1N3NA 4CC0A 3TZEA 5HGGS 4GSKA 4OM8A 1AIFB 5IANA 3SS8A 3MRTA 4A2EA 5FNVA 4BWGA 1VL1A 2LD4A 1M2JA 1RZKL 3R74A 3LNGA 3DA0A 4LEOB 2SKDA 2VO8A 1HWWA 3TTWA 2F53B 1MJ8L 4BFEA 4JX0A 1A4XA 2RKOA 4ZCMA 3QIWD 2QRZA 2FJFB 1G66A 3I3DA 1BIIB 4XPTH 1ZJ6A 3MNWB 2O1EA 2HTLC 1RWWA 2VKTA 3FN0H 2AS5M 5B12A 4HDCA 3L1FA 4PJ5D 4AW9A 4BTVA 5JE8A 2ZYUX 3MRNB 1IBRA 3DR3A 1KJ3L 4QRBA 1I5EA 3IU3A 4QOSA 5E2IA 2C2ZA 5LZ4A 1NWOA 2H5JA 1A6WH 3FYSA 1DU4A 4OB5L 4R3WA 4WY2A 4BECA 3PIQB 9PCYA 2C9XA 1IGJB 4CM9D 4Z0HO 4BY9E 1MI5B 2GT9B 4DUZB 1ISJA 1CJKC 1R0ZA 3L2LA 4R16A 5IGXH 5CHEA 5J1SC 2MSDB 1XB3A 3HZYB 3HB3C 3NKLA 4AEEA 3M83A 1QLEL 3AU0A 3GRYA 5DJ2B 4H1LB 3KQNA 1QOKA 4HUWA 2OAQ1 2C8LA 3T3OA 2ZRJA 3F9RA 4C3OB 1HCZA 3T3ME 3VTMA 3MLSL 2XQFA 1XRQA 3M49A 1GGEA 1RZFH 5L6YH 2JXMA 2CYCA 4L3WA 2WLZA 4LZZA 3GM0A 3HJEA 4YHIB 3DL0A 5A3IC 4GC9A 2CVPA 1YASA 4EG5A 2NSQA 1YDEA 3VI4B 3UW1A 2XF8A 4WI0B 4GNRA 4W9IC 4JEMA 1U8ZA 1RWKA 1RKXA 5EUOA 4LXHA 5DD6B 3EY9A 2O8VA 1NCAH 2XF2A 3HJAA 4J8PA 3EVGA 1BYOA 1MP0A 1R3LB 1G6KA 2GS9A 5IQMA 1N0UA 1RU9H 2J8UB 3WN6A 3K0BA 3T1YB 1J5EB 4C7KA 2O07A 2FMXA 2J3MA 4AYID 1QTNA 4RLHA 3KWUA 1U8KB 3W2DL 4GR9A 3GLVA 3U46A 3SPGA 3EQ2A 4NIKB 4IIUA 3KBBA 2EILB 3AR6A 1GHFL 4HCRH 2WFZA 3DWGA 1QE5A 5B8CA 3PRJA 4D57A 2YQ2A 2X4TA 2BNRE 2PZKA 1NMCC 4PREA 1TM5E 4WWNA 3O6FD 3UJCA 3I52A 1L4BA 3FIUA 4WJKB 4RLQA 4UMFA 5F51A 3TJRA 4UUMA 5LQBL 3T4YA 5BNTA 1G9ML 1S0UA 2Q3ZA 4Q6IB 5AXDA 3KEMA 1P4LB 2DBJA 1ENOA 4TRMA 2VQSA 3A4LA 4UOJA 1P7CA 2XTNA 3IBFA 4HS3B 4GPZA 1CICB 4YMLA 3AYZB 5GXBB 3EDCA 4C59B 2YAEA 5EZQA 4ZU6X 1NFDE 2AHIA 4JBWA 4FMDB 4M0MA 3I53A 5DFVD 4IRJD 2VF5X 1EXGA 3QZPA 1MCBA 1U2DA 1WW2A 1W72B 2B37A 1NKGA 2ROYA 1FSGA 2QUAA 4N1EA 1OC2A 4QJ4B 2WE7A 1QFWM 5JZVA 3LS2A 3BXHA 5T8KC 2ATKA 3DVRX 2ZJZA 1NNLA 2UDPA 3DV9A 3DMDA 4OLBA 1P8JA 3A26A 2FIKB 5EHGA 1NSFA 1RZIB 3TS1A 2YUXA 4MYPA 5HA5A 4FHGA 4RQBA 4M5TA 5FR1A 1BN7A 3S9DB 3RNQA 2GVNA 3C2QA 2TMDA 3N44F 4PQXA 1PSWA 4DTCA 1NICA 1M05A 1ZNZA 1SYSB 1OB5A 1MFUA 2N9UA 3DV4A 2L18A 2EFCB 2HQBA 4HAGA 3KQVA 4MS4A 4H2AA 2V3EA 3CUSA 2AJSL 5KVQA 4OAPA 5E9QA 5CEZD 1G1CA 3B36A 3QFRA 2QQNH 2ZNXA 1ZANL 5FXCH 5GPRA 1RZ8B 1D04A 1Q1BA 2VSNA 4YA6A 4JI2B 4CZ2A 1Q94A 3RBXA 1IM8A 4JRXB 2K4MA 4S1RH 5MENE 4YI3A 3T8XB 2QZ9A 1U6AH 4H1TA 1JFFB 1DQLL 3TLBA 4L6IA 1UK9A 4CTJA 3HCPA 2NDFA 4I2XA 5ECJE 4EY8A 1Z2CA 1CXKA 4IFEA 4C30A 3DRTB 3EZ2A 4PI0A 3WIIL 2ONYA 4RDXA 4ZFFA 2FJPA 1SQMA 4Q7EA 6NULA 3MRMB 2G7ZA 2J9XB 3OJVC 3LW7A 2XLBA 4JROA 1U1FA 3D5EA 1J9RA 5JJBA 3BAIA 2WYOA 1G0YR 3QQ5A 4BCBA 1JHTA 2O5XL 1UM9B 3OHXC 1RZ7L 1U2HA 2E6KA 2G72A 2ZZNA 2O72A 4NFCA 5K3FA 4D56A 5U4QA 1JBJA 4F7WA 1EWHA 1I7ZB 4Z7NE 3TLEA 3F7VA 1VE7A 5TT1A 4ZFGL 4AFNA 3RUFA 3ZCSA 1H1TA 4LOFA 1T22B 4OUDA 2OXHB 1UKEA 3O5AA 3KDSE 4JO5A 2OSXA 2D73A 3SDCC 3GLFB 1W25A 1TMYA 2O3SA 4WI4A 1G9XA 1Y18A 3HA0A 3LSTA 2GCYA 2R56H 2EKLA 3PEUA 3ILDA 3RVLA 3R5KA 3UK0A 4ZHQB 1OLSA 4UTAL 2ZUVA 1OARH 1G84A 5IP5A 5IHUL 3S37L 4F9PA 3E03A 1NDMB 2FO8A 5CFOA 2ZVJA 3WY1A 3NNSA 1R4ZA 3VYRB 5BRZD 1RRFA 4AAYA 1K5PA 4LDQA 4JAMB 4MSUA 4FA8A 3TNMB 2OQRA 1YT5A 3U9SA 4LSSH 2VBGA 3N2NA 2Y5EA 3ESZA 1S4MA 3I02B 3CN3A 3O4RA 3TOPA 4F4HA 3HI1B 3ZXUB 1QCCA 2EACA 3DZFA 5GSVA 1XMXA 2HTLD 4F7EB 3KLLA 4NDAA 4BDSA 1BOGB 2YV3A 2UXGA 2OCDA 1O6BA 4TUOB 4MCMA 5LHDA 2D7QA 4F38A 2X4UA 1HE4A 1KBKA 3MLTA 3GRCA 1NXVA 1XH3A 2YMOA 4CW1A 4MUGA 5A3QA 1LDNA 3RUGF 2CNBA 2GTZA 3RFXA 3R7BA 3BWXA 2P1RA 3FT3B 5EF2A 1KN2L 1YN7B 1M6EX 3WV0A 4F2MB 2IWFA 2LU7A 3TZ6A 4I6JA 4MVCA 2AFHB 4P49A 1SVWA 4KRPC 2GEUA 5F9OL 2V59A 5GJVC 1U9KA 3ZDRA 3Q8WA 1XEUA 2BY2A 4EUEA 1Y6FA 1FYVA 4HAWA 3N86A 5IAAA 3QXAA 5KOMC 2J7LA 1ZRMA 5GGSY 2VZEA 4FFYA 5A7FA 1JPNA 2GYYA 1WCBA 5HGHB 3G9VA 2ZYIA 4M7JL 3SGDI 5F7LB 1I85C 4FCTA 3SYOA 2F1RA 4LP5A 2HXGA 4OCLC 2IHBA 1FL5A 4KOCA 2O93L 5HI5C 3MWDA 3DFFA 1V7PC 5CVDA 3CVYA 1X9QA 1YNLL 1LQUA 1BIHA 3UHFA 4RANA 1IJBA 3V4FA 1YZVA 1KP9A 5DHFA 3VOAA 2PUWA 4KBYA 4UUAA 5EP4A 2R8YA 1U2GA 5JMOC 3R06A 3HG5A 3V6BR 2Z8RA 1WG3A 4LNHA 1W0CA 2BOLA 1COWD 3SXPA 1L4NA 1NA5A 3IT1A 1XZBA 4ZMSA 1RKQA 4OY9A 5J4HA 3ML9A 1WAAA 4WV1B 5EBWB 2ORWA 5EGSA 4WU5B 2OVBA 2HG5B 2YQ4A 4FGKA 3RAJH 2J87A 3QE4A 3GSRA 4M0CA 1PFQA 1UBRS 3KXPA 3A67H 4N5DA 1P1RA 1ZK0A 5KAPA 3O0DA 4WLUA 1TAUA 3A1VA 1DVRA 2I1VB 1BDYA 3MDJA 4MKFA 1BWMA 2R87A 1AG0A 2BVOA 3TJEH 4PYGA 3FMVA 2QD3A 3RS4A 3PVZA 3O3CA 1TZGL 1Z5NA 3F04A 4XTRC 1HCYA 5B3JF 4TPKA 3VXOA 1KDRA 3WSTA 3GKWH 5SYNA 2IZ6A 4EDXA 2COVD 3PHHA 3Q15C 3TX2A 5GS3A 4LF4B 4CIYA 2A1UA 5FUBA 3FQ1A 3A6EA 1JPGA 4D0BB 2OYMA 2PS0A 2PV7A 1T89A 4OSUH 4ODBD 3BXNA 4BUCA 1YEHH 3FKJA 3NBAA 5LWQA 4NNPH 2DIJA 3H84A 2LKDA 1GY2A 3TYGH 3LQQA 4NO2A 1CI3M 3QHZL 2VLRB 1XVTA 2FG5A 3KJFA 3J80A 4MITA 5GMOA 4BX2A 2HUEA 3RVKA 2XIBA 5E3HA 1AGEB 5DN6A 2OT3B 5E5LA 3FQRB 1GFZA 3BH6A 2X70B 1GNSA 2J8HA 5D7SH 2QLYA 1AY1L 2JJ2A 5GGQH 5LQRA 5CIQA 2P2GA 2CDFB 3KE8A 1BQLL 1FCGA 4MXVE 4R7NB 2FN7A 3H3JA 5JHHB 1XTJA 1LYQA 3OESA 3DO4A 4XSGA 4JN1L 4HOXA 4PTTA 3O3EB 1AGNA 2O1SA 4UATA 5BQ7B 3DH0A 1QYIA 2YJQA 3TP4A 3X3FH 2O5ZL 5ILQA 1KBWA 4P23A 2X2YA 2VLLA 1J07A 3OPXA 3PWPD 3H6AA 1E5TA 5E6RA 3V7AE 2PBFA 4AUEA 4GXFA 3CUWA 5ITFB 5BXFB 4FOPA 1OP3H 1GQQA 2J8UF 4CW7A 2RBKA 4HB3A 4W9ZA 1Y7HA 1HAWA 3ZQUA 1EM8A 2BDTA 2XVGA 4WW0A 4JODA 5DJZB 1XALA 3VGHA 4FQLH 4PGDB 4YGAB 1Q1PA 3FFXA 1QRNB 3QEKA 3O4HA 5DMIL 1DC6A 3T7CA 4EKIA 4IJUA 3B9AA 1B8NA 4HNAB 4NDMB 3RSQA 2NT1A 3JQEA 4CJXA 1IBGL 3AXSA 4QHPA 5KYWB 2FEPA 1N12A 2OMTB 1I2DA 1O95D 1TJYA 3H2ZA 4B34A 4FZVA 4JHUA 3NT2A 4IDOA 4LJ8A 5A6SB 3VX4A 3R20A 4IBTA 3W9SA 1AV7A 1TF5A 1IGMH 2CJFA 1H9CA 4MDJA 2XA9A 4RA6A 1H2EA 1C9NA 1PR2A 1PDVA 4C56A 3MJHA 2QHRH 1NZRA 5E5MA 3STZB 1UJMA 5EG6C 3GMRB 4MULA 1YVEI 3NN8A 3P9NA 4A7GA 5ITBL 2VDLH 3ENEA 3V6OA 4B3RB 4HADA 3THMH 4QHKJ 1I1NA 1YMUA 3BD4A 4ETQB 1VFMA 5ES4B 4KAXA 5CB4A 1NCCL 3S36H 4NG4A 3E9RA 4JP8A 2OFOA 3NN8B 2OSLA 4HD8A 3SDXB 1JHMA 2O8EA 5E5MB 4FFVD 1TQBB 3GSXB 3AL0C 1AI1H 1AKPA 1PAMA 3D2TA 3OLIA 5JD4A 1PZ2A 5T64A 3HPLB 4YHYB 1N9KA 3UXMA 4G5GA 3WEOA 2XSZD 1YJDL 3I6QA 4Z7QB 4DT2A 3E6AA 2GIMA 4CI0B 1CB7A 1F4LA 1XEFA 3JAWA 1DO8A 4OTXL 1E62A 2B0CA 3RKDC 1LHZA 1X80A 3CWGA 4OLZL 2F67A 4CADB 2E6QA 2XXCB 3FPFA 1ZESA 3D9AL 4FE3A 1ETUA 1VCOA 4UV7H 1RZFL 4LF9B 4MVXA 1G0DA 4ZSOE 3BC1A 4BRZA 2IBZY 3B5IA 4XNMA 2AI0H 2O50A 4PJIE 1JEOA 1J9QA 1Z3IX 2PYFB 1AY0A 3DHPA 2EVIA 3H1AA 2GLUA 5DD3H 4BRSA 1A4JB 2PRJA 3O2DA 1JXMA 4OB5H 4HH0A 3NBMA 3U40A 1JXOA 3I6GA 1N0WA 2OO3A 3NGBB 3RWEB 3QKSB 5D71L 1Y37A 1WHTB 4P3CL 1EZ1A 4C4KO 3OPUA 2OYKA 4M3JA 4NECA 2IF7A 3SGEH 4EUNA 3ENVA 3NFRA 3IEKA 4U3XA 1LEGB 3KJNA 4MARA 2G4GA 1R6DA 3L4VA 4W7SA 1HQ4B 3A6HA 1JNNL 2X4UB 2FEMA 2OS7A 4I36A 2I03A 2AZUA 5CSZA 3QDMA 4NAVA 2LLGA 4P31A 1M42A 1CFNA 1KV3A 2Y25A 1ARZA 1DTEA 1A7NH 2VDRB 2C9OA 2J5QA 3Q1SH 2HYIC 2FX7L 2AE1A 4EHDA 5KAQF 4QUHA 1X0VA 2G76A 3RC8A 3UH8A 3EFHA 4QGYA 3I64A 3ICPA 3DKVA 4HGYA 1JNHA 2VDMB 2FHFA 4RH1A 4O4IB 4YFLI 2JGJA 1E8MA 1KDOA 2ZIDA 2D2EA 4CU8A 4F58H 2YY5A 5I30H 4ZUVA 1FP1D 3GD7A 1IQWL 4Z9KB 4BH7A 2IXBA 1PG7W 1VFAB 2WTRA 2CV2A 1OGTA 5KPJA 4NAJA 5KN5A 3JR3A 3QNZA 2WD8A 4BAGA 4LCWE 5K01A 1AMOA 3RSFA 3RIKA 2YN4A 3VO0A 3EXG1 2C4HA 3LRHA 2V1UA 4HLUA 4TVPE 4RQTA 4YHML 3ME5A 4Z1MD 2MNWA 3DK2A 1SC1A 5EMLA 1UWCA 1JH9A 2ZICA 2BLFA 2DTML 4R2KA 4Z6KA 3ITEA 1J5OL 1N19A 2JXMB 4KC3B 3M1AA 1CS0A 2O2GA 3ZV5A 4A55A 5C0AE 3VG9C 3RV3A 1EH9A 3GZKA 3L4SO 1AZRA 4A2GA 2VJBA 3KPSD 4JHBA 2XE8A 3MYYA 1J0XO 4M5SA 2UYGA 5H2BA 2I1LA 4E4RA 4QDTA 3NC0C 1QHQA 1HZJA 5EHNA 2ZZKA 4WFGE 1RYFA 2I5YL 2V7VA 3RUDA 4ALIA 4EPYA 2DY1A 3X12A 2UY6B 3WXWH 1T7XA 2HRPH 4OT1L 4KKRA 3QPQC 1NMYA 2EP7A 2VYQA 3WLSA 3UT5B 4PB0H 3KVVA 3UC2A 3WVNA 1DL7H 5IVPA 4I0PB 3WLQA 1I9IL 1GHTA 1Z5LB 3SQOA 4HIEB 3RL1A 4JE0A 4LLDA 5ECGC 4XE5B 1DQYA 1EFTA 2OBNA 1GGIH 3K8LA 3FOZA 4CKBA 2DTSA 5IK2D 4EW2A 2XB6A 4F9TA 5DKFA 3C3MA 4F6RA 3LEVL 4U2EA 3KWTA 4O4JF 1XAJA 1SEBA 1IAQA 4MGZR 1ZCBA 2HQOA 5JBNA 1N3IA 2BZ1A 1EVYA 3EBLA 5D2LB 2XPCA 5J2UB 4YE4L 2Z9BA 5HP4A 4PV1C 2XY4A 2ZWIA 1HWYA 2ZPAA 2QTVB 1KB5H 3WMSA 4N90D 5C7LO 1ZA2A 5D7IA 2ADIB 4N8SA 2NUTB 4TV3A 2PTHA 2E27H 3LKRA 1I7UA 3HRKA 3A3YA 4TSFA 4HFWB 1P7YA 3U4QB 2D13A 2YD9A 2B6HA 1X2BA 5KJFA 1UINA 3Q7JA 4M1WA 5MGBA 4B41A 1TJ3A 1AQ6A 2QVGA 2JFZA 1ES9A 4GLFA 5CLQA 2LRHA 5K93A 2IS4A 5IVXA 5E6IC 3GTVA 4TT3D 4YCNA 3ABZA 3PJSA 4YQEA 4BNFA 5ANHA 3PWLB 1N7GA 3CFTA 1L1EA 3QEMA 4JO3H 4MGKR 3L5XH 3U31A 2AP2A 4X7PA 4KLNA 2J5KA 4WTZA 2HPHA 4QT0A 3WLHA 1VG9B 2FZ3B 4KBFA 1WV7T 1NIEA 2O26U 1BAPA 2R4RH 4BB5A 4DJTA 2H2FA 3RTEA 3CHRA 2BBOA 2E75C 4OJAA 1C7EA 4UFOA 1U2EA 1QMGA 2BW5A 1HF3A 5KCZA 1DJXA 4BQCA 3KKKA 3F7PC 4QOKD 1JT9A 2J44A 1V11B 3OX8A 4M0EA 3SDXE 4CVUA 4Q52A 1FQ9C 3MRLA 1ODIA 3AG6A 1ASOA 2DV6A 3OTIA 1BJMA 4WERA 2D8MA 4I2XE 3O38A 1ND6A 1UBUS 2JLXA 1OFTA 1SKMA 3W81A 3K4ZA 1IC4L 1PFOA 1CTQA 1EQUA 1YRAA 3OC6A 2JKXA 1NN5A 2ODTX 4GBXB 4OF7A 1QC5B 3L0CA 5K0NA 5C9KA 2QENA 5DF1A 5ALIA 1TYAE 4EQZA 3W5UA 2WVVB 2R25B 1IZZA 4HQ6A 3QJVB 4HK0A 1ZL2A 3D8BA 2ITDB 5EPUA 2IU4A 4FJ1A 2AZTA 3WBKA 1XGRA 2QXYA 2XBZA 4MRRA 1JGVH 1ECJA 4V1CA 1QHSA 3UTSB 1NPNA 2X9ZA 2GM9A 5GS0D 5H02A 3FYUB 3QXHA 1IVNA 1TLFA 4Z3GA 4AMBA 3ROLB 1JFRA 3OT5A 2QMHA 3RY4A 2WKGA 4P5TB 4PHFA 2VH2A 1CR2A 2E86A 1DCEA 1OPGH 1FBIH 3VHXA 1TQCC 1GRNA 1EVQA 4YAKA 2YLHA 4TZ6A 4KROD 2PJUA 4FHEA 4I3SH 3ETBJ 3AWIA 2Z35B 4I5IA 2FHCA 1KYIA 2JJ1D 3NZUA 3X1FA 1Z08A 2JI1A 4DMHA 1G5QA 3P2MA 1ZR2A 4NQZA 1RWMA 4BFOA 2VCEA 3RLFA 4F84A 4KNQA 4OJCA 1OWPA 3PU7A 1VA4A 2EF1A 4MHOA 3SYCA 1OFUX 3HI1A 4OBEA 3UJTL 3SYQA 2GPJA 1M7DB 1R3JB 2FPRA 2OQIA 5FOXA 1YU6A 1N2GA 4MPTA 2QN7A 4XVTL 5FR3A 5FULA 2BR4A 3OZRA 1NDMA 2I4RA 2W6CX 4Q3EA 2VOJA 3K0SA 4BQSA 2PRSA 4LY6A 5CYOA 2WTXA 4EQ2A 1D1SA 3DX8A 1L6RA 2D2IA 2RK6A 5KI6A 1R37A 1FO0L 3DBIA 1ZL0A 2VDNH 1SUEA 3TAHA 3WKNA 1VERA 4TMFA 5D5MB 3QKRA 1NXQA 1A4UA 4WI1A 2JIBA 4EDFA 3BJ91 4P2QE 2WKOF 3W7BA 5LL6P 2PP7A 3GSNB 5D1HA 2V74B 3ZN2A 3V5HB 4FQXB 1D3CA 5CJ2A 3SMVA 3BDVA 3LNEA 4KNTA 3FVQA 3GFBA 4HUUA 1G3UA 4MGEA 1BXRA 1A7KA 5C7XL 2ZGVA 3JQFC 2RAFA 3O1IC 2RGGA 1WFOA 1AQDA 1QE3A 2EO1A 2P5PA 1LTKA 2OO7A 5E95B 2AS0A 2BIPA 5I15H 4A16A 3PTAA 3WTVA 4I5BA 5KU1A 1FGNH 2BHZA 1E79A 3BCSA 3VTKA 1S9YA 4RGQA 4CXMA 3EO9L 3IERA 1IOZA 3ECVA 1QH8B 5E7JA 4LNAA 2IUYA 3L13A 2A92A 4AROA 5AW5A 4UE6A 1YMQA 5F1SA 5BNXD 1U1GA 3FW1A 1IBMB 4UQ3B 5IPFA 3MCZA 3T0ED 4F0JA 3RURA 2EYSA 1QLRB 4ZCLA 4AN0A 1CY6A 3IP3A 2J43A 5DMGC 1JSLA 3AT8A 2NSXA 2ZBDA 3LMJH 2R0KL 4PYIA 1VJ5A 2A74B 1SK8A 1GNRA 3CX6A 4IJKA 3VE0A 3SBQA 1DVFC 1OTXA 5K8UA 1EK5A 2CVHA 1JPFB 2C7FA 3VI4A 4YRZA 3D0QA 4TLCA 1TM1E 3GA0A 3H42L 1VKNA 5BV8A 3JYHA 1OXBB 4PP2B 1MLDA 4I77H 4N8CL 2F15A 3UK2A 1FTWA 2KH2B 2ZBRA 4MDYA 4YASA 3RJZA 4MQEB 5I7AA 4AIIA 1ID2A 5B1CA 1GJRA 1G8MA 4TSBL 2J4DA 3F6EX 4XPGL 4W4TA 4P46A 2BS8A 1JL3A 1A7BA 1JR6A 1L9XA 3M8KA 4UNUA 2QYHA 3ATBA 2Y93A 3QE0A 3CSGA 5K6AA 4KI5D 3FHLA 4JR1A 2PVSA 2WHRA 3P2IA 3STYA 2PAFA 2ZJ5A 1BVOA 4X4XA 4BX9A 4IYKA 3KPMA 5I6PA 4F5EA 4BBAA 4Y2JA 3NPAA 4LRIC 2Z95A 5IBUB 1EWYA 3BVUA 1J5XA 3T4UA 5HJEA 1JFQH 4CIVA 3HKEB 1R19A 1DL7L 1RP9A 4ZAFA 4UU0A 3D39B 4KZDH 1MNUL 4CNBA 3RR2A 2ZX8A 2XXMB 2NYYD 3KYOA 1B43A 2V2XA 4IRMA 1CQIA 4YT5A 1CFSB 3ISRA 1E6MA 4NKMA 2CMFA 4GLJA 4QR7A 3GZJA 4ROSA 1RJEA 2UZIR 2H0FA 2MT9A 1UM6H 5T1DL 2D2OA 3IBCA 2FX3A 3ZSTA 5I6XC 3QPCA 4EECA 5J40A 1WUZA 2JFXA 1QX3A 4DJFC 2BN4A 2P40A 3QGVA 1Z0ZA 3OZTA 2DFTA 3BHBB 4GM0A 5CEZH 2WIFA 3OG4B 2IYAA 1KVUA 1OY1A 3EFDH 4POOA 2IAMB 5JPNA 2RTTA 5AVQB 2J5BA 2VMFA 3TB6A 4I0CC 4TUYA 3C5SB 5K0GA 2P43B 5B1JC 5CGQB 1X74A 3SICE 3EJTA 4C4RA 1LV7A 1JZ7A 2HRCA 4EIGB 3NWOA 4JRYB 1X6VA 4Q1BA 5F3WB 2BS71 2ZYRA 2UVPB 4DGQA 5D84A 4LHXA 3VYOA 4XD7D 3WIHH 1G7RA 1Z8FA 3SYAA 4UOQA 5ER9A 1BXUA 3PABB 4DXHA 4L4VB 1NXOA 5I6KA 3SEFA 5A6SA 3OKKA 3F6SA 5LMCA 1PEKE 4M36A 3K2QA 1JHVA 3K16A 4NABA 1ITZA 2AJSH 1KZHA 4G41A 4QXGH 4B7AA 4OM1L 4C0QC 2HPOA 2YHIB 3V8NA 1U0FA 3OIUA 1E3WB 2W5PA 5EBLA 3IMUA 4DTGL 3UH0A 1RI8A 3ZLJA 1A66A 3GF4A 4JB9H 3BUPA 2ZI3A 3HB0A 2R7MA 5EE3A 2WB7A 3WMQA 1HU8A 1DG1G 4W9KC 4LSUH 3VXRB 2V55B 1KR5A 2CLIB 3MLXH 2UXDB 2YHIA 1MQAA 3CW9A 2ZM5A 1RU3A 3F58H 1YQWA 1YH3A 2CUIA 3G2QA 4ANVA 1CXZA 1XGPA 1CK0H 2ZKIA 3FR7A 4FFWD 3IQDB 2YZ1A 4GZLA 4I9GA 3RY6C 3V9CA 1JTOA 1RPKA 2ZTMA 2VM9A 4WZZA 4UT7L 3QUYA 1MVLA 4KFCA 1SCUA 4UNSA 4Y2YA 4P4KA 4CG3A 2PR4L 2QGEA 4AZ0A 3DSNA 1CL7H 1JDBB 4EN3A 1DHRA 2FJSA 4BX3A 3LN4B 3UXHA 3UJNA 1VJ1A 1EJFA 5JNUA 4S1PA 3H0TA 2ADIA 2FMIA 1SJMA 4YSUA 3RSHA 1DEAA 1LL1A 5BVHA 1DX9A 1XHHA 3P30L 1VGKB 5LGJB 2OSWA 4OP3A 4XCYA 3KUDA 5IQLA 3D25A 3L16A 2J3JA 3FPXA 1D6JA 4PQEA 2EGUA 2R2EA 5C18A 2HV9A 1N5RA 4GOLD 3DT8A 4KQ4L 2IPNA 4TULL 3GVXA 1HIML 2XVZA 1MIOA 2ZCKL 5AM4A 1EVJA 1ZK5A 4JFSA 1CUFA 3ZY5A 5FBZA 4NGHL 1P72A 5ISZE 1Y1LA 4KKNA 3T52A 2DWDB 1KPRB 3R0JA 4INZA 3ZW3A 5KOHA 5L3SA 3H9GA 1U8PB 2PEYA 2O6PA 3GOQA 1RURL 2W80C 4KWUA 1JG7A 3LVTA 5BN4A 5D1ZB 3NNDA 5DC9B 3OU7A 3N2IA 1B6TA 4G9FD 3DXXA 2JFNA 3OWRA 3GU3A 3BKJL 2PRYA 1AQDB 3DKPA 3VDAA 3I2IA 4NBYB 5HBBA 2N47A 3ZCPA 4GWKA 1R8SA 2WICA 4RFSA 1HE2A 2CBZA 1BSVA 3CX4A 3H9SA 5C5EA 2VBFA 4OYYA 5KVEE 2UV8A 2BP3A 3IXQA 4RTJA 2PF6A 4JNXA 1FN4A 3MN8A 2EJUA 3TMYA 4FQJL 3OLYA 2DQUL 4F2GA 2CT8A 3UYPB 5HKBA 5IJKA 1VKJA 3L0PA 4AXXA 3DUUB 3NCWA 4Y8DC 3DW1X 1KFCB 1IIIA 3MWKA 4N22A 4QRUA 5HI3D 1BAGA 3R7AA 4B48A 4BBWA 3I9IA 4QUAA 5GGRY 3X3FL 2W65A 3R3JA 1CZUA 3CHXA 12E8L 4YRPA 4PTYA 3HXOA 3F5QA 4OQLA 5E1AA 3O2JA 3QSGA 5JXED 3PUZA 3KLAA 1I7SB 4P7FA 1WWWX 2IH2A 4DMUB 1T3ZA 4DQDA 3V52H 2XH8A 3IVKA 1FUIA 2XA3A 1T1RA 4ENWA 1A1NB 3OZVA 3RX9A 4WEQA 5EZLB 1DCLA 3OM0A 3IDYC 4C1BA 3QLJA 2O14A 4D0NA 4QQRA 2QNIA 3KEHA 2X1VA 1S8AA 4MVJP 2DQUH 2XQYK 2IEDA 3GQFA 1IRIA 1RKBA 4MBRA 2IITA 4OQQA 4XQEA 4ZT5A 2D59A 3KPSE 1HSAA 4ZTZB 3WNMA 1AZCA 4UKDA 4RISL 1A8JH 2DL2A 1KK3A 2DH3A 2P79A 3DAYA 1E4OA 2I62A 4LPYA 4L29A 4OSUL 2AUTA 2ZS9A 2BGRA 3SQLA 1XEWX 5HDBB 3AEUB 3COJA 5H5JA 1RPNA 5CFZA 2D7TH 1YQQA 4N2LA 4H60A 3QG6B 5SZIA 3JV7A 3ZZQA 5HRCA 1YA6A 1GGTA 1VKOA 5BPPA 3CIAA 2NPOA 3OIWA 4BA0A 1VYVA 1YD7A 2FKAA 1EVZA 3A3KA 3EB9A 1CKEA 1PTJA 4NOJA 1XLTA 1FFPB 3VD3A 3FFAA 4MUIA 3FB5B 3JWDL 3TTUA 1BE8A 5D7JB 3T0BA 4P2RE 3ZMEA 2P8MB 5CJXA 2ZCLL 3I3SR 5JEEA 4PVLA 2J3HA 3AEYA 5I5EA 4RTKA 1FVCB 1C3OB 1OI2A 2WQRA 2O4UX 4UOZA 4COOA 5BSWA 5MEQB 4XNXH 4FT2A 4JGUA 4E4TA 1OPOA 2Y0CA 3UWKA 4FXGA 4OJFL 5IJVB 4LJSA 1Q0TA 3ZGVA 4PO8A 1A6VH 3VZDA 3LHIA 2VGLM 1T5HX 4ZI7F 4AK2A 4NBRA 4L5FE 1SM3L 4GP4B 2EH7L 2PKCA 3KTAA 1INQA 3BISA 2LPMA 3P9RA 5LA6A 3L54A 2NW3A 4ZQKA 1Q7RA 5DSZA 3ECBB 3SDZA 4JQCA 2XUKA 1OF2A 4YRJA 3QTLA 2GTIA 4P8RA 5BSVA 1XPOA 3FWKA 5KANG 4FMBB 2CHNA 3HJTA 3GQVA 3X1GA 3N3EA 4XIJA 5B1EA 1JD7A 3D6VA 2Z09A 2XNKA 1RUMH 3R7QA 1HX7A 4M8KA 3GBMH 3U0BA 1FYEA 2PZGA 1FP7A 3MRKB 3VD0A 3BIAX 4JLDA 3ABGA 4M89A 1M54A 4NXKA 2C82A 1M74A 2NY4B 2WJ6A 2ZOTA 2YGOA 5HMLA 1JS4A 4Q6IC 1K0UA 1OHHD 3DP9A 3GUCA 4C76A 1MW3A 4YRFA 4C1NA 3VC2A 4MAMA 2BIIA 4CMIA 4J3WA 3T99A 1X1EA 1LWOA 2YAFA 4OKNA 4FW8A 1SJHB 4NKDA 2BFBA 1X5HA 4GQ9L 4GPIB 3NCYP 4DP7X 5JHDE 3INUL 5BYJA 1NM5A 3UO8B 3D1MC 1MJFA 4E41E 3ANMA 4FXKC 1UWKA 1T4GA 1QS0A 3GHYA 5DURD 4GPTA 1ZEAL 4NMMA 4K1LA 3KUCA 16PKA 4CIDA 1PQZA 1AKQA 3GEFA 3W9EA 1ADWA 2MCAA 4ZTBA 2BVQB 1VL5A 4C6HA 2B99A 3G23A 5E6ID 2C9BA 3NU1A 1V6SA 4DM3A 3D39E 1O6CA 4CKZA 1PS3A 3QA3A 4Z0TA 1BXGA 4BGVA 5E6UA 2BJMH 4FFOA 1RWPA 1U3DA 2J9YB 2VXTL 3HJGA 3C6LC 2P9RA 3S40A 3BZ4B 2NY2B 1W30A 5IJ0A 5TE7H 1UAGA 4ACBA 5IZCC 5AVYA 1A82A 4P7GA 1Z75A 2X09A 5LDHA 2BM1A 2PMBA 5AVRB 2C7UA 1AB6A 2Q7YB 5E4OA 1WY5A 5SY9A 3RS7A 1T7ZA 1SHLA 3N1PC 3NCHA 2GN6A 5EJAA 5I1AA 1LGYA 4HB4A 4PTUA 2K8QA 1UM6L 2NPLX 4OHZA 1EM8B 5FRDA 2JGDA 1TMKA 4RFLA 5B4MC 5JS2A 3BEVA 2LR4A 1ZCJA 5GZOA 5J1TB 5IT5A 3X1EA 5K03A 4TL4A 1GGFA 4V39A 1EPFA 4KTEL 3ZLQC 4HDRA 2HFEA 2OG1A 5AKTA 4XOBA 5ADWA 5JMPA 4HJ0D 1A1OA 3GLHE 3AACA 4UVDA 1INEH 1U0GA 2PSFA 1CVRA 4XNUH 4HNQA 2Q9CA 4WFEE 4REQB 3HG0A 3NCXA 1SVSA 5JOPD 1EE9A 4AY2A 4E9VA 3ZL4L 4U7SA 3WV4A 4JIGA 2QADD 1DZBA 4DKTA 1RUQL 1QO9A 5ICGA 3FCEA 3KLDA 4HDKA 3QZWB 3NTLA 5IMBA 3H3PL 4CSSA 1C7IA 1HHJB 3FROA 5AKKA 3C5CA 1EJOL 1UENA 1FBNA 1UFGA 2CO3A 2J0UA 5I7UA 3GHBH 1HPLA 3SGDH 5DYGA 3SSMA 1UEIA 4FNUA 3FTYA 4YROA 4M3NA 3SLRA 2VQ4A 1R9GA 3FOLB 1HJCA 4HMEA 3M07A 2I33A 3IB3A 4YOKA 2Z6UA 1G8HA 3IU4L 5FFMA 2ZYGA 3IVCA 4HXFB 3FS9A 3HPLA 1R3JA 5IBLD 4KHTH 2W2TA 1S7WA 5E00B 3K53A 1XT6A 5FPHA 1N8NA 4EVQA 2IG2L 5C6PB 1EFCA 2O8EB 3JQQA 4TF4A 2AXFA 2WWNA 2NZ9D 2R0KH 3F7YB 3FU8A 5GWXA 1BXKA 3HVRA 4ATWA 3IIIA 4BP9A 4MO9A 2H2GA 4RVGA 3Q5TA 4UPVA 2R69L 1JLHA 3UMJA 4P5KA 4X00A 1TFRA 4TYMA 4HCRL 5DS8A 3U7QA 4LAQH 5JHGB 1G4MA 4HIJB 3B9BA 4BTLA 3TT3H 5AFSA 1V9CA 4OI2A 4O2AF 3I73A 4DLKA 3ZKXB 1K5WA 4EL5A 2ON6A 4AGOA 4ZVMA 1VZ2A 4GG1A 4KYVA 4EJ0A 5D93C 3U2JA 3MV9A 1BX2B 1RZJH 3B70A 1ITCA 4PPYA 5E94B 1QFYA 2OMYB 4WVRA 2EC9U 1CUEA 1QHFA 3H1GA 3DX6A 2N1MA 2CB0A 4Y2SA 3PPIA 2VZTA 3W82A 4G5ZH 4Y2DB 4XXDA 1GUFA 1YVPA 5G55A 2RK3A 4NC1C 5HM8A 4BRVA 1GYPA 3I9FA 4RPIA 5ALKA 4XBGB 2JIZD 3CY6A 3JS5A 4H8PA 1CDGA 3A3PA 4Z8XA 1JGTA 1OO2A 5IR1A 3KR3H 4JEHA 4Q7MB 5EU6E 4OZHB 3UG7A 2QE7D 4LXFA 1SHZA 4QYSA 4BMDA 1XMQB 3MT0A 1DVQA 4GOJA 3ESDA 4CLRB 3FN3A 1MHCB 3W0LB 4JG0L 3ZHQA 3I50L 1TUPA 1WKVA 3WI9A 1USKA 3SY8A 1E59A 3AQXA 4LLQB 6Q21A 2X44D 4X4ZA 2UZ4A 1UOVA 3TEUA 1MCRA 2XWBA 2DEYX 1UPAA 4YCLA 3VO9A 1YCSA 4WSJA 3UAJC 3RK1A 3FO1B 3A25A 1L9RA 1QZ3A 1CR0A 3EPRA 3PKIA 3QXCA 2V4UA 1FLAA 2VFAA 2WYUA 1GQ2A 1THGA 2HJWA 4GAFB 1YCGA 3ULUC 3HJNA 4DLXA 1TJPB 1CDDA 4HKBA 4MZDA 3KCPB 1EWKA 5FJIA 3TYFA 1T2DA 4R7NA 3FN0L 5IM7A 3AHIA 4R26L 1H5QA 2J7PD 1JRHH 3VFOA 5KHLB 1XZNA 4DO5A 5EOVA 4NIMA 1Z0SA 2B8OT 4F7KA 4G01B 4KR3A 2QPSA 5FYKU 3TAUA 1W9HA 4OGWA 3LUPA 2G36A 3EIFA 4P7JA 2W6JD 4D0LB 1FUEA 4RH3A 4AJJA 5MENA 4JY6A 4PG8A 2RACA 1DBAH 2D31A 3NWEA 5DNWA 3R7DA 5HKKA 3DPUA 3T5AA 4YSRA 1JXGA 4BKUA 3M1BA 5DH9A 4FGUA 3PC3A 3KJEA 4GQQA 5F1OA 1QX1A 4NP6A 4ZOLF 2G3YA 4X5XA 1GZ5A 4NRZB 2GFIA 4YAGA 2OZLB 3W79A 4ALAC 1GM5A 1JUFB 4N7MA 1GIAA 1TK2A 2XVLA 1H3GA 3A6FA 1IM3A 2OGUA 3UROR 4LI0A 2HHAA 2H2HA 2UX6A 1H5BB 2YWFA 3D4GA 4NCBA 2OK0H 4JNKA 1B3BA 2ZPUA 3LF2A 5LCVL 2FO1A 3FMIA 2N3ZA 1XGPB 4XVSL 1LO3L 4OUKX 4LLVB 2PS9A 2JGFA 3H2JA 1RUPH 4DJAA 4AGMA 4HUKB 2RJNA 3D48R 4Z0XB 4LLUA 3U36A 4BJ3A 4P4SA 3KEQA 4NM4H 4ZVLA 2PL9A 1KTJA 5FOQA 1K06A 3SJVA 3V0VB 4PWEA 4OD1H 5LOVB 1PZCA 1N3NB 5IZCA 1OTUC 4XZ3A 1O7DE 3WL4A 4YHLL 3RVNA 2EDKA 5GZ1A 2EARA 3VX0A 3IOMA 4MJJA 3MNVA 1A4BA 1S3RA 4H35A 4P5TD 1KLUA 2JCGA 4IHAA 1O6GA 4P2RB 2VH5R 4HLQB 4Q9IA 4AWJC 3CVCA 4U6XB 2VDRL 3GGSA 3UK7A 3UIYA 3Q2IA 2VZ3A 4MJ2A 4OV5A 4PRDA 3ORRA 1L7VC 1GPYA 2LW7A 3WMWA 4DCCA 4MRPA 3K8YA 1D5IL 1WIWA 3JVIA 4H2DA 3K5SA 4ILKA 3L8YA 2HT3D 4BZ2A 2Y72A 4RVNA 3ZCXA 3FW6A 2Z5LA 3NM4A 5L4FA 5JQGA 4ZUTB 3FWNA 1FSFA 1OYOA 3ZDZB 3EDDA 3S2SA 1ZVQA 3IDAA 2DUMA 1OM9A 4DFIA 2DPYA 1LSJA 1MCNA 1K8ZB 4P5EA 1NW6A 1TQ8A 5CEJA 3GSNL 5HHQA 1F97A 5FTNA 2WQAA 1MCPL 1LEIA 3AILA 4M0DA 3ACDA 1KWKA 3UXEA 1A6VL 4NNOA 2WXPA 4PAMA 4YN3A 1Z5HA 3H9SB 1F9EA 4XNDA 4NPYB 4PRZA 4CC4A 4D2NA 3PCTA 5I3ZA 5KZMB 4DUYB 1KRWA 4QDJA 2B3RA 4JYAB 5AD0B 2VXQH 2JKWA 4PAZA 4KJXA 3PNMA 5HHQB 1ET7A 1JAIA 2GNPA 4QJ5A 3V7AG 4C4BA 1MEEA 4KVFA 5CPBA 2ZRQA 4KJPC 3RIYA 2C00A 3CSYA 1AANA 1F2VA 3NBKA 5C0CB 5H3CA 5GRUL 3QIVA 4LOKA 4CC4C 1W0KD 5D7HA 4PJIB 3UWPA 1G7MB 4C22A 1MDTA 1I51A 2CLSA 2PQMA 3STTA 4OX9Y 2IF2A 5IK3B 2DAVA 3NJ4A 2ZUCA 1PLJA 2B2XL 5E9DD 4I87A 1Z3CA 4JN6B 5AI9A 2P9TA 2O3JA 4MTLA 3FBQA 2DQCH 1DEKA 2VDKH 1KRHA 2WB1A 1J2EA 2E0PA 3Q3GA 4Q4LA 4LWQA 4LYJA 4GW1A 3HR8A 4ZX4A 3BW9B 3RDTC 1MHEB 1RWVA 3ECSA 2EZTA 1THMA 1WKBA 1UCTA 1X7XA 4PRAA 1MGOA 5K59E 3L2MA 2NTYC 1KLFA 1TAHA 5L4JA 4P2OD 4F58L 4OHVA 4DEUA 2HFTA 2B1RA 3HHEA 4F5ZA 3U3XA 4GXUN 5DS8B 1QNLA 2K2QB 5B21A 2F48A 2GBAA 3PSHA 3O4LB 5DRXB 3AP1A 4WVLA 2CGYA 4PAGA 1Z35A 3LYAA 1UZUA 3MSXA 3LV8A 4N9QA 3FPAA 5FM4A 5AUNB 1YN6A 1OTHA 4TL7A 3EJYD 1NBVH 4RMHA 1XB8A 1WLHA 1QOZA 5DN6D 1FB5A 5BVGB 1JB9A 3PGVA 4YP5A 3DVAB 1E0KA 1CQXA 1CZ8L 4C6TB 4XBPB 1GEEA 2IU3A 1OHHA 3NAMA 4NUJA 4HEA6 5B1DA 3NHBA 4ZRMA 1NCIA 4S04A 2C94A 1HYEA 3B9VA 5TQVA 1EDQA 1ICIA 1ZINA 2QPEB 2WZAA 2E21A 5ITZB 2WLSA 3HR7A 1H66A 1A8HA 3QP9A 4E94A 2P6MA 1C0LA 3P4NA 1CUVA 3KYMA 4KSCA 1OTSD 1TZ8A 4JENA 4JUAA 4R2JA 1A76A 2ZPKH 3P27A 1CGUA 4PJFF 2TRYA 2D6FA 4IVPA 2XT9A 4KFSA 3BKXA 5HK9A 1YB1A 3GRVA 3K2EA 4EXKA 4N47A 1OCZB 2Z8VC 2TS1A 2N46A 3VMPA 3G6JA 5LBSH 1PSKL 5JJIA 1SPDA 2GXUA 5EWLA 4P0QB 1SLVA 1PZFA 5K0EA 3U83A 4C7JA 3NWBA 4G2AA 4YHLH 3KPYA 3GPBA 4K5NA 3NA9H 2AQ8A 2NPIA 4KN9S 1AGCA 3G8YA 4OBWA 2V6JA 2P5WB 1Z63A 3O2WL 1JWMA 4C56E 4HF7A 2I6QA 1TNDA 3MRHA 3BPLC 4EFNA 3VNSA 3KXFD 1EFPB 2AJXL 2BMJA 5HVHB 1DS6A 4OQFA 1AGDB 2BK8A 5BO1L 4P7KA 5ABPA 2PEZA 1JHPA 5ERXA 1F1GA 4FS0A 4JMLA 3VNRA 4KE8A 1Y3BE 3CRW1 3I2KA 4LCEA 5EZLA 3ETLA 4XUDA 3T08A 1WJGA 5L4NA 4W1TA 1JCKA 2BEJA 1JZFA 3I3OA 4FE7A 3DE4X 1VJDA 3TPUB 4K6MA 1KE2A 2VHYA 2VN8A 2WVHA 5AW9B 4N5NA 4O4LA 5B1IA 2VEOA 2IOFA 4LNRA 2NY6D 4PS3A 1UC8A 4RMTA 1SXHA 4ZMQA 3VX3A 4N8DA 1KOLA 4Z7VA 4QPEA 3X1JA 3AM8A 1EWTA 4MW1A 4OIAA 2ZIWB 3R3SA 4XP6L 2I99A 4LVHB 2YXEA 1YY9C 2ZXBA 2BUCA 1E3QA 3EYSH 2GJ4A 1VDMA 2ZIVB 1RH8A 2LLNA 2X5XA 4E5XG 4GNKA 8GPBA 4LDJA 4IHBA 1E1RD 1BP3B 4K2AA 4L28A 3RV4A 1WW8A 1G94A 4JO8A 4RGNE 5I76B 5KTOA 1USGA 2PQ6A 1JF5A 3OCXA 2KBEA 4AQAB 2EFHB 1DBJH 3VG0H 4JFFE 1WZ1H 1BRMA 3M4NA 1NU8A 4R1LA 1AT1A 3KOOA 2NADA 3BMOB 3ZLUA 1X7QB 4BB9A 3I6KA 4M86A 3B3BA 3DS8A 3G5WA 3QIUA 3UZQA 5FGCB 4CILA 4GKNB 3D85B 4HYQA 4XNAA 3MUGB 2WNHA 1KAHA 1MWAB 3UJ3X 4N25A 4NQVB 3RC3A 5DC2A 1WSST 1ZVYA 3LUFA 2RAPA 4XVUA 4Q89A 2PV0A 3TOCA 2WMPA 4G85A 4YXKL 4JB9L 1KK0A 1HLPA 1V7CA 1L0XA 1W36B 4L8CB 2FSFA 1RPTA 4D4KA 4S10A 4ZTOH 4MQLA 1ICEA 4NSKB 3NGXA 4HMDA 3IT0A 3MS7A 2CDEA 3PQYA 3G08B 4TL5A 1LNUB 4WOBA 4JFYB 2H0AA 3TCTA 4HWBA 1G5PA 5FI3A 1O6FA 1VG1A 2QDKA 4Y9TA 1QFUL 3BRGC 2IH4A 1PN3A 3EZXA 2X6UA 3T0IA 2MMCA 1LI7A 4I55F 1JBKA 1COWA 3QNXA 5DMKB 5EMHA 3ARPA 1EGJH 4O8ZA 3TNJA 2CDNA 1IM5A 3IJ8A 1JXDA 4GW3A 5JPMA 3QJRB 3DECA 1U8IA 5H94B 1SHWA 3OU6A 1K2VN 4YLBA 1IGCL 3TE6A 4UI2A 3TZCA 4DABA 3UMSA 5AW7B 3H11B 2XQJA 5FB3A 3X11A 4I55A 3O4FA 3RKDD 4MNQA 2GSIA 4I4IA 3D6GA 2JKLA 3COVA 1EEZA 1N3BA 5EQFA 3A1TA 2H59A 4RDCA 4OXNA 1VBMA 3EEIA 1RKRA 4FKMA 4R4FH 5DJDB 4BZXA 4TS1A 2VR9A 1EFQA 2PSDA 3KLNA 3DYOA 4QBFA 1BJ8A 4MI3A 4U1GB 1T0JB 1XJ0A 2JIXA 2PZEA 3K0WA 3DNFA 4HX5A 3BP5A 5MEOA 3TWCH 4YJZL 3FAWA 5LUAA 4KAQL 3EXHC 4P46B 3VA2C 2APTA 2W9DH 4P2OA 2JHAA 1DB3A 2DHDA 3UTQB 2PMZA 2POQX 1YE8A 1MC8A 1LO4H 3LTVA 3M81A 2C4WA 2CXXA 5CU7A 1WETA 2VLKA 1NXSA 4F3FB 2GZSA 2LU4A 5ESVB 5SV3A 1EDOA 3AVTA 3BEWB 2VAXA 3KPNA 3BGWA 1SUJA 2NYRA 1X44A 4Q21A 5FGRA 4OKDA 1VCNA 5EO9A 2B9AA 2YRBA 3LF1A 2M8XA 1WDLA 3Q9NA 4ISCA 5EOTA 4HMOA 1UM4H 1X3LA 5JNLA 4XXWA 3V0HA 1ZH4A 5AM2A 1KFAH 1EJ2A 3T35A 5DFAA 2C3PA 4BHTA 3Q9LA 1J8QA 2BRUC 1E4EA 1AH1A 1IEWA 5EJ6A 1E1CB 1LLUA 1YNLH 3AGQA 1B4TA 1H23A 3EQ7A 2MOKA 1P2FA 4A6YH 4U6HB 3LQFA 1AKWA 3TEJA 1SBBA 3NIGF 3HCAA 4X6EA 4PRID 2N0SA 4OYRA 1JFTA 2PH7A 3DGGB 2QRQA 2AT1A 4WT7A 3P2OA 5T1JA 1J09A 4PLJC 4DDMA 1XQ9A 2HDHA 1RYEA 3OBBA 1VDZA 1B14A 1KQOA 3VR0A 1XPRA 4IW3B 5F7EL 4CEHA 4X1KB 4UQIM 2WD7A 4RL4A 4ZW6A 2G80A 5IVXE 4KHXH 4L23A 3ESYA 3TOXA 4J1SA 4RTMA 2R0LH 1M9SA 2NZVG 4QOGA 1J8DA 3G3LA 4EUFA 1FSSA 4R05A 4BGEA 4KK3A 1P1ZA 2NSMA 2R7EA 4YJGB 3K6SB 1JK9B 3CV5A 1XF2A 2WUBH 3FQTA 1ZMTA 4P81A 4QYMA 4DQ0A 5GGSA 4JQIA 3ON5A 1FC0A 3UOWA 2VITB 4ZX5A 1DNPA 3ORSA 4G2NA 3BGVA 1JLSA 1YS1X 5FL7A 4IJQA 3DBOB 1N2CE 1MVYA 4WI2A 4ZBJA 4FA7B 3OKEB 3A1WA 3OLCX 4O4IA 1KAMA 1QIMA 1AR1B 1QH0A 3NW9A 3WLIA 3EJUA 4WPGA 5CG2A 1LQTA 4XCCH 1TGVA 1UZ6F 1YEGH 4OZFG 3A9UA 2Z7UA 1G20B 5K8IA 3TWCL 3RF6A 1W6LA 3V55A 3L84A 1LQ2A 5FYJE 1F4XH 3LH5A 4D9BA 2B1AL 1CS4C 2M6SA 4Z7OF 3OL2B 5LD2C 3INNA 3OUUA 4Z0NA 2BH0A 4LOVA 3WJJC 3MOQA 3MXWH 1I8TA 2WA2A 3U4GA 3SIXA 1IVTA 1K7FB 2FSVA 3IXTB 1MCWM 1MRCL 5A6LA 5CYPA 4BCXA 2O61A 2X9GA 2QPFA 4AH2B 1L4LA 5DPMA 3LP6A 1GSAA 5TE6L 2WFLA 2Q62A 5L7XH 1E9VA 3UZUA 2B3DA 3B1KA 4AKEA 1UQUA 4UZEA 1BMFA 4H4DA 4KJWD 1DVYA 3B1YA 4GYYA 3UTPE 3QLVC 2LCIA 1P4LA 1RXLA 1KJ2A 3MJWA 2AXEA 5ALLA 1AKVA 1UZ8B 4C4SA 1AQJA 2GRJA 1SHSA 2A4KA 3DHYA 3LZ6A 4H26B 1IM9D 2C3WA 3APFA 4RRPM 2NU8A 1G9SA 1XQWA 3K2BA 4BGDA 2LVEA 2ZDQA 4XQ9A 3VD7A 5AJVB 2OLKA 2Z2IA 2K4AA 2H4HA 4JJEA 1M2OA 3L02A 1A9XB 2BY3A 3OCJA 5HTKA 3KQTA 1GTFA 3LXXA 4NYIR 3V8OA 3UFBA 3JWDC 2CMRL 5EC8A 4F46A 1NBYB 1M7UA 4FNLH 3M5WA 4V1DD 4JI1B 1KIQB 1G5AA 3M2TA 2W2QA 2YBDA 2QQNL 4X7TA 3D25B 1W8DA 3RG8A 4N2IA 1F0LA 1I8KB 3PXJA 4UHEA 2JWYA 3FO2B 1AU9A 3QF7A 2A0YA 4QUBA 3UG6A 5I66A 1HDXA 2AEQL 5D5ME 3GFFA 3N2GA 3WLBB 5F6IC 3EOAI 5HSGA 5CBPB 4MA8L 4MVBD 1S7XA 1V9LA 5FX3A 3AEXA 4HIIB 4IRZA 1WFJA 3A3YB 2P8LA 2BFEB 3T7TA 4BV8A 2AYYA 1HXHA 2WAQA 4IYRA 5CJQL 1RAHA 5DI9A 4N1CA 4MNQD 2NZWA 1S3KL 2MWMA 1LMIA 4WBNB 2HDWA 1IL0A 4H0IA 4EYOA 4RVOA 2WAHA 3AF6A 4X65B 3H9JA 1OXUA 3S1SA 1TEHA 5C51B 4RMRA 1JV5A 2F19H 4S0SD 5I2IB 2WQWA 3CZJA 1X7HA 1F1JA 1DKMA 2BKAA 1T4CB 2XHNA 4O9HH 1ZWKA 5JXAL 3M8OH 4P84A 3MV7A 1SOXA 1CFZA 4ELMB 2OGZA 2DWTA 1VPEA 3QG7L 2VN5A 4OIBA 3CC5A 4EG4A 1T0PB 5IV2A 5JHLA 2DR2A 3JYLA 3THRA 3KVQA 3K0CA 3Q8LA 1T91A 1HZHL 2YWDA 3IKCB 3CKYA 1DANT 1SY7A 3S44A 3H5IA 4MQFB 3BPCA 2YV1A 1FAIL 3S37X 1XUOA 1CLUA 4M1DL 3EJCA 3N1GC 3TWOA 2D4HA 3CSPA 5DEFA 2Q6TA 1LK5A 4Y1AB 2Q1TA 4P4NA 5C0BB 2ICAA 3VOTA 1JKIA 3CZCA 3BFXA 1AYOA 2K70A 1D2GA 3FT4B 5G1NA 4YNYA 1L5FA 5I7SA 1PSKH 3LQ4A 2PPLA 3RDTD 3DMMD 3FQRA 1A7QH 4Y1AA 4J5VA 3WXBA 5LBGA 5FX2A 2ED7A 4LX8A 2F55A 2E3JA 3X14A 4JO4L 1B4JL 1NCWL 1QHIA 2DH2A 4FWIB 3MO1B 4E5YA 3O2DL 4DR3B 3AVVA 3PX7A 2CVFA 5THQA 1JRLA 4RMIA 1VMDA 1OSZB 2CLVB 4UXHA 2GCEA 3D0LA 5DHMC 4LSVL 2G5PA 1NI5A 4KKAD 4EUPA 1PHRA 4XPBH 3E18A 2PSJA 1EK2A 2YJ3A 4F20A 5A3RA 2VW6A 3GMPB 3P3UA 4DEWA 1ZHNB 1TQWA 4ID3A 2AITA 2PH5A 3EYQC 4RGNC 3UEQA 3OTHA 4BEBA 3ZS8A 2FAUA 3UDWA 1QV6A 4CTOA 1E3TA 2MNJB 4ESVA 2FX8L 4HKXB 2ALAA 3SZRA 2AEPH 3C4QA 5DU7A 4PB0L 2FWAA 1E28B 4ADSG 1JF1B 1RJDA 2VNCA 1TKWB 4JEGB 2W9LA 4KK9D 4J3OG 4NQSB 1IATA 5L3QA 2FQGA 5TJ9A 1U6KA 2GKIA 3GB7B 2CL0X 2BDNL 1YY8A 3WHE1 2BNQA 2G1JA 3KLAB 4FXKB 5ALCH 3S4SA 3R6TA 4YC2C 1PJRA 4ZDHA 1P9RA 3ILPB 1A1NA 3GIZH 3OB0H 4IIGA 3OM1A 5ILTL 2WSSA 4HRYA 1RLWA 3JQ8B 721PA 1YACA 1PKEA 3TO5A 1ORSA 4K88A 3C60D 1AZNA 2F8SA 2R3SA 3JQBA 2NG1A 4Y5VC 1RWXA 3EJQA 4URXR 3U4IA 1UJCA 4FXKA 4JPKL 3S4SB 5KAMA 1G7IB 3DAPA 5EXPA 1QG3A 4LG1A 3N8DA 1Q0SA 1P0PA 5DQDL 2LDXA 3HE7D 3QWIA 1YY9D 3H11A 3LNIA 2APWA 4PG2A 5F89A 1FYTA 1FUYB 4KZPA 1ED3A 2LGNA 3HAEA 4W4OC 4KKLD 1JHYA 2Z34A 1M3JA 3VISA 2M6KA 1FYFA 1JHKH 1YQUA 4KV7A 4ELKA 1LCIA 3GFQA 5FIEA 1KQ3A 3MV8D 1D07A 5IAKA 4Q3AA 1COBA 4GXQA 2AJUL 3OC8A 2ONJA 2BM9A 1JHRA 1MCPH 2ZCZA 4LMRA 5IVDA 2Q8AH 5HYJB 5KG9B 1TU0A 4CMHC 4FR2A 3M5PA 1G9NH 5C37A 4YHKL 1KTVA 5JJCA 5J13B 2GCIA 5AKVA 2IFTA 3ZK9A 2BH9A 1SUDA 1QNIA 2CJYA 1BQ5A 3V95A 3W38A 4NZTL 4ZVTA 4X6UA 2AOTB 2J3LA 1LEKB 1DTSA 2D7OA 3UTOA 3FCBA 4KIWA 2DT5A 4TXJA 4OKIA 2WQUA 4PRBB 4CMGA 1U8JA 1N5AA 2YV5A 1L8QA 3NH7L 4GSLA 3BICA 3WXVL 4K2UH 3JWNE 4EZLA 1N0LB 2DM6A 1GW0A 3Q8AA 3CUEF 3Q3VA 3PWKA 1EDHA 3C16C 3TW8A 1O94D 3FUEA 4UDUB 3DURA 4TTAA 3KZVA 5AWNL 4RJTA 4YY3B 2BLLA 2P9QA 4AZ0B 1FRZA 4MP8A 5SWZE 2FPUA 3Q2KA 4URTB 3C1UA 3VH3A 1MCZA 3QC5X 1EGMB 4IGEA 3DCIA 4OZIB 3W8RA 4OD1L 2AWOA 2PGLA 1YS6A 1E4KA 3FCUB 4LARL 5LBTA 1FJ1A 2JKYA 1A6PA 4IGBA 2QAGB 3FGNA 5TF1H 4U7GA 1G7SA 4KLRA 4Q9RL 1S8NA 3QVGA 2R7KA 2RGYA 1PX8A 3PNLA 3WLFA 1JI0A 2WLJA 1NJ9B 4LDCA 2ZIUB 4QWWC 3OBAA 3A27A 2AJCA 4QRSB 2VCOA 3OECA 2EDAA 4RNDB 4U1HB 4WJ5A 5CFLA 1WFUA 1B93A 1E5DA 1JFSA 3PHBE 4GXNA 3CN0A 3MSCA 4PG7A 4FINA 5IM4F 1G8SA 1QQDB 3DROA 4MMZB 3JYQA 1EZZA 2QIPA 4WESA 4J8RB 3A6DA 3A24A 4ZA2A 3LVEA 5ANMA 4HR7A 3B5TA 1A8SA 4DNOA 4S3MA 1NAMA 4U1HA 1VGRA 3E9ZA 4A6DA 2HUPA 3N6XA 3DM9B 1HSBB 5D85A 2YC1B 3X2SA 5L2KA 3PUUA 2KMWA 1UURA 4MQSB 2PG3A 3TNYA 3IODA 1W2HA 4F6RB 1J06A 1RQRA 3DDUA 2NX5D 4TLUA 3AT1A 1W47A 4P06A 4BNLA 1VLZA 4RH4A 1G20E 2W4IA 5KTEL 2EFYA 1PZSA 1C50A 4E5SA 1W87A 1EYZA 3VFSA 5BPHA 1K8RA 3PPEA 1TT6A 3R0NA 3K9FC 1FNEA 1H9DA 2NTVA 5EWIL 1DQML 2FWJA 2G3ZA 3ANSA 4WLVA 1ZSDA 2DQ6A 3P2DA 2R1VB 3DFMA 1AF4A 1J1PL 2IH8A 4GOND 4I1PA 3BXPA 1G8YA 1IZKA 1HQYE 4PQYA 5LLTA 3MJ4A 2MQ0A 2ONKA 5JH7A 2WQVA 1JPST 1YFJA 4YDIH 1JBEA 1T8RA 3RL1B 3PFFA 3GNTA 2VUIB 3FU9A 4XPFL 2CK0L 4P3DB 1Z25A 2ZSIA 4NLLA 4NULA 5EJGA 1OCCB 4I19A 1HEIA 5F98A 5E8JA 1D2EA 4HEQA 4MA7L 4J4PC 3HE6B 3DQPA 4JG1H 3H7BB 4CNQA 3MBWB 5DEGB 4MRAA 4ALAL 2QVCA 4Q4CA 1XMWA 4ONFL 2YRPA 1DQTA 4NQQA 3DO8A 3HUEA 1BQLH 3E4CA 1GCAA 1KZ9A 5AW3B 4YFYA 2XZAH 5NULA 2LTAA 2FZLA 5ARDA 3HV2A 1LVHA 1AY1H 4KROB 3I6KB 2YRLA 3DE6X 2R9HC 3V5KA 4YFVA 1MCOL 4ENEC 4AYWA 1PX3A 5JW4Q 5AG8A 3GMLB 2ZXWB 2WHEA 2AZAA 4RFEB 2WZDA 4B3JA 4YXWD 4M9RA 1XVLA 2H63A 4G5QA 1X7WB 2JRCA 4PCAA 2DIAA 2YKKA 2XIDA 2IEAA 1J5DA 4P22A 3SX2A 2OI9C 4ZRNA 1L4KA 1RJWA 3EMKA 1TTPB 3V7FA 5FNVB 1PF7E 4CGUB 5HUHA 3HEIB 3BWAB 2JEZA 1EO7A 4OJNA 1J4AA 2FG7C 2XQGA 2B9BA 5JJLA 2GEKA 5GRWA 2WJPA 3F8TA 3GINA 1EU1A 1BM7A 2VDQL 1KEWA 4ME6A 4KXZH 5T1LB 1C0PA 3IDQA 4DR5B 5INCB 2QTAA 4X7RA 1KCUH 4PGEB 2CSXA 3DOHA 3E6HA 3B3GA 3W9YA 3ARBC 3L9YA 1FFOB 3IDIA 5JXAH 3QPWA 1JR2A 3ALWA 5IB3B 4MB4A 2UYLB 2FPOA 1PJ8A 1XIWB 2PU5A 1QI5A 4II3A 1B23P 1B2YA 4HA1A 5EU3A 3D0AA 3O91A 3GLHA 3BSZL 1KI1A 2OZKA 3JQDA 4MGIR 1XCTB 2X7JA 2EQBA 1E92A 2UUPA 3T1HB 2WMYA 4EJ2A 4P3NA 3HLTA 1E7UA 4KMTL 5FBQB 3W5SA 3FRPA 5BN3A 3D51A 1PJCA 3SEQA 2NTFA 2Y1YA 1J2YA 3E3OA 3LH8A 1TJIL 4HWNA 3CZLA 4KE7A 3EZ8A 3STLB 5DLMH 1LA2A 3NT5A 2Q3HA 4RSMA 3L7LA 4HGQA 4DMLA 4RELA 4AVHA 3DRTA 1OWMA 3SZLA 4ENTA 4Y9GA 3GVCA 3MLTB 1NJGA 3DD5A 4HYTA 3U0TB 2PR9A 5C4GB 2G7MC 3P4OA 4XZUA 2Y05A 3ZLVA 2AV7A 1HOXA 2H2SD 2ZP0T 3THYB 4JU8A 4OM7A 1Z83A 2WT4A 3OY2A 3DX6B 3NEEA 1Y07A 4YECA 2XZAL 1KC3A 3EUEA 5K9JH 5I1GL 4OXRA 1XX9C 1E5VA 3M86A 3MUNA 2D1YA 1J90A 2MJLA 4NC1E 2SNIE 3O2VL 4NU5A 5CB4B 4OU3A 2Y3IA 3C2AL 3QA9A 1M7IA 4JN2B 3ARSA 4GRIA 2D7MA 3QDGE 1CK4A 3VH8B 3UTTE 4IX9A 1VHQA 4E41A 2RARA 2WSIA 5LAPA 2NVWA 4OPMA 1R9JA 5TNXA 3WLOA 1HYBA 1V8PA 1WLSA 1P9NA 3GQBB 4HGWA 1Z9PA 1JIUA 5I0ZA 3TXXA 1DBBL 3TLZA 3PDOB 3OQMA 2F59A 3VWJD 3LZLA 2J2ZA 4KXWA 3SZUA 4WWID 5HXAA 2PCJA 1XD2A 3DOUA 4ZFFB 4EQ3A 1UKQA 4HZUB 1F3JB 5D1XD 3IAS6 1HWGB 3HN7A 2GABA 3NEAA 1DWUA 5BP7A 2B1OA 2NNAB 3F7OA 5AO9A 3DLHA 1WSBA 5JMWA 2ZI4A 4EX7A 4CSTA 1Z62A 4PC3A 4W6WB 1IHOA 2GQHA 2JBHA 4ARSA 3ARFC 5A3ID 1GPUA 1WU7A 4KQWA 2YD2A 2GB2A 3I62A 1NGPL 4A7GF 1IVLA 3O3NB 2V5UA 1ECFA 4B43A 4JB8A 2D3VA 3L6RA 3KQHA 4ZXBB 4JYCA 3HCVB 2BF4A 1KGJA 1JKFA 4WGVB 1WFMA 4IOIA 3STHA 4OCRH 3TU6A 1T04A 2JC3A 4BD4A 2C57A 4K9MA 3Q8XB 4KIGA 1MJ5A 2OZLA 2YW9A 2H3EA 3AXLB 4P3YA 5D3ZA 1T4MA 5D7JC 2OAP1 3OCYA 1UDCA 4I18B 1OL0A 4JO3L 4BCZA 2HCJB 4AZVA 4HKBB 1NAML 3LH2L 2OTUA 4PGHA 1XWIA 1QQ5A 2I29A 1WB4A 1NVXQ 2IVZA 4N8VG 5BYAA 5DJAA 3ZGYA 4Z0BH 4Q7DA 3HCNA 2NR6C 5T3UA 3LNFA 3MX0B 3IDSA 1JR3D 2QR0A 4OF8A 2EIXA 3CZPA 2HXYA 1BFVL 5IBLC 2GETA 1H22A 4FFVA 5HCUA 4N3UA 3UHJA 2R86A 4RIRA 1A2QA 4GRLD 3JTMA 3B9PA 2ZCHL 4KPHH 4PBXA 4OFIA 3NM6B 5EJ7A 3AI1A 5DX0A 1OAYH 1VLHA 2W8BA 3FMFA 4CM7A 1R3UA 2PTTA 1S6YA 3BSSA 4BFIB 5FK9B 1LSSA 4DQOH 2EBWA 3HYSA 2A0KA 1PZ3A 3ZIAD 3BWMA 1QI3A 3I45A 2A57A 3QNWA 1NGWA 2BZGA 4BP3A 2ORVA 4MWCA 1R6UA 2EQAA 1E3FA 3R5SA 2ZB4A 1ZD1A 1E96A 1YAHA 4HXAH 3QFJE 3IB4A 5M94B 1XQYA 1W4CA 4BZYA 1C1XA 4JBGA 5CINH 2CJXA 3CPHA 4OT1H 5J2TA 2WBKA 3N39C 3O11B 4XNXL 3LHPH 3M6FA 2KHZA 1NGWB 3OXSA 5KZCD 2F1JA 2DE0X 3KJZA 4HH4A 1NF3A 3V8VA 3KAAA 5L53A 2FZ4A 2NY0C 3FKSD 5CD3B 1YBMA 3RJQB 1LTQA 2UYYA 2BNRB 1BEYH 1DFGA 3U4EA 3BH8B 2F3RA 4F2FA 3KXKA 2QDVA 3ZXIA 2CH8A 2VNIA 4HIXL 3IO5A 1IXRC 3ZWNA 2JBWA 4FDVA 4MR9A 3QVUA 4E68A 3VSCA 4WV1A 1SJEB 1W0WB 3MA9H 3WUWA 3UJ8A 5DHPA 3VH1A 3W9EB 5FOTA 4FNOA 2YR0A 4CRWB 4YCJA 4JQIH 1P0SE 1I3NA 3QUYD 1XZCA 3CH1A 4OI8A 2AKYA 3PENA 1O5IA 2F08A 4ODSL 3ZMRA 4QBHA 4G7VL 1ML4A 1MFCH 4BDVA 2I2CA 1K8IB 1JYNA 1E1QD 4TTVA 4PZYA 2F62A 2H2PC 2FZ5A 4XYMA 4OVVA 2PXCA 5I18L 1SC4A 4HQQL 4TLDA 2JLVA 4X6DA 4V0OA 2I54A 3IPYA 4A2HA 3IJRA 1MQ8B 1UBOS 5KJRL 4NSNA 2JSFA 3QPAA 2YIVX 4O3UB 5FXMA 3T3PB 5L2KB 2FF7A 4F2EA 4MAYA 3B8HA 3RT9A 3PPXA 1U9CA 4CKEA 5F64A 3IQHX 2XNHA 2PGOA 3LVFO 1JZSA 3JYOA 2H0EA 5D1QD 5JOFB 2XE6A 4S1OA 4DSAA 4A1OA 3A1NA 2RGAA 2Q4RA 4P33A 3WFEH 1OHZA 4QTZA 3RYCA 4JV5B 4WHYG 3ARDA 1J0IA 1Z6PA 2XMQA 3K8KA 3B82A 4TQEH 2OK8A