2VE8A

Xray structure of ftsk gamma domain (p. aeruginosa)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
b'EDDPLYDEAVRFVTESRRASISAVQRKLKIGYNRAARMIEAMEMAGVVTPMNTNGSREVIAPAPVRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA TRANSLOCASE FTSK
publication title Molecular Mechanism of Sequence-Directed DNA Loading and Translocation by Ftsk.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 17
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09397 FtsK_gamma Ftsk gamma domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ve8A01
4KN7X 4KUMA 2MH9A 5D8KB 2H94A 1GHCA 4GO1A 2XUBA 4HDUA 5ICCA 1D8KA 1MDMA 1ON1A 2EK5A 2FNAA 3QPHA 4P9FA 2DK5A 1YW9A 2HEOA 4KNYA 3VFZA 1UCRA 1QO0D 4HQEA 3GW2A 1SFEA 5L3CA 2P5VA 1UHMA 2MD5A 3V7SA 1OKRA 3TOBA 2IA2A 4UV8A 3T5XA 2RKHA 3RYRA 3LA3A 1BI3A 3CDHA 2OQGA 3I64A 4CDGA 2VONA 4DQ2A 1R00A 1J75A 1XB4A 4RGSA 1RUOA 2FA5A 1T98A 5DEQA 4EJUA 3WE2A 1SD6A 3E5UA 1U6GA 1MGTA 3T8RA 4YIIA 4IRGA 3BPXA 3KP6A 2EB7A 3RI4A 4A5NA 1S7OA 2KIFA 5DD4A 1HW1A 2QLZA 1FYMA 1B9MA 3LAPA 2XHKA 1REPC 3IRRA 3S2WA 4EM0B 2W24A 4KFCA 3FMSA 1SFXA 4P96A 3IWZA 5FLXK 4OU0A 3WTZA 3P9KA 2HTSA 2Y75A 2K02A 2ADUA 2KKOA 1R5HA 4KA4A 3BJAA 1ZRCA 2HTJA 3F23A 1FBQA 4I2OA 2GQQA 5LHIA 2L02A 3FHZA 5DYMA 1A04A 4MHGA 1LQ1A 4XLPF 4HQMA 3F8FA 1L0OC 5FO5A 1O7LA 2EV5A 1LB2A 4G6QA 1FPQA 2NYXA 2OAZA 3HYIA 3GWZA 2GA2A 2JSCA 2STTA 4A2UA 4LJZF 3FMQA 1MD0A 2QM3A 1QZZA 1QNTA 5L3GA 1XCVA 2YSRA 4FT8A 4U7BA 4CXFA 2L4AA 1B1BA 1IN7A 4L5IA 2R7DA 1J59A 2QQBA 2ZMEA 1D3YA 3RKWA 5D6FA 5BS6A 2P5LC 1J9IA 2G7UA 4UVBA 3T1BA 2VBWA 1IN4A 1HKQA 1TNTA 2Z9OA 2O3FA 1W7PA 2GXGA 2ZMEB 2CWEA 3K69A 3I58A 1HW2A 1YW8A 3RDIA 2W57A 3I5UA 5K5OA 3RKXA 2HKOA 4H0EA 2ZXJA 3U2RA 2IT0A 1YS6A 4M9SA 3HSEA 3DFGA 1TQIA 3GX4X 4ENNA 1WKMA 2ACJA 2H6BA 2CQKA 2MLKA 1ULYA 2E1CA 1P4XA 4LD5A 1O3QA 5TRDA 4QWQA 3SQNA 5BOXA 2VXZA 2Z3YA 2R3SA 2XAHA 3OV8A 4HV5A 2CGPA 3BROA 4A5MA 2XAQA 1E2XA 1TW2A 1XGSA 3RTRA 4R8HA 4AIHA 5HOOA 3MWMA 4RB0A 5L3FA 5FLXZ 3T8TA 3E5XA 2GA1A 3HIFA 4XRFA 5HDNA 1U5TC 3BP8A 2FMYA 3SZTA 4HAMA 3SZPA 4YFKF 3R0AA 4CGZA 4UV9A 1TNSA 2ISYA 3KP2A 2OA4A 1ZRFA 4N9IA 1YTYA 1MZBA 1RNLA 1ZH5A 4WXCA 3KCCA 3KETA 2OQRA 2HKXA 1ON2A 3K1PA 2ZCWA 1BI0A 5ILVA 5IT9K 5AIQA 3AAFA 4L9TA 5CYVA 4M71A 2A3SA 3M1EA 4WF2A 2LF8A 3WTUC 2V1UA 1TLHB 4Q48A 1RI7A 4LK1F 2FF4A 2EV0A 1YQAA 2IJLA 3Q5FA 2GZWA 4O5VA 2FSWA 3COAC 1ONVA 3B73A 1BJAA 3JW4A 1VTNC 1WQ2A 4LB6B 3DV8A 1U8RA 1O7FA 3CO6C 5L3EA 4M73A 1ZG1A 5ERIA 3V7RA 4OIRF 2DI3A 2VBYA 1G3TA 5E18F 3H92A 3KZZA 3IKTA 1FOKA 2A5YB 3DXJF 4OMZA 4EVIA 1BC8C 3VOEA 1OR7A 3P9IA 4LG0A 1KU7A 3ZMUA 2TDXA 1ZG3A 2W84A 1XD7A 4I0AA 4ZYEA 1LNWA 3GFMA 3GEZA 1T38A 2P8TA 1IW7F 3B02A 2V9VA 1MKMA 1FBSA 3KP3A 5E8GA 2QUFA 3F72A 1BOAA 3ML6A 2A6HF 3R4KA 2PBIA 4N0BA 2Z33A 5JI6A 4HX8A 3RJPA 1OPCA 1BI2A 2HYGD 2M30A 3MCZA 5J8FA 4EGZA 4S05A 2ESNA 2DAOA 3WGIA 5A2QZ 4CO8A 5EEGA 5HDGA 3W6JB 3M9AA 1S8NA 3KP7A 1ZAOA 3ECHA 1WRJA 5DUIA 4OIPF 1Y0UA 5ICGA 2VOOA 3NQOA 4AIKA 1FC3A 2YX7A 2CFXA 5H20A 3WTTC 2F5DA 3KE2A 2O0YA 3ZMZA 2JPBA 5LRSA 1U5TA 1F1ZA 5LEJA 4F7ZA 5IT9Z 4L0ZB 1BI1A 3QP5A 2ELHA 3MZYA 3CUQA 4AWXB 4IF4A 1DUXC 4S04A 3BJ6A 3IC7A 2A6EF 2OZUA 3TO9A 4KMUX 4JQFA 2ETHA 3ISPA 2ZO4A 1K79A 4P5OA 2OD5A 2DPDA 1L3LA 3FM5A 3R0JA 2H27A 4G9YA 4LGWA 1EV7A 5D4RA 4NB5A 3NEUA 3I0TA 3RKYA 1Z1DA 3F21A 2M87A 4G94A 1I5ZA 4GYIA 2IA0A 2M5WA 2DTRA 3CJNA 4BH9A 2RN7A 2O8XA 3ZQ7A 1JE8A 1XDSA 5BPDA 1STZA 1F5TA 2AS5F 2E1NA 1S6LA 2R7FA 3ZMTA 1XSVA 3Q9SA 3HSFA 3ZMDA 2HQRA 3WTSC 3HTUA 4HOBA 2PLYA 3PFIA 4LLNA 5LHGA 2BGCA 2FBHA 4G6DA 4GGGA 5J6XA 1HQCA 4UHTA 4UXNA 4YIFA 2HYFA 3TQNA 3LFKA 2Q8KA 1FLIA 1T0FA 1ZG5A 4EJOA 3FXRA 3R60A 1HBXG 2OZ6A 4A0YA 1BBYA 3C18A 3BY6A 3DF8A 2EFQA 2LNBA 5E20A 1JHFA 4AD9A 4EJTA 4WWCA 3RPUA 3MAJA 4JK1X 3KEOA 5FGMA 5DDGA 1NHAA 4KDPA 2LF7A 1T39A 3J7AO 3HTSB 2DFIA 3GLXA 1R1VA 1K78B 4UVAA 2V1DA 2EFOA 1FYKA 3WTYC 5BMZA 3KLOA 3MFKA 1KA8A 4HF2A 4PZJA 4BHBA 5D5XB 3K2ZA 2VC0A 2M8EA 3P9CA 2HOEA 2VODA 1SAXA 4HZFA 2P7VB 4ZYDA 3GXOA 1WI9A 2X0LA 2QYOA 5ED4A 2XIGA 4KIGA 1LDKB 3GO5A 2H6CA 3F8NA 4RGXA 2W85A 2IVMA 5HLGA 5D5UB 4HLXA 1K6OA 2XV4S 2JT1A 4L5JA 3BJOA 3F8CA 2LSOA 3JAMK 2HWVA 4I7HA 4HW0A 4HLYA 5HLHA 2UXXA 1G3YA 2EFPA 1BM9A 3F8BA 4R79A 4CYDA 4Q5SF 3LSTA 1KU9A 4ESBA 1RZ4A 4IHTA 4HF0A 4IJAA 1JXSA 5KVRA 4YG2F 1FZPB 4MGRA 2VBXA 5HS7A 3RYPA 4OINF 2HQNA 2PFBA 1R22A 1XMKA 2XAGA 2EA4A 4ZYHA 2ZFWA 1FP1D 2XKOA 1Q1HA 2D45A 3GYHX 2FNPA 3RPQA 2QVOA 1ODDA 1XCBA 1P2FA 2NAZA 1U78A 1IRFA 4GXOA 4A0ZA 1P4WA 5CVJA 2HFHA 1IF1A 3QAHA 4KN4X 2P5KA 3LQQA 4I0BA 2ZJ2A 2D2WA 3O2PE 4ZZDA 3REOA 5AONA 4BXUA 4BYYA 3DKWA 1BC7C 1HW5A 4DNCA 3GUDA 3GZ6A 4EJWA 2V1XA 2FMLA 5JVTA 3WU1B 3KFWX 4PCQA 3ZPLA 4TV7A 1R1UA 3DPTA 2DPUA 1I27A 5E17F 5HDKA 5A2QK 1IUYA 1P6RA 3PQKA 3GVAA 2X4HA 3KLNA 2YX4A 3I4PA 1IN5A 4HBLA 1SD5A 1V3FA 4M74A 1Z91A 3WGHA 3V4GA 5D4SA 3ABTA 4KT5C 5HS9A 1FNNA 2CO5A 1XMAA 3L9FA 4P9UA 4MTDA 1B4AA 3TO7A 4M6YA 1TQPA 1QPMA 1Z7UA 1J0RA 5FFXA 3JAMZ 5FB2A 3CUQC 5F64A 1T6SA 2O6GE 1C0WA 1YFHA 2BV6A 1KQ8A 1JHHA 3EUHA 1KYWA 1IN8A 3V7CA 2FBIA 2IP2A 2YR2A 5FD6A 4M9ZA 1O3TA 4CZZA 2O03A 3ZN0A 2EFWA 4O6JA 1JGSA 3LWFA 4XBFA 1W7PD 5DUKA 1YW7A 2QQ9A 3TDUC 2A68F 3QP6A 1X3UA 1IRGA 2QWWA 1EH7A 2PG4A 4XSXF 1F4KA 3FWEA 4KMFA 3HRTA 2V6CA 2YPRA 3D0SA 5D5WB 4Y13A 2RDPA 3CTAA 2L54A 3G3ZA 2P6TA 1BN5A 3ROUA 5E8IA 1ZN2A 4L9JA 3DQVC 2G7HA 3H3UA 3KEQA 4EM2A 3C3WA 5LRRA 2STWA 1R23A 2CW0F 2B0LA 2UWMA 3F6OA 2XKPA 1XN7A 1Z6TA 2GWRA 3QU3A 2MC3A 3K9TA 1MJBA 2JPCA 3U1DA 4U7DA 4KIFA 4ZYGA 1XSXA 2PN6A 3TOAA 1WSUA 1S7AA 2PQ8A 3EQLF 3WTVC 3ELKA 2MH2A 3V8JA 1W5SA 3HRSA 5FD5A 4ENMA 3P7NA 4Y17A 2E7WA 1IXRC 4BQAA 2RNJA 1OYIA 1KQ9A 4WK8F 2M1BA 3K0LA 4D0PA 5BPIA 4L9NA 1UB9A 3CLOA 5H6RA 2KJCA 2A61A 4R1HA 1O57A 1LEBA 3TO6A 2PJPA 5BQTA 3J80Z 3HHHA 1W5TA 3WODF 4ETSA 4EMSA 3FZVA 1SD7A 2PEXA 2L01A 1W4MA 2XVCA 1DPUA 4M72A 3HOTA 1HSJA 2QBYB 1RUNA 3GFIA 3OOPA 5IT3A 3E6MA 3HUGA 2VOPA 4XSZF 3QOPA 1LDDA 2VBZA 4YFXF 4Y15A 3FXQA 3J81K 2K4BA 4O3MA 1G4DA 4L18B 3ZMSA 4ESFA 1USTA 3ZN1A 1B59A 1B9NA 3E97A 4CICA 1QQIA 2E7XA 2RQPA 3U9GA 2EWNA 4GYGA 2FQ3A 4FX4A 4B8XA 3BOQA 2Z5UA 4FHTA 4NHJA 3IRQA 3KZYA 4EV0A 2Y0MA 2KIMA 1HKSA 1F9NA 3M7GA 4U0YA 3L00A 1ZGAA 4G7OF 1GVJA 2EA2A 1Z05A 4EQQA 1V4RA 1ZGJA 3BWGA 2K4JA 2JTVA 2CYYA 4I01A 3L2CA 5DV5A 1U3EM 2UXNA 3ULQB 4AVPA 2NRAC 3WG9A 1K7AA 1I1SA 3I71A 1R5GA 2XROA 1UFMA 3TGNA 4LB5A 1MJ9A 2OBPA 3HSRA 5HVQC 4LLGF 1XSDA 1TW3A 1KU2A 3F3XA 4U0WA 4Q4ZF 2FRHA 2ISZA 1KGSA 3WGGA 3DPLC 2ZBKA 4BHPA 1BIBA 1LJ9A 2YU3A 3SXYA 2NS0A 1O3RA 2ZNZA 3ZP5A 4RAYA 4G7HF 3MQ0A 1OYWA 1HXDA 4FX0A 4LMYA 1MDMB 1HKTA 1YIOA 3VB2A 5DCMA 4ZH4F 1K78A 4P55A 1E17A 4MQ9F 1I1GA 4RS8A 5K5RA 3JTGA 1AWCA 1J5YA 4NQWA 2LKPA 2EFNA 2P4WA 4MQVA 5DCMB 3J81Z 1HSTA 3GFLA 4K2EA 2FXAA 4OIOF 3KP4A 1LVAA 3R61A 3EYYA 3EYIA 2V79A 1YS7A 3FM3A 1KU3A 3N97A 4A6DA 2FEZA 3HOSA 3L09A 4Q47A 1G3WA 1T2KA 4KICA 2L4MA 3GF2A 1J2XA 3I54A 2EJRA 3C7JA 2GXBA 4WCGA 3WTXC 3HRUA 3JSPA 4IPAA 2F5CA 3CO7C 2K86A 2M45A 3CUOA 2A69F 2J5OA 2WTEA 2DW4A 6PAXA 4WX9A 4PGGA 3M8FA 3LA2A 3IKVA 3HRMA 5L3DA 2BE5F 1SMYF 1PP7U 1ZLKA 2Q2EA 4RB2C 1B6AA 1ZARA 1IXSB 4I02A 2BBYA 2RVCA 1USSA 5L3BA 2CSOA 3O3KA 1FSHA 3V8LA 4B09A 5E1ZB 3F6VA 2VE8A 2XGXA 2G9WA 3C1DA 2MBFA 4ON0A 2DK8A 1R58A 2AXLA 3EDPA 2FOKA 3WU0A 3QRFF 2Y48A 4BNCA 3PQJA 3E5QA 1G3SA 1DP7P 2F2EA 3N4MA 3E6CC 4N9HA 2HS5A 2ESHA 4WXHA 4ENKA 3FXUA 1FBUA 1RIOH 3I59A 1YG2A 5TJJA 2A07F 4A0XA 1R36A 2J5PA 4BAYA 2MA3A 4HF1A 4L0YB 2FU4A 3E3VA 1OMIA 3I59B 4QLCU 1FY7A 1XDUA 4Z2YA 1IAWA 1H0MA 2BEOA 3IWFA 4RB1A 4LK0F 5CVIA 5K1YA 1XGOA 2UZKA 1H9GA 3KP5A 2P7CB 4G8XA 3MEXA 1EH6A 5DD8A 5KK1A 4KYWA 3SFZA 3ABUA 4HYEA 4M9XA 3E6BA 4MEYF 2RC4A 4UNOA 2XAFA 1QBJA 2JRTA 2DQLA 4JBAA 3ERED 1W7PB 1TBXA 2NNNA 2OU2A 3J80K 3I53A 1BIAA 1R1TA 1J7KA 1FWZA 2P6SA 3MZHA 1PP8F 2XASA 3F8MA 5D5VB 5E1WA 1GXPA 4G7ZF 3JTHA 2F5FA 4U88A 4EJVA 5ICEA 4A12A 4YFNF 3G73A 3HHGA 2FBKA 4XLNF 1G6NA 2MLGA 4HV6A 2K27A 1ZLJA 3IHUA 3ECOA 2KIUA 1FP2A 2RGVA 5LGUA 3LQRA 1SMTA 5EEHA 2IA1A 5F1RA 1O3SA 4BHCA 4HX4A 5CLSA 2PMHA 1SD4A 2COMA 4IXAA 4EGYA 1YLFA 2ZKZA 2DT5A 2IPQX 3DEUA 1SFUA 5CVRA 4PGHA 2GIVA 1PDNC 3VODA 1IZ1A 1DDNA 1PUEE 3O6BB 1ZREA 3NRVA 1XGNA 2HR3A 1FT9A 1UHWA 4HA8A 3K1NA 3L7WA 4I98B 2Q0OA 3D5LA 3SHFA 1DPRA 5AIPA 1OYYA 1GXQA 4ENJA 5CJ9A 1KQ0A 2EV6A 4LLLA 3WE3A 5HS8A 3DP7A 4WXDA 1FX7A 3FMRA 4RGUA 2VT2A 5LLQA 3V8KA 2D1HA 3K1MA 4OMYA 1QZYA 3ZMVA 4IHSA 1P4AA 1Z9CA 4CHUA 2L3DA 4MTEA 1YO5C 3RIRA 3GFJA 5LGTA 2RV8A 3WTWC 1S3JA 2DBBA 3JSOA 5FFZA 4UUVA 3EETA 2DU9A 5LEKA 4KIBA 2O61A 2DQRA 2W25A 4PDKA 1QGPA 1ZYRF 5H6QA 2CG4A 1S29A 5E1XA 3GZ5A 5ICFA 2Z99A 1D5VA 4U0VA 2VC1A 3TKYA 4ZZLA 2PI0A 2IRFG 2XAJA 3BZ6A 3H3ZA 2PMUA 2QBYA 2F5EA 1R7JA 1ZHFA 2QENA 4RB3C 2BYVE 2WV0A 2HDCA 1P92A 1KYZA 2GAUA 5JR3A 1U2WA 4LG0B 3BDDA 4IVNA 2DLLA 3TDZC 4I09A 4HX7A 3BPVA 4IRHA 1LEAA 2JZYA 4ASNA 3FX3A 1I6XA 1Z6RA 3M8EA 4HDVA 1CGPA 1IXCA 5LHHA 1EH8A 1FSEA 5DCFA 4EM1A 4MNUA 5LBQA 5K5QA 5JFRA 5F6FA 2KRFA 2K7LA 1FYLA 2H09A 3W6KB 5ILSA 1WWXA 1MJAA 3Q9VA 4OOIA 3E6DA 2VE9A 4M6XA 2QQAA 5CVVA 2IW5A 1YYVA 1IN6A 2C6YA 2QZ8A 2FE3A 2HGCA 4GCVA 3LAJA 1AOYA 1TQMA 4AIJA 3QPTA 3T0YA 3R6SA 4RGRA 3QU6A 1CF7A 2DO7A 4UVCA 5JHUA 1ZRDA 5J8CA 3VEPA 3IL2A 2WC2A 4L9VA 4A6EA 4LFUA 4E70A 2XRNA 1TTYA 3LA7A 2LDUA 2D1VA 4MEXF 4ESJA 5ILUA 5LGNA 1CF7B 1XGMA 1U5TB 4OIQF 2VN2A 2ZNYA 1H9TA 5HLIA 5D6EA 4IRIA 4RAZA 3FF5A 1LDJA 3CUQB 2KJBA 2VT3A 5CVUA 2WWYA 2HZTA 3F22A 5D8LB 1D8JA 2NNYA
chains in the Genus database with same CATH superfamily
2Y30A 4KN7X 1MNEA 1WHUA 1IC8A 3CD6I 2R5ZB 4XLEA 1RKTA 4KUMA 2MH9A 2CRGA 3NWTA 1RRJA 4A3GJ 2IS2A 2CS3A 2L5QA 1YE9A 3H5AA 1R6RA 4IQJA 5D8KB 2DDAA 2EBIA 2KZVA 2WB1N 1I6HJ 2RAEA 1JTXA 4V2GA 1H88C 2H94A 1WPKA 1GHCA 4DZJA 4GO1A 4ZDOA 3JR9A 2XUBA 1BL0A 3PO2J 4HDUA 3OR2C 5ICCA 3W2AA 1D8KA 1MDMA 2BVLA 1ON1A 1ETWA 2EK5A 2FNAA 3QPHA 4FE7A 3PSIA 4P9FA 2B63J 2DK5A 1YW9A 2W00A 3VYRB 2HEOA 4CUGA 3QYEA 3VFZA 4KNYA 1UCRA 2DYSH 4W97A 1QO0D 4HQEA 3GW2A 3TEDA 1DU0A 3A01A 1SFEA 2EZIA 5L3CA 2KFDA 2P5VA 1UHMA 2V1NA 1UAAA 2K9NA 4OWRB 2MD5A 3V7SA 1OKRA 3TOBA 2IA2A 4UV8A 1POGA 3MZ8A 3T5XA 2RKHA 3PSFA 1OCPA 3RYRA 3LA3A 1NG7A 3A0HC 3LNQA 1BI3A 4CSWA 4G12A 2L2OA 3CDHA 4XNFA 2OQGA 3I64A 5FKNA 2V4JC 4BACA 4CDGA 2VONA 3SYTA 3MN2A 1KZHA 2R93J 4DQ2A 1R00A 1J75A 3JREA 1XB4A 5B3SH 4RGSA 1X1AA 1RUOA 2FA5A 1OFCX 1T98A 4XOPA 5DEQA 4E6KG 2L9RA 4EJUA 3WE2A 3OR1C 1SD6A 3BG7A 3LSIA 4RMNA 3E5UA 5DTDA 1U6GA 1MGTA 2EZLA 3HOZJ 3T8RA 1RKWA 4YIIA 4IRGA 4HNVA 2JA6J 2VI6A 3BPXA 3KP6A 3GTGJ 2EB7A 3RI4A 1I3AA 4A5NA 4CCLA 1S7OA 2KIFA 5DD4A 3ZQQA 5JLWA 4A3KJ 2IXSA 1FIPA 1HW1A 3UNGC 2MW8A 2QLZA 3W3CA 1FYMA 1B9MA 1Z0XA 3LAPA 2VB6A 2XHKA 2LY9A 5K7HA 2XF7A 1REPC 2X6WA 2ZSHB 3IAS2 4UUTA 3W2VA 1JKOC 2VJIA 2M0MA 3S2WA 3IRRA 4EM0B 2W24A 4KFCA 3LL7A 2DT6A 1BR4A 2KT0A 3FMSA 1SFXA 4P96A 3IWZA 1UELB 3OYHA 5FLXK 2JA5J 4OU0A 3VSKA 1M1EB 3WTZA 3ZXSA 3P9KA 1SFKA 2HTSA 2XC7A 1YITI 1T8IA 2Y75A 3ASOH 2LK2A 2L7KA 3J7YJ 2NVQJ 2K02A 4QSHA 2ADUA 2OCCH 1ZTRA 2KKOA 1R5HA 1W36D 1K4SA 4KA4A 3BJAA 1HDPA 4QPOA 1ZRCA 2HTJA 3F23A 1FBQA 1TWHJ 3ABMH 4I2OA 2GQQA 4RM2A 5LHIA 3AG1H 4BKXA 1E0EA 2L02A 1D1AA 5KHDA 1DGRM 2CV0A 2AQFA 3FHZA 4BJ5C 3S15J 5DYMA 1A04A 4MHGA 1LQ1A 4XLPF 4HQMA 3F8FA 1L0OC 3BTCA 5FO5A 2OPTA 4IO9F 1O7LA 2EV5A 2XGEA 3E0JB 2A05A 1LB2A 4G6QA 1FPQA 2NYXA 2OAZA 4AU7A 4I76A 2KZGA 3S1MJ 3HYIA 3GWZA 2HVSA 2GA2A 3HGYA 2JSCA 2STTA 3H1CA 4A2UA 2I5UA 3QOEA 4LJZF 3FMQA 2CFOA 1VFCA 1MD0A 1TWCJ 2QM3A 2QKMB 1V5EA 1QZZA 2GLOA 1E3PA 2DN0A 1QNTA 3ZQFA 2OF7A 2K5CA 5L3GA 5GAGJ 1ZR4A 1XCVA 2YSRA 4E7SA 1N75A 4FT8A 4U7BA 4CXFA 3S1RJ 2L4AA 1B1BA 1HDDC 1IN7A 3JCUC 4L5IA 2R7DA 3A0BC 1J59A 2QQBA 2ZMEA 4M3GA 3OYAA 5HLTA 1D3YA 3G6EI 3RKWA 3BC8A 3S1NJ 2DOAA 4RLQA 5D6FA 5BS6A 2P5LC 1J9IA 3TMOA 2G7UA 5K7ZA 4U87A 3AG3H 4UVBA 2O7OA 2LY1A 3VSLA 3T1BA 5CQGA 2V6EA 2VBWA 1IN4A 1HKQA 3K7AJ 1TNTA 2Z9OA 2O3FA 2BY3A 1W7PA 3F9KA 3KZIC 3H9GA 4IHYA 4XMYA 3JRGA 4E7ZA 2GXGA 2ZMEB 2CWEA 2VQCA 3K69A 4M3EA 3SZGA 4E4HA 3I58A 1XX5A 1HW2A 2DMUA 2QF7A 1YW8A 2CUEA 3RDIA 2W57A 2HDWA 3I5UA 3RKXA 2HKOA 5K5OA 4H0EA 2ZXJA 3U2RA 1LE8B 2IT0A 1YS6A 4F92B 2V26A 4M9SA 4IHWA 1OCTC 3HSEA 1NG6A 3DFGA 3KYCB 1ETQA 1TQIA 3HC7A 2BXZA 5IPAA 3GX4X 4IOAF 3BG3A 4ENNA 4L5EA 1WKMA 2ACJA 4MFDA 1FMVA 1X4OA 2H6BA 2CQKA 2MLKA 2VJ4A 1MMDA 2L7FP 1ULYA 2E1CA 1P4XA 2E34A 2P0WA 3PM1A 4LD5A 1O3QA 2ECCA 5TRDA 2KDZA 4QWQA 3SQNA 5HNFA 2WV1A 5BOXA 2VXZA 2Z3YA 3OYKA 1FTTA 2R3SA 2XAHA 3A1YA 3OV8A 2V7FA 4HV5A 2CGPA 3BROA 4A5MA 2XAQA 1E2XA 1U8BA 2MSYA 2LLKA 2EPFA 1TZLA 5HNHA 1TW2A 2R7SA 1XGSA 3RTRA 4R8HA 4BQQA 3O8GA 4AIHA 3CC2I 5HOOA 3MWMA 3RZDJ 1Z67A 4RB0A 3CMYA 5L3FA 2BXYA 5FLXZ 4I6ZA 1IRZA 3T8TA 3TW7A 3E5XA 2GA1A 1MMNA 5EZGA 3HIFA 2DOEA 4XRFA 5HDNA 1QRYA 1U5TC 3BP8A 2FMYA 3G2BA 2CV2A 3SZTA 3S14J 3GTJJ 3K4JA 4HAMA 3BZKA 5J4YA 1SANA 1NH3A 3SZPA 3KPHA 3CCVI 4YFKF 3R0AA 4FASD 4CGZA 4UV9A 1TNSA 2ISYA 2QGUA 3KP2A 2OA4A 4BXFA 1ZRFA 2K3PA 2Y0SA 5K7FA 4N9IA 1YTYA 4XLAA 3CMEI 3H9QA 1MZBA 1RNLA 2LD5A 4WXCA 3DEWA 1ZH5A 2Q1ZB 2X1DA 1WJCA 3KCCA 4QIWN 2AQEA 4C30A 3KETA 3M07A 1TT0A 2OQRA 1O4XA 2HKXA 1ON2A 3K1PA 2ZCWA 1RESA 2QSFX 3OY9A 1VQ7I 2ELJA 1BI0A 5ILVA 2IGKA 5IT9K 2NOJB 5AIQA 2ZJQF 2DA4A 2X48A 1W0TA 4EATA 5FLVA 3AAFA 4L9TA 1FMWA 1T56A 5CYVA 4M71A 2A3SA 3M1EA 4WF2A 2LF8A 2H1LA 3WTUC 2V1UA 1TLHB 3NAUA 4Q48A 1RI7A 4LK1F 3S3OA 2FF4A 2EV0A 1YQAA 1V5FA 2IJLA 2F48A 3Q5FA 2GZWA 3FISA 1MBHA 4O5VA 3WU2C 1JUMA 2FSWA 3COAC 3QWLA 1PUFA 1JKRC 1ONVA 3DPUA 3GTOJ 3B73A 2WB1A 3H9JA 4CCJA 1BJAA 3JW4A 1VTNC 1WQ2A 3K4BA 4LB6B 3DV8A 4A3EJ 1U8RA 2CUJA 1O7FA 4A3FJ 3CO6C 2VJJA 1HOMA 5L3EA 4M73A 1ZG1A 4AYBN 5ERIA 3HZJA 2LTPA 3V7RA 2K85A 1PUFB 4OIRF 2DI3A 2VBYA 1B8IB 1G3TA 3A03A 3LOCA 5E18F 2R7XA 4DYRA 3H92A 3KZZA 3IKTA 1FOKA 1WJBA 4FCYA 2A5YB 3DXJF 4OMZA 3DU5A 4EVIA 1BC8C 2X51A 4RDUA 4EEFG 3VOEA 1OR7A 3P9IA 4LG0A 1KU7A 3RZOJ 1JKPC 3ZMUA 5IP9J 3RKQA 2TDXA 3CCLI 1AHDP 1X3ZB 5KAIC 2JA2A 4W1UA 1ZG3A 4Y52J 2W84A 3IAM2 3C2BA 2KISA 4XRSG 1XD7A 4I0AA 4ZYEA 1LNWA 1X2NA 5CKTA 3GFMA 5GAEJ 1T38A 2P8TA 1IW7F 3B02A 2V9VA 1MKMA 1BR2A 1FBSA 3KP3A 4PJJA 5E8GA 4C9YA 1ETYA 2QUFA 3F72A 1BOAA 3ML6A 1XMXA 3HJEA 1WH7A 4BXXJ 1W1WE 4HSRA 1WI3A 2A6HF 3M1CA 3JRHA 1EJ9A 2CUZA 1MBFA 3R4KA 4B1RA 2PBIA 3ERMA 3EUAA 1HA8A 4N0BA 1SVMA 2Z33A 1RR8C 1TWGJ 3MMYB 5JI6A 4DIQA 4HX8A 3RJPA 1QA6A 1OPCA 1BI2A 2HYGD 4X1EA 2M30A 3MCZA 5J8FA 4EGZA 2JK3A 4LIVA 4S05A 1WJ5A 2LR8A 1YHQI 2ESNA 2DAOA 2XF5A 2Z16A 3WGIA 5A2QZ 2VPRA 2PJRB 2DMTA 4CO8A 4DYQA 1MNMC 1GLNA 5EEGA 3K4CA 2UUZA 2K9MA 5HDGA 1JJ6C 2E5NA 3VPRA 3KX2A 3W6JB 1XPXA 1XTAA 3S93A 3S17J 1F36A 3M9AA 1S8NA 3KP7A 1ZAOA 4KJZA 1R4MB 3ECHA 4LOCA 1WRJA 1TP4A 5DUIA 2K9SA 2WY7Q 3OIQA 1WZ2A 4OIPF 1U9OA 1Y0UA 5ICGA 2VOOA 2ELKA 3NQOA 4AIKA 1H89C 5J40A 4XK4A 1TT5B 3TW6A 1FC3A 2YX7A 2CFXA 4UUSB 2M7AA 4LIUA 4Y4RA 3K4MA 2W7NA 4UB8C 3H0DA 2LY2A 5H20A 5IP6A 2DOFA 3WTTC 1VQ8I 2F5DA 1BJZA 3KE2A 2O0YA 2K9LA 3HUGB 3ZMZA 2JPBA 4BS9A 5IYDJ 5LRSA 1OQYA 1U5TA 1F1ZA 2OV7A 3HL2A 5LEJA 1W0UA 3S32A 4F7ZA 5IT9Z 2BW3B 4LG3A 1GV2A 4L0ZB 3M8JA 1HC8A 1BI1A 2O5RA 3QP5A 2ELHA 4PFPA 3O8HA 4XM3A 1X4PA 2AXTC 3MZYA 3CUQA 4AWXB 4IF4A 3LSHA 1DUXC 4S04A 1D0YA 3BJ6A 2BZTA 3IC7A 3P5JA 9ANTA 2A6EF 2OZUA 1WJDA 2NVUB 2XF6A 3PUBA 3S1QJ 3TO9A 4KMUX 4JQFA 2ETHA 3ZRGA 1KONA 2GBYA 3ISPA 3W2WA 2ZO4A 1K79A 4P5OA 2OD5A 2L7ZA 3BT9A 3QPLA 1TWFJ 1WFXA 4N4OB 2R5ZA 1L3LA 1MSFC 2DPDA 2DMQA 4NUBA 2OCEA 1X3WB 3FM5A 2JJ7A 4M6VA 2CQNA 4KT6A 4XKCA 2IEKA 2DFFA 3UR3C 1ITYA 3R0JA 2HPIA 2H27A 2LP0A 4G9YA 4LGWA 5E3LA 5IYBJ 4S0HB 4CH7A 2GM4A 1EV7A 4DJAA 5D4RA 4NB5A 3NEUA 3I0TA 4AIDA 3RKYA 1Z1DA 4B43A 1U0JA 3F21A 2M87A 4G94A 1ZKGA 1I5ZA 5FJ8J 4CZCA 4GYIA 2IA0A 4D7NA 2M5WA 3D5SC 2DTRA 3QYBA 3CCYA 3CJNA 4BH9A 2HYJA 1IO2A 1T95A 2EIKH 2RN7A 2O8XA 3LSMA 3ZQ7A 4XLHA 1JE8A 2QKLB 3PNTA 2ZMEC 4B3AA 1XDSA 4F55A 2HU9A 5BPDA 4E7JA 1STZA 5GP9A 1F5TA 2BHYA 3IP4B 2AS5F 2HVQA 2E1NA 2VJ5A 1Z3YA 3SEZA 1B72B 1S6LA 2R7FA 3ZMTA 5M5XJ 1XSVA 1A6IA 3Q9SA 1FOYA 4DBRA 4YELA 1ETOA 1K6YA 4BQOA 3HSFA 3ZMDA 4UB6C 4AM3A 2HQRA 5C4JJ 3WTSC 3LSRA 2HPMA 3HTUA 4DBQA 3NWSA 4HOBA 4Y33A 1QVTA 2M34A 1K83J 4PJLA 3ZR8X 2PLYA 3PFIA 1R71A 4LLNA 5FLMJ 2JVHA 5LHGA 2XAUA 5E3NA 1QPIA 2BGCA 3L2WA 2FBHA 4G6DA 3QPSA 4GGGA 5J6XA 1HQCA 4UHTA 4UXNA 4YIFA 2HYFA 4CA0A 1VQ9I 3TQNA 3LFKA 2F4OB 2W82A 2Q8KA 3HKZN 2VASA 3L2UA 1FLIA 4BGDA 1T0FA 1ZG5A 4EJOA 4V2FA 2JMWA 3DCFA 4FE4A 3FXRA 2K40A 2ICWG 3R60A 2OZ6A 5EF6A 1HBXG 4CYCB 4A0YA 2NOGA 2IBDA 1BBYA 4DGWB 2QA4I 3C18A 3FXOA 2WADA 3BY6A 3OSFA 3DF8A 2E19A 2EFQA 2LNBA 5F27A 3DLLF 5E20A 1JHFA 4AD9A 2X6OA 4ANJA 4EJTA 4WWCA 3RPUA 3ZQIA 4BE0A 3BR2A 3MAJA 4JK1X 3KEOA 5FGMA 5DDGA 4IKFA 1VNDA 1NHAA 4BU2A 2HZDA 4MO7A 4KDPA 3CCJI 2K9QA 2LF7A 2VKVA 4IL6C 1SAUA 1T39A 1E3HA 3J7AO 3HTSB 2DFIA 3HBLA 3GLXA 2DMNA 4KITB 1R1VA 2FOWA 4X0GA 1K78B 4CCMA 3QODA 4UVAA 3D5RC 2V1DA 3G1LA 2EFOA 1FYKA 3HOVJ 1AU7A 3WTYC 5BMZA 2KLOA 3KLOA 5IYCJ 4NQWB 4D1QA 1MMSA 3BR3A 3MFKA 1KA8A 4HF2A 1VQNI 2R92J 2X9DA 1UG0A 4PZJA 4BHBA 5D5XB 3I4NJ 3K2ZA 2VC0A 4F91B 2M8EA 3P9CA 1FOXA 2HOEA 2VODA 1SAXA 3PFYA 4HZFA 2P7VB 1IV6A 1TC3C 1SVLA 4ZYDA 3GXOA 3JRFA 1WI9A 2X0LA 2QYOA 2ME6A 5ED4A 5M5WJ 2L0KA 2XIGA 3OIOA 4KIGA 1LDKB 3GO5A 1UMQA 3U21A 4HNTA 2R5YA 2H6CA 3F8NA 3L2RA 2JN6A 4RGXA 2W85A 4IHXA 2GOXB 2IVMA 5HLGA 5D5UB 2OTJI 2KDOA 3S2DJ 4HLXA 1K6OA 1Y0NA 1JTYA 3FKIJ 5HODA 3HB9A 3BG5A 2XV4S 2JT1A 4L5JA 1A35A 2DJIA 3BJOA 5IY5H 3F8CA 4D5CA 2F5VA 2LSOA 1Z7LA 1VZ0A 3JAMK 2HWVA 2VQLA 4I7HA 3KIOA 4PUSA 2R4GA 2R5YB 3GLLA 1FEXA 4HW0A 5F0HA 4BQNA 3DU6A 4HLYA 3OL3A 5HLHA 2UXXA 1G3YA 2EFPA 1BM9A 3F8BA 4R79A 4CYDA 3MKWB 4Q5SF 1JT0A 3LSTA 4F52A 1KU9A 3OYCA 2LKXA 4ESBA 5CQEA 1RZ4A 3BR5A 4C2UA 4XRMA 4IHTA 2VUMJ 1R4NB 3K10A 2O9LA 3KEYA 5J1YA 2Q2EB 4HF0A 4RAGA 2DMPA 4IJAA 1JXSA 4AYBA 4FETA 2XSJC 4ZYAA 2DJNA 5KVRA 1YRNB 4YG2F 1FZPB 4MGRA 2VBXA 5HS7A 1FIAA 4CCNA 5FRNA 3RYPA 5B5EC 4OINF 1ZR2A 1D0XA 4XN3A 3RPUD 3BLYA 3CJRB 3OYIA 3H0GJ 2BY0A 2HQNA 2PFBA 3I3LA 1R22A 1XMKA 2XAGA 3JRBA 2EA4A 3CC4I 2CW8A 1S7EA 4ZYHA 4C2TA 3BCBA 4KISA 2ZFWA 4BBSJ 1FP1D 2MG4A 1Y56A 4AUXA 1OR7C 1JKQC 2XKOA 1Q1HA 2D45A 3GYHX 2FNPA 3HGGA 3RPQA 2QVOA 1LE8A 1ODDA 1FOWA 1XCBA 2X6XA 1P2FA 2NAZA 1IJWC 1U78A 2R7RA 4RAFA 3QYFA 1HF0A 1MBGA 4N4NB 1IRFA 1VQLI 2ZXIA 4GXOA 4IQ4A 3MKYB 4A0ZA 3AL0C 1P4WA 3TBIA 2KRHA 1MH3A 1NK2P 5CVJA 2HFHA 5E3OA 2HI3A 1SC7A 4A3DJ 1IF1A 3QAHA 2ID6A 3ZQHA 4KN4X 2P5KA 2E2IJ 3LQQA 4I0BA 2ZJ2A 2D2WA 3O2PE 1DU6A 2VLAA 4ZZDA 2R7QA 4M3DA 4PSXA 3REOA 3TP0A 5AONA 1YJ9I 1TL8A 2FX0A 4BXUA 5KAFC 4B4CA 5B66C 2JWTA 4NC6A 2WY8Q 3MKZA 3A2KA 4BYYA 5JVGF 3DKWA 3DEEA 3H35A 4PK4A 1FTZA 1BC7C 1HW5A 3AKZA 3G1OA 5J1RA 1ETVA 2QCOA 4DNCA 1BW6A 3GUDA 3GZ6A 3OS1A 3WG7H 1BW5A 2M2EA 4EJWA 3TL4X 5EGOB 2LBFB 2V1XA 1R9TJ 2FMLA 2KPMA 5JVTA 3WU1B 3KFWX 4PCQA 4ABZA 3ZPLA 4TV7A 1ETXA 5IOZA 2VKHA 1R1UA 3DPTA 3OYGA 2DPUA 1I27A 3FHNA 5E17F 5HDKA 2XGCA 5A2QK 1IUYA 1P6RA 3PQKA 2KL4A 3GVAA 2X4HA 3KLNA 1ZGWA 2CQQA 2YX4A 3I4PA 4XQFA 1IN5A 4HBLA 1SD5A 2KMUA 5EG0B 1G2HA 1V3FA 3DBHB 2N8GA 1GV5A 4M74A 1Z91A 3WGHA 3V4GA 4A3BJ 2E71A 5D4SA 4MIMA 3ABTA 4QTRA 3CP2A 3K6GA 1HLVA 2L9SA 4KT5C 5HS9A 1FNNA 2CO5A 1XMAA 3L9FA 4P9UA 5F08A 1B4AA 4MTDA 3TO7A 4M6YA 2EZHA 1Y39A 1TQPA 2DA5A 3NARA 1QPMA 4BDZA 1Z7UA 2NVYJ 4A3LJ 2VQGA 1J0RA 1ORKA 5FFXA 3JAMZ 5FB2A 3CUQC 5F64A 1T6SA 4XICA 1G8XA 2O6GE 4YRVA 1C0WA 3VYSB 1YFHA 2BV6A 1KQ8A 1JHHA 2QSHX 3EUHA 1KYWA 1IN8A 3V7CA 2FBIA 2Y9YA 2IP2A 2NVTJ 2LG4A 2YR2A 5FD6A 2Z1DA 4M9ZA 3L2QA 1O3TA 4CZZA 3CJQB 2IS1A 4PJ0C 2O03A 3ZN0A 4OAYA 2EFWA 1MMAA 4O6JA 1LPQA 2NS7A 3K2AA 1JGSA 3LWFA 4XBFA 3RCOA 3A4CA 3HDDA 1W7PD 5DUKA 4PSWA 2LC2A 1YW7A 2HNHA 2QQ9A 3MKLA 3TDUC 2GXAA 2A68F 5KCMA 3QP6A 2W4SA 1X3UA 2KHMA 2JVGA 2M3AA 1SFOJ 2NS8A 1IRGA 2QWWA 1XG1A 4M3FA 1EH7A 5E79C 2PG4A 1MBJA 4XSXF 1F4KA 3FWEA 4KMFA 2HOTA 3HRTA 1YI2I 2V6CA 4FISA 2EZKA 3H5NA 1B8IA 2YPRA 3ZQCA 3D0SA 5D5WB 4Y13A 2E2JJ 4IZZA 2V9PA 4OAZA 2RDPA 3CTAA 2L54A 3G3ZA 2P6TA 4YIRX 1BN5A 3ROUA 5E8IA 1ZN2A 2PMZN 4L9JA 3ZGKA 3OYEA 2BY2A 3DQVC 1PYVA 2G7HA 3I9V2 3H3UA 3KEQA 4EM2A 4HNUA 5FKOA 3C3WA 5LRRA 5J47A 1Y1WJ 1VQMI 3OYFA 2STWA 1R23A 2CW0F 1JJ8C 3ZQLA 2B0LA 2UWMA 3F6OA 2XKPA 1XN7A 4ZDPA 3WHBA 1Z6TA 2GWRA 3QU3A 4MLOA 2MC3A 3K9TA 2B9SA 5GTIC 1MJBA 2JPCA 3U1DA 4U7DA 3GTMJ 4KIFA 4ZYGA 1XSXA 2PN6A 3TOAA 1WSUA 1S7AA 2PQ8A 4LITA 3EQLF 3M4OJ 1IRXA 1T33A 3HKZA 3WTVC 5BNGA 3ELKA 4B47A 5M3MJ 3SEQA 2MH2A 3V8JA 1W5SA 1I39A 4PJNA 3OIPA 1T0FC 1MH4A 1RETA 3BR6A 3HRSA 3K4NA 5FD5A 1YOVB 4ENMA 2WA0A 3E1SA 3P7NA 2VKEA 4QPQA 4Y17A 2LOOA 2E7WA 2PJRA 1IXRC 4BQAA 3CP8A 3EUKL 2RNJA 1OYIA 1KQ9A 4WK8F 2HXIA 2M1BA 3K0LA 5DS9A 2XPWA 4D0PA 3PL8A 5BPIA 4JP0A 2MABA 1P7IA 1UB9A 3CLOA 4L9NA 5H6RA 4B44A 2KJCA 2A61A 4R1HA 1O57A 1VQPI 1LEBA 3TO6A 2PJPA 2ID3A 5BQTA 2FUG2 5F0FA 3J80Z 2LFBA 3HHHA 3OYNA 5FKMA 1W5TA 3FIWA 3C2HA 3K4LA 3WODF 1N25A 4EMSA 3FZVA 1SD7A 3BG6A 4ETSA 5GPCA 2PEXA 4E7KA 2L01A 1W4MA 2XVCA 3RQIA 4JX4A 1DPUA 2E1OA 3GBGA 4M72A 3HOTA 1HSJA 3G1MA 4UUSA 2QBYB 1YJWI 1I3QJ 1RUNA 3GFIA 1FJLA 3OOPA 4CCOA 5IT3A 4HEA2 3LSGA 2CV1A 1VQ5I 1ZK8A 5C44J 3DWLE 3E6MA 1UHSA 3HUGA 2VOPA 4XSZF 3QOPA 4DOZA 3S16J 1LDDA 2VBZA 4YFXF 2VIXA 4Y15A 2BW3A 4BBRJ 4XL9A 3FXQA 3J81K 1LUJB 3BR0A 2K4BA 1X1DA 4I99C 3VYTB 4O3MA 3SFIA 1G59A 1G4DA 3DBLB 1S72I 3Q0WA 3CCEI 4L18B 4IHVA 3ZMSA 1T08B 4ESFA 3FXJA 1USTA 3ZN1A 3CF2A 1B59A 1B9NA 1VI0A 3E97A 3BQYA 4GFBA 3CJTB 4CICA 3UKGA 2TCTA 1QQIA 3ABKH 2E7XA 2RQPA 4DYCA 3U9GA 2EWNA 2Y31A 2JUGA 2XRLA 4GYGA 2FQ3A 4FTHA 4FX4A 4B8XA 3BOQA 2Z5UA 3IH3A 3V42A 5DM7F 2CW7A 1I50J 2E1MB 1YX3A 2MYSA 4FHTA 4NHJA 3IRQA 3KZYA 2Y9ZA 4EV0A 3BZCA 2Y0MA 4A3IJ 3GCMA 4F3QA 1IDYA 2KIMA 1HKSA 1JGGA 3FDYA 5J1UA 1F9NA 3M7GA 5GAHJ 1P9QC 4U0YA 2I10A 2JUCA 3L00A 1QVUA 3DLAA 5B1BH 1ZGAA 4G7OF 1GVJA 2EA2A 3FKJA 1BR1A 1Z05A 3QQAA 4B48A 4AVZA 4EQQA 3S3MA 3S2HJ 3BG9A 1V4RA 1GDTA 3K70D 1ZGJA 5F04A 3BWGA 2K4JA 2JTVA 1JUSA 2CYYA 3E7LA 2NNYA 4I01A 3L2CA 5DV5A 1LFBA 2EINH 4Y7NJ 1U3EM 2UXNA 1B72A 1V54H 3ULQB 1NTCA 4AVPA 2NRAC 1MBKA 4DW6A 2M7BA 3WG9A 2E35A 2MGQA 1K7AA 3HOYJ 1I1SA 1VQKI 3I71A 2EIMH 1X1PA 1R5GA 3PIPF 1UFMA 3TGNA 2XROA 2IS6A 1N77A 4LB5A 3VDXA 1MJ9A 2DA1A 2OBPA 4ZTFA 2CU7A 3KYDB 4NC7A 1P7JA 2RNGA 3HSRA 4ZTJA 5HVQC 4A93J 3Q0UA 2F4MB 4LLGF 1Q1VA 1XSDA 1S9HA 1TW3A 2AO9A 5TGTA 3OS0A 1KU2A 1R5ID 3F3XA 1Y6IA 3CESA 4U0WA 3OYLA 2DODA 3PJRA 2CMPA 2JQ7A 4Q4ZF 1W5CC 4CYCA 2FRHA 2ISZA 2GIZA 3GTPJ 1KGSA 3WGGA 4D7MA 3DPLC 1J09A 2ZBKA 4BHPA 1BIBA 1LJ9A 2YU3A 2DA3A 2L7MP 1JI8A 1X2MA 1GVDA 1LFUP 3SXYA 2NS0A 2DT7B 1O3RA 2DXIA 3EPZA 1IDZA 1EA3A 2ZNZA 2M9HA 3ZP5A 1DGWY 2OTLI 2R7ZJ 4RAYA 4G7HF 3PNVA 2R7WA 3MQ0A 2HOSA 3SDGA 1OYWA 1HXDA 2IGNA 4FX0A 4LMYA 2V9KA 1MDMB 3CMAI 1HKTA 1YIOA 3VB2A 5DCMA 1GT0C 4ZH4F 3AFHA 2P81A 1K78A 4P55A 1E17A 1MMGA 3PO3J 2ECBA 4MQ9F 1I1GA 4RS8A 5K5RA 3JTGA 1AWCA 1J5YA 3JRAA 4NQWA 4ZC3A 4BL0B 1YJNI 2LKPA 2X1EA 5EJCA 2EFNA 3A01B 2VL8A 2P4WA 2EIJH 2LREA 4MQVA 1LVKA 5DCMB 3J81Z 2XPVA 4RM3A 1HSTA 3GFLA 2ZFUA 3FXKA 4K2EA 2JA8J 2FXAA 4OIOF 3KP4A 1LVAA 3R61A 3EYYA 1V5GA 3EYIA 2V79A 1OJLA 1YS7A 3FM3A 1KU3A 2W48A 4A6DA 3N97A 4GRIA 2FEZA 2M4GA 3DTIA 3HOSA 3L09A 5JLXA 1R49A 2R7UA 1X1BA 3DKXA 2EH3A 2L9NA 4P1WA 4Q47A 2IGMA 1G3WA 2H8RA 1T2KA 4KICA 2L4MA 3CQZJ 3CMMA 3GF2A 1J2XA 4IEJA 3ZOBA 1E3OC 1XC5A 4J19A 4B3XA 3I54A 3VYUB 1V55H 2EJRA 3H5RA 2EQRA 3C7JA 3CF5F 4G6TB 1BA5A 2GXBA 3EUHC 5H2FC 4BUPA 3FK7A 4WCGA 3WTXC 3B6AA 3HRUA 3JSPA 2NXNB 4IPAA 2F5CA 2VXDA 3CO7C 2K86A 2M45A 4NC8A 2R7TA 3CUOA 2A69F 2J5OA 2WTEA 2DW4A 5JHFA 2WBMA 6PAXA 3J7AY 1JT6A 4WX9A 4PGGA 3M8FA 1A31A 3LA2A 3IKVA 3HRMA 4DZPA 5L3DA 2BE5F 5DM6F 4MFEA 1SMYF 1U9NA 1PVEA 2WAFA 2RREA 4C3JJ 1PP7U 2Q2EA 1AKHA 3JRIA 2ZJRF 1ZLKA 4RB2C 1B6AA 1ZARA 1YRNA 1IXSB 1UG2A 4I02A 5B1AH 4Z6YA 1Z3XA 1HCRA 3CCMI 2BBYA 2RVCA 1EKEA 1USSA 5L3BA 2CSOA 3OYMA 3O3KA 1FSHA 2CJJA 3V8LA 4B09A 4PJMA 5E1ZB 3F6VA 2PMZA 2VE8A 2COBA 2XGXA 2G9WA 3HPHA 3C1DA 4YEJA 2MBFA 1ENHA 4ON0A 2Y2ZA 2LYCA 1AKHB 2DK8A 2E60A 1R58A 2AXLA 3OYDA 3DKYA 3EDPA 2LMDA 1OCCH 2HVRA 2CH0A 2FOKA 3WU0A 3QRFF 3TP3A 2Y48A 4BNCA 3PQJA 4ZJZA 5GADJ 3E5QA 3JRDA 4BY7J 4A3JJ 3FBNB 1G3SA 1DP7P 2F2EA 3N4MA 3E6CC 1A36A 3W6VA 1SVOA 4N9HA 4XLCA 4A3CJ 2HS5A 2M4KA 2QEXI 4ZDLA 2ESHA 2RQQA 4BEHA 3DTEA 1QHHD 4WXHA 3CC7I 3GTLJ 3BTJA 4XORA 3IUOA 4ENKA 3FXUA 5E3MA 2BHZA 3SJMA 1FBUA 1RIOH 3I59A 2IGOA 2A6TA 1X1CA 1YG2A 4JX5A 5TJJA 3HG9A 4ITVA 5KNLA 1A5JA 3BTLA 4XR6A 2A07F 4Y3OA 3BQZA 2QSGX 2M8GX 2ZXWH 1ZELA 2HQAA 1R36A 2JRMA 2J5PA 4A0XA 2E2HJ 4BAYA 2XDVA 2MA3A 3WHCA 2UV1A 3ZQGA 1ACIA 4BE2A 4RA2A 3GZNB 5F1JA 4HF1A 4L0YB 4BJ6C 3G4SI 4BEHB 2BOLA 3K70C 4NBQA 3C2GA 3CCRI 2FU4A 3E3VA 5TISC 1OMIA 3I59B 4QLCU 1FY7A 1XDUA 2DA2A 4Z2YA 1IAWA 2OUMA 1JUPA 2BVMA 2JA7J 1H0MA 3U1KA 2BEOA 3IWFA 4RB1A 4LK0F 2XB5A 5EGOA 5CVIA 2LBFA 5LD2C 2YUSA 5K1YA 1XGOA 1OLTA 4II2A 2UZKA 1H9GA 3KP5A 5FKKA 4C3HJ 1YIJI 1IGNA 2P7CB 5IP7J 4G8XA 3MEXA 3B6CA 1EH6A 5DD8A 5KK1A 4KYWA 3SFZA 3ABUA 2EILH 4HYEA 1OCZH 2E36A 2R7VA 5C4XJ 4M9XA 3E6BA 4MEYF 2RC4A 2XSDC 4UNOA 4J01A 2XAFA 1QBJA 3ABLH 2JRTA 4M3BA 2DQLA 4JBAA 3ERED 3OL4A 5EG0A 1W7PB 3ZCOA 2MC4A 1TBXA 2NNNA 2OU2A 5GPAA 3J80K 3I53A 1BIAA 1R1TA 1VQOI 1RPWA 2H8WA 1J7KA 1H8AC 2DDBA 3OSGA 1FWZA 2P6SA 3MZHA 1PP8F 2XASA 3BTIA 2VPLA 3F8MA 5D5VB 5E1WA 2KQRA 4IOCF 1GXPA 4G7ZF 3JTHA 1X19A 4JX6A 2F5FA 3CDLA 4U88A 4EJVA 5ICEA 3FK6A 4JYKA 5J4VA 4J00A 4A12A 4YFNF 3CCSI 4E7IA 2DFEA 2ME0A 3I55I 3G73A 3HHGA 2FBKA 3MVPA 4XLNF 1G6NA 2CQ7A 4HPQA 2M0CA 2MLGA 1AA7A 4XONA 2E1MC 4HV6A 2K27A 1ZLJA 5M5YJ 2L9VA 3IHUA 2B7EA 3ECOA 4XKWA 2KIUA 1FP2A 2RGVA 1QHGA 5LGUA 4II3A 1K61A 3LQRA 4XOTA 1SMTA 3IH2A 5EEHA 2IA1A 5F1RA 1O3SA 4BHCA 4HX4A 5CLSA 2PMHA 2LRDA 1SD4A 4XN0A 2JSPA 2COMA 3S3NA 3AG2H 4IXAA 2ZXHA 4D9JA 4EGYA 1YLFA 1GUUA 5FKLA 2ZKZA 4XKBA 3JRCA 2DT5A 2AHQA 2IPQX 3DEUA 1SFUA 2E5ZA 2WAQA 5CVRA 4PGHA 1Y8QB 4X6AJ 4PFOA 3L2VA 4CCKA 5EYRA 2NVXJ 2GIVA 2FQ4A 1OCOH 1PDNC 4AC0A 3H36A 3VODA 3S8PA 3A02A 1IZ1A 1WVRA 1DDNA 2IS4A 1Z77A 1PUEE 3LSKA 3O6BB 1ZREA 2OC6A 3NRVA 1XGNA 2HR3A 1FT9A 1UHWA 4RBOA 4HA8A 1SEUA 2TRTA 4C3IJ 1F43A 3K1NA 3L7WA 1ETKA 2W1OA 4I98B 3CCQI 4JOMA 2Q0OA 3D5LA 1OISA 2KP6A 3SHFA 5M3FJ 1DPRA 2HQ5A 2DA7A 2FD5A 5AIPA 1RC9A 3Q0VA 1OYYA 1GXQA 3LMMA 4ENJA 1K4TA 5CJ9A 1KQ0A 3AG4H 3GTQJ 2EV6A 4LLLA 3WE3A 5HS8A 3H3VK 3DP7A 4E7HA 4UY8I 2H1KA 4WXDA 1FX7A 3FMRA 4RGUA 2VT2A 5LLQA 3N05A 2LVSA 3V8KA 2X6YA 1N78A 1NK3P 2D1HA 1MBEA 3K1MA 2YU9J 5FROA 2R0QC 1YX5A 4OMYA 3CLQA 1QZYA 1WGXA 2CUFA 3ZMVA 2MD0A 4IHSA 2ZSIB 1P4AA 1Z9CA 4CHUA 2L3DA 4MTEA 1YO5C 4NDLA 3FBIB 2DYRH 3RIRA 5IOYA 1XS9A 1MNDA 3GFJA 5LGTA 5F0CA 1WJEA 2D5VA 2RV8A 3WTWC 1S3JA 2WAEA 4XLFA 2DBBA 1MIJA 3JSOA 5FFZA 3CCUI 4UUVA 3EETA 2DU9A 3GTKJ 1LFPA 5LEKA 1WJFA 1D1BA 5C3EJ 3OYBA 4KIBA 3ESWB 2R7OA 2O61A 5EZHA 4A3MJ 2DQRA 1UZCA 2W25A 4PDKA 2ZB9A 1QGPA 4HG2A 1ZYRF 5EEAA 1Z21A 2DCEA 3BCAA 1W36C 5H6QA 1D0ZA 2CG4A 1S29A 5CPRB 1S5LC 2HDDA 5E1XA 3GZ5A 5ICFA 2Z99A 1D5VA 2F6CA 4U0VA 3HXLA 2VC1A 3TKYA 4ZZLA 3RSNA 2PI0A 1WJAA 2XGDA 3I4MJ 2IRFG 3CDIA 4XRSA 4IX7A 4HSTA 2XAJA 4RLFA 3BZ6A 2X85A 3H3ZA 2PMUA 1ERDA 2QBYA 5J3LA 2F5EA 1R7JA 1ZHFA 2QENA 3G71I 1ZQ3P 4RB3C 2YS9A 2PX9A 2BYVE 2F4IA 2WV0A 3HM5A 2HDCA 1P92A 4H4KC 4C2MJ 4BE1A 1QU3A 1KYZA 2VQHA 2GAUA 3PNYA 5JR3A 1PJRA 1OCRH 3BR1A 1U2WA 4LG0B 4XKVA 1X58A 3BDDA 4IVNA 2DLLA 1LKXA 2Y69H 3K4KA 2KRCA 3TDZC 2FJ1A 4I09A 4HX7A 1DQUA 3DTKA 1WCMJ 4GDFA 1CQTA 3BPVA 4IRHA 1LEAA 2DFHA 2JZYA 4ASNA 3FX3A 3FXMA 3LSJA 3IH4A 1I6XA 1Z6RA 3M8EA 4HDVA 1D5YA 1CGPA 1IXCA 3LFUA 3AL0B 3OWTA 5LHHA 2DTZA 1EH8A 1FSEA 5DCFA 4BJTA 2XPUA 4EM1A 4V19K 1DP3A 3VWBA 4D5FA 5GTHC 4MNUA 5LBQA 5K5QA 1RR7A 2Z2SB 5JFRA 5F6FA 1VQ4I 2KRFA 3F0CA 2K7LA 1FYLA 3D1NI 2H09A 3W6KB 5ILSA 1WWXA 3FXLA 1MSEC 2LKSA 1MJAA 2IAIA 4A69C 3PUFA 3Q9VA 4OOIA 3RQ4A 3DBRB 3IV5A 3E6DA 2VE9A 4NNJA 4M6XA 2CQXA 2GOMA 1IUFA 2QQAA 5CVVA 2BY1A 2IW5A 1YYVA 1IN6A 2C6YA 2QZ8A 1MW7A 2FE3A 2HGCA 4GCVA 3LAJA 1AOYA 1TQMA 2K3FA 3OYJA 4AIJA 3QPTA 3ONQA 3T0YA 3R6SA 5EDNA 4RGRA 3QU6A 1CF7A 2WAQN 2DO7A 3Q3SA 2VKDA 4UVCA 3OOUA 2XB0X 1BOBA 5JHUA 5FRMA 2LH9A 3SDBA 1ZRDA 5J8CA 3VEPA 3M3YJ 3IL2A 2A5WA 2WC2A 4L9VA 2I8DA 1A6QA 4A6EA 4LFUA 4HRIA 4E70A 2DA6A 2XRNA 3HOXJ 2ZJPF 1WH5A 1TTYA 3LA7A 2Y0SN 2QQ8A 3KYLA 3X2QH 4F93B 2LDUA 2D1VA 4MEXF 1VQ6I 3LSPA 2HXOA 2G0EA 3PIOF 1EF4A 1D1CA 1IV8A 1VF9A 5ILUA 4ESJA 5LGNA 1CF7B 1XGMA 1Y1VJ 1U5TB 5LFAA 3J7ZI 4BDYA 4OIQF 2VN2A 2ZC2A 1QZEA 2HOAA 2ZNYA 3L1PA 1H9TA 2MFZA 5HLIA 5D6EA 3MD2A 2KIQA 4BY1J 2OJED 1IG7A 4IRIA 4RAZA 3OS2A 3FF5A 1LDJA 3OMYA 3CUQB 2KJBA 3I56I 4E7LA 4FQGA 2VT3A 5CVUA 2WWYA 1Y8RB 2X1CA 3HOWJ 3CZ6A 3HEFA 1APLC 2HZTA 3F22A 5D8LB 1TWAJ 4XIDA 3ASNH 2O8KA 3HPGA 1UJ8A 3HOUJ 1D8JA 3GMEA 3GEZA
chains in the Genus database with same CATH topology
4KN7X 4KUMA 2MH9A 5D8KB 2H94A 1GHCA 4GO1A 2XUBA 4HDUA 5ICCA 1D8KA 1MDMA 1ON1A 2EK5A 2FNAA 3QPHA 4P9FA 2DK5A 1YW9A 2HEOA 4KNYA 3VFZA 1UCRA 1QO0D 4HQEA 3GW2A 1SFEA 5L3CA 2P5VA 1UHMA 2MD5A 3V7SA 1OKRA 3TOBA 2IA2A 4UV8A 3T5XA 2RKHA 3RYRA 3LA3A 1BI3A 3CDHA 2OQGA 3I64A 4CDGA 2VONA 4DQ2A 1R00A 1J75A 1XB4A 4RGSA 1RUOA 2FA5A 1T98A 5DEQA 4EJUA 3WE2A 1SD6A 3E5UA 1U6GA 1MGTA 3T8RA 4YIIA 4IRGA 3BPXA 3KP6A 2EB7A 3RI4A 4A5NA 1S7OA 2KIFA 5DD4A 1HW1A 2QLZA 1FYMA 1B9MA 3LAPA 2XHKA 1REPC 3IRRA 3S2WA 4EM0B 2W24A 4KFCA 3FMSA 1SFXA 4P96A 3IWZA 5FLXK 4OU0A 3WTZA 3P9KA 2HTSA 2Y75A 2K02A 2ADUA 2KKOA 1R5HA 4KA4A 3BJAA 1ZRCA 2HTJA 3F23A 1FBQA 4I2OA 2GQQA 5LHIA 2L02A 3FHZA 5DYMA 1A04A 4MHGA 1LQ1A 4XLPF 4HQMA 3F8FA 1L0OC 5FO5A 1O7LA 2EV5A 1LB2A 4G6QA 1FPQA 2NYXA 2OAZA 3HYIA 3GWZA 2GA2A 2JSCA 2STTA 4A2UA 4LJZF 3FMQA 1MD0A 2QM3A 1QZZA 1QNTA 5L3GA 1XCVA 2YSRA 4FT8A 4U7BA 4CXFA 2L4AA 1B1BA 1IN7A 4L5IA 2R7DA 1J59A 2QQBA 2ZMEA 1D3YA 3RKWA 5D6FA 5BS6A 2P5LC 1J9IA 2G7UA 4UVBA 3T1BA 2VBWA 1IN4A 1HKQA 1TNTA 2Z9OA 2O3FA 1W7PA 2GXGA 2ZMEB 2CWEA 3K69A 3I58A 1HW2A 1YW8A 3RDIA 2W57A 3I5UA 5K5OA 3RKXA 2HKOA 4H0EA 2ZXJA 3U2RA 2IT0A 1YS6A 4M9SA 3HSEA 3DFGA 1TQIA 3GX4X 4ENNA 1WKMA 2ACJA 2H6BA 2CQKA 2MLKA 1ULYA 2E1CA 1P4XA 4LD5A 1O3QA 5TRDA 4QWQA 3SQNA 5BOXA 2VXZA 2Z3YA 2R3SA 2XAHA 3OV8A 4HV5A 2CGPA 3BROA 4A5MA 2XAQA 1E2XA 1TW2A 1XGSA 3RTRA 4R8HA 4AIHA 5HOOA 3MWMA 4RB0A 5L3FA 5FLXZ 3T8TA 3E5XA 2GA1A 3HIFA 4XRFA 5HDNA 1U5TC 3BP8A 2FMYA 3SZTA 4HAMA 3SZPA 4YFKF 3R0AA 4CGZA 4UV9A 1TNSA 2ISYA 3KP2A 2OA4A 1ZRFA 4N9IA 1YTYA 1MZBA 1RNLA 1ZH5A 4WXCA 3KCCA 3KETA 2OQRA 2HKXA 1ON2A 3K1PA 2ZCWA 1BI0A 5ILVA 5IT9K 5AIQA 3AAFA 4L9TA 5CYVA 4M71A 2A3SA 3M1EA 4WF2A 2LF8A 3WTUC 2V1UA 1TLHB 4Q48A 1RI7A 4LK1F 2FF4A 2EV0A 1YQAA 2IJLA 3Q5FA 2GZWA 4O5VA 2FSWA 3COAC 1ONVA 3B73A 1BJAA 3JW4A 1VTNC 1WQ2A 4LB6B 3DV8A 1U8RA 1O7FA 3CO6C 5L3EA 4M73A 1ZG1A 5ERIA 3V7RA 4OIRF 2DI3A 2VBYA 1G3TA 5E18F 3H92A 3KZZA 3IKTA 1FOKA 2A5YB 3DXJF 4OMZA 4EVIA 1BC8C 3VOEA 1OR7A 3P9IA 4LG0A 1KU7A 3ZMUA 2TDXA 1ZG3A 2W84A 1XD7A 4I0AA 4ZYEA 1LNWA 3GFMA 3GEZA 1T38A 2P8TA 1IW7F 3B02A 2V9VA 1MKMA 1FBSA 3KP3A 5E8GA 2QUFA 3F72A 1BOAA 3ML6A 2A6HF 3R4KA 2PBIA 4N0BA 2Z33A 5JI6A 4HX8A 3RJPA 1OPCA 1BI2A 2HYGD 2M30A 3MCZA 5J8FA 4EGZA 4S05A 2ESNA 2DAOA 3WGIA 5A2QZ 4CO8A 5EEGA 5HDGA 3W6JB 3M9AA 1S8NA 3KP7A 1ZAOA 3ECHA 1WRJA 5DUIA 4OIPF 1Y0UA 5ICGA 2VOOA 3NQOA 4AIKA 1FC3A 2YX7A 2CFXA 5H20A 3WTTC 2F5DA 3KE2A 2O0YA 3ZMZA 2JPBA 5LRSA 1U5TA 1F1ZA 5LEJA 4F7ZA 5IT9Z 4L0ZB 1BI1A 3QP5A 2ELHA 3MZYA 3CUQA 4AWXB 4IF4A 1DUXC 4S04A 3BJ6A 3IC7A 2A6EF 2OZUA 3TO9A 4KMUX 4JQFA 2ETHA 3ISPA 2ZO4A 1K79A 4P5OA 2OD5A 2DPDA 1L3LA 3FM5A 3R0JA 2H27A 4G9YA 4LGWA 1EV7A 5D4RA 4NB5A 3NEUA 3I0TA 3RKYA 1Z1DA 3F21A 2M87A 4G94A 1I5ZA 4GYIA 2IA0A 2M5WA 2DTRA 3CJNA 4BH9A 2RN7A 2O8XA 3ZQ7A 1JE8A 1XDSA 5BPDA 1STZA 1F5TA 2AS5F 2E1NA 1S6LA 2R7FA 3ZMTA 1XSVA 3Q9SA 3HSFA 3ZMDA 2HQRA 3WTSC 3HTUA 4HOBA 2PLYA 3PFIA 4LLNA 5LHGA 2BGCA 2FBHA 4G6DA 4GGGA 5J6XA 1HQCA 4UHTA 4UXNA 4YIFA 2HYFA 3TQNA 3LFKA 2Q8KA 1FLIA 1T0FA 1ZG5A 4EJOA 3FXRA 3R60A 1HBXG 2OZ6A 4A0YA 1BBYA 3C18A 3BY6A 3DF8A 2EFQA 2LNBA 5E20A 1JHFA 4AD9A 4EJTA 4WWCA 3RPUA 3MAJA 4JK1X 3KEOA 5FGMA 5DDGA 1NHAA 4KDPA 2LF7A 1T39A 3J7AO 3HTSB 2DFIA 3GLXA 1R1VA 1K78B 4UVAA 2V1DA 2EFOA 1FYKA 3WTYC 5BMZA 3KLOA 3MFKA 1KA8A 4HF2A 4PZJA 4BHBA 5D5XB 3K2ZA 2VC0A 2M8EA 3P9CA 2HOEA 2VODA 1SAXA 4HZFA 2P7VB 4ZYDA 3GXOA 1WI9A 2X0LA 2QYOA 5ED4A 2XIGA 4KIGA 1LDKB 3GO5A 2H6CA 3F8NA 4RGXA 2W85A 2IVMA 5HLGA 5D5UB 4HLXA 1K6OA 2XV4S 2JT1A 4L5JA 3BJOA 3F8CA 2LSOA 3JAMK 2HWVA 4I7HA 4HW0A 4HLYA 5HLHA 2UXXA 1G3YA 2EFPA 1BM9A 3F8BA 4R79A 4CYDA 4Q5SF 3LSTA 1KU9A 4ESBA 1RZ4A 4IHTA 4HF0A 4IJAA 1JXSA 5KVRA 4YG2F 1FZPB 4MGRA 2VBXA 5HS7A 3RYPA 4OINF 2HQNA 2PFBA 1R22A 1XMKA 2XAGA 2EA4A 4ZYHA 2ZFWA 1FP1D 2XKOA 1Q1HA 2D45A 3GYHX 2FNPA 3RPQA 2QVOA 1ODDA 1XCBA 1P2FA 2NAZA 1U78A 1IRFA 4GXOA 4A0ZA 1P4WA 5CVJA 2HFHA 1IF1A 3QAHA 4KN4X 2P5KA 3LQQA 4I0BA 2ZJ2A 2D2WA 3O2PE 4ZZDA 3REOA 5AONA 4BXUA 4BYYA 3DKWA 1BC7C 1HW5A 4DNCA 3GUDA 3GZ6A 4EJWA 2V1XA 2FMLA 5JVTA 3WU1B 3KFWX 4PCQA 3ZPLA 4TV7A 1R1UA 3DPTA 2DPUA 1I27A 5E17F 5HDKA 5A2QK 1IUYA 1P6RA 3PQKA 3GVAA 2X4HA 3KLNA 2YX4A 3I4PA 1IN5A 4HBLA 1SD5A 1V3FA 4M74A 1Z91A 3WGHA 3V4GA 5D4SA 3ABTA 4KT5C 5HS9A 1FNNA 2CO5A 1XMAA 3L9FA 4P9UA 4MTDA 1B4AA 3TO7A 4M6YA 1TQPA 1QPMA 1Z7UA 1J0RA 5FFXA 3JAMZ 5FB2A 3CUQC 5F64A 1T6SA 2O6GE 1C0WA 1YFHA 2BV6A 1KQ8A 1JHHA 3EUHA 1KYWA 1IN8A 3V7CA 2FBIA 2IP2A 2YR2A 5FD6A 4M9ZA 1O3TA 4CZZA 2O03A 3ZN0A 2EFWA 4O6JA 1JGSA 3LWFA 4XBFA 1W7PD 5DUKA 1YW7A 2QQ9A 3TDUC 2A68F 3QP6A 1X3UA 1IRGA 2QWWA 1EH7A 2PG4A 4XSXF 1F4KA 3FWEA 4KMFA 3HRTA 2V6CA 2YPRA 3D0SA 5D5WB 4Y13A 2RDPA 3CTAA 2L54A 3G3ZA 2P6TA 1BN5A 3ROUA 5E8IA 1ZN2A 4L9JA 3DQVC 2G7HA 3H3UA 3KEQA 4EM2A 3C3WA 5LRRA 2STWA 1R23A 2CW0F 2B0LA 2UWMA 3F6OA 2XKPA 1XN7A 1Z6TA 2GWRA 3QU3A 2MC3A 3K9TA 1MJBA 2JPCA 3U1DA 4U7DA 4KIFA 4ZYGA 1XSXA 2PN6A 3TOAA 1WSUA 1S7AA 2PQ8A 3EQLF 3WTVC 3ELKA 2MH2A 3V8JA 1W5SA 3HRSA 5FD5A 4ENMA 3P7NA 4Y17A 2E7WA 1IXRC 4BQAA 2RNJA 1OYIA 1KQ9A 4WK8F 2M1BA 3K0LA 4D0PA 5BPIA 4L9NA 1UB9A 3CLOA 5H6RA 2KJCA 2A61A 4R1HA 1O57A 1LEBA 3TO6A 2PJPA 5BQTA 3J80Z 3HHHA 1W5TA 3WODF 4ETSA 4EMSA 3FZVA 1SD7A 2PEXA 2L01A 1W4MA 2XVCA 1DPUA 4M72A 3HOTA 1HSJA 2QBYB 1RUNA 3GFIA 3OOPA 5IT3A 3E6MA 3HUGA 2VOPA 4XSZF 3QOPA 1LDDA 2VBZA 4YFXF 4Y15A 3FXQA 3J81K 2K4BA 4O3MA 1G4DA 4L18B 3ZMSA 4ESFA 1USTA 3ZN1A 1B59A 1B9NA 3E97A 4CICA 1QQIA 2E7XA 2RQPA 3U9GA 2EWNA 4GYGA 2FQ3A 4FX4A 4B8XA 3BOQA 2Z5UA 4FHTA 4NHJA 3IRQA 3KZYA 4EV0A 2Y0MA 2KIMA 1HKSA 1F9NA 3M7GA 4U0YA 3L00A 1ZGAA 4G7OF 1GVJA 2EA2A 1Z05A 4EQQA 1V4RA 1ZGJA 3BWGA 2K4JA 2JTVA 2CYYA 4I01A 3L2CA 5DV5A 1U3EM 2UXNA 3ULQB 4AVPA 2NRAC 3WG9A 1K7AA 1I1SA 3I71A 1R5GA 2XROA 1UFMA 3TGNA 4LB5A 1MJ9A 2OBPA 3HSRA 5HVQC 4LLGF 1XSDA 1TW3A 1KU2A 3F3XA 4U0WA 4Q4ZF 2FRHA 2ISZA 1KGSA 3WGGA 3DPLC 2ZBKA 4BHPA 1BIBA 1LJ9A 2YU3A 3SXYA 2NS0A 1O3RA 2ZNZA 3ZP5A 4RAYA 4G7HF 3MQ0A 1OYWA 1HXDA 4FX0A 4LMYA 1MDMB 1HKTA 1YIOA 3VB2A 5DCMA 4ZH4F 1K78A 4P55A 1E17A 4MQ9F 1I1GA 4RS8A 5K5RA 3JTGA 1AWCA 1J5YA 4NQWA 2LKPA 2EFNA 2P4WA 4MQVA 5DCMB 3J81Z 1HSTA 3GFLA 4K2EA 2FXAA 4OIOF 3KP4A 1LVAA 3R61A 3EYYA 3EYIA 2V79A 1YS7A 3FM3A 1KU3A 3N97A 4A6DA 2FEZA 3HOSA 3L09A 4Q47A 1G3WA 1T2KA 4KICA 2L4MA 3GF2A 1J2XA 3I54A 2EJRA 3C7JA 2GXBA 4WCGA 3WTXC 3HRUA 3JSPA 4IPAA 2F5CA 3CO7C 2K86A 2M45A 3CUOA 2A69F 2J5OA 2WTEA 2DW4A 6PAXA 4WX9A 4PGGA 3M8FA 3LA2A 3IKVA 3HRMA 5L3DA 2BE5F 1SMYF 1PP7U 1ZLKA 2Q2EA 4RB2C 1B6AA 1ZARA 1IXSB 4I02A 2BBYA 2RVCA 1USSA 5L3BA 2CSOA 3O3KA 1FSHA 3V8LA 4B09A 5E1ZB 3F6VA 2VE8A 2XGXA 2G9WA 3C1DA 2MBFA 4ON0A 2DK8A 1R58A 2AXLA 3EDPA 2FOKA 3WU0A 3QRFF 2Y48A 4BNCA 3PQJA 3E5QA 1G3SA 1DP7P 2F2EA 3N4MA 3E6CC 4N9HA 2HS5A 2ESHA 4WXHA 4ENKA 3FXUA 1FBUA 1RIOH 3I59A 1YG2A 5TJJA 2A07F 4A0XA 1R36A 2J5PA 4BAYA 2MA3A 4HF1A 4L0YB 2FU4A 3E3VA 1OMIA 3I59B 4QLCU 1FY7A 1XDUA 4Z2YA 1IAWA 1H0MA 2BEOA 3IWFA 4RB1A 4LK0F 5CVIA 5K1YA 1XGOA 2UZKA 1H9GA 3KP5A 2P7CB 4G8XA 3MEXA 1EH6A 5DD8A 5KK1A 4KYWA 3SFZA 3ABUA 4HYEA 4M9XA 3E6BA 4MEYF 2RC4A 4UNOA 2XAFA 1QBJA 2JRTA 2DQLA 4JBAA 3ERED 1W7PB 1TBXA 2NNNA 2OU2A 3J80K 3I53A 1BIAA 1R1TA 1J7KA 1FWZA 2P6SA 3MZHA 1PP8F 2XASA 3F8MA 5D5VB 5E1WA 1GXPA 4G7ZF 3JTHA 2F5FA 4U88A 4EJVA 5ICEA 4A12A 4YFNF 3G73A 3HHGA 2FBKA 4XLNF 1G6NA 2MLGA 4HV6A 2K27A 1ZLJA 3IHUA 3ECOA 2KIUA 1FP2A 2RGVA 5LGUA 3LQRA 1SMTA 5EEHA 2IA1A 5F1RA 1O3SA 4BHCA 4HX4A 5CLSA 2PMHA 1SD4A 2COMA 4IXAA 4EGYA 1YLFA 2ZKZA 2DT5A 2IPQX 3DEUA 1SFUA 5CVRA 4PGHA 2GIVA 1PDNC 3VODA 1IZ1A 1DDNA 1PUEE 3O6BB 1ZREA 3NRVA 1XGNA 2HR3A 1FT9A 1UHWA 4HA8A 3K1NA 3L7WA 4I98B 2Q0OA 3D5LA 3SHFA 1DPRA 5AIPA 1OYYA 1GXQA 4ENJA 5CJ9A 1KQ0A 2EV6A 4LLLA 3WE3A 5HS8A 3DP7A 4WXDA 1FX7A 3FMRA 4RGUA 2VT2A 5LLQA 3V8KA 2D1HA 3K1MA 4OMYA 1QZYA 3ZMVA 4IHSA 1P4AA 1Z9CA 4CHUA 2L3DA 4MTEA 1YO5C 3RIRA 3GFJA 5LGTA 2RV8A 3WTWC 1S3JA 2DBBA 3JSOA 5FFZA 4UUVA 3EETA 2DU9A 5LEKA 4KIBA 2O61A 2DQRA 2W25A 4PDKA 1QGPA 1ZYRF 5H6QA 2CG4A 1S29A 5E1XA 3GZ5A 5ICFA 2Z99A 1D5VA 4U0VA 2VC1A 3TKYA 4ZZLA 2PI0A 2IRFG 2XAJA 3BZ6A 3H3ZA 2PMUA 2QBYA 2F5EA 1R7JA 1ZHFA 2QENA 4RB3C 2BYVE 2WV0A 2HDCA 1P92A 1KYZA 2GAUA 5JR3A 1U2WA 4LG0B 3BDDA 4IVNA 2DLLA 3TDZC 4I09A 4HX7A 3BPVA 4IRHA 1LEAA 2JZYA 4ASNA 3FX3A 1I6XA 1Z6RA 3M8EA 4HDVA 1CGPA 1IXCA 5LHHA 1EH8A 1FSEA 5DCFA 4EM1A 4MNUA 5LBQA 5K5QA 5JFRA 5F6FA 2KRFA 2K7LA 1FYLA 2H09A 3W6KB 5ILSA 1WWXA 1MJAA 3Q9VA 4OOIA 3E6DA 2VE9A 4M6XA 2QQAA 5CVVA 2IW5A 1YYVA 1IN6A 2C6YA 2QZ8A 2FE3A 2HGCA 4GCVA 3LAJA 1AOYA 1TQMA 4AIJA 3QPTA 3T0YA 3R6SA 4RGRA 3QU6A 1CF7A 2DO7A 4UVCA 5JHUA 1ZRDA 5J8CA 3VEPA 3IL2A 2WC2A 4L9VA 4A6EA 4LFUA 4E70A 2XRNA 1TTYA 3LA7A 2LDUA 2D1VA 4MEXF 4ESJA 5ILUA 5LGNA 1CF7B 1XGMA 1U5TB 4OIQF 2VN2A 2ZNYA 1H9TA 5HLIA 5D6EA 4IRIA 4RAZA 3FF5A 1LDJA 3CUQB 2KJBA 2VT3A 5CVUA 2WWYA 2HZTA 3F22A 5D8LB 1D8JA 2NNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN7 X;  4KUM A;  2MH9 A;  5D8K B;  2H94 A;  1GHC A;  4GO1 A;  2XUB A;  4HDU A;  5ICC A;  1D8K A;  1MDM A;  1ON1 A;  2EK5 A;  2FNA A;  3QPH A;  4P9F A;  2DK5 A;  1YW9 A;  2HEO A;  4KNY A;  3VFZ A;  1UCR A;  1QO0 D;  4HQE A;  3GW2 A;  1SFE A;  5L3C A;  2P5V A;  1UHM A;  2MD5 A;  3V7S A;  1OKR A;  3TOB A;  2IA2 A;  4UV8 A;  3T5X A;  2RKH A;  3RYR A;  3LA3 A;  1BI3 A;  3CDH A;  2OQG A;  3I64 A;  4CDG A;  2VON A;  4DQ2 A;  1R00 A;  1J75 A;  1XB4 A;  4RGS A;  1RUO A;  2FA5 A;  1T98 A;  5DEQ A;  4EJU A;  3WE2 A;  1SD6 A;  3E5U A;  1U6G A;  1MGT A;  3T8R A;  4YII A;  4IRG A;  3BPX A;  3KP6 A;  2EB7 A;  3RI4 A;  4A5N A;  1S7O A;  2KIF A;  5DD4 A;  1HW1 A;  2QLZ A;  1FYM A;  1B9M A;  3LAP A;  2XHK A;  1REP C;  3IRR A;  3S2W A;  4EM0 B;  2W24 A;  4KFC A;  3FMS A;  1SFX A;  4P96 A;  3IWZ A;  5FLX K;  4OU0 A;  3WTZ A;  3P9K A;  2HTS A;  2Y75 A;  2K02 A;  2ADU A;  2KKO A;  1R5H A;  4KA4 A;  3BJA A;  1ZRC A;  2HTJ A;  3F23 A;  1FBQ A;  4I2O A;  2GQQ A;  5LHI A;  2L02 A;  3FHZ A;  5DYM A;  1A04 A;  4MHG A;  1LQ1 A;  4XLP F;  4HQM A;  3F8F A;  1L0O C;  5FO5 A;  1O7L A;  2EV5 A;  1LB2 A;  4G6Q A;  1FPQ A;  2NYX A;  2OAZ A;  3HYI A;  3GWZ A;  2GA2 A;  2JSC A;  2STT A;  4A2U A;  4LJZ F;  3FMQ A;  1MD0 A;  2QM3 A;  1QZZ A;  1QNT A;  5L3G A;  1XCV A;  2YSR A;  4FT8 A;  4U7B A;  4CXF A;  2L4A A;  1B1B A;  1IN7 A;  4L5I A;  2R7D A;  1J59 A;  2QQB A;  2ZME A;  1D3Y A;  3RKW A;  5D6F A;  5BS6 A;  2P5L C;  1J9I A;  2G7U A;  4UVB A;  3T1B A;  2VBW A;  1IN4 A;  1HKQ A;  1TNT A;  2Z9O A;  2O3F A;  1W7P A;  2GXG A;  2ZME B;  2CWE A;  3K69 A;  3I58 A;  1HW2 A;  1YW8 A;  3RDI A;  2W57 A;  3I5U A;  5K5O A;  3RKX A;  2HKO A;  4H0E A;  2ZXJ A;  3U2R A;  2IT0 A;  1YS6 A;  4M9S A;  3HSE A;  3DFG A;  1TQI A;  3GX4 X;  4ENN A;  1WKM A;  2ACJ A;  2H6B A;  2CQK A;  2MLK A;  1ULY A;  2E1C A;  1P4X A;  4LD5 A;  1O3Q A;  5TRD A;  4QWQ A;  3SQN A;  5BOX A;  2VXZ A;  2Z3Y A;  2R3S A;  2XAH A;  3OV8 A;  4HV5 A;  2CGP A;  3BRO A;  4A5M A;  2XAQ A;  1E2X A;  1TW2 A;  1XGS A;  3RTR A;  4R8H A;  4AIH A;  5HOO A;  3MWM A;  4RB0 A;  5L3F A;  5FLX Z;  3T8T A;  3E5X A;  2GA1 A;  3HIF A;  4XRF A;  5HDN A;  1U5T C;  3BP8 A;  2FMY A;  3SZT A;  4HAM A;  3SZP A;  4YFK F;  3R0A A;  4CGZ A;  4UV9 A;  1TNS A;  2ISY A;  3KP2 A;  2OA4 A;  1ZRF A;  4N9I A;  1YTY A;  1MZB A;  1RNL A;  1ZH5 A;  4WXC A;  3KCC A;  3KET A;  2OQR A;  2HKX A;  1ON2 A;  3K1P A;  2ZCW A;  1BI0 A;  5ILV A;  5IT9 K;  5AIQ A;  3AAF A;  4L9T A;  5CYV A;  4M71 A;  2A3S A;  3M1E A;  4WF2 A;  2LF8 A;  3WTU C;  2V1U A;  1TLH B;  4Q48 A;  1RI7 A;  4LK1 F;  2FF4 A;  2EV0 A;  1YQA A;  2IJL A;  3Q5F A;  2GZW A;  4O5V A;  2FSW A;  3COA C;  1ONV A;  3B73 A;  1BJA A;  3JW4 A;  1VTN C;  1WQ2 A;  4LB6 B;  3DV8 A;  1U8R A;  1O7F A;  3CO6 C;  5L3E A;  4M73 A;  1ZG1 A;  5ERI A;  3V7R A;  4OIR F;  2DI3 A;  2VBY A;  1G3T A;  5E18 F;  3H92 A;  3KZZ A;  3IKT A;  1FOK A;  2A5Y B;  3DXJ F;  4OMZ A;  4EVI A;  1BC8 C;  3VOE A;  1OR7 A;  3P9I A;  4LG0 A;  1KU7 A;  3ZMU A;  2TDX A;  1ZG3 A;  2W84 A;  1XD7 A;  4I0A A;  4ZYE A;  1LNW A;  3GFM A;  3GEZ A;  1T38 A;  2P8T A;  1IW7 F;  3B02 A;  2V9V A;  1MKM A;  1FBS A;  3KP3 A;  5E8G A;  2QUF A;  3F72 A;  1BOA A;  3ML6 A;  2A6H F;  3R4K A;  2PBI A;  4N0B A;  2Z33 A;  5JI6 A;  4HX8 A;  3RJP A;  1OPC A;  1BI2 A;  2HYG D;  2M30 A;  3MCZ A;  5J8F A;  4EGZ A;  4S05 A;  2ESN A;  2DAO A;  3WGI A;  5A2Q Z;  4CO8 A;  5EEG A;  5HDG A;  3W6J B;  3M9A A;  1S8N A;  3KP7 A;  1ZAO A;  3ECH A;  1WRJ A;  5DUI A;  4OIP F;  1Y0U A;  5ICG A;  2VOO A;  3NQO A;  4AIK A;  1FC3 A;  2YX7 A;  2CFX A;  5H20 A;  3WTT C;  2F5D A;  3KE2 A;  2O0Y A;  3ZMZ A;  2JPB A;  5LRS A;  1U5T A;  1F1Z A;  5LEJ A;  4F7Z A;  5IT9 Z;  4L0Z B;  1BI1 A;  3QP5 A;  2ELH A;  3MZY A;  3CUQ A;  4AWX B;  4IF4 A;  1DUX C;  4S04 A;  3BJ6 A;  3IC7 A;  2A6E F;  2OZU A;  3TO9 A;  4KMU X;  4JQF A;  2ETH A;  3ISP A;  2ZO4 A;  1K79 A;  4P5O A;  2OD5 A;  2DPD A;  1L3L A;  3FM5 A;  3R0J A;  2H27 A;  4G9Y A;  4LGW A;  1EV7 A;  5D4R A;  4NB5 A;  3NEU A;  3I0T A;  3RKY A;  1Z1D A;  3F21 A;  2M87 A;  4G94 A;  1I5Z A;  4GYI A;  2IA0 A;  2M5W A;  2DTR A;  3CJN A;  4BH9 A;  2RN7 A;  2O8X A;  3ZQ7 A;  1JE8 A;  1XDS A;  5BPD A;  1STZ A;  1F5T A;  2AS5 F;  2E1N A;  1S6L A;  2R7F A;  3ZMT A;  1XSV A;  3Q9S A;  3HSF A;  3ZMD A;  2HQR A;  3WTS C;  3HTU A;  4HOB A;  2PLY A;  3PFI A;  4LLN A;  5LHG A;  2BGC A;  2FBH A;  4G6D A;  4GGG A;  5J6X A;  1HQC A;  4UHT A;  4UXN A;  4YIF A;  2HYF A;  3TQN A;  3LFK A;  2Q8K A;  1FLI A;  1T0F A;  1ZG5 A;  4EJO A;  3FXR A;  3R60 A;  1HBX G;  2OZ6 A;  4A0Y A;  1BBY A;  3C18 A;  3BY6 A;  3DF8 A;  2EFQ A;  2LNB A;  5E20 A;  1JHF A;  4AD9 A;  4EJT A;  4WWC A;  3RPU A;  3MAJ A;  4JK1 X;  3KEO A;  5FGM A;  5DDG A;  1NHA A;  4KDP A;  2LF7 A;  1T39 A;  3J7A O;  3HTS B;  2DFI A;  3GLX A;  1R1V A;  1K78 B;  4UVA A;  2V1D A;  2EFO A;  1FYK A;  3WTY C;  5BMZ A;  3KLO A;  3MFK A;  1KA8 A;  4HF2 A;  4PZJ A;  4BHB A;  5D5X B;  3K2Z A;  2VC0 A;  2M8E A;  3P9C A;  2HOE A;  2VOD A;  1SAX A;  4HZF A;  2P7V B;  4ZYD A;  3GXO A;  1WI9 A;  2X0L A;  2QYO A;  5ED4 A;  2XIG A;  4KIG A;  1LDK B;  3GO5 A;  2H6C A;  3F8N A;  4RGX A;  2W85 A;  2IVM A;  5HLG A;  5D5U B;  4HLX A;  1K6O A;  2XV4 S;  2JT1 A;  4L5J A;  3BJO A;  3F8C A;  2LSO A;  3JAM K;  2HWV A;  4I7H A;  4HW0 A;  4HLY A;  5HLH A;  2UXX A;  1G3Y A;  2EFP A;  1BM9 A;  3F8B A;  4R79 A;  4CYD A;  4Q5S F;  3LST A;  1KU9 A;  4ESB A;  1RZ4 A;  4IHT A;  4HF0 A;  4IJA A;  1JXS A;  5KVR A;  4YG2 F;  1FZP B;  4MGR A;  2VBX A;  5HS7 A;  3RYP A;  4OIN F;  2HQN A;  2PFB A;  1R22 A;  1XMK A;  2XAG A;  2EA4 A;  4ZYH A;  2ZFW A;  1FP1 D;  2XKO A;  1Q1H A;  2D45 A;  3GYH X;  2FNP A;  3RPQ A;  2QVO A;  1ODD A;  1XCB A;  1P2F A;  2NAZ A;  1U78 A;  1IRF A;  4GXO A;  4A0Z A;  1P4W A;  5CVJ A;  2HFH A;  1IF1 A;  3QAH A;  4KN4 X;  2P5K A;  3LQQ A;  4I0B A;  2ZJ2 A;  2D2W A;  3O2P E;  4ZZD A;  3REO A;  5AON A;  4BXU A;  4BYY A;  3DKW A;  1BC7 C;  1HW5 A;  4DNC A;  3GUD A;  3GZ6 A;  4EJW A;  2V1X A;  2FML A;  5JVT A;  3WU1 B;  3KFW X;  4PCQ A;  3ZPL A;  4TV7 A;  1R1U A;  3DPT A;  2DPU A;  1I27 A;  5E17 F;  5HDK A;  5A2Q K;  1IUY A;  1P6R A;  3PQK A;  3GVA A;  2X4H A;  3KLN A;  2YX4 A;  3I4P A;  1IN5 A;  4HBL A;  1SD5 A;  1V3F A;  4M74 A;  1Z91 A;  3WGH A;  3V4G A;  5D4S A;  3ABT A;  4KT5 C;  5HS9 A;  1FNN A;  2CO5 A;  1XMA A;  3L9F A;  4P9U A;  4MTD A;  1B4A A;  3TO7 A;  4M6Y A;  1TQP A;  1QPM A;  1Z7U A;  1J0R A;  5FFX A;  3JAM Z;  5FB2 A;  3CUQ C;  5F64 A;  1T6S A;  2O6G E;  1C0W A;  1YFH A;  2BV6 A;  1KQ8 A;  1JHH A;  3EUH A;  1KYW A;  1IN8 A;  3V7C A;  2FBI A;  2IP2 A;  2YR2 A;  5FD6 A;  4M9Z A;  1O3T A;  4CZZ A;  2O03 A;  3ZN0 A;  2EFW A;  4O6J A;  1JGS A;  3LWF A;  4XBF A;  1W7P D;  5DUK A;  1YW7 A;  2QQ9 A;  3TDU C;  2A68 F;  3QP6 A;  1X3U A;  1IRG A;  2QWW A;  1EH7 A;  2PG4 A;  4XSX F;  1F4K A;  3FWE A;  4KMF A;  3HRT A;  2V6C A;  2YPR A;  3D0S A;  5D5W B;  4Y13 A;  2RDP A;  3CTA A;  2L54 A;  3G3Z A;  2P6T A;  1BN5 A;  3ROU A;  5E8I A;  1ZN2 A;  4L9J A;  3DQV C;  2G7H A;  3H3U A;  3KEQ A;  4EM2 A;  3C3W A;  5LRR A;  2STW A;  1R23 A;  2CW0 F;  2B0L A;  2UWM A;  3F6O A;  2XKP A;  1XN7 A;  1Z6T A;  2GWR A;  3QU3 A;  2MC3 A;  3K9T A;  1MJB A;  2JPC A;  3U1D A;  4U7D A;  4KIF A;  4ZYG A;  1XSX A;  2PN6 A;  3TOA A;  1WSU A;  1S7A A;  2PQ8 A;  3EQL F;  3WTV C;  3ELK A;  2MH2 A;  3V8J A;  1W5S A;  3HRS A;  5FD5 A;  4ENM A;  3P7N A;  4Y17 A;  2E7W A;  1IXR C;  4BQA A;  2RNJ A;  1OYI A;  1KQ9 A;  4WK8 F;  2M1B A;  3K0L A;  4D0P A;  5BPI A;  4L9N A;  1UB9 A;  3CLO A;  5H6R A;  2KJC A;  2A61 A;  4R1H A;  1O57 A;  1LEB A;  3TO6 A;  2PJP A;  5BQT A;  3J80 Z;  3HHH A;  1W5T A;  3WOD F;  4ETS A;  4EMS A;  3FZV A;  1SD7 A;  2PEX A;  2L01 A;  1W4M A;  2XVC A;  1DPU A;  4M72 A;  3HOT A;  1HSJ A;  2QBY B;  1RUN A;  3GFI A;  3OOP A;  5IT3 A;  3E6M A;  3HUG A;  2VOP A;  4XSZ F;  3QOP A;  1LDD A;  2VBZ A;  4YFX F;  4Y15 A;  3FXQ A;  3J81 K;  2K4B A;  4O3M A;  1G4D A;  4L18 B;  3ZMS A;  4ESF A;  1UST A;  3ZN1 A;  1B59 A;  1B9N A;  3E97 A;  4CIC A;  1QQI A;  2E7X A;  2RQP A;  3U9G A;  2EWN A;  4GYG A;  2FQ3 A;  4FX4 A;  4B8X A;  3BOQ A;  2Z5U A;  4FHT A;  4NHJ A;  3IRQ A;  3KZY A;  4EV0 A;  2Y0M A;  2KIM A;  1HKS A;  1F9N A;  3M7G A;  4U0Y A;  3L00 A;  1ZGA A;  4G7O F;  1GVJ A;  2EA2 A;  1Z05 A;  4EQQ A;  1V4R A;  1ZGJ A;  3BWG A;  2K4J A;  2JTV A;  2CYY A;  4I01 A;  3L2C A;  5DV5 A;  1U3E M;  2UXN A;  3ULQ B;  4AVP A;  2NRA C;  3WG9 A;  1K7A A;  1I1S A;  3I71 A;  1R5G A;  2XRO A;  1UFM A;  3TGN A;  4LB5 A;  1MJ9 A;  2OBP A;  3HSR A;  5HVQ C;  4LLG F;  1XSD A;  1TW3 A;  1KU2 A;  3F3X A;  4U0W A;  4Q4Z F;  2FRH A;  2ISZ A;  1KGS A;  3WGG A;  3DPL C;  2ZBK A;  4BHP A;  1BIB A;  1LJ9 A;  2YU3 A;  3SXY A;  2NS0 A;  1O3R A;  2ZNZ A;  3ZP5 A;  4RAY A;  4G7H F;  3MQ0 A;  1OYW A;  1HXD A;  4FX0 A;  4LMY A;  1MDM B;  1HKT A;  1YIO A;  3VB2 A;  5DCM A;  4ZH4 F;  1K78 A;  4P55 A;  1E17 A;  4MQ9 F;  1I1G A;  4RS8 A;  5K5R A;  3JTG A;  1AWC A;  1J5Y A;  4NQW A;  2LKP A;  2EFN A;  2P4W A;  4MQV A;  5DCM B;  3J81 Z;  1HST A;  3GFL A;  4K2E A;  2FXA A;  4OIO F;  3KP4 A;  1LVA A;  3R61 A;  3EYY A;  3EYI A;  2V79 A;  1YS7 A;  3FM3 A;  1KU3 A;  3N97 A;  4A6D A;  2FEZ A;  3HOS A;  3L09 A;  4Q47 A;  1G3W A;  1T2K A;  4KIC A;  2L4M A;  3GF2 A;  1J2X A;  3I54 A;  2EJR A;  3C7J A;  2GXB A;  4WCG A;  3WTX C;  3HRU A;  3JSP A;  4IPA A;  2F5C A;  3CO7 C;  2K86 A;  2M45 A;  3CUO A;  2A69 F;  2J5O A;  2WTE A;  2DW4 A;  6PAX A;  4WX9 A;  4PGG A;  3M8F A;  3LA2 A;  3IKV A;  3HRM A;  5L3D A;  2BE5 F;  1SMY F;  1PP7 U;  1ZLK A;  2Q2E A;  4RB2 C;  1B6A A;  1ZAR A;  1IXS B;  4I02 A;  2BBY A;  2RVC A;  1USS A;  5L3B A;  2CSO A;  3O3K A;  1FSH A;  3V8L A;  4B09 A;  5E1Z B;  3F6V A;  2VE8 A;  2XGX A;  2G9W A;  3C1D A;  2MBF A;  4ON0 A;  2DK8 A;  1R58 A;  2AXL A;  3EDP A;  2FOK A;  3WU0 A;  3QRF F;  2Y48 A;  4BNC A;  3PQJ A;  3E5Q A;  1G3S A;  1DP7 P;  2F2E A;  3N4M A;  3E6C C;  4N9H A;  2HS5 A;  2ESH A;  4WXH A;  4ENK A;  3FXU A;  1FBU A;  1RIO H;  3I59 A;  1YG2 A;  5TJJ A;  2A07 F;  4A0X A;  1R36 A;  2J5P A;  4BAY A;  2MA3 A;  4HF1 A;  4L0Y B;  2FU4 A;  3E3V A;  1OMI A;  3I59 B;  4QLC U;  1FY7 A;  1XDU A;  4Z2Y A;  1IAW A;  1H0M A;  2BEO A;  3IWF A;  4RB1 A;  4LK0 F;  5CVI A;  5K1Y A;  1XGO A;  2UZK A;  1H9G A;  3KP5 A;  2P7C B;  4G8X A;  3MEX A;  1EH6 A;  5DD8 A;  5KK1 A;  4KYW A;  3SFZ A;  3ABU A;  4HYE A;  4M9X A;  3E6B A;  4MEY F;  2RC4 A;  4UNO A;  2XAF A;  1QBJ A;  2JRT A;  2DQL A;  4JBA A;  3ERE D;  1W7P B;  1TBX A;  2NNN A;  2OU2 A;  3J80 K;  3I53 A;  1BIA A;  1R1T A;  1J7K A;  1FWZ A;  2P6S A;  3MZH A;  1PP8 F;  2XAS A;  3F8M A;  5D5V B;  5E1W A;  1GXP A;  4G7Z F;  3JTH A;  2F5F A;  4U88 A;  4EJV A;  5ICE A;  4A12 A;  4YFN F;  3G73 A;  3HHG A;  2FBK A;  4XLN F;  1G6N A;  2MLG A;  4HV6 A;  2K27 A;  1ZLJ A;  3IHU A;  3ECO A;  2KIU A;  1FP2 A;  2RGV A;  5LGU A;  3LQR A;  1SMT A;  5EEH A;  2IA1 A;  5F1R A;  1O3S A;  4BHC A;  4HX4 A;  5CLS A;  2PMH A;  1SD4 A;  2COM A;  4IXA A;  4EGY A;  1YLF A;  2ZKZ A;  2DT5 A;  2IPQ X;  3DEU A;  1SFU A;  5CVR A;  4PGH A;  2GIV A;  1PDN C;  3VOD A;  1IZ1 A;  1DDN A;  1PUE E;  3O6B B;  1ZRE A;  3NRV A;  1XGN A;  2HR3 A;  1FT9 A;  1UHW A;  4HA8 A;  3K1N A;  3L7W A;  4I98 B;  2Q0O A;  3D5L A;  3SHF A;  1DPR A;  5AIP A;  1OYY A;  1GXQ A;  4ENJ A;  5CJ9 A;  1KQ0 A;  2EV6 A;  4LLL A;  3WE3 A;  5HS8 A;  3DP7 A;  4WXD A;  1FX7 A;  3FMR A;  4RGU A;  2VT2 A;  5LLQ A;  3V8K A;  2D1H A;  3K1M A;  4OMY A;  1QZY A;  3ZMV A;  4IHS A;  1P4A A;  1Z9C A;  4CHU A;  2L3D A;  4MTE A;  1YO5 C;  3RIR A;  3GFJ A;  5LGT A;  2RV8 A;  3WTW C;  1S3J A;  2DBB A;  3JSO A;  5FFZ A;  4UUV A;  3EET A;  2DU9 A;  5LEK A;  4KIB A;  2O61 A;  2DQR A;  2W25 A;  4PDK A;  1QGP A;  1ZYR F;  5H6Q A;  2CG4 A;  1S29 A;  5E1X A;  3GZ5 A;  5ICF A;  2Z99 A;  1D5V A;  4U0V A;  2VC1 A;  3TKY A;  4ZZL A;  2PI0 A;  2IRF G;  2XAJ A;  3BZ6 A;  3H3Z A;  2PMU A;  2QBY A;  2F5E A;  1R7J A;  1ZHF A;  2QEN A;  4RB3 C;  2BYV E;  2WV0 A;  2HDC A;  1P92 A;  1KYZ A;  2GAU A;  5JR3 A;  1U2W A;  4LG0 B;  3BDD A;  4IVN A;  2DLL A;  3TDZ C;  4I09 A;  4HX7 A;  3BPV A;  4IRH A;  1LEA A;  2JZY A;  4ASN A;  3FX3 A;  1I6X A;  1Z6R A;  3M8E A;  4HDV A;  1CGP A;  1IXC A;  5LHH A;  1EH8 A;  1FSE A;  5DCF A;  4EM1 A;  4MNU A;  5LBQ A;  5K5Q A;  5JFR A;  5F6F A;  2KRF A;  2K7L A;  1FYL A;  2H09 A;  3W6K B;  5ILS A;  1WWX A;  1MJA A;  3Q9V A;  4OOI A;  3E6D A;  2VE9 A;  4M6X A;  2QQA A;  5CVV A;  2IW5 A;  1YYV A;  1IN6 A;  2C6Y A;  2QZ8 A;  2FE3 A;  2HGC A;  4GCV A;  3LAJ A;  1AOY A;  1TQM A;  4AIJ A;  3QPT A;  3T0Y A;  3R6S A;  4RGR A;  3QU6 A;  1CF7 A;  2DO7 A;  4UVC A;  5JHU A;  1ZRD A;  5J8C A;  3VEP A;  3IL2 A;  2WC2 A;  4L9V A;  4A6E A;  4LFU A;  4E70 A;  2XRN A;  1TTY A;  3LA7 A;  2LDU A;  2D1V A;  4MEX F;  4ESJ A;  5ILU A;  5LGN A;  1CF7 B;  1XGM A;  1U5T B;  4OIQ F;  2VN2 A;  2ZNY A;  1H9T A;  5HLI A;  5D6E A;  4IRI A;  4RAZ A;  3FF5 A;  1LDJ A;  3CUQ B;  2KJB A;  2VT3 A;  5CVU A;  2WWY A;  2HZT A;  3F22 A;  5D8L B;  1D8J A;  2NNY A; 
#chains in the Genus database with same CATH topology
 2Y30 A;  4KN7 X;  1MNE A;  1WHU A;  1IC8 A;  3CD6 I;  2R5Z B;  4XLE A;  1RKT A;  4KUM A;  2MH9 A;  2CRG A;  3NWT A;  1RRJ A;  4A3G J;  2IS2 A;  2CS3 A;  2L5Q A;  1YE9 A;  3H5A A;  1R6R A;  4IQJ A;  5D8K B;  2DDA A;  2EBI A;  2KZV A;  2WB1 N;  1I6H J;  2RAE A;  1JTX A;  4V2G A;  1H88 C;  2H94 A;  1WPK A;  1GHC A;  4DZJ A;  4GO1 A;  4ZDO A;  3JR9 A;  2XUB A;  1BL0 A;  3PO2 J;  4HDU A;  3OR2 C;  5ICC A;  3W2A A;  1D8K A;  1MDM A;  2BVL A;  1ON1 A;  1ETW A;  2EK5 A;  2FNA A;  3QPH A;  4FE7 A;  3PSI A;  4P9F A;  2B63 J;  2DK5 A;  1YW9 A;  2W00 A;  3VYR B;  2HEO A;  4CUG A;  3QYE A;  3VFZ A;  4KNY A;  1UCR A;  2DYS H;  4W97 A;  1QO0 D;  4HQE A;  3GW2 A;  3TED A;  1DU0 A;  3A01 A;  1SFE A;  2EZI A;  5L3C A;  2KFD A;  2P5V A;  1UHM A;  2V1N A;  1UAA A;  2K9N A;  4OWR B;  2MD5 A;  3V7S A;  1OKR A;  3TOB A;  2IA2 A;  4UV8 A;  1POG A;  3MZ8 A;  3T5X A;  2RKH A;  3PSF A;  1OCP A;  3RYR A;  3LA3 A;  1NG7 A;  3A0H C;  3LNQ A;  1BI3 A;  4CSW A;  4G12 A;  2L2O A;  3CDH A;  4XNF A;  2OQG A;  3I64 A;  5FKN A;  2V4J C;  4BAC A;  4CDG A;  2VON A;  3SYT A;  3MN2 A;  1KZH A;  2R93 J;  4DQ2 A;  1R00 A;  1J75 A;  3JRE A;  1XB4 A;  5B3S H;  4RGS A;  1X1A A;  1RUO A;  2FA5 A;  1OFC X;  1T98 A;  4XOP A;  5DEQ A;  4E6K G;  2L9R A;  4EJU A;  3WE2 A;  3OR1 C;  1SD6 A;  3BG7 A;  3LSI A;  4RMN A;  3E5U A;  5DTD A;  1U6G A;  1MGT A;  2EZL A;  3HOZ J;  3T8R A;  1RKW A;  4YII A;  4IRG A;  4HNV A;  2JA6 J;  2VI6 A;  3BPX A;  3KP6 A;  3GTG J;  2EB7 A;  3RI4 A;  1I3A A;  4A5N A;  4CCL A;  1S7O A;  2KIF A;  5DD4 A;  3ZQQ A;  5JLW A;  4A3K J;  2IXS A;  1FIP A;  1HW1 A;  3UNG C;  2MW8 A;  2QLZ A;  3W3C A;  1FYM A;  1B9M A;  1Z0X A;  3LAP A;  2VB6 A;  2XHK A;  2LY9 A;  5K7H A;  2XF7 A;  1REP C;  2X6W A;  2ZSH B;  3IAS 2;  4UUT A;  3W2V A;  1JKO C;  2VJI A;  2M0M A;  3S2W A;  3IRR A;  4EM0 B;  2W24 A;  4KFC A;  3LL7 A;  2DT6 A;  1BR4 A;  2KT0 A;  3FMS A;  1SFX A;  4P96 A;  3IWZ A;  1UEL B;  3OYH A;  5FLX K;  2JA5 J;  4OU0 A;  3VSK A;  1M1E B;  3WTZ A;  3ZXS A;  3P9K A;  1SFK A;  2HTS A;  2XC7 A;  1YIT I;  1T8I A;  2Y75 A;  3ASO H;  2LK2 A;  2L7K A;  3J7Y J;  2NVQ J;  2K02 A;  4QSH A;  2ADU A;  2OCC H;  1ZTR A;  2KKO A;  1R5H A;  1W36 D;  1K4S A;  4KA4 A;  3BJA A;  1HDP A;  4QPO A;  1ZRC A;  2HTJ A;  3F23 A;  1FBQ A;  1TWH J;  3ABM H;  4I2O A;  2GQQ A;  4RM2 A;  5LHI A;  3AG1 H;  4BKX A;  1E0E A;  2L02 A;  1D1A A;  5KHD A;  1DGR M;  2CV0 A;  2AQF A;  3FHZ A;  4BJ5 C;  3S15 J;  5DYM A;  1A04 A;  4MHG A;  1LQ1 A;  4XLP F;  4HQM A;  3F8F A;  1L0O C;  3BTC A;  5FO5 A;  2OPT A;  4IO9 F;  1O7L A;  2EV5 A;  2XGE A;  3E0J B;  2A05 A;  1LB2 A;  4G6Q A;  1FPQ A;  2NYX A;  2OAZ A;  4AU7 A;  4I76 A;  2KZG A;  3S1M J;  3HYI A;  3GWZ A;  2HVS A;  2GA2 A;  3HGY A;  2JSC A;  2STT A;  3H1C A;  4A2U A;  2I5U A;  3QOE A;  4LJZ F;  3FMQ A;  2CFO A;  1VFC A;  1MD0 A;  1TWC J;  2QM3 A;  2QKM B;  1V5E A;  1QZZ A;  2GLO A;  1E3P A;  2DN0 A;  1QNT A;  3ZQF A;  2OF7 A;  2K5C A;  5L3G A;  5GAG J;  1ZR4 A;  1XCV A;  2YSR A;  4E7S A;  1N75 A;  4FT8 A;  4U7B A;  4CXF A;  3S1R J;  2L4A A;  1B1B A;  1HDD C;  1IN7 A;  3JCU C;  4L5I A;  2R7D A;  3A0B C;  1J59 A;  2QQB A;  2ZME A;  4M3G A;  3OYA A;  5HLT A;  1D3Y A;  3G6E I;  3RKW A;  3BC8 A;  3S1N J;  2DOA A;  4RLQ A;  5D6F A;  5BS6 A;  2P5L C;  1J9I A;  3TMO A;  2G7U A;  5K7Z A;  4U87 A;  3AG3 H;  4UVB A;  2O7O A;  2LY1 A;  3VSL A;  3T1B A;  5CQG A;  2V6E A;  2VBW A;  1IN4 A;  1HKQ A;  3K7A J;  1TNT A;  2Z9O A;  2O3F A;  2BY3 A;  1W7P A;  3F9K A;  3KZI C;  3H9G A;  4IHY A;  4XMY A;  3JRG A;  4E7Z A;  2GXG A;  2ZME B;  2CWE A;  2VQC A;  3K69 A;  4M3E A;  3SZG A;  4E4H A;  3I58 A;  1XX5 A;  1HW2 A;  2DMU A;  2QF7 A;  1YW8 A;  2CUE A;  3RDI A;  2W57 A;  2HDW A;  3I5U A;  3RKX A;  2HKO A;  5K5O A;  4H0E A;  2ZXJ A;  3U2R A;  1LE8 B;  2IT0 A;  1YS6 A;  4F92 B;  2V26 A;  4M9S A;  4IHW A;  1OCT C;  3HSE A;  1NG6 A;  3DFG A;  3KYC B;  1ETQ A;  1TQI A;  3HC7 A;  2BXZ A;  5IPA A;  3GX4 X;  4IOA F;  3BG3 A;  4ENN A;  4L5E A;  1WKM A;  2ACJ A;  4MFD A;  1FMV A;  1X4O A;  2H6B A;  2CQK A;  2MLK A;  2VJ4 A;  1MMD A;  2L7F P;  1ULY A;  2E1C A;  1P4X A;  2E34 A;  2P0W A;  3PM1 A;  4LD5 A;  1O3Q A;  2ECC A;  5TRD A;  2KDZ A;  4QWQ A;  3SQN A;  5HNF A;  2WV1 A;  5BOX A;  2VXZ A;  2Z3Y A;  3OYK A;  1FTT A;  2R3S A;  2XAH A;  3A1Y A;  3OV8 A;  2V7F A;  4HV5 A;  2CGP A;  3BRO A;  4A5M A;  2XAQ A;  1E2X A;  1U8B A;  2MSY A;  2LLK A;  2EPF A;  1TZL A;  5HNH A;  1TW2 A;  2R7S A;  1XGS A;  3RTR A;  4R8H A;  4BQQ A;  3O8G A;  4AIH A;  3CC2 I;  5HOO A;  3MWM A;  3RZD J;  1Z67 A;  4RB0 A;  3CMY A;  5L3F A;  2BXY A;  5FLX Z;  4I6Z A;  1IRZ A;  3T8T A;  3TW7 A;  3E5X A;  2GA1 A;  1MMN A;  5EZG A;  3HIF A;  2DOE A;  4XRF A;  5HDN A;  1QRY A;  1U5T C;  3BP8 A;  2FMY A;  3G2B A;  2CV2 A;  3SZT A;  3S14 J;  3GTJ J;  3K4J A;  4HAM A;  3BZK A;  5J4Y A;  1SAN A;  1NH3 A;  3SZP A;  3KPH A;  3CCV I;  4YFK F;  3R0A A;  4FAS D;  4CGZ A;  4UV9 A;  1TNS A;  2ISY A;  2QGU A;  3KP2 A;  2OA4 A;  4BXF A;  1ZRF A;  2K3P A;  2Y0S A;  5K7F A;  4N9I A;  1YTY A;  4XLA A;  3CME I;  3H9Q A;  1MZB A;  1RNL A;  2LD5 A;  4WXC A;  3DEW A;  1ZH5 A;  2Q1Z B;  2X1D A;  1WJC A;  3KCC A;  4QIW N;  2AQE A;  4C30 A;  3KET A;  3M07 A;  1TT0 A;  2OQR A;  1O4X A;  2HKX A;  1ON2 A;  3K1P A;  2ZCW A;  1RES A;  2QSF X;  3OY9 A;  1VQ7 I;  2ELJ A;  1BI0 A;  5ILV A;  2IGK A;  5IT9 K;  2NOJ B;  5AIQ A;  2ZJQ F;  2DA4 A;  2X48 A;  1W0T A;  4EAT A;  5FLV A;  3AAF A;  4L9T A;  1FMW A;  1T56 A;  5CYV A;  4M71 A;  2A3S A;  3M1E A;  4WF2 A;  2LF8 A;  2H1L A;  3WTU C;  2V1U A;  1TLH B;  3NAU A;  4Q48 A;  1RI7 A;  4LK1 F;  3S3O A;  2FF4 A;  2EV0 A;  1YQA A;  1V5F A;  2IJL A;  2F48 A;  3Q5F A;  2GZW A;  3FIS A;  1MBH A;  4O5V A;  3WU2 C;  1JUM A;  2FSW A;  3COA C;  3QWL A;  1PUF A;  1JKR C;  1ONV A;  3DPU A;  3GTO J;  3B73 A;  2WB1 A;  3H9J A;  4CCJ A;  1BJA A;  3JW4 A;  1VTN C;  1WQ2 A;  3K4B A;  4LB6 B;  3DV8 A;  4A3E J;  1U8R A;  2CUJ A;  1O7F A;  4A3F J;  3CO6 C;  2VJJ A;  1HOM A;  5L3E A;  4M73 A;  1ZG1 A;  4AYB N;  5ERI A;  3HZJ A;  2LTP A;  3V7R A;  2K85 A;  1PUF B;  4OIR F;  2DI3 A;  2VBY A;  1B8I B;  1G3T A;  3A03 A;  3LOC A;  5E18 F;  2R7X A;  4DYR A;  3H92 A;  3KZZ A;  3IKT A;  1FOK A;  1WJB A;  4FCY A;  2A5Y B;  3DXJ F;  4OMZ A;  3DU5 A;  4EVI A;  1BC8 C;  2X51 A;  4RDU A;  4EEF G;  3VOE A;  1OR7 A;  3P9I A;  4LG0 A;  1KU7 A;  3RZO J;  1JKP C;  3ZMU A;  5IP9 J;  3RKQ A;  2TDX A;  3CCL I;  1AHD P;  1X3Z B;  5KAI C;  2JA2 A;  4W1U A;  1ZG3 A;  4Y52 J;  2W84 A;  3IAM 2;  3C2B A;  2KIS A;  4XRS G;  1XD7 A;  4I0A A;  4ZYE A;  1LNW A;  1X2N A;  5CKT A;  3GFM A;  5GAE J;  1T38 A;  2P8T A;  1IW7 F;  3B02 A;  2V9V A;  1MKM A;  1BR2 A;  1FBS A;  3KP3 A;  4PJJ A;  5E8G A;  4C9Y A;  1ETY A;  2QUF A;  3F72 A;  1BOA A;  3ML6 A;  1XMX A;  3HJE A;  1WH7 A;  4BXX J;  1W1W E;  4HSR A;  1WI3 A;  2A6H F;  3M1C A;  3JRH A;  1EJ9 A;  2CUZ A;  1MBF A;  3R4K A;  4B1R A;  2PBI A;  3ERM A;  3EUA A;  1HA8 A;  4N0B A;  1SVM A;  2Z33 A;  1RR8 C;  1TWG J;  3MMY B;  5JI6 A;  4DIQ A;  4HX8 A;  3RJP A;  1QA6 A;  1OPC A;  1BI2 A;  2HYG D;  4X1E A;  2M30 A;  3MCZ A;  5J8F A;  4EGZ A;  2JK3 A;  4LIV A;  4S05 A;  1WJ5 A;  2LR8 A;  1YHQ I;  2ESN A;  2DAO A;  2XF5 A;  2Z16 A;  3WGI A;  5A2Q Z;  2VPR A;  2PJR B;  2DMT A;  4CO8 A;  4DYQ A;  1MNM C;  1GLN A;  5EEG A;  3K4C A;  2UUZ A;  2K9M A;  5HDG A;  1JJ6 C;  2E5N A;  3VPR A;  3KX2 A;  3W6J B;  1XPX A;  1XTA A;  3S93 A;  3S17 J;  1F36 A;  3M9A A;  1S8N A;  3KP7 A;  1ZAO A;  4KJZ A;  1R4M B;  3ECH A;  4LOC A;  1WRJ A;  1TP4 A;  5DUI A;  2K9S A;  2WY7 Q;  3OIQ A;  1WZ2 A;  4OIP F;  1U9O A;  1Y0U A;  5ICG A;  2VOO A;  2ELK A;  3NQO A;  4AIK A;  1H89 C;  5J40 A;  4XK4 A;  1TT5 B;  3TW6 A;  1FC3 A;  2YX7 A;  2CFX A;  4UUS B;  2M7A A;  4LIU A;  4Y4R A;  3K4M A;  2W7N A;  4UB8 C;  3H0D A;  2LY2 A;  5H20 A;  5IP6 A;  2DOF A;  3WTT C;  1VQ8 I;  2F5D A;  1BJZ A;  3KE2 A;  2O0Y A;  2K9L A;  3HUG B;  3ZMZ A;  2JPB A;  4BS9 A;  5IYD J;  5LRS A;  1OQY A;  1U5T A;  1F1Z A;  2OV7 A;  3HL2 A;  5LEJ A;  1W0U A;  3S32 A;  4F7Z A;  5IT9 Z;  2BW3 B;  4LG3 A;  1GV2 A;  4L0Z B;  3M8J A;  1HC8 A;  1BI1 A;  2O5R A;  3QP5 A;  2ELH A;  4PFP A;  3O8H A;  4XM3 A;  1X4P A;  2AXT C;  3MZY A;  3CUQ A;  4AWX B;  4IF4 A;  3LSH A;  1DUX C;  4S04 A;  1D0Y A;  3BJ6 A;  2BZT A;  3IC7 A;  3P5J A;  9ANT A;  2A6E F;  2OZU A;  1WJD A;  2NVU B;  2XF6 A;  3PUB A;  3S1Q J;  3TO9 A;  4KMU X;  4JQF A;  2ETH A;  3ZRG A;  1KON A;  2GBY A;  3ISP A;  3W2W A;  2ZO4 A;  1K79 A;  4P5O A;  2OD5 A;  2L7Z A;  3BT9 A;  3QPL A;  1TWF J;  1WFX A;  4N4O B;  2R5Z A;  1L3L A;  1MSF C;  2DPD A;  2DMQ A;  4NUB A;  2OCE A;  1X3W B;  3FM5 A;  2JJ7 A;  4M6V A;  2CQN A;  4KT6 A;  4XKC A;  2IEK A;  2DFF A;  3UR3 C;  1ITY A;  3R0J A;  2HPI A;  2H27 A;  2LP0 A;  4G9Y A;  4LGW A;  5E3L A;  5IYB J;  4S0H B;  4CH7 A;  2GM4 A;  1EV7 A;  4DJA A;  5D4R A;  4NB5 A;  3NEU A;  3I0T A;  4AID A;  3RKY A;  1Z1D A;  4B43 A;  1U0J A;  3F21 A;  2M87 A;  4G94 A;  1ZKG A;  1I5Z A;  5FJ8 J;  4CZC A;  4GYI A;  2IA0 A;  4D7N A;  2M5W A;  3D5S C;  2DTR A;  3QYB A;  3CCY A;  3CJN A;  4BH9 A;  2HYJ A;  1IO2 A;  1T95 A;  2EIK H;  2RN7 A;  2O8X A;  3LSM A;  3ZQ7 A;  4XLH A;  1JE8 A;  2QKL B;  3PNT A;  2ZME C;  4B3A A;  1XDS A;  4F55 A;  2HU9 A;  5BPD A;  4E7J A;  1STZ A;  5GP9 A;  1F5T A;  2BHY A;  3IP4 B;  2AS5 F;  2HVQ A;  2E1N A;  2VJ5 A;  1Z3Y A;  3SEZ A;  1B72 B;  1S6L A;  2R7F A;  3ZMT A;  5M5X J;  1XSV A;  1A6I A;  3Q9S A;  1FOY A;  4DBR A;  4YEL A;  1ETO A;  1K6Y A;  4BQO A;  3HSF A;  3ZMD A;  4UB6 C;  4AM3 A;  2HQR A;  5C4J J;  3WTS C;  3LSR A;  2HPM A;  3HTU A;  4DBQ A;  3NWS A;  4HOB A;  4Y33 A;  1QVT A;  2M34 A;  1K83 J;  4PJL A;  3ZR8 X;  2PLY A;  3PFI A;  1R71 A;  4LLN A;  5FLM J;  2JVH A;  5LHG A;  2XAU A;  5E3N A;  1QPI A;  2BGC A;  3L2W A;  2FBH A;  4G6D A;  3QPS A;  4GGG A;  5J6X A;  1HQC A;  4UHT A;  4UXN A;  4YIF A;  2HYF A;  4CA0 A;  1VQ9 I;  3TQN A;  3LFK A;  2F4O B;  2W82 A;  2Q8K A;  3HKZ N;  2VAS A;  3L2U A;  1FLI A;  4BGD A;  1T0F A;  1ZG5 A;  4EJO A;  4V2F A;  2JMW A;  3DCF A;  4FE4 A;  3FXR A;  2K40 A;  2ICW G;  3R60 A;  2OZ6 A;  5EF6 A;  1HBX G;  4CYC B;  4A0Y A;  2NOG A;  2IBD A;  1BBY A;  4DGW B;  2QA4 I;  3C18 A;  3FXO A;  2WAD A;  3BY6 A;  3OSF A;  3DF8 A;  2E19 A;  2EFQ A;  2LNB A;  5F27 A;  3DLL F;  5E20 A;  1JHF A;  4AD9 A;  2X6O A;  4ANJ A;  4EJT A;  4WWC A;  3RPU A;  3ZQI A;  4BE0 A;  3BR2 A;  3MAJ A;  4JK1 X;  3KEO A;  5FGM A;  5DDG A;  4IKF A;  1VND A;  1NHA A;  4BU2 A;  2HZD A;  4MO7 A;  4KDP A;  3CCJ I;  2K9Q A;  2LF7 A;  2VKV A;  4IL6 C;  1SAU A;  1T39 A;  1E3H A;  3J7A O;  3HTS B;  2DFI A;  3HBL A;  3GLX A;  2DMN A;  4KIT B;  1R1V A;  2FOW A;  4X0G A;  1K78 B;  4CCM A;  3QOD A;  4UVA A;  3D5R C;  2V1D A;  3G1L A;  2EFO A;  1FYK A;  3HOV J;  1AU7 A;  3WTY C;  5BMZ A;  2KLO A;  3KLO A;  5IYC J;  4NQW B;  4D1Q A;  1MMS A;  3BR3 A;  3MFK A;  1KA8 A;  4HF2 A;  1VQN I;  2R92 J;  2X9D A;  1UG0 A;  4PZJ A;  4BHB A;  5D5X B;  3I4N J;  3K2Z A;  2VC0 A;  4F91 B;  2M8E A;  3P9C A;  1FOX A;  2HOE A;  2VOD A;  1SAX A;  3PFY A;  4HZF A;  2P7V B;  1IV6 A;  1TC3 C;  1SVL A;  4ZYD A;  3GXO A;  3JRF A;  1WI9 A;  2X0L A;  2QYO A;  2ME6 A;  5ED4 A;  5M5W J;  2L0K A;  2XIG A;  3OIO A;  4KIG A;  1LDK B;  3GO5 A;  1UMQ A;  3U21 A;  4HNT A;  2R5Y A;  2H6C A;  3F8N A;  3L2R A;  2JN6 A;  4RGX A;  2W85 A;  4IHX A;  2GOX B;  2IVM A;  5HLG A;  5D5U B;  2OTJ I;  2KDO A;  3S2D J;  4HLX A;  1K6O A;  1Y0N A;  1JTY A;  3FKI J;  5HOD A;  3HB9 A;  3BG5 A;  2XV4 S;  2JT1 A;  4L5J A;  1A35 A;  2DJI A;  3BJO A;  5IY5 H;  3F8C A;  4D5C A;  2F5V A;  2LSO A;  1Z7L A;  1VZ0 A;  3JAM K;  2HWV A;  2VQL A;  4I7H A;  3KIO A;  4PUS A;  2R4G A;  2R5Y B;  3GLL A;  1FEX A;  4HW0 A;  5F0H A;  4BQN A;  3DU6 A;  4HLY A;  3OL3 A;  5HLH A;  2UXX A;  1G3Y A;  2EFP A;  1BM9 A;  3F8B A;  4R79 A;  4CYD A;  3MKW B;  4Q5S F;  1JT0 A;  3LST A;  4F52 A;  1KU9 A;  3OYC A;  2LKX A;  4ESB A;  5CQE A;  1RZ4 A;  3BR5 A;  4C2U A;  4XRM A;  4IHT A;  2VUM J;  1R4N B;  3K10 A;  2O9L A;  3KEY A;  5J1Y A;  2Q2E B;  4HF0 A;  4RAG A;  2DMP A;  4IJA A;  1JXS A;  4AYB A;  4FET A;  2XSJ C;  4ZYA A;  2DJN A;  5KVR A;  1YRN B;  4YG2 F;  1FZP B;  4MGR A;  2VBX A;  5HS7 A;  1FIA A;  4CCN A;  5FRN A;  3RYP A;  5B5E C;  4OIN F;  1ZR2 A;  1D0X A;  4XN3 A;  3RPU D;  3BLY A;  3CJR B;  3OYI A;  3H0G J;  2BY0 A;  2HQN A;  2PFB A;  3I3L A;  1R22 A;  1XMK A;  2XAG A;  3JRB A;  2EA4 A;  3CC4 I;  2CW8 A;  1S7E A;  4ZYH A;  4C2T A;  3BCB A;  4KIS A;  2ZFW A;  4BBS J;  1FP1 D;  2MG4 A;  1Y56 A;  4AUX A;  1OR7 C;  1JKQ C;  2XKO A;  1Q1H A;  2D45 A;  3GYH X;  2FNP A;  3HGG A;  3RPQ A;  2QVO A;  1LE8 A;  1ODD A;  1FOW A;  1XCB A;  2X6X A;  1P2F A;  2NAZ A;  1IJW C;  1U78 A;  2R7R A;  4RAF A;  3QYF A;  1HF0 A;  1MBG A;  4N4N B;  1IRF A;  1VQL I;  2ZXI A;  4GXO A;  4IQ4 A;  3MKY B;  4A0Z A;  3AL0 C;  1P4W A;  3TBI A;  2KRH A;  1MH3 A;  1NK2 P;  5CVJ A;  2HFH A;  5E3O A;  2HI3 A;  1SC7 A;  4A3D J;  1IF1 A;  3QAH A;  2ID6 A;  3ZQH A;  4KN4 X;  2P5K A;  2E2I J;  3LQQ A;  4I0B A;  2ZJ2 A;  2D2W A;  3O2P E;  1DU6 A;  2VLA A;  4ZZD A;  2R7Q A;  4M3D A;  4PSX A;  3REO A;  3TP0 A;  5AON A;  1YJ9 I;  1TL8 A;  2FX0 A;  4BXU A;  5KAF C;  4B4C A;  5B66 C;  2JWT A;  4NC6 A;  2WY8 Q;  3MKZ A;  3A2K A;  4BYY A;  5JVG F;  3DKW A;  3DEE A;  3H35 A;  4PK4 A;  1FTZ A;  1BC7 C;  1HW5 A;  3AKZ A;  3G1O A;  5J1R A;  1ETV A;  2QCO A;  4DNC A;  1BW6 A;  3GUD A;  3GZ6 A;  3OS1 A;  3WG7 H;  1BW5 A;  2M2E A;  4EJW A;  3TL4 X;  5EGO B;  2LBF B;  2V1X A;  1R9T J;  2FML A;  2KPM A;  5JVT A;  3WU1 B;  3KFW X;  4PCQ A;  4ABZ A;  3ZPL A;  4TV7 A;  1ETX A;  5IOZ A;  2VKH A;  1R1U A;  3DPT A;  3OYG A;  2DPU A;  1I27 A;  3FHN A;  5E17 F;  5HDK A;  2XGC A;  5A2Q K;  1IUY A;  1P6R A;  3PQK A;  2KL4 A;  3GVA A;  2X4H A;  3KLN A;  1ZGW A;  2CQQ A;  2YX4 A;  3I4P A;  4XQF A;  1IN5 A;  4HBL A;  1SD5 A;  2KMU A;  5EG0 B;  1G2H A;  1V3F A;  3DBH B;  2N8G A;  1GV5 A;  4M74 A;  1Z91 A;  3WGH A;  3V4G A;  4A3B J;  2E71 A;  5D4S A;  4MIM A;  3ABT A;  4QTR A;  3CP2 A;  3K6G A;  1HLV A;  2L9S A;  4KT5 C;  5HS9 A;  1FNN A;  2CO5 A;  1XMA A;  3L9F A;  4P9U A;  5F08 A;  1B4A A;  4MTD A;  3TO7 A;  4M6Y A;  2EZH A;  1Y39 A;  1TQP A;  2DA5 A;  3NAR A;  1QPM A;  4BDZ A;  1Z7U A;  2NVY J;  4A3L J;  2VQG A;  1J0R A;  1ORK A;  5FFX A;  3JAM Z;  5FB2 A;  3CUQ C;  5F64 A;  1T6S A;  4XIC A;  1G8X A;  2O6G E;  4YRV A;  1C0W A;  3VYS B;  1YFH A;  2BV6 A;  1KQ8 A;  1JHH A;  2QSH X;  3EUH A;  1KYW A;  1IN8 A;  3V7C A;  2FBI A;  2Y9Y A;  2IP2 A;  2NVT J;  2LG4 A;  2YR2 A;  5FD6 A;  2Z1D A;  4M9Z A;  3L2Q A;  1O3T A;  4CZZ A;  3CJQ B;  2IS1 A;  4PJ0 C;  2O03 A;  3ZN0 A;  4OAY A;  2EFW A;  1MMA A;  4O6J A;  1LPQ A;  2NS7 A;  3K2A A;  1JGS A;  3LWF A;  4XBF A;  3RCO A;  3A4C A;  3HDD A;  1W7P D;  5DUK A;  4PSW A;  2LC2 A;  1YW7 A;  2HNH A;  2QQ9 A;  3MKL A;  3TDU C;  2GXA A;  2A68 F;  5KCM A;  3QP6 A;  2W4S A;  1X3U A;  2KHM A;  2JVG A;  2M3A A;  1SFO J;  2NS8 A;  1IRG A;  2QWW A;  1XG1 A;  4M3F A;  1EH7 A;  5E79 C;  2PG4 A;  1MBJ A;  4XSX F;  1F4K A;  3FWE A;  4KMF A;  2HOT A;  3HRT A;  1YI2 I;  2V6C A;  4FIS A;  2EZK A;  3H5N A;  1B8I A;  2YPR A;  3ZQC A;  3D0S A;  5D5W B;  4Y13 A;  2E2J J;  4IZZ A;  2V9P A;  4OAZ A;  2RDP A;  3CTA A;  2L54 A;  3G3Z A;  2P6T A;  4YIR X;  1BN5 A;  3ROU A;  5E8I A;  1ZN2 A;  2PMZ N;  4L9J A;  3ZGK A;  3OYE A;  2BY2 A;  3DQV C;  1PYV A;  2G7H A;  3I9V 2;  3H3U A;  3KEQ A;  4EM2 A;  4HNU A;  5FKO A;  3C3W A;  5LRR A;  5J47 A;  1Y1W J;  1VQM I;  3OYF A;  2STW A;  1R23 A;  2CW0 F;  1JJ8 C;  3ZQL A;  2B0L A;  2UWM A;  3F6O A;  2XKP A;  1XN7 A;  4ZDP A;  3WHB A;  1Z6T A;  2GWR A;  3QU3 A;  4MLO A;  2MC3 A;  3K9T A;  2B9S A;  5GTI C;  1MJB A;  2JPC A;  3U1D A;  4U7D A;  3GTM J;  4KIF A;  4ZYG A;  1XSX A;  2PN6 A;  3TOA A;  1WSU A;  1S7A A;  2PQ8 A;  4LIT A;  3EQL F;  3M4O J;  1IRX A;  1T33 A;  3HKZ A;  3WTV C;  5BNG A;  3ELK A;  4B47 A;  5M3M J;  3SEQ A;  2MH2 A;  3V8J A;  1W5S A;  1I39 A;  4PJN A;  3OIP A;  1T0F C;  1MH4 A;  1RET A;  3BR6 A;  3HRS A;  3K4N A;  5FD5 A;  1YOV B;  4ENM A;  2WA0 A;  3E1S A;  3P7N A;  2VKE A;  4QPQ A;  4Y17 A;  2LOO A;  2E7W A;  2PJR A;  1IXR C;  4BQA A;  3CP8 A;  3EUK L;  2RNJ A;  1OYI A;  1KQ9 A;  4WK8 F;  2HXI A;  2M1B A;  3K0L A;  5DS9 A;  2XPW A;  4D0P A;  3PL8 A;  5BPI A;  4JP0 A;  2MAB A;  1P7I A;  1UB9 A;  3CLO A;  4L9N A;  5H6R A;  4B44 A;  2KJC A;  2A61 A;  4R1H A;  1O57 A;  1VQP I;  1LEB A;  3TO6 A;  2PJP A;  2ID3 A;  5BQT A;  2FUG 2;  5F0F A;  3J80 Z;  2LFB A;  3HHH A;  3OYN A;  5FKM A;  1W5T A;  3FIW A;  3C2H A;  3K4L A;  3WOD F;  1N25 A;  4EMS A;  3FZV A;  1SD7 A;  3BG6 A;  4ETS A;  5GPC A;  2PEX A;  4E7K A;  2L01 A;  1W4M A;  2XVC A;  3RQI A;  4JX4 A;  1DPU A;  2E1O A;  3GBG A;  4M72 A;  3HOT A;  1HSJ A;  3G1M A;  4UUS A;  2QBY B;  1YJW I;  1I3Q J;  1RUN A;  3GFI A;  1FJL A;  3OOP A;  4CCO A;  5IT3 A;  4HEA 2;  3LSG A;  2CV1 A;  1VQ5 I;  1ZK8 A;  5C44 J;  3DWL E;  3E6M A;  1UHS A;  3HUG A;  2VOP A;  4XSZ F;  3QOP A;  4DOZ A;  3S16 J;  1LDD A;  2VBZ A;  4YFX F;  2VIX A;  4Y15 A;  2BW3 A;  4BBR J;  4XL9 A;  3FXQ A;  3J81 K;  1LUJ B;  3BR0 A;  2K4B A;  1X1D A;  4I99 C;  3VYT B;  4O3M A;  3SFI A;  1G59 A;  1G4D A;  3DBL B;  1S72 I;  3Q0W A;  3CCE I;  4L18 B;  4IHV A;  3ZMS A;  1T08 B;  4ESF A;  3FXJ A;  1UST A;  3ZN1 A;  3CF2 A;  1B59 A;  1B9N A;  1VI0 A;  3E97 A;  3BQY A;  4GFB A;  3CJT B;  4CIC A;  3UKG A;  2TCT A;  1QQI A;  3ABK H;  2E7X A;  2RQP A;  4DYC A;  3U9G A;  2EWN A;  2Y31 A;  2JUG A;  2XRL A;  4GYG A;  2FQ3 A;  4FTH A;  4FX4 A;  4B8X A;  3BOQ A;  2Z5U A;  3IH3 A;  3V42 A;  5DM7 F;  2CW7 A;  1I50 J;  2E1M B;  1YX3 A;  2MYS A;  4FHT A;  4NHJ A;  3IRQ A;  3KZY A;  2Y9Z A;  4EV0 A;  3BZC A;  2Y0M A;  4A3I J;  3GCM A;  4F3Q A;  1IDY A;  2KIM A;  1HKS A;  1JGG A;  3FDY A;  5J1U A;  1F9N A;  3M7G A;  5GAH J;  1P9Q C;  4U0Y A;  2I10 A;  2JUC A;  3L00 A;  1QVU A;  3DLA A;  5B1B H;  1ZGA A;  4G7O F;  1GVJ A;  2EA2 A;  3FKJ A;  1BR1 A;  1Z05 A;  3QQA A;  4B48 A;  4AVZ A;  4EQQ A;  3S3M A;  3S2H J;  3BG9 A;  1V4R A;  1GDT A;  3K70 D;  1ZGJ A;  5F04 A;  3BWG A;  2K4J A;  2JTV A;  1JUS A;  2CYY A;  3E7L A;  2NNY A;  4I01 A;  3L2C A;  5DV5 A;  1LFB A;  2EIN H;  4Y7N J;  1U3E M;  2UXN A;  1B72 A;  1V54 H;  3ULQ B;  1NTC A;  4AVP A;  2NRA C;  1MBK A;  4DW6 A;  2M7B A;  3WG9 A;  2E35 A;  2MGQ A;  1K7A A;  3HOY J;  1I1S A;  1VQK I;  3I71 A;  2EIM H;  1X1P A;  1R5G A;  3PIP F;  1UFM A;  3TGN A;  2XRO A;  2IS6 A;  1N77 A;  4LB5 A;  3VDX A;  1MJ9 A;  2DA1 A;  2OBP A;  4ZTF A;  2CU7 A;  3KYD B;  4NC7 A;  1P7J A;  2RNG A;  3HSR A;  4ZTJ A;  5HVQ C;  4A93 J;  3Q0U A;  2F4M B;  4LLG F;  1Q1V A;  1XSD A;  1S9H A;  1TW3 A;  2AO9 A;  5TGT A;  3OS0 A;  1KU2 A;  1R5I D;  3F3X A;  1Y6I A;  3CES A;  4U0W A;  3OYL A;  2DOD A;  3PJR A;  2CMP A;  2JQ7 A;  4Q4Z F;  1W5C C;  4CYC A;  2FRH A;  2ISZ A;  2GIZ A;  3GTP J;  1KGS A;  3WGG A;  4D7M A;  3DPL C;  1J09 A;  2ZBK A;  4BHP A;  1BIB A;  1LJ9 A;  2YU3 A;  2DA3 A;  2L7M P;  1JI8 A;  1X2M A;  1GVD A;  1LFU P;  3SXY A;  2NS0 A;  2DT7 B;  1O3R A;  2DXI A;  3EPZ A;  1IDZ A;  1EA3 A;  2ZNZ A;  2M9H A;  3ZP5 A;  1DGW Y;  2OTL I;  2R7Z J;  4RAY A;  4G7H F;  3PNV A;  2R7W A;  3MQ0 A;  2HOS A;  3SDG A;  1OYW A;  1HXD A;  2IGN A;  4FX0 A;  4LMY A;  2V9K A;  1MDM B;  3CMA I;  1HKT A;  1YIO A;  3VB2 A;  5DCM A;  1GT0 C;  4ZH4 F;  3AFH A;  2P81 A;  1K78 A;  4P55 A;  1E17 A;  1MMG A;  3PO3 J;  2ECB A;  4MQ9 F;  1I1G A;  4RS8 A;  5K5R A;  3JTG A;  1AWC A;  1J5Y A;  3JRA A;  4NQW A;  4ZC3 A;  4BL0 B;  1YJN I;  2LKP A;  2X1E A;  5EJC A;  2EFN A;  3A01 B;  2VL8 A;  2P4W A;  2EIJ H;  2LRE A;  4MQV A;  1LVK A;  5DCM B;  3J81 Z;  2XPV A;  4RM3 A;  1HST A;  3GFL A;  2ZFU A;  3FXK A;  4K2E A;  2JA8 J;  2FXA A;  4OIO F;  3KP4 A;  1LVA A;  3R61 A;  3EYY A;  1V5G A;  3EYI A;  2V79 A;  1OJL A;  1YS7 A;  3FM3 A;  1KU3 A;  2W48 A;  4A6D A;  3N97 A;  4GRI A;  2FEZ A;  2M4G A;  3DTI A;  3HOS A;  3L09 A;  5JLX A;  1R49 A;  2R7U A;  1X1B A;  3DKX A;  2EH3 A;  2L9N A;  4P1W A;  4Q47 A;  2IGM A;  1G3W A;  2H8R A;  1T2K A;  4KIC A;  2L4M A;  3CQZ J;  3CMM A;  3GF2 A;  1J2X A;  4IEJ A;  3ZOB A;  1E3O C;  1XC5 A;  4J19 A;  4B3X A;  3I54 A;  3VYU B;  1V55 H;  2EJR A;  3H5R A;  2EQR A;  3C7J A;  3CF5 F;  4G6T B;  1BA5 A;  2GXB A;  3EUH C;  5H2F C;  4BUP A;  3FK7 A;  4WCG A;  3WTX C;  3B6A A;  3HRU A;  3JSP A;  2NXN B;  4IPA A;  2F5C A;  2VXD A;  3CO7 C;  2K86 A;  2M45 A;  4NC8 A;  2R7T A;  3CUO A;  2A69 F;  2J5O A;  2WTE A;  2DW4 A;  5JHF A;  2WBM A;  6PAX A;  3J7A Y;  1JT6 A;  4WX9 A;  4PGG A;  3M8F A;  1A31 A;  3LA2 A;  3IKV A;  3HRM A;  4DZP A;  5L3D A;  2BE5 F;  5DM6 F;  4MFE A;  1SMY F;  1U9N A;  1PVE A;  2WAF A;  2RRE A;  4C3J J;  1PP7 U;  2Q2E A;  1AKH A;  3JRI A;  2ZJR F;  1ZLK A;  4RB2 C;  1B6A A;  1ZAR A;  1YRN A;  1IXS B;  1UG2 A;  4I02 A;  5B1A H;  4Z6Y A;  1Z3X A;  1HCR A;  3CCM I;  2BBY A;  2RVC A;  1EKE A;  1USS A;  5L3B A;  2CSO A;  3OYM A;  3O3K A;  1FSH A;  2CJJ A;  3V8L A;  4B09 A;  4PJM A;  5E1Z B;  3F6V A;  2PMZ A;  2VE8 A;  2COB A;  2XGX A;  2G9W A;  3HPH A;  3C1D A;  4YEJ A;  2MBF A;  1ENH A;  4ON0 A;  2Y2Z A;  2LYC A;  1AKH B;  2DK8 A;  2E60 A;  1R58 A;  2AXL A;  3OYD A;  3DKY A;  3EDP A;  2LMD A;  1OCC H;  2HVR A;  2CH0 A;  2FOK A;  3WU0 A;  3QRF F;  3TP3 A;  2Y48 A;  4BNC A;  3PQJ A;  4ZJZ A;  5GAD J;  3E5Q A;  3JRD A;  4BY7 J;  4A3J J;  3FBN B;  1G3S A;  1DP7 P;  2F2E A;  3N4M A;  3E6C C;  1A36 A;  3W6V A;  1SVO A;  4N9H A;  4XLC A;  4A3C J;  2HS5 A;  2M4K A;  2QEX I;  4ZDL A;  2ESH A;  2RQQ A;  4BEH A;  3DTE A;  1QHH D;  4WXH A;  3CC7 I;  3GTL J;  3BTJ A;  4XOR A;  3IUO A;  4ENK A;  3FXU A;  5E3M A;  2BHZ A;  3SJM A;  1FBU A;  1RIO H;  3I59 A;  2IGO A;  2A6T A;  1X1C A;  1YG2 A;  4JX5 A;  5TJJ A;  3HG9 A;  4ITV A;  5KNL A;  1A5J A;  3BTL A;  4XR6 A;  2A07 F;  4Y3O A;  3BQZ A;  2QSG X;  2M8G X;  2ZXW H;  1ZEL A;  2HQA A;  1R36 A;  2JRM A;  2J5P A;  4A0X A;  2E2H J;  4BAY A;  2XDV A;  2MA3 A;  3WHC A;  2UV1 A;  3ZQG A;  1ACI A;  4BE2 A;  4RA2 A;  3GZN B;  5F1J A;  4HF1 A;  4L0Y B;  4BJ6 C;  3G4S I;  4BEH B;  2BOL A;  3K70 C;  4NBQ A;  3C2G A;  3CCR I;  2FU4 A;  3E3V A;  5TIS C;  1OMI A;  3I59 B;  4QLC U;  1FY7 A;  1XDU A;  2DA2 A;  4Z2Y A;  1IAW A;  2OUM A;  1JUP A;  2BVM A;  2JA7 J;  1H0M A;  3U1K A;  2BEO A;  3IWF A;  4RB1 A;  4LK0 F;  2XB5 A;  5EGO A;  5CVI A;  2LBF A;  5LD2 C;  2YUS A;  5K1Y A;  1XGO A;  1OLT A;  4II2 A;  2UZK A;  1H9G A;  3KP5 A;  5FKK A;  4C3H J;  1YIJ I;  1IGN A;  2P7C B;  5IP7 J;  4G8X A;  3MEX A;  3B6C A;  1EH6 A;  5DD8 A;  5KK1 A;  4KYW A;  3SFZ A;  3ABU A;  2EIL H;  4HYE A;  1OCZ H;  2E36 A;  2R7V A;  5C4X J;  4M9X A;  3E6B A;  4MEY F;  2RC4 A;  2XSD C;  4UNO A;  4J01 A;  2XAF A;  1QBJ A;  3ABL H;  2JRT A;  4M3B A;  2DQL A;  4JBA A;  3ERE D;  3OL4 A;  5EG0 A;  1W7P B;  3ZCO A;  2MC4 A;  1TBX A;  2NNN A;  2OU2 A;  5GPA A;  3J80 K;  3I53 A;  1BIA A;  1R1T A;  1VQO I;  1RPW A;  2H8W A;  1J7K A;  1H8A C;  2DDB A;  3OSG A;  1FWZ A;  2P6S A;  3MZH A;  1PP8 F;  2XAS A;  3BTI A;  2VPL A;  3F8M A;  5D5V B;  5E1W A;  2KQR A;  4IOC F;  1GXP A;  4G7Z F;  3JTH A;  1X19 A;  4JX6 A;  2F5F A;  3CDL A;  4U88 A;  4EJV A;  5ICE A;  3FK6 A;  4JYK A;  5J4V A;  4J00 A;  4A12 A;  4YFN F;  3CCS I;  4E7I A;  2DFE A;  2ME0 A;  3I55 I;  3G73 A;  3HHG A;  2FBK A;  3MVP A;  4XLN F;  1G6N A;  2CQ7 A;  4HPQ A;  2M0C A;  2MLG A;  1AA7 A;  4XON A;  2E1M C;  4HV6 A;  2K27 A;  1ZLJ A;  5M5Y J;  2L9V A;  3IHU A;  2B7E A;  3ECO A;  4XKW A;  2KIU A;  1FP2 A;  2RGV A;  1QHG A;  5LGU A;  4II3 A;  1K61 A;  3LQR A;  4XOT A;  1SMT A;  3IH2 A;  5EEH A;  2IA1 A;  5F1R A;  1O3S A;  4BHC A;  4HX4 A;  5CLS A;  2PMH A;  2LRD A;  1SD4 A;  4XN0 A;  2JSP A;  2COM A;  3S3N A;  3AG2 H;  4IXA A;  2ZXH A;  4D9J A;  4EGY A;  1YLF A;  1GUU A;  5FKL A;  2ZKZ A;  4XKB A;  3JRC A;  2DT5 A;  2AHQ A;  2IPQ X;  3DEU A;  1SFU A;  2E5Z A;  2WAQ A;  5CVR A;  4PGH A;  1Y8Q B;  4X6A J;  4PFO A;  3L2V A;  4CCK A;  5EYR A;  2NVX J;  2GIV A;  2FQ4 A;  1OCO H;  1PDN C;  4AC0 A;  3H36 A;  3VOD A;  3S8P A;  3A02 A;  1IZ1 A;  1WVR A;  1DDN A;  2IS4 A;  1Z77 A;  1PUE E;  3LSK A;  3O6B B;  1ZRE A;  2OC6 A;  3NRV A;  1XGN A;  2HR3 A;  1FT9 A;  1UHW A;  4RBO A;  4HA8 A;  1SEU A;  2TRT A;  4C3I J;  1F43 A;  3K1N A;  3L7W A;  1ETK A;  2W1O A;  4I98 B;  3CCQ I;  4JOM A;  2Q0O A;  3D5L A;  1OIS A;  2KP6 A;  3SHF A;  5M3F J;  1DPR A;  2HQ5 A;  2DA7 A;  2FD5 A;  5AIP A;  1RC9 A;  3Q0V A;  1OYY A;  1GXQ A;  3LMM A;  4ENJ A;  1K4T A;  5CJ9 A;  1KQ0 A;  3AG4 H;  3GTQ J;  2EV6 A;  4LLL A;  3WE3 A;  5HS8 A;  3H3V K;  3DP7 A;  4E7H A;  4UY8 I;  2H1K A;  4WXD A;  1FX7 A;  3FMR A;  4RGU A;  2VT2 A;  5LLQ A;  3N05 A;  2LVS A;  3V8K A;  2X6Y A;  1N78 A;  1NK3 P;  2D1H A;  1MBE A;  3K1M A;  2YU9 J;  5FRO A;  2R0Q C;  1YX5 A;  4OMY A;  3CLQ A;  1QZY A;  1WGX A;  2CUF A;  3ZMV A;  2MD0 A;  4IHS A;  2ZSI B;  1P4A A;  1Z9C A;  4CHU A;  2L3D A;  4MTE A;  1YO5 C;  4NDL A;  3FBI B;  2DYR H;  3RIR A;  5IOY A;  1XS9 A;  1MND A;  3GFJ A;  5LGT A;  5F0C A;  1WJE A;  2D5V A;  2RV8 A;  3WTW C;  1S3J A;  2WAE A;  4XLF A;  2DBB A;  1MIJ A;  3JSO A;  5FFZ A;  3CCU I;  4UUV A;  3EET A;  2DU9 A;  3GTK J;  1LFP A;  5LEK A;  1WJF A;  1D1B A;  5C3E J;  3OYB A;  4KIB A;  3ESW B;  2R7O A;  2O61 A;  5EZH A;  4A3M J;  2DQR A;  1UZC A;  2W25 A;  4PDK A;  2ZB9 A;  1QGP A;  4HG2 A;  1ZYR F;  5EEA A;  1Z21 A;  2DCE A;  3BCA A;  1W36 C;  5H6Q A;  1D0Z A;  2CG4 A;  1S29 A;  5CPR B;  1S5L C;  2HDD A;  5E1X A;  3GZ5 A;  5ICF A;  2Z99 A;  1D5V A;  2F6C A;  4U0V A;  3HXL A;  2VC1 A;  3TKY A;  4ZZL A;  3RSN A;  2PI0 A;  1WJA A;  2XGD A;  3I4M J;  2IRF G;  3CDI A;  4XRS A;  4IX7 A;  4HST A;  2XAJ A;  4RLF A;  3BZ6 A;  2X85 A;  3H3Z A;  2PMU A;  1ERD A;  2QBY A;  5J3L A;  2F5E A;  1R7J A;  1ZHF A;  2QEN A;  3G71 I;  1ZQ3 P;  4RB3 C;  2YS9 A;  2PX9 A;  2BYV E;  2F4I A;  2WV0 A;  3HM5 A;  2HDC A;  1P92 A;  4H4K C;  4C2M J;  4BE1 A;  1QU3 A;  1KYZ A;  2VQH A;  2GAU A;  3PNY A;  5JR3 A;  1PJR A;  1OCR H;  3BR1 A;  1U2W A;  4LG0 B;  4XKV A;  1X58 A;  3BDD A;  4IVN A;  2DLL A;  1LKX A;  2Y69 H;  3K4K A;  2KRC A;  3TDZ C;  2FJ1 A;  4I09 A;  4HX7 A;  1DQU A;  3DTK A;  1WCM J;  4GDF A;  1CQT A;  3BPV A;  4IRH A;  1LEA A;  2DFH A;  2JZY A;  4ASN A;  3FX3 A;  3FXM A;  3LSJ A;  3IH4 A;  1I6X A;  1Z6R A;  3M8E A;  4HDV A;  1D5Y A;  1CGP A;  1IXC A;  3LFU A;  3AL0 B;  3OWT A;  5LHH A;  2DTZ A;  1EH8 A;  1FSE A;  5DCF A;  4BJT A;  2XPU A;  4EM1 A;  4V19 K;  1DP3 A;  3VWB A;  4D5F A;  5GTH C;  4MNU A;  5LBQ A;  5K5Q A;  1RR7 A;  2Z2S B;  5JFR A;  5F6F A;  1VQ4 I;  2KRF A;  3F0C A;  2K7L A;  1FYL A;  3D1N I;  2H09 A;  3W6K B;  5ILS A;  1WWX A;  3FXL A;  1MSE C;  2LKS A;  1MJA A;  2IAI A;  4A69 C;  3PUF A;  3Q9V A;  4OOI A;  3RQ4 A;  3DBR B;  3IV5 A;  3E6D A;  2VE9 A;  4NNJ A;  4M6X A;  2CQX A;  2GOM A;  1IUF A;  2QQA A;  5CVV A;  2BY1 A;  2IW5 A;  1YYV A;  1IN6 A;  2C6Y A;  2QZ8 A;  1MW7 A;  2FE3 A;  2HGC A;  4GCV A;  3LAJ A;  1AOY A;  1TQM A;  2K3F A;  3OYJ A;  4AIJ A;  3QPT A;  3ONQ A;  3T0Y A;  3R6S A;  5EDN A;  4RGR A;  3QU6 A;  1CF7 A;  2WAQ N;  2DO7 A;  3Q3S A;  2VKD A;  4UVC A;  3OOU A;  2XB0 X;  1BOB A;  5JHU A;  5FRM A;  2LH9 A;  3SDB A;  1ZRD A;  5J8C A;  3VEP A;  3M3Y J;  3IL2 A;  2A5W A;  2WC2 A;  4L9V A;  2I8D A;  1A6Q A;  4A6E A;  4LFU A;  4HRI A;  4E70 A;  2DA6 A;  2XRN A;  3HOX J;  2ZJP F;  1WH5 A;  1TTY A;  3LA7 A;  2Y0S N;  2QQ8 A;  3KYL A;  3X2Q H;  4F93 B;  2LDU A;  2D1V A;  4MEX F;  1VQ6 I;  3LSP A;  2HXO A;  2G0E A;  3PIO F;  1EF4 A;  1D1C A;  1IV8 A;  1VF9 A;  5ILU A;  4ESJ A;  5LGN A;  1CF7 B;  1XGM A;  1Y1V J;  1U5T B;  5LFA A;  3J7Z I;  4BDY A;  4OIQ F;  2VN2 A;  2ZC2 A;  1QZE A;  2HOA A;  2ZNY A;  3L1P A;  1H9T A;  2MFZ A;  5HLI A;  5D6E A;  3MD2 A;  2KIQ A;  4BY1 J;  2OJE D;  1IG7 A;  4IRI A;  4RAZ A;  3OS2 A;  3FF5 A;  1LDJ A;  3OMY A;  3CUQ B;  2KJB A;  3I56 I;  4E7L A;  4FQG A;  2VT3 A;  5CVU A;  2WWY A;  1Y8R B;  2X1C A;  3HOW J;  3CZ6 A;  3HEF A;  1APL C;  2HZT A;  3F22 A;  5D8L B;  1TWA J;  4XID A;  3ASN H;  2O8K A;  3HPG A;  1UJ8 A;  3HOU J;  1D8J A;  3GME A;  3GEZ A; 
#chains in the Genus database with same CATH homology
 4KN7 X;  4KUM A;  2MH9 A;  5D8K B;  2H94 A;  1GHC A;  4GO1 A;  2XUB A;  4HDU A;  5ICC A;  1D8K A;  1MDM A;  1ON1 A;  2EK5 A;  2FNA A;  3QPH A;  4P9F A;  2DK5 A;  1YW9 A;  2HEO A;  4KNY A;  3VFZ A;  1UCR A;  1QO0 D;  4HQE A;  3GW2 A;  1SFE A;  5L3C A;  2P5V A;  1UHM A;  2MD5 A;  3V7S A;  1OKR A;  3TOB A;  2IA2 A;  4UV8 A;  3T5X A;  2RKH A;  3RYR A;  3LA3 A;  1BI3 A;  3CDH A;  2OQG A;  3I64 A;  4CDG A;  2VON A;  4DQ2 A;  1R00 A;  1J75 A;  1XB4 A;  4RGS A;  1RUO A;  2FA5 A;  1T98 A;  5DEQ A;  4EJU A;  3WE2 A;  1SD6 A;  3E5U A;  1U6G A;  1MGT A;  3T8R A;  4YII A;  4IRG A;  3BPX A;  3KP6 A;  2EB7 A;  3RI4 A;  4A5N A;  1S7O A;  2KIF A;  5DD4 A;  1HW1 A;  2QLZ A;  1FYM A;  1B9M A;  3LAP A;  2XHK A;  1REP C;  3IRR A;  3S2W A;  4EM0 B;  2W24 A;  4KFC A;  3FMS A;  1SFX A;  4P96 A;  3IWZ A;  5FLX K;  4OU0 A;  3WTZ A;  3P9K A;  2HTS A;  2Y75 A;  2K02 A;  2ADU A;  2KKO A;  1R5H A;  4KA4 A;  3BJA A;  1ZRC A;  2HTJ A;  3F23 A;  1FBQ A;  4I2O A;  2GQQ A;  5LHI A;  2L02 A;  3FHZ A;  5DYM A;  1A04 A;  4MHG A;  1LQ1 A;  4XLP F;  4HQM A;  3F8F A;  1L0O C;  5FO5 A;  1O7L A;  2EV5 A;  1LB2 A;  4G6Q A;  1FPQ A;  2NYX A;  2OAZ A;  3HYI A;  3GWZ A;  2GA2 A;  2JSC A;  2STT A;  4A2U A;  4LJZ F;  3FMQ A;  1MD0 A;  2QM3 A;  1QZZ A;  1QNT A;  5L3G A;  1XCV A;  2YSR A;  4FT8 A;  4U7B A;  4CXF A;  2L4A A;  1B1B A;  1IN7 A;  4L5I A;  2R7D A;  1J59 A;  2QQB A;  2ZME A;  1D3Y A;  3RKW A;  5D6F A;  5BS6 A;  2P5L C;  1J9I A;  2G7U A;  4UVB A;  3T1B A;  2VBW A;  1IN4 A;  1HKQ A;  1TNT A;  2Z9O A;  2O3F A;  1W7P A;  2GXG A;  2ZME B;  2CWE A;  3K69 A;  3I58 A;  1HW2 A;  1YW8 A;  3RDI A;  2W57 A;  3I5U A;  5K5O A;  3RKX A;  2HKO A;  4H0E A;  2ZXJ A;  3U2R A;  2IT0 A;  1YS6 A;  4M9S A;  3HSE A;  3DFG A;  1TQI A;  3GX4 X;  4ENN A;  1WKM A;  2ACJ A;  2H6B A;  2CQK A;  2MLK A;  1ULY A;  2E1C A;  1P4X A;  4LD5 A;  1O3Q A;  5TRD A;  4QWQ A;  3SQN A;  5BOX A;  2VXZ A;  2Z3Y A;  2R3S A;  2XAH A;  3OV8 A;  4HV5 A;  2CGP A;  3BRO A;  4A5M A;  2XAQ A;  1E2X A;  1TW2 A;  1XGS A;  3RTR A;  4R8H A;  4AIH A;  5HOO A;  3MWM A;  4RB0 A;  5L3F A;  5FLX Z;  3T8T A;  3E5X A;  2GA1 A;  3HIF A;  4XRF A;  5HDN A;  1U5T C;  3BP8 A;  2FMY A;  3SZT A;  4HAM A;  3SZP A;  4YFK F;  3R0A A;  4CGZ A;  4UV9 A;  1TNS A;  2ISY A;  3KP2 A;  2OA4 A;  1ZRF A;  4N9I A;  1YTY A;  1MZB A;  1RNL A;  1ZH5 A;  4WXC A;  3KCC A;  3KET A;  2OQR A;  2HKX A;  1ON2 A;  3K1P A;  2ZCW A;  1BI0 A;  5ILV A;  5IT9 K;  5AIQ A;  3AAF A;  4L9T A;  5CYV A;  4M71 A;  2A3S A;  3M1E A;  4WF2 A;  2LF8 A;  3WTU C;  2V1U A;  1TLH B;  4Q48 A;  1RI7 A;  4LK1 F;  2FF4 A;  2EV0 A;  1YQA A;  2IJL A;  3Q5F A;  2GZW A;  4O5V A;  2FSW A;  3COA C;  1ONV A;  3B73 A;  1BJA A;  3JW4 A;  1VTN C;  1WQ2 A;  4LB6 B;  3DV8 A;  1U8R A;  1O7F A;  3CO6 C;  5L3E A;  4M73 A;  1ZG1 A;  5ERI A;  3V7R A;  4OIR F;  2DI3 A;  2VBY A;  1G3T A;  5E18 F;  3H92 A;  3KZZ A;  3IKT A;  1FOK A;  2A5Y B;  3DXJ F;  4OMZ A;  4EVI A;  1BC8 C;  3VOE A;  1OR7 A;  3P9I A;  4LG0 A;  1KU7 A;  3ZMU A;  2TDX A;  1ZG3 A;  2W84 A;  1XD7 A;  4I0A A;  4ZYE A;  1LNW A;  3GFM A;  3GEZ A;  1T38 A;  2P8T A;  1IW7 F;  3B02 A;  2V9V A;  1MKM A;  1FBS A;  3KP3 A;  5E8G A;  2QUF A;  3F72 A;  1BOA A;  3ML6 A;  2A6H F;  3R4K A;  2PBI A;  4N0B A;  2Z33 A;  5JI6 A;  4HX8 A;  3RJP A;  1OPC A;  1BI2 A;  2HYG D;  2M30 A;  3MCZ A;  5J8F A;  4EGZ A;  4S05 A;  2ESN A;  2DAO A;  3WGI A;  5A2Q Z;  4CO8 A;  5EEG A;  5HDG A;  3W6J B;  3M9A A;  1S8N A;  3KP7 A;  1ZAO A;  3ECH A;  1WRJ A;  5DUI A;  4OIP F;  1Y0U A;  5ICG A;  2VOO A;  3NQO A;  4AIK A;  1FC3 A;  2YX7 A;  2CFX A;  5H20 A;  3WTT C;  2F5D A;  3KE2 A;  2O0Y A;  3ZMZ A;  2JPB A;  5LRS A;  1U5T A;  1F1Z A;  5LEJ A;  4F7Z A;  5IT9 Z;  4L0Z B;  1BI1 A;  3QP5 A;  2ELH A;  3MZY A;  3CUQ A;  4AWX B;  4IF4 A;  1DUX C;  4S04 A;  3BJ6 A;  3IC7 A;  2A6E F;  2OZU A;  3TO9 A;  4KMU X;  4JQF A;  2ETH A;  3ISP A;  2ZO4 A;  1K79 A;  4P5O A;  2OD5 A;  2DPD A;  1L3L A;  3FM5 A;  3R0J A;  2H27 A;  4G9Y A;  4LGW A;  1EV7 A;  5D4R A;  4NB5 A;  3NEU A;  3I0T A;  3RKY A;  1Z1D A;  3F21 A;  2M87 A;  4G94 A;  1I5Z A;  4GYI A;  2IA0 A;  2M5W A;  2DTR A;  3CJN A;  4BH9 A;  2RN7 A;  2O8X A;  3ZQ7 A;  1JE8 A;  1XDS A;  5BPD A;  1STZ A;  1F5T A;  2AS5 F;  2E1N A;  1S6L A;  2R7F A;  3ZMT A;  1XSV A;  3Q9S A;  3HSF A;  3ZMD A;  2HQR A;  3WTS C;  3HTU A;  4HOB A;  2PLY A;  3PFI A;  4LLN A;  5LHG A;  2BGC A;  2FBH A;  4G6D A;  4GGG A;  5J6X A;  1HQC A;  4UHT A;  4UXN A;  4YIF A;  2HYF A;  3TQN A;  3LFK A;  2Q8K A;  1FLI A;  1T0F A;  1ZG5 A;  4EJO A;  3FXR A;  3R60 A;  1HBX G;  2OZ6 A;  4A0Y A;  1BBY A;  3C18 A;  3BY6 A;  3DF8 A;  2EFQ A;  2LNB A;  5E20 A;  1JHF A;  4AD9 A;  4EJT A;  4WWC A;  3RPU A;  3MAJ A;  4JK1 X;  3KEO A;  5FGM A;  5DDG A;  1NHA A;  4KDP A;  2LF7 A;  1T39 A;  3J7A O;  3HTS B;  2DFI A;  3GLX A;  1R1V A;  1K78 B;  4UVA A;  2V1D A;  2EFO A;  1FYK A;  3WTY C;  5BMZ A;  3KLO A;  3MFK A;  1KA8 A;  4HF2 A;  4PZJ A;  4BHB A;  5D5X B;  3K2Z A;  2VC0 A;  2M8E A;  3P9C A;  2HOE A;  2VOD A;  1SAX A;  4HZF A;  2P7V B;  4ZYD A;  3GXO A;  1WI9 A;  2X0L A;  2QYO A;  5ED4 A;  2XIG A;  4KIG A;  1LDK B;  3GO5 A;  2H6C A;  3F8N A;  4RGX A;  2W85 A;  2IVM A;  5HLG A;  5D5U B;  4HLX A;  1K6O A;  2XV4 S;  2JT1 A;  4L5J A;  3BJO A;  3F8C A;  2LSO A;  3JAM K;  2HWV A;  4I7H A;  4HW0 A;  4HLY A;  5HLH A;  2UXX A;  1G3Y A;  2EFP A;  1BM9 A;  3F8B A;  4R79 A;  4CYD A;  4Q5S F;  3LST A;  1KU9 A;  4ESB A;  1RZ4 A;  4IHT A;  4HF0 A;  4IJA A;  1JXS A;  5KVR A;  4YG2 F;  1FZP B;  4MGR A;  2VBX A;  5HS7 A;  3RYP A;  4OIN F;  2HQN A;  2PFB A;  1R22 A;  1XMK A;  2XAG A;  2EA4 A;  4ZYH A;  2ZFW A;  1FP1 D;  2XKO A;  1Q1H A;  2D45 A;  3GYH X;  2FNP A;  3RPQ A;  2QVO A;  1ODD A;  1XCB A;  1P2F A;  2NAZ A;  1U78 A;  1IRF A;  4GXO A;  4A0Z A;  1P4W A;  5CVJ A;  2HFH A;  1IF1 A;  3QAH A;  4KN4 X;  2P5K A;  3LQQ A;  4I0B A;  2ZJ2 A;  2D2W A;  3O2P E;  4ZZD A;  3REO A;  5AON A;  4BXU A;  4BYY A;  3DKW A;  1BC7 C;  1HW5 A;  4DNC A;  3GUD A;  3GZ6 A;  4EJW A;  2V1X A;  2FML A;  5JVT A;  3WU1 B;  3KFW X;  4PCQ A;  3ZPL A;  4TV7 A;  1R1U A;  3DPT A;  2DPU A;  1I27 A;  5E17 F;  5HDK A;  5A2Q K;  1IUY A;  1P6R A;  3PQK A;  3GVA A;  2X4H A;  3KLN A;  2YX4 A;  3I4P A;  1IN5 A;  4HBL A;  1SD5 A;  1V3F A;  4M74 A;  1Z91 A;  3WGH A;  3V4G A;  5D4S A;  3ABT A;  4KT5 C;  5HS9 A;  1FNN A;  2CO5 A;  1XMA A;  3L9F A;  4P9U A;  4MTD A;  1B4A A;  3TO7 A;  4M6Y A;  1TQP A;  1QPM A;  1Z7U A;  1J0R A;  5FFX A;  3JAM Z;  5FB2 A;  3CUQ C;  5F64 A;  1T6S A;  2O6G E;  1C0W A;  1YFH A;  2BV6 A;  1KQ8 A;  1JHH A;  3EUH A;  1KYW A;  1IN8 A;  3V7C A;  2FBI A;  2IP2 A;  2YR2 A;  5FD6 A;  4M9Z A;  1O3T A;  4CZZ A;  2O03 A;  3ZN0 A;  2EFW A;  4O6J A;  1JGS A;  3LWF A;  4XBF A;  1W7P D;  5DUK A;  1YW7 A;  2QQ9 A;  3TDU C;  2A68 F;  3QP6 A;  1X3U A;  1IRG A;  2QWW A;  1EH7 A;  2PG4 A;  4XSX F;  1F4K A;  3FWE A;  4KMF A;  3HRT A;  2V6C A;  2YPR A;  3D0S A;  5D5W B;  4Y13 A;  2RDP A;  3CTA A;  2L54 A;  3G3Z A;  2P6T A;  1BN5 A;  3ROU A;  5E8I A;  1ZN2 A;  4L9J A;  3DQV C;  2G7H A;  3H3U A;  3KEQ A;  4EM2 A;  3C3W A;  5LRR A;  2STW A;  1R23 A;  2CW0 F;  2B0L A;  2UWM A;  3F6O A;  2XKP A;  1XN7 A;  1Z6T A;  2GWR A;  3QU3 A;  2MC3 A;  3K9T A;  1MJB A;  2JPC A;  3U1D A;  4U7D A;  4KIF A;  4ZYG A;  1XSX A;  2PN6 A;  3TOA A;  1WSU A;  1S7A A;  2PQ8 A;  3EQL F;  3WTV C;  3ELK A;  2MH2 A;  3V8J A;  1W5S A;  3HRS A;  5FD5 A;  4ENM A;  3P7N A;  4Y17 A;  2E7W A;  1IXR C;  4BQA A;  2RNJ A;  1OYI A;  1KQ9 A;  4WK8 F;  2M1B A;  3K0L A;  4D0P A;  5BPI A;  4L9N A;  1UB9 A;  3CLO A;  5H6R A;  2KJC A;  2A61 A;  4R1H A;  1O57 A;  1LEB A;  3TO6 A;  2PJP A;  5BQT A;  3J80 Z;  3HHH A;  1W5T A;  3WOD F;  4ETS A;  4EMS A;  3FZV A;  1SD7 A;  2PEX A;  2L01 A;  1W4M A;  2XVC A;  1DPU A;  4M72 A;  3HOT A;  1HSJ A;  2QBY B;  1RUN A;  3GFI A;  3OOP A;  5IT3 A;  3E6M A;  3HUG A;  2VOP A;  4XSZ F;  3QOP A;  1LDD A;  2VBZ A;  4YFX F;  4Y15 A;  3FXQ A;  3J81 K;  2K4B A;  4O3M A;  1G4D A;  4L18 B;  3ZMS A;  4ESF A;  1UST A;  3ZN1 A;  1B59 A;  1B9N A;  3E97 A;  4CIC A;  1QQI A;  2E7X A;  2RQP A;  3U9G A;  2EWN A;  4GYG A;  2FQ3 A;  4FX4 A;  4B8X A;  3BOQ A;  2Z5U A;  4FHT A;  4NHJ A;  3IRQ A;  3KZY A;  4EV0 A;  2Y0M A;  2KIM A;  1HKS A;  1F9N A;  3M7G A;  4U0Y A;  3L00 A;  1ZGA A;  4G7O F;  1GVJ A;  2EA2 A;  1Z05 A;  4EQQ A;  1V4R A;  1ZGJ A;  3BWG A;  2K4J A;  2JTV A;  2CYY A;  4I01 A;  3L2C A;  5DV5 A;  1U3E M;  2UXN A;  3ULQ B;  4AVP A;  2NRA C;  3WG9 A;  1K7A A;  1I1S A;  3I71 A;  1R5G A;  2XRO A;  1UFM A;  3TGN A;  4LB5 A;  1MJ9 A;  2OBP A;  3HSR A;  5HVQ C;  4LLG F;  1XSD A;  1TW3 A;  1KU2 A;  3F3X A;  4U0W A;  4Q4Z F;  2FRH A;  2ISZ A;  1KGS A;  3WGG A;  3DPL C;  2ZBK A;  4BHP A;  1BIB A;  1LJ9 A;  2YU3 A;  3SXY A;  2NS0 A;  1O3R A;  2ZNZ A;  3ZP5 A;  4RAY A;  4G7H F;  3MQ0 A;  1OYW A;  1HXD A;  4FX0 A;  4LMY A;  1MDM B;  1HKT A;  1YIO A;  3VB2 A;  5DCM A;  4ZH4 F;  1K78 A;  4P55 A;  1E17 A;  4MQ9 F;  1I1G A;  4RS8 A;  5K5R A;  3JTG A;  1AWC A;  1J5Y A;  4NQW A;  2LKP A;  2EFN A;  2P4W A;  4MQV A;  5DCM B;  3J81 Z;  1HST A;  3GFL A;  4K2E A;  2FXA A;  4OIO F;  3KP4 A;  1LVA A;  3R61 A;  3EYY A;  3EYI A;  2V79 A;  1YS7 A;  3FM3 A;  1KU3 A;  3N97 A;  4A6D A;  2FEZ A;  3HOS A;  3L09 A;  4Q47 A;  1G3W A;  1T2K A;  4KIC A;  2L4M A;  3GF2 A;  1J2X A;  3I54 A;  2EJR A;  3C7J A;  2GXB A;  4WCG A;  3WTX C;  3HRU A;  3JSP A;  4IPA A;  2F5C A;  3CO7 C;  2K86 A;  2M45 A;  3CUO A;  2A69 F;  2J5O A;  2WTE A;  2DW4 A;  6PAX A;  4WX9 A;  4PGG A;  3M8F A;  3LA2 A;  3IKV A;  3HRM A;  5L3D A;  2BE5 F;  1SMY F;  1PP7 U;  1ZLK A;  2Q2E A;  4RB2 C;  1B6A A;  1ZAR A;  1IXS B;  4I02 A;  2BBY A;  2RVC A;  1USS A;  5L3B A;  2CSO A;  3O3K A;  1FSH A;  3V8L A;  4B09 A;  5E1Z B;  3F6V A;  2VE8 A;  2XGX A;  2G9W A;  3C1D A;  2MBF A;  4ON0 A;  2DK8 A;  1R58 A;  2AXL A;  3EDP A;  2FOK A;  3WU0 A;  3QRF F;  2Y48 A;  4BNC A;  3PQJ A;  3E5Q A;  1G3S A;  1DP7 P;  2F2E A;  3N4M A;  3E6C C;  4N9H A;  2HS5 A;  2ESH A;  4WXH A;  4ENK A;  3FXU A;  1FBU A;  1RIO H;  3I59 A;  1YG2 A;  5TJJ A;  2A07 F;  4A0X A;  1R36 A;  2J5P A;  4BAY A;  2MA3 A;  4HF1 A;  4L0Y B;  2FU4 A;  3E3V A;  1OMI A;  3I59 B;  4QLC U;  1FY7 A;  1XDU A;  4Z2Y A;  1IAW A;  1H0M A;  2BEO A;  3IWF A;  4RB1 A;  4LK0 F;  5CVI A;  5K1Y A;  1XGO A;  2UZK A;  1H9G A;  3KP5 A;  2P7C B;  4G8X A;  3MEX A;  1EH6 A;  5DD8 A;  5KK1 A;  4KYW A;  3SFZ A;  3ABU A;  4HYE A;  4M9X A;  3E6B A;  4MEY F;  2RC4 A;  4UNO A;  2XAF A;  1QBJ A;  2JRT A;  2DQL A;  4JBA A;  3ERE D;  1W7P B;  1TBX A;  2NNN A;  2OU2 A;  3J80 K;  3I53 A;  1BIA A;  1R1T A;  1J7K A;  1FWZ A;  2P6S A;  3MZH A;  1PP8 F;  2XAS A;  3F8M A;  5D5V B;  5E1W A;  1GXP A;  4G7Z F;  3JTH A;  2F5F A;  4U88 A;  4EJV A;  5ICE A;  4A12 A;  4YFN F;  3G73 A;  3HHG A;  2FBK A;  4XLN F;  1G6N A;  2MLG A;  4HV6 A;  2K27 A;  1ZLJ A;  3IHU A;  3ECO A;  2KIU A;  1FP2 A;  2RGV A;  5LGU A;  3LQR A;  1SMT A;  5EEH A;  2IA1 A;  5F1R A;  1O3S A;  4BHC A;  4HX4 A;  5CLS A;  2PMH A;  1SD4 A;  2COM A;  4IXA A;  4EGY A;  1YLF A;  2ZKZ A;  2DT5 A;  2IPQ X;  3DEU A;  1SFU A;  5CVR A;  4PGH A;  2GIV A;  1PDN C;  3VOD A;  1IZ1 A;  1DDN A;  1PUE E;  3O6B B;  1ZRE A;  3NRV A;  1XGN A;  2HR3 A;  1FT9 A;  1UHW A;  4HA8 A;  3K1N A;  3L7W A;  4I98 B;  2Q0O A;  3D5L A;  3SHF A;  1DPR A;  5AIP A;  1OYY A;  1GXQ A;  4ENJ A;  5CJ9 A;  1KQ0 A;  2EV6 A;  4LLL A;  3WE3 A;  5HS8 A;  3DP7 A;  4WXD A;  1FX7 A;  3FMR A;  4RGU A;  2VT2 A;  5LLQ A;  3V8K A;  2D1H A;  3K1M A;  4OMY A;  1QZY A;  3ZMV A;  4IHS A;  1P4A A;  1Z9C A;  4CHU A;  2L3D A;  4MTE A;  1YO5 C;  3RIR A;  3GFJ A;  5LGT A;  2RV8 A;  3WTW C;  1S3J A;  2DBB A;  3JSO A;  5FFZ A;  4UUV A;  3EET A;  2DU9 A;  5LEK A;  4KIB A;  2O61 A;  2DQR A;  2W25 A;  4PDK A;  1QGP A;  1ZYR F;  5H6Q A;  2CG4 A;  1S29 A;  5E1X A;  3GZ5 A;  5ICF A;  2Z99 A;  1D5V A;  4U0V A;  2VC1 A;  3TKY A;  4ZZL A;  2PI0 A;  2IRF G;  2XAJ A;  3BZ6 A;  3H3Z A;  2PMU A;  2QBY A;  2F5E A;  1R7J A;  1ZHF A;  2QEN A;  4RB3 C;  2BYV E;  2WV0 A;  2HDC A;  1P92 A;  1KYZ A;  2GAU A;  5JR3 A;  1U2W A;  4LG0 B;  3BDD A;  4IVN A;  2DLL A;  3TDZ C;  4I09 A;  4HX7 A;  3BPV A;  4IRH A;  1LEA A;  2JZY A;  4ASN A;  3FX3 A;  1I6X A;  1Z6R A;  3M8E A;  4HDV A;  1CGP A;  1IXC A;  5LHH A;  1EH8 A;  1FSE A;  5DCF A;  4EM1 A;  4MNU A;  5LBQ A;  5K5Q A;  5JFR A;  5F6F A;  2KRF A;  2K7L A;  1FYL A;  2H09 A;  3W6K B;  5ILS A;  1WWX A;  1MJA A;  3Q9V A;  4OOI A;  3E6D A;  2VE9 A;  4M6X A;  2QQA A;  5CVV A;  2IW5 A;  1YYV A;  1IN6 A;  2C6Y A;  2QZ8 A;  2FE3 A;  2HGC A;  4GCV A;  3LAJ A;  1AOY A;  1TQM A;  4AIJ A;  3QPT A;  3T0Y A;  3R6S A;  4RGR A;  3QU6 A;  1CF7 A;  2DO7 A;  4UVC A;  5JHU A;  1ZRD A;  5J8C A;  3VEP A;  3IL2 A;  2WC2 A;  4L9V A;  4A6E A;  4LFU A;  4E70 A;  2XRN A;  1TTY A;  3LA7 A;  2LDU A;  2D1V A;  4MEX F;  4ESJ A;  5ILU A;  5LGN A;  1CF7 B;  1XGM A;  1U5T B;  4OIQ F;  2VN2 A;  2ZNY A;  1H9T A;  5HLI A;  5D6E A;  4IRI A;  4RAZ A;  3FF5 A;  1LDJ A;  3CUQ B;  2KJB A;  2VT3 A;  5CVU A;  2WWY A;  2HZT A;  3F22 A;  5D8L B;  1D8J A;  2NNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...