2VE8A

Xray structure of ftsk gamma domain (p. aeruginosa)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
EDDPLYDEAVRFVTESRRASISAVQRKLKIGYNRAARMIEAMEMAGVVTPMNTNGSREVIAPAPVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA TRANSLOCASE FTSK
publication title Molecular Mechanism of Sequence-Directed DNA Loading and Translocation by Ftsk.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 17
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09397 FtsK_gamma Ftsk gamma domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ve8A01
3F8NA 2CYYA 4LLGF 2P5VA 3TO7A 1IN7A 1OPCA 1L3LA 4MHGA 2XROA 1RZ4A 5HOOA 3EETA 1QQIA 4R1HA 3F3XA 1Z9CA 1C0WA 2QWWA 2AXLA 3DFGA 1LB2A 4YG2F 4BHBA 3FXQA 4YIFA 4BYYA 1B1BA 2EA2A 2ESHA 3V7SA 5ICGA 3FM3A 3HOSA 1P2FA 2V9VA 1G6NA 5F1RA 4O3MA 4LJZF 3CUQC 1Z91A 1MJAA 1U5TB 2PMUA 1LNWA 4L0YB 4HQEA 4I0AA 1JHHA 4R8HA 4G8XA 3K69A 4IJAA 3JAMZ 5DDGA 5DUKA 3LQQA 5LRRA 1UB9A 2BE5F 3ECOA 2NAZA 2YSRA 4FHTA 3LAJA 2Z3YA 1PP8F 2UXNA 1F9NA 1R7JA 3RPUA 2HTSA 1IN4A 4RAZA 3LWFA 1OYIA 3HHGA 2CQKA 3GVAA 1R00A 3L7WA 2EFOA 2JTVA 5L3GA 4A6DA 5D5WB 1REPC 3ZMTA 1ZAOA 4AVPA 5KK1A 2BEOA 3BY6A 4WCGA 3E3VA 1IN6A 2KKOA 2MLKA 3KP7A 3L9FA 3N97A 3SZPA 3E6BA 3RJPA 2W24A 1JXSA 2ZXJA 5D6FA 2HQNA 1YG2A 4LLLA 4U0WA 1BM9A 2F5DA 1CF7A 2QLZA 1G4DA 1RUNA 1FLIA 2YX7A 3L09A 3CLOA 2VODA 4EMSA 1OYWA 4UV9A 3O3KA 2OBPA 2D2WA 3DF8A 1OKRA 1I5ZA 5JFRA 1U6GA 2IA0A 3N4MA 1YTYA 1RUOA 1TBXA 2HTJA 4HYEA 5D6EA 4S05A 4K2EA 4HF2A 3WTSC 4EVIA 2FNPA 4GCVA 1ULYA 1QBJA 3C1DA 2MH2A 4JQFA 3TDZC 4M72A 2HEOA 3V8KA 1O3TA 2FRHA 1UFMA 1LJ9A 4PDKA 2WC2A 2HR3A 5JI6A 5HS9A 1HW5A 2QBYA 4U0VA 2H6BA 5HDKA 1IRFA 3BWGA 1ONVA 1D8KA 2K4JA 4YFNF 2QVOA 5TJJA 5ILUA 2EK5A 2O6GE 2NS0A 4U0YA 4EGZA 5LBQA 2DPUA 1ZH5A 1T6SA 2HS5A 3U1DA 2OU2A 2UWMA 2LDUA 3MEXA 1Z1DA 1XCVA 4MTEA 1SAXA 4M6XA 2F5EA 4MQ9F 3E6MA 2NNNA 4A0YA 1YYVA 4A5NA 1ZLKA 3I5UA 4L9TA 3R4KA 2EA4A 5LGNA 4NQWA 3FMRA 2V79A 2RGVA 3Q9VA 3KZYA 1SD5A 3FM5A 4HV6A 5D5XB 1T39A 1FC3A 2O8XA 5IT9Z 4RGSA 5LHGA 2NNYA 3ELKA 1HXDA 4HF1A 1MDMB 2HQRA 3SQNA 2ESNA 3CDHA 4CHUA 3BDDA 1B6AA 1XMAA 1HKTA 1ZGAA 2QUFA 5BS6A 4RS8A 1I1SA 3DQVC 4CDGA 2L4MA 2DTRA 2JSCA 1TW3A 3FX3A 1R1TA 4PGGA 4XSZF 5IT3A 2QQ9A 4ZH4F 2EWNA 2VE8A 3E5UA 4RGXA 4ON0A 2LF7A 4XLNF 3R60A 1T2KA 2DI3A 2P7CB 3KZZA 4FX0A 2E7XA 4BHCA 3C7JA 3F22A 1ZRCA 4BNCA 1H0MA 1XGNA 3T1BA 3I59A 4BQAA 3R0AA 3VB2A 3T0YA 4RGUA 2ETHA 2ZO4A 2P5KA 3KP6A 1O57A 3ZMUA 2EV5A 2LNBA 1YQAA 3HYIA 4RB2C 3GW2A 1JE8A 1BI0A 3WU0A 5FGMA 2VBYA 2MLGA 5E1WA 1F4KA 1R23A 4GO1A 4LFUA 5BQTA 1K79A 2RV8A 4EJTA 3TO6A 4CO8A 3RKXA 4HDVA 3J7AO 5LGTA 2JPBA 1BIBA 2L54A 3DPTA 5F64A 4FX4A 1X3UA 1Z05A 4WK8F 3RKYA 1A04A 1ODDA 4UHTA 1J7KA 2O61A 1G3YA 4M73A 1I27A 1VTNC 3J81K 2J5OA 3QU3A 4N0BA 3LSTA 5HS7A 3M8EA 3VFZA 4ZZLA 1IN5A 2A3SA 5A2QK 4LK0F 2VE9A 1BI2A 4EM2A 3FZVA 2DQLA 2O03A 3H3ZA 4IF4A 1Y0UA 1DUXC 1YS6A 3ROUA 5D5UB 2W25A 1FBSA 4KUMA 2VXZA 2V1DA 4LGWA 5EEGA 4OU0A 1QGPA 1FZPB 2F5CA 4EM1A 4D0PA 4KNYA 5CLSA 1P4XA 1S3JA 1GVJA 5L3BA 3QPHA 4AIJA 1DP7P 3TDUC 1BOAA 2JPCA 2FOKA 3WTXC 2L01A 5JR3A 3MZHA 2EV0A 2R7FA 4UVAA 2IRFG 2G7HA 2KJCA 2DO7A 1R36A 1CF7B 4UUVA 4IRHA 4Y15A 3QPTA 2GXGA 3V8JA 4KMFA 5JVTA 4OMYA 3BJOA 3KEOA 3EUHA 1ZG1A 5FD6A 4CICA 1TLHB 3GZ6A 2KIMA 5LHIA 2VONA 4ZZDA 1YS7A 4M71A 5DYMA 5AIPA 1KQ8A 2HYFA 4CZZA 4DQ2A 3LQRA 4ESJA 2C6YA 1SMYF 4ZYDA 4PCQA 4M9SA 2X0LA 1FP2A 3WU1B 1GXPA 1HKSA 3GFLA 4P9FA 5ICEA 3BJAA 4KIFA 2QBYB 4M74A 3S2WA 2PQ8A 2R3SA 5D4RA 3BZ6A 1STZA 5D4SA 4BXUA 5EEHA 5FLXZ 4A5MA 3BP8A 3J80Z 4WXDA 5H6RA 1IF1A 4OIRF 2ADUA 1ON2A 1O7LA 5J8FA 2E1NA 4LB6B 4Y17A 4EJWA 1MZBA 3OOPA 1U2WA 1KU9A 5HLGA 3H92A 5ERIA 1XCBA 5FO5A 4KYWA 2O3FA 3BOQA 5HLHA 3V4GA 5HDNA 4YIIA 2IA2A 2A61A 1FNNA 1OMIA 2J5PA 4IVNA 5LLQA 4LB5A 3SFZA 3CJNA 5DCMA 2COMA 3QOPA 2XHKA 4WXCA 2XAFA 3FMSA 1E17A 1V4RA 4U88A 2O0YA 4HZFA 3CUQA 4G7ZF 3HTSB 1T0FA 4IRIA 3VODA 2OQGA 1IZ1A 2RC4A 5BOXA 4KN4X 3I71A 4ZYHA 5E20A 5ED4A 4YFXF 3ZMVA 4YFKF 1ZRFA 1RIOH 1FT9A 1AOYA 1KGSA 5CVVA 3IL2A 2FMYA 1J0RA 3ZQ7A 3WG9A 2PMHA 2K86A 3PQKA 4IRGA 4M9XA 1FYKA 2FMLA 3GUDA 3I53A 3IC7A 3I59B 1LDJA 2D1VA 3MQ0A 4HF0A 4RB3C 4JK1X 4B09A 2AS5F 1MJBA 2OZUA 3JSPA 5CVIA 4GXOA 1SFEA 2FXAA 3ZN1A 2XIGA 3REOA 3LA2A 2RVCA 5DUIA 3U9GA 1B4AA 2ZNYA 2V1UA 2FBHA 4RGRA 2VC1A 3GF2A 4HX8A 4G7HF 1FYLA 1W7PA 2VBZA 3WTTC 4MQVA 1B59A 5BPDA 5DD4A 2H27A 1D8JA 3WTWC 3I0TA 2VBWA 1AWCA 1W5TA 1UCRA 4RAYA 5CJ9A 4ESFA 4NB5A 4Z2YA 4A2UA 4LG0A 3LA3A 4A12A 2PFBA 1RNLA 1BN5A 1BIAA 5DD8A 5HLIA 3TO9A 2EJRA 1W7PD 3DEUA 2GXBA 1R5HA 1HW2A 2ZJ2A 2P5LC 4L9VA 3L2CA 2QZ8A 4M9ZA 2XUBA 1K7AA 5DV5A 4EGYA 4FT8A 1SMTA 4HOBA 2RDPA 1PUEE 5CVRA 1V3FA 4ETSA 1P92A 2G7UA 3QP6A 3U2RA 3OV8A 2HKOA 2IT0A 2M87A 4TV7A 4L9NA 2L3DA 3KETA 5ILSA 3RI4A 1MKMA 1HSTA 3GWZA 1EH6A 1LDKB 4OIOF 3E97A 3JAMK 4HW0A 3F8BA 4Q47A 3V7RA 3RYPA 2Z33A 2FQ3A 2BV6A 1FBQA 3F21A 3GFIA 1U5TC 1W4MA 2RKHA 5LGUA 3DKWA 3NRVA 3AAFA 2F5FA 3K1MA 4JBAA 3LA7A 3IRRA 3WTVC 2UZKA 1FPQA 1WKMA 2LSOA 3ZMSA 1LVAA 3GXOA 4XSXF 2OZ6A 3F6VA 1KYWA 2EFQA 5CVJA 2XKPA 1FSHA 3HRSA 2Z5UA 1O3RA 3HRTA 4KMUX 4QWQA 3M8FA 4BHPA 4N9IA 4GYGA 1F5TA 5H20A 4UXNA 2V1XA 1XSDA 4G6QA 2FEZA 1TQMA 2ZNZA 3HHHA 1BC7C 3W6KB 1Z7UA 2EB7A 1ZG5A 5F6FA 3KLNA 3G73A 2IJLA 2JRTA 1KU2A 2IW5A 3RTRA 1J5YA 1R5GA 2YX4A 2XV4S 4UV8A 4HDUA 3HRUA 3HIFA 2VN2A 4MGRA 2GQQA 4P9UA 4H0EA 2XKOA 2HWVA 2RN7A 4N9HA 4WX9A 1S7OA 1J75A 3WTZA 3GO5A 4AWXB 2A6HF 4IHTA 2LF8A 3C18A 4GGGA 3VOEA 5J8CA 2MC3A 1KYZA 3K1PA 1SFXA 3QAHA 2DPDA 3BROA 3M7GA 2CWEA 5K5OA 4G6DA 5DCMB 3V7CA 2L02A 2W85A 1MGTA 2MBFA 5L3FA 1XB4A 2Q0OA 3EQLF 4KDPA 3D5LA 4Q4ZF 2XGXA 1DDNA 1QPMA 4OIPF 2WWYA 2FBKA 1TNTA 3KEQA 5E1ZB 3CUQB 1BJAA 3KP2A 1SD7A 2ZBKA 3K1NA 3WGIA 1IXRC 2W57A 2P8TA 3Q9SA 4I09A 2F2EA 2ZMEA 1PDNC 1EV7A 3ML6A 1CGPA 4OMZA 2CW0F 1ZLJA 4KIBA 2HFHA 1EH8A 2XAHA 4U7BA 2VT3A 1YFHA 1JGSA 1ZREA 1J2XA 3JTHA 3GFMA 4KT5C 4KN7X 5IT9K 1LDDA 5LRSA 3PQJA 3ZMZA 4WF2A 1KA8A 5E1XA 4XLPF 1FBUA 3P9IA 3GFJA 1FY7A 1ZARA 3WE2A 2DW4A 3SHFA 2MD5A 2ISYA 5L3EA 3ZN0A 1J59A 5FFXA 1XGOA 4G7OF 4MEXF 2OD5A 1W7PB 1S29A 2HGCA 1ZGJA 5H6QA 2ACJA 4UVCA 1XDSA 1P6RA 1YIOA 1Q1HA 5KVRA 1FWZA 1R58A 1BBYA 3COAC 5CVUA 3FWEA 3F8CA 2HOEA 1FX7A 3SXYA 2XASA 4LG0B 4B8XA 1YO5C 3D0SA 2Q2EA 3IHUA 1HBXG 1DPRA 3R6SA 1O3SA 4DNCA 2VOOA 2FNAA 3E5XA 3ZPLA 1HSJA 1H9GA 1XGMA 3IKVA 4XRFA 3VEPA 1TNSA 2IA1A 4I2OA 3ERED 4Q48A 2DAOA 2ZCWA 3ZP5A 1FYMA 3KP4A 1ZHFA 4P5OA 2XRNA 4WWCA 3F8FA 3CO6C 2MA3A 3TOBA 2DBBA 2VT2A 1XGSA 3EYYA 3RPQA 2M45A 4MNUA 3G3ZA 1P4WA 3NEUA 5E8GA 1B9MA 2HYGD 3F8MA 4AD9A 3WTYC 4E70A 3JTGA 3E6CC 5DEQA 2EFWA 2NRAC 4OINF 3E5QA 4HV5A 5BMZA 3P7NA 3TOAA 4G9YA 2FE3A 3EYIA 1IN8A 5LEKA 3WODF 4I01A 4LD5A 4HLYA 5ICFA 1FSEA 1BC8C 2D1HA 3WGGA 1PP7U 3I54A 2CSOA 4ZYEA 3I4PA 3KLOA 5J6XA 4OIQF 4KICA 4L0ZB 2QM3A 1ON1A 1B9NA 4CXFA 2RNJA 3MFKA 3WGHA 3MCZA 3CO7C 1BI3A 1QZZA 1H9TA 4EJUA 1T38A 2XAJA 2R7DA 3GLXA 4A0ZA 1YW7A 1Z6TA 1U78A 3ECHA 2Y0MA 2TDXA 4Y13A 3K2ZA 4HLXA 2RQPA 2PI0A 1G3TA 4HBLA 4AIKA 3HSRA 4OOIA 4ASNA 1I6XA 2KRFA 2QQBA 3RKWA 3ABTA 5ILVA 1SFUA 3H3UA 2YR2A 2DFIA 2WTEA 1K78A 3DP7A 4M6YA 1FOKA 4A6EA 3RYRA 1WRJA 4AIHA 2Y75A 4G94A 3HTUA 2BBYA 2M1BA 1GXQA 2A6EF 2OAZA 4I98B 2NYXA 3EDPA 1YW8A 2KIUA 2DQRA 1YLFA 2X4HA 5FLXK 3J80K 1D5VA 4KA4A 3IKTA 2GWRA 2M8EA 5ICCA 1OYYA 1QNTA 3HRMA 3O2PE 4O5VA 4P96A 1HW1A 3ISPA 3O6BB 2IP2A 2PEXA 2ISZA 4IHSA 1MD0A 3PFIA 4ENNA 1GHCA 1O3QA 2FSWA 2OQRA 2ZMEB 2H09A 4HX7A 3ULQB 2STTA 5D5VB 1XDUA 1J9IA 4EQQA 5L3CA 3FMQA 4WXHA 3QU6A 1HQCA 5AIQA 2UXXA 3B02A 2OA4A 3J81Z 3JW4A 5D8KB 5L3DA 2VC0A 3I58A 5HVQC 3TKYA 5A2QZ 4KIGA 3FHZA 2IPQX 4L9JA 4BAYA 3FF5A 2MH9A 4ESBA 2YU3A 1WWXA 1UHMA 2GA2A 5K5QA 1L0OC 2Y48A 2A07F 2A69F 3TGNA 4EJVA 1TQIA 4UNOA 2ELHA 1E2XA 1QZYA 4F7ZA 1KQ0A 1U5TA 2P7VB 3RDIA 4A0XA 3KP5A 1NHAA 3F6OA 2JZYA 4EV0A 2CO5A 2JT1A 2GA1A 4O6JA 5FD5A 3GEZA 3GZ5A 3DPLC 2L4AA 5FFZA 3RIRA 4HQMA 4CGZA 2IVMA 3F23A 2A68F 4EJOA 2A5YB 4RB1A 2PLYA 2EFPA 3SZTA 5HDGA 3FXUA 2CG4A 4U7DA 3F72A 2CGPA 3T8RA 2QQAA 1WSUA 1R1UA 4LLNA 4EM0B 1S8NA 2KJBA 3BPVA 1G3WA 1U3EM 3NQOA 4R79A 1IXSB 3KE2A 1KU3A 1TQPA 1BI1A 3P9KA 4ENMA 3KFWX 3MZYA 2QYOA 1ZRDA 1WQ2A 4LK1F 2LKPA 5CYVA 1ZN2A 2VBXA 1MJ9A 1SD4A 2BGCA 2P6TA 5K5RA 3IWFA 4ENKA 1WI9A 3WTUC 2G9WA 3T5XA 1HKQA 2P4WA 2DLLA 2FF4A 5HS8A 2XAGA 1W5SA 3M1EA 4LMYA 1O7FA 1K6OA 1TTYA 3HSFA 4I0BA 4I7HA 2P6SA 3GYHX 1DPUA 1KQ9A 1U8RA 2K7LA 4L5IA 4I02A 2M5WA 3CUOA 1XSXA 4ENJA 2DT5A 2GAUA 5LEJA 4ZYGA 1S6LA 2V6CA 1ZYRF 3LAPA 3BPXA 4MEYF 3ZMDA 3K9TA 5E18F 1R22A 1USSA 1UHWA 1USTA 2PN6A 2Q8KA 4BH9A 2M30A 1SD6A 3I64A 1LEBA 3V8LA 2H94A 2E1CA 3IWZA 4QLCU 4UVBA 2HKXA 2DK8A 1XMKA 3K0LA 1IUYA 2EFNA 2QENA 3R0JA 1LEAA 1YW9A 3HSEA 3MAJA 4PGHA 2Z9OA 2CFXA 4CYDA 3Q5FA 3HOTA 5D8LB 3CTAA 1D3YA 2EV6A 3R61A 2K4BA 2ZFWA 6PAXA 3DV8A 4Q5SF 3QRFF 3HUGA 4P55A 3T8TA 2PBIA 2BYVE 2XVCA 2H6CA 3KP3A 2WV0A 1QO0D 1LQ1A 5BPIA 1P4AA 3JSOA 2K27A 3QP5A 1EH7A 1XN7A 3L00A 4RB0A 1RI7A 5E17F 5E8IA 3IRQA 2HZTA 4GYIA 4HX4A 2Z99A 1S7AA 1K78B 3DXJF 1OR7A 3MWMA 2YPRA 2D45A 3B73A 4IXAA 2FA5A 3W6JB 1TW2A 3GX4X 2STWA 1ZG3A 2HDCA 2DK5A 3BJ6A 3WE3A 1R1VA 5TRDA 1XD7A 3KCCA 1MDMA 1T98A 1KU7A 1Z6RA 4S04A 2GZWA 1XSVA 2KIFA 4NHJA 1IXCA 4L5JA 4MTDA 2FBIA 1IRGA 1FP1D 5DCFA 3FXRA 3M9AA 3LFKA 3E6DA 1I1GA 2B0LA 3P9CA 5JHUA 4HA8A 4L18B 5LHHA 2DU9A 5AONA 3C3WA 2XAQA 2FU4A 4HAMA 4KFCA 1JHFA 2PG4A 3TQNA 2W84A 2E7WA 4PZJA 1IAWA 2PJPA 2VOPA 4IPAA 1G3SA 5FB2A 2K02A 1IW7F 2ZKZA 4XBFA 2GIVA 3ABUA 5K1YA 1F1ZA
chains in the Genus database with same CATH superfamily
2DFEA 3F8NA 4PSWA 1A6QA 2CYYA 4LLGF 2P5VA 2DFHA 1IN7A 3TO7A 3DLLF 3TW7A 4XK4A 2A6TA 4PFPA 1OPCA 3FXLA 1L3LA 1Z67A 2IAIA 4MHGA 2ME0A 2XROA 2L9NA 1RZ4A 4BEHA 5HOOA 1NH3A 3E7LA 2JVHA 3EETA 1QQIA 4R1HA 3OS1A 3F3XA 3HGGA 4JOMA 1Z9CA 1YE9A 1LFPA 2XB0X 1C0WA 1HDDC 2QWWA 2OF7A 2AXLA 1HC8A 3DFGA 1D0ZA 1PYVA 2DMUA 4AU7A 1LB2A 4YG2F 4BHBA 3FXQA 4YIFA 2LFBA 4IO9F 4BYYA 3ASNH 3S2HJ 1DP3A 4DIQA 2OUMA 1B1BA 3G1OA 1X1AA 1JT6A 1I39A 2EA2A 2EPFA 2CU7A 2V26A 2KZGA 2HPIA 2ZJPF 2ESHA 3V7SA 5ICGA 1GVDA 3FM3A 1T56A 2LY2A 3DLAA 2FUG2 3HOSA 1P2FA 3U21A 2PJRB 1Y39A 2V9VA 1G6NA 1WJ5A 1VNDA 5F1RA 2KL4A 3CUQC 1Z91A 4LJZF 4O3MA 1TZLA 3RZDJ 1MJAA 2N8GA 1FIPA 3OYAA 3CJTB 1U5TB 2PMUA 1LNWA 4L0YB 3DKYA 4JYKA 1QVTA 4HQEA 1Z3YA 3PNVA 3Q0VA 4I0AA 1JHHA 4R8HA 4G8XA 1QHGA 3HGYA 3K69A 3S1NJ 4IJAA 3JAMZ 5DDGA 2O9LA 3JCUC 5DUKA 2P0WA 3OYMA 1T8IA 3P5JA 2BY3A 1MBJA 3LQQA 3S1MJ 5LRRA 1UB9A 2BE5F 5H2FC 1OCTC 3BZKA 1K6YA 2VXDA 4MFEA 4MIMA 3ECOA 1Z3XA 1DGRM 2NAZA 4X0GA 4LOCA 2YSRA 4FHTA 3LAJA 1E3OC 2Z3YA 1PP8F 2DOFA 2UXNA 4E4HA 1F9NA 1T95A 2L9VA 2D5VA 2EH3A 3A2KA 1R7JA 1FMVA 3RPUA 2MC4A 2PX9A 2HTSA 5KNLA 2HOSA 1IN4A 2VKVA 3OYFA 4RAZA 3LWFA 1OYIA 2CRGA 3HHGA 2CQKA 3GVAA 1DGWY 1R00A 3L7WA 4AVZA 2EZIA 2EFOA 2JTVA 3HOYJ 3SEQA 3KYLA 2EBIA 3WG7H 5L3GA 3ZQLA 3K4KA 1EKEA 1G59A 4A6DA 5D5WB 4BY1J 3SFIA 1REPC 3ZMTA 1ZAOA 1SFKA 1SC7A 2BY2A 4IL6C 3DPUA 4FQGA 4AVPA 3KYCB 5KK1A 2X9DA 2BEOA 3BY6A 4WCGA 1Z7LA 3E3VA 1IN6A 2GIZA 3RPUD 3BR6A 2GXAA 3QYFA 2KKOA 2MLKA 2JK3A 3KP7A 3L9FA 3OR2C 3SZPA 3N97A 3E6BA 3RJPA 3JRIA 2QSHX 2W24A 1JXSA 2ZXJA 3PUFA 5D6FA 2HQNA 5EG0B 5LD2C 1YG2A 4LLLA 1GV2A 3S3OA 4U0WA 5F04A 1BM9A 2VJ5A 2KDOA 2TRTA 4PSXA 2F5DA 1CF7A 4XMYA 1R6RA 2QLZA 1G4DA 1RUNA 1FLIA 2YX7A 3L09A 3A1YA 3CLOA 2VODA 1B8IA 2E71A 4EMSA 1OYWA 4UV9A 3O3KA 4E7KA 2OBPA 2D2WA 1U0JA 2NS7A 1OKRA 1I5ZA 3DF8A 5JFRA 3CMAI 4ZTFA 1U6GA 3UR3C 2FX0A 2IA0A 3N4MA 1YTYA 1RUOA 1TBXA 2HTJA 4HYEA 5D6EA 4CYCA 2R7TA 4S05A 1S7EA 1ZK8A 2E2IJ 4AUXA 3HDDA 4BUPA 4K2EA 1MNEA 4HF2A 4CH7A 3WTSC 2K9NA 2DA2A 4EVIA 4DGWB 3OS0A 4W97A 3WHBA 2DJNA 2QA4I 1F36A 2AQEA 2FNPA 3LFUA 4GCVA 3ZOBA 1ULYA 4AYBA 5F08A 1QBJA 3C1DA 1X1DA 2MH2A 4JQFA 3TDZC 4M72A 2HEOA 3V8KA 2KZVA 3RZOJ 2MFZA 1O3TA 2FRHA 4BXXJ 5FLVA 1UFMA 1LJ9A 4DBQA 4PDKA 4DW6A 4RDUA 2WC2A 2HR3A 5JI6A 5HS9A 2IBDA 1HW5A 2QBYA 1NTCA 4Z6YA 3PUBA 4RLFA 4A3IJ 4U0VA 2H6BA 4ZC3A 2L9RA 5HDKA 1T33A 1IRFA 4IZZA 1R4MB 3BWGA 1HOMA 2VASA 2FJ1A 2DA4A 1ONVA 5FKMA 1D8KA 2K4JA 1BA5A 4J00A 4YFNF 2QVOA 1BR1A 5TJJA 5GTIC 4NC8A 5ILUA 2EK5A 2M8GX 2O6GE 2NS0A 5CPRB 1VQNI 2QKLB 4CCNA 2NVXJ 2X85A 3H35A 3KX2A 4U0YA 4A3DJ 2H1LA 4EGZA 3HUGB 2EINH 5LBQA 1X2NA 2BXYA 4NUBA 3QYEA 2DPUA 2KFDA 5IP9J 1ZH5A 4FASD 1T6SA 2A05A 2HS5A 2HXOA 3U1DA 4EATA 2OU2A 1AU7A 4IX7A 5EJCA 5LFAA 4B1RA 2UWMA 2DMNA 2LDUA 3MEXA 1ENHA 1Z1DA 1HCRA 1XCVA 3CCMI 5M5WJ 1DU6A 4MTEA 4AYBN 1SAXA 4M6XA 3AG1H 4UUSB 2F5EA 1R9TJ 4MQ9F 3E6MA 3J7AY 1VQ7I 2NNNA 2X1DA 4A0YA 3CESA 1RESA 1YYVA 2CQXA 4M3GA 4A5NA 3PL8A 1ZLKA 2CS3A 3I5UA 4L9TA 3A0BC 3R4KA 2EA4A 5LGNA 5GADJ 4NQWA 2DFFA 3FMRA 3NAUA 3L2VA 2V79A 3OYIA 2RGVA 2DOAA 3Q9VA 3KZYA 4XRSA 1SD5A 3FM5A 4HV6A 5D5XB 1R5ID 4XKVA 3QWLA 3A4CA 2R4GA 4M3BA 1T39A 3K4BA 1FC3A 3K4JA 2O8XA 3VSLA 3ASOH 4BQNA 2COBA 3DBRB 2IS6A 3CQZJ 5IT9Z 4RGSA 5LHGA 1FMWA 2NNYA 3ELKA 3L2WA 3L1PA 1HXDA 4HF1A 2LH9A 1VQMI 3QPLA 2BY0A 3LL7A 2HQRA 3SQNA 1MDMB 2L5QA 4E7SA 2ESNA 3CDHA 4CHUA 2L9SA 1Y8QB 3BDDA 1B6AA 3H9GA 4GRIA 1XMAA 1WJDA 1HKTA 1ZGAA 2OJED 2M2EA 2DJIA 2QUFA 3CD6I 5BS6A 4RS8A 1I1SA 2ZFUA 4JX4A 1LE8B 5IOYA 3DQVC 3QYBA 3PIPF 3BG3A 1UELB 1HLVA 4CDGA 2L4MA 2DTRA 4A3EJ 1IDYA 4XM3A 2JSCA 1TW3A 3HOWJ 3FX3A 2WADA 1R1TA 4PGGA 4KISA 3HOXJ 4XSZF 3MVPA 2ZJQF 4BY7J 5IT3A 2QQ9A 4ZH4F 1ZQ3P 4RA2A 2R7VA 2WY7Q 2IGKA 2EWNA 2VE8A 3E5UA 4II2A 1WCMJ 4RGXA 4ON0A 2LF7A 2CUEA 2QKMB 4XLNF 3R60A 1ETWA 1T2KA 2DI3A 2P7CB 3KZZA 4QSHA 2DTZA 2XRLA 9ANTA 4FX0A 3QQAA 4F92B 3G4SI 3EUAA 2E7XA 3DTEA 4BHCA 2IEKA 3C7JA 4A3KJ 3F22A 3BG9A 4AIDA 1ZRCA 4BNCA 1H0MA 1XGNA 3T1BA 3CCJI 3GBGA 1RKTA 2F6CA 1R4NB 2Z1DA 3I59A 3A01A 4BQAA 3R0AA 2CW8A 2ZXIA 3VB2A 5HLTA 4JX6A 3T0YA 4RGUA 1S72I 2ETHA 4FE4A 2ZO4A 2P5KA 2VKEA 2K5CA 3D5RC 3S32A 3KP6A 1O57A 2BY1A 3ZMUA 1ZR4A 2EV5A 2LNBA 1YQAA 3HYIA 4BEHB 4RB2C 3GW2A 1JE8A 5JLXA 1BI0A 5F0FA 2ZJRF 5HODA 2KLOA 3WU0A 3NWSA 3O8GA 5FGMA 4BQQA 2VBYA 2MYSA 2MLGA 5E1WA 1F4KA 1R23A 1VQ6I 2WBMA 3AKZA 1N25A 5CQGA 4RLQA 4GO1A 2JJ7A 4LFUA 5DTDA 5BQTA 3H3VK 3OYJA 1K79A 2RV8A 4BE2A 1KZHA 2ID3A 4EJTA 2W82A 3TO6A 4CO8A 4RAFA 4Y33A 2ECCA 3RKXA 4HDVA 3J7AO 5LGTA 2JPBA 1BIBA 2L54A 3MMYB 4A3GJ 3DPTA 5F64A 4FX4A 1X3UA 1Z05A 2HPMA 4WK8F 1G8XA 2F4MB 1GUUA 3RKYA 1A04A 2E19A 1ODDA 4UHTA 1J7KA 4E7JA 2O61A 1G3YA 3OWTA 2IS1A 4A93J 4M73A 4HNTA 2E1OA 2R7UA 3ZQQA 1I27A 1VTNC 3J81K 2X1CA 2V1NA 3CCLI 1E3PA 2J5OA 2AQFA 3QU3A 4N0BA 3LSTA 5HS7A 4IQ4A 2ZMEC 3M8EA 1BR2A 3VFZA 4ZZLA 4DZPA 1IN5A 2A3SA 5A2QK 1LKXA 4LK0F 2XF6A 1BI2A 2VE9A 4EM2A 3FZVA 1OCOH 2DQLA 1JKQC 2IS4A 2O03A 2LP0A 3H3ZA 4KITB 4IF4A 3CJRB 1Y0UA 1DUXC 4HEA2 5E3OA 3HEFA 5J3LA 4X1EA 3S1QJ 1YS6A 3ROUA 4E6KG 5D5UB 1WJCA 2W25A 2W00A 3U1KA 1FBSA 4KUMA 2VXZA 2V1DA 4LGWA 3OS2A 4M6VA 3TW6A 1W5CC 5EEGA 4OU0A 1EA3A 1QGPA 1VF9A 2WV1A 1FZPB 2F5CA 4EM1A 3TL4X 4D0PA 4KNYA 2RNGA 2IGNA 3JRDA 5CLSA 1P4XA 1S3JA 1GVJA 5L3BA 4XICA 3I4MJ 4XORA 3QPHA 2I8DA 4AIJA 4UB8C 1JTYA 3IP4B 3I4NJ 1ERDA 1W0UA 3VPRA 1DP7P 3TDUC 1BOAA 2JPCA 3ONQA 2XDVA 1MBKA 1MMAA 1UG2A 2BHZA 2FOKA 2DT6A 4B3XA 3B6CA 3WTXC 1D1BA 2L01A 2O5RA 5JR3A 3MZHA 3CJQB 1ETXA 2EV0A 2R7FA 4UVAA 3S93A 2IRFG 1MNDA 2G7HA 2KJCA 2DO7A 3JRFA 2YU9J 1LPQA 2JN6A 1R36A 1CF7B 4UUVA 5FROA 4IRHA 4Y15A 3W2VA 1N77A 3QPTA 2NVTJ 3W6VA 1B8IB 2WAQA 2GXGA 3V8JA 2M7BA 5JLWA 1HDPA 5EF6A 4KMFA 5JVTA 4OMYA 3BJOA 3KEOA 3AL0B 1GT0C 3F9KA 3CCVI 3CMMA 3EUHA 1ZG1A 5FD6A 4CICA 1TLHB 4CYCB 3GZ6A 1X4OA 2BHYA 2KIMA 4V2GA 5LHIA 2LY9A 4S0HB 2EZHA 2VONA 3S2DJ 2HDWA 4ZZDA 3K70D 1YS7A 2L7ZA 4M71A 5DYMA 5AIPA 1D1CA 1KQ8A 2L7MP 2HYFA 1XTAA 4CZZA 4DQ2A 3OYCA 2VB6A 2XF5A 3OYGA 2DDAA 3LQRA 4ESJA 2C6YA 1SMYF 3G1LA 4CCMA 1MMSA 4ZYDA 1POGA 4XRSG 4PCQA 4M9SA 2X0LA 1FP2A 3N05A 4XKCA 3WU1B 4KJZA 1GXPA 5IYDJ 1V5GA 4QPOA 3SZGA 1HKSA 2HVQA 2CUZA 3GFLA 4P9FA 2XGCA 3BC8A 4RAGA 4D7MA 3BJAA 5ICEA 2Y0SA 1IUFA 4KIFA 4BDZA 2QBYB 2LRDA 4M74A 3S2WA 1PUFA 1IC8A 2OTLI 2DA1A 2ELKA 3CP8A 4XN0A 5GTHC 2PQ8A 2R3SA 2WAQN 3MKLA 2E34A 5D4RA 3BZ6A 3TP0A 1STZA 2BVMA 3CC2I 5D4SA 2LC2A 4BXUA 5EEHA 5FLXZ 4A5MA 3BP8A 5GPCA 3J80Z 1ORKA 2V4JC 4WXDA 2E1MB 4JX5A 1A35A 2XB5A 2JA8J 5H6RA 1I3QJ 1IF1A 1QA6A 4OIRF 4HRIA 2ADUA 3OYKA 2DA5A 1ON2A 4Y3OA 1O7LA 2CV2A 5J8FA 1H89C 3LSMA 5IPAA 2E1NA 4LB6B 4Y17A 4EJWA 4DBRA 1JKOC 1MZBA 2CUFA 3OOPA 2DMPA 1U2WA 1KU9A 5HLGA 1ETVA 1XC5A 3BLYA 5KHDA 2BW3A 1LFBA 4YEJA 3M1CA 3LMMA 3H92A 5ERIA 1B72A 1XCBA 3MD2A 5FO5A 3BTJA 1JGGA 3DBHB 2LR8A 2ZB9A 4HNVA 4KYWA 3OY9A 2O3FA 3BOQA 5HLHA 3ZQHA 3V4GA 5HDNA 1YHQI 4YIIA 1U9NA 2ZXWH 4NQWB 5F27A 2IA2A 3IV5A 2A61A 3FBNB 3BG5A 1BR4A 1FNNA 2Y0SN 1OMIA 2J5PA 4IVNA 5LLQA 4LB5A 2QGUA 3SFZA 3CJNA 3GTGJ 5DCMA 2COMA 3HB9A 1AKHA 4IOAF 3TBIA 3QOPA 4KT6A 1RR8C 2XHKA 4WXCA 3S1RJ 2WY8Q 2XAFA 5K7FA 3FMSA 1E17A 3BQZA 5EGOA 1V4RA 2VQGA 1A36A 3BCAA 4U88A 2O0YA 4HZFA 2NOGA 3CUQA 3K4LA 3GTOJ 4G7ZF 3HTSB 1T0FA 2XGDA 2GM4A 1I50J 4IRIA 3VODA 2OQGA 1ITYA 4ANJA 3MN2A 2JA7J 1WH5A 4HSTA 1IZ1A 5J1UA 2DYRH 2HVRA 2RC4A 5BOXA 1R71A 4KN4X 2NS8A 4NNJA 2OC6A 5J1RA 2E36A 3I71A 2E2HJ 4ZYHA 5E20A 5ED4A 4YFXF 3ZMVA 4YFKF 2H1KA 1ZRFA 2WAFA 1HA8A 1LVKA 1RIOH 3CMEI 1FT9A 5IYCJ 1AOYA 1KGSA 5CVVA 3IL2A 1D0XA 5FKOA 1VZ0A 2FMYA 3BG7A 5GAHJ 1J0RA 4OWRB 3WG9A 3ZQ7A 1VQ4I 2PMHA 2K86A 5M3FJ 2QF7A 3PQKA 4IRGA 4HSRA 4M9XA 3Q3SA 4NBQA 1FYKA 4ITVA 2FMLA 4NDLA 4Y4RA 3GUDA 4E7ZA 3I53A 3IC7A 3GTQJ 3I59B 3VWBA 1LDJA 3A01B 2D1VA 3MQ0A 4HF0A 4RB3C 3NARA 4JK1X 2K3FA 3RQIA 4B09A 2AS5F 3HJEA 5CQEA 2VKDA 1MJBA 3J7ZI 2JRMA 2OZUA 3JSPA 5CVIA 5E3LA 4GXOA 1SFEA 3FXJA 2FXAA 3SEZA 1JUPA 2XGEA 2JMWA 1Y56A 5TGTA 3ZN1A 2XIGA 2HZDA 3A02A 3REOA 5B1BH 4BJTA 4XIDA 1R49A 3LA2A 3NWTA 1MH4A 1U8BA 2X6XA 5J47A 2RVCA 2DXIA 5DUIA 3U9GA 3FDYA 1B4AA 2M34A 1IDZA 2ZNYA 3QOEA 3HPGA 2V1UA 2R5YB 3OIPA 2R0QC 2FBHA 2B63J 3CMYA 4RGRA 2VC1A 3GF2A 4HX8A 4G7HF 4UY8I 1FYLA 4XL9A 1W7PA 2VBZA 3WTTC 4MQVA 3ZQIA 1B59A 4E7HA 5BPDA 3PJRA 5DD4A 2H27A 1D8JA 3WTWC 3E1SA 2K3PA 3I0TA 2VBWA 2FD5A 1AWCA 2Y31A 5C44J 2IS2A 2ICWG 1W5TA 1UCRA 1XG1A 4RAYA 5CJ9A 3X2QH 3AG4H 4ESFA 4NB5A 3CF2A 4Z2YA 4A2UA 5B3SH 4LG0A 2XAUA 3IAS2 3LA3A 3FISA 4A12A 2PFBA 3FKIJ 1RNLA 1BN5A 1BIAA 5DD8A 5HLIA 3TO9A 1GLNA 2EJRA 1W7PD 3DEUA 2GXBA 1R5HA 1YX5A 4XKWA 1OCPA 1HW2A 2ZJ2A 2P5LC 4L9VA 2Y9ZA 3L2CA 2QZ8A 2F4OB 4M9ZA 2XUBA 1K7AA 3VYRB 3PO3J 1GDTA 5DV5A 4ZYAA 4EGYA 2EIJH 4FT8A 1WPKA 2EQRA 3DU6A 1SMTA 4HOBA 4QIWN 1I3AA 2KHMA 2RDPA 2E35A 4DYRA 1PUEE 3AG3H 5CVRA 4E7IA 3CLQA 2ME6A 1V3FA 3DTIA 4YELA 4B44A 5BNGA 4ETSA 3GTKJ 1QZEA 5J4VA 1XPXA 1P92A 2UV1A 3S3MA 1D1AA 2G7UA 3OIQA 1H88C 3TP3A 3QP6A 3U2RA 3OSGA 1ETQA 3Q0WA 3OV8A 4YRVA 2HKOA 1PJRA 2IT0A 2M87A 4TV7A 4B4CA 4XOPA 5K7HA 1QU3A 3ERMA 2VJ4A 2L3DA 4L9NA 3KETA 4UUTA 5ILSA 1A6IA 3RI4A 2EZLA 1MKMA 1HSTA 3GWZA 4M3EA 1Y0NA 3I55I 2R7QA 1Z21A 1EH6A 1LDKB 4OIOF 3E97A 2VKHA 4XN3A 2RREA 3JAMK 1YOVB 2X6YA 4HW0A 2LKSA 1JUSA 4F52A 3F8BA 4Q47A 4D9JA 3V7RA 1BW6A 4U87A 1E0EA 3RYPA 3O8HA 2Z33A 2FQ3A 1YI2I 2BV6A 2VQHA 1FBQA 5FJ8J 1ACIA 1VQLI 2HOTA 4XRMA 2YUSA 3F21A 3GFIA 3HXLA 1U5TC 1TP4A 3K4CA 1FTZA 3K6GA 2VIXA 4A3LJ 5FLMJ 1VQOI 1DU0A 1W4MA 3FK6A 3PNTA 2OTJI 1S9HA 2VLAA 2RKHA 5LGUA 3DKWA 3NRVA 3AAFA 2F5FA 3K1MA 3F0CA 4JBAA 4B47A 2JVGA 1WH7A 3LA7A 3EPZA 3IRRA 3WTVC 3K4NA 2UZKA 1FPQA 2CH0A 1WKMA 3JRCA 2LSOA 5GPAA 3ZMSA 1LVAA 2CQ7A 4PFOA 3GXOA 4XSXF 2R7RA 5HNFA 2OZ6A 5EZGA 3F6VA 3LNQA 1KYWA 2EFQA 5CVJA 3ZRGA 2XKPA 4D7NA 1RRJA 2MABA 1FSHA 1SANA 3HRSA 2NOJB 2Z5UA 4CCKA 3DEWA 2F48A 1O3RA 3ZR8X 3HRTA 3LSPA 1JJ8C 1WJEA 4KMUX 1OJLA 2LVSA 4QWQA 3M8FA 4BHPA 2VPRA 4N9IA 4GYGA 1W36D 1P9QC 3CCSI 2LLKA 1F5TA 1K61A 5GAEJ 2DCEA 2R7ZJ 5H20A 4UXNA 2TCTA 4XLCA 2KIQA 2V1XA 3CCYA 1XSDA 3S16J 1UG0A 4G6QA 1D0YA 2FEZA 1TQMA 2ZNZA 3HHHA 3I9V2 2NVYJ 1BC7C 3W6KB 4EEFG 1Z7UA 2EB7A 3JRAA 1ZG5A 1VI0A 2VUMJ 2A5WA 2AHQA 5F6FA 3GTLJ 2M4GA 3KLNA 3G73A 1PUFB 2IJLA 2JRTA 1IRZA 1KU2A 2DA7A 2IW5A 3RTRA 3HM5A 2WA0A 1J5YA 5EEAA 3RQ4A 2BZTA 1RPWA 5GP9A 1MNMC 1DQUA 2V9PA 1R5GA 4IEJA 3HZJA 3S17J 2YX4A 2XV4S 4UV8A 2Y9YA 3LOCA 4HDUA 2LBFA 2JSPA 4XKBA 3ZQCA 2VPLA 4E7LA 5B1AH 2EIMH 3HRUA 3H5AA 2JA6J 3HIFA 5TISC 2VN2A 4MGRA 2GQQA 4P9UA 4G6TB 4H0EA 3OOUA 1Z77A 2B9SA 2F5VA 1IGNA 3OSFA 2XKOA 2R7XA 2HWVA 2RN7A 4BS9A 4DJAA 1X3WB 4LIVA 4N9HA 3OR1C 3K7AJ 2VQCA 2BW3B 2R5YA 3PIOF 3ZQFA 4WX9A 1B72B 3CCEI 1S7OA 1J75A 3V42A 2L7FP 3LSHA 3WTZA 1YRNA 4LITA 3GO5A 4AWXB 2A6HF 4IKFA 2M0CA 2HNHA 4IHTA 2LF8A 2CFOA 3C18A 4GGGA 3VOEA 2MC3A 5J8CA 1EJ9A 1KYZA 1FJLA 4BJ6C 3TEDA 2DODA 3K1PA 1FOXA 1SFXA 1EF4A 3QAHA 2DPDA 3VYSB 3BROA 1ETKA 2NVQJ 5IY5H 3M7GA 2CWEA 5K5OA 1APLC 1VQKI 4G6DA 5DCMB 1AKHB 3C2HA 3V7CA 1JTXA 2L02A 2W85A 1MGTA 2MBFA 5L3FA 1XB4A 2Q0OA 3EQLF 4GDFA 4KDPA 1IO2A 2XF7A 3D5LA 2XGXA 4Q4ZF 1DDNA 1QPMA 4OIPF 4MO7A 5EGOB 1LUJB 2WWYA 2FBKA 1TNTA 3KEQA 3ABMH 2WB1A 3CUQB 2YS9A 5E1ZB 1BJAA 2NVUB 2R92J 2LREA 2HQ5A 3KP2A 1P7IA 1SD7A 4LIUA 2ZXHA 2ZBKA 2DYSH 3K1NA 2DA3A 2L2OA 1QHHD 3WGIA 1IXRC 2W57A 2KT0A 2P8TA 3Q9SA 1ETOA 4I09A 2F2EA 2ZMEA 4CA0A 1O4XA 3H9JA 4I6ZA 2LOOA 2JQ7A 3CCQI 1PDNC 1EV7A 3ML6A 2LK2A 2OCEA 4D1QA 1Y6IA 1CGPA 3TMOA 1UMQA 5K7ZA 2G0EA 1WZ2A 4OMZA 1FIAA 5F1JA 3ABKH 2CW0F 1JJ6C 1AA7A 2R93J 1ZLJA 1MBHA 2HFHA 2NXNB 1EH8A 4KIBA 2XAHA 4U7BA 1TWHJ 4D5CA 3AG2H 2VT3A 4RBOA 3G71I 1JGSA 1PVEA 3ZQGA 1YFHA 1IG7A 4YIRX 1ZREA 3CDIA 1J2XA 3JTHA 3GFMA 4KT5C 4KN7X 5IT9K 3MZ8A 4IHWA 5JVGF 1LDDA 2H8WA 5LRSA 3J7YJ 3OYNA 3PQJA 3ZMZA 3HBLA 4WF2A 4ZJZA 2UUZA 1KA8A 5E1XA 3MKYB 4XLPF 4CCLA 1MMNA 3CDLA 1Y1VJ 1FBUA 3P9IA 5FKLA 3OYEA 1OR7C 3GFJA 1FY7A 1ZARA 3WE2A 3K70C 1Y8RB 4BE1A 2WB1N 3E0JB 4F55A 4NC7A 3CZ6A 2DW4A 2E2JJ 2QQ8A 4JP0A 3SHFA 3BZCA 3LSGA 2MD5A 2ISYA 4FISA 5L3EA 1MH3A 2M7AA 3ZN0A 3JRBA 1J59A 5C3EJ 1SVOA 1ETYA 2ID6A 3ABLH 4B3AA 3EUHC 5FFXA 2KMUA 3FXKA 3SDGA 5J40A 1XGOA 4G7OF 4MEXF 2OD5A 1W7PB 1S29A 4MLOA 3S8PA 4Y7NJ 3JRHA 2HGCA 1ZGJA 2R5ZA 4B43A 5H6QA 4Y52J 2ACJA 4UVCA 1HF0A 1XDSA 1P6RA 1YIOA 3K4MA 2JUGA 4C2TA 3ZGKA 3L2RA 1Y1WJ 1Q1HA 4XQFA 5KVRA 1FWZA 4I76A 4BE0A 4AC0A 1R58A 1XMXA 2XSDC 4AM3A 2V6EA 1BBYA 3COAC 5CVUA 3FWEA 2K9SA 4DYQA 3F8CA 2HOEA 1FX7A 3SXYA 2XASA 4LG0B 4B8XA 3CC4I 1BOBA 3HL2A 1YO5C 3D0SA 2Q2EA 1X2MA 2PMZA 1MMDA 3IHUA 2OV7A 2RAEA 1HBXG 1DPRA 3H36A 3IH4A 3OIOA 3R6SA 1O3SA 1WJAA 2F4IA 1QPIA 3LSKA 4DNCA 2VOOA 2FNAA 3BT9A 3E5XA 1MMGA 3ZPLA 3VYTB 1HSJA 1H9GA 1XGMA 1SVLA 1K83J 3LSRA 2EIKH 3IKVA 4F91B 4XRFA 3VEPA 1TNSA 2IA1A 3H0GJ 1FEXA 4I2OA 3ERED 2X48A 5FKNA 1VQPI 1YJ9I 3HOVJ 4Q48A 2DAOA 1MBFA 2ZCWA 3ZP5A 1NK3P 1FYMA 3PO2J 3KP4A 1ZHFA 4P5OA 2IGMA 2XRNA 4WWCA 2AO9A 3F8FA 2VI6A 4C9YA 3CO6C 2MA3A 3TOBA 4BJ5C 3KZIC 3C2BA 2R7SA 3FIWA 3DU5A 1F43A 2CV1A 2DBBA 2ZC2A 3OL3A 2VT2A 5IYBJ 3M4OJ 1XGSA 5EDNA 3EYYA 3RPQA 2QCOA 3GTJJ 2M45A 2CQNA 4MNUA 3G3ZA 3ESWB 3G6EI 4CCJA 2PMZN 1X1PA 3JR9A 2L0KA 1J09A 1P4WA 4PJJA 1MBGA 2GBYA 3NEUA 4X6AJ 1TWGJ 5E8GA 5KAFC 1WJFA 1B9MA 2HYGD 3F8MA 1OCZH 2W4SA 4IQJA 4AD9A 3WTYC 4E70A 3AFHA 3EUKL 3CCUI 2CW7A 2DMQA 4RM3A 3JTGA 4FTHA 4ZTJA 2FOWA 3E6CC 5DEQA 2BVLA 2EFWA 3L2UA 1VQ9I 1M1EB 2NRAC 1SFOJ 4OINF 1UJ8A 3MKWB 2AXTC 3E5QA 1RR7A 1X3ZB 4HV5A 4BU2A 2MD0A 3P7NA 3TOAA 5BMZA 1WI3A 4G9YA 2FE3A 3EYIA 3GTPJ 2LMDA 1IN8A 5LEKA 1T0FC 3WODF 3OMYA 4I01A 4LD5A 1YIJI 5M5XJ 4HLYA 5ICFA 1FSEA 2R7WA 1BC8C 2D1HA 3WGGA 1PP7U 3I54A 3IH3A 3BR3A 2CSOA 3GZNB 2IGOA 1V5FA 1ZKGA 4ZYEA 3I4PA 1OISA 2LG4A 3DEEA 4OAZA 4CSWA 3KLOA 4IHYA 1RKWA 3CP2A 5J6XA 4OIQF 4KICA 4L0ZB 4GFBA 2QM3A 1ON1A 1JKPC 1B9NA 4CXFA 2RNJA 3MFKA 3WGHA 3MCZA 1NK2P 3CO7C 3OYHA 2X1EA 4PJLA 1BI3A 1QZZA 2ZSHB 3HPHA 4UB6C 2XAJA 2XSJC 4EJUA 5E3MA 1T38A 1V5EA 3D1NI 2R7DA 2ZSIB 2VJJA 1WGXA 2X51A 3GLXA 4A0ZA 1YW7A 4FETA 5B5EC 1MBEA 1Z6TA 1U78A 3ECHA 4A69C 3S3NA 2VJIA 1IRXA 2Y0MA 1FOYA 2LBFB 3BCBA 3FK7A 2TDXA 4Y13A 3K2ZA 4HLXA 5C4XJ 2RQPA 2K9QA 2PI0A 4XLFA 4P1WA 3KPHA 4XLHA 5KCMA 3K2AA 2HQAA 1G3TA 4HBLA 4AIKA 3HSRA 5J4YA 4OOIA 3BTLA 4ASNA 5E79C 3WHCA 1I6XA 2KRFA 3BR0A 4IOCF 4CZCA 1OQYA 2QQBA 5EYRA 3RSNA 5EZHA 1JT0A 4XOTA 3RKWA 3ABTA 5B66C 5ILVA 3AL0C 1AHDP 2XPVA 1SFUA 3DTKA 2LKXA 3S14J 3H3UA 2YR2A 2DFIA 1XX5A 3UNGC 3GMEA 2WTEA 1OLTA 1K78A 4XLAA 4C2UA 2B7EA 2E5NA 2E60A 4J01A 1YRNB 3DP7A 4M6YA 1FOKA 4G12A 3M8JA 4A6EA 3S15J 3RYRA 4NC6A 2RQQA 1WRJA 3B6AA 3RKQA 4AIHA 2Z16A 2Y75A 4G94A 3HTUA 1MSFC 2BBYA 2M1BA 3IUOA 1GXQA 2V9KA 1N75A 2A6EF 2OAZA 4I98B 3ZCOA 2W48A 2NYXA 3EDPA 1YW8A 5J1YA 2KIUA 2DQRA 1YLFA 2X4HA 4L5EA 4N4NB 1V54H 3C2GA 4HG2A 4PJ0C 5FLXK 3J80K 1D5VA 4KA4A 3IKTA 4QTRA 2GWRA 2KP6A 5CKTA 3VDXA 1MW7A 2M8EA 5ICCA 1UAAA 2X6OA 4XLEA 3HG9A 1OYYA 1QNTA 4F93B 3HRMA 3O2PE 4O5VA 4P96A 4B48A 1XS9A 1HW1A 1U9OA 1T08B 1JUMA 3ISPA 2LD5A 3O6BB 3H1CA 2IP2A 1K4SA 4ABZA 2PEXA 2ISZA 4IHSA 1MD0A 3PFIA 4ENNA 2Q1ZB 1GHCA 1O3QA 2FSWA 2OQRA 2ZMEB 2H09A 2X6WA 2E1MC 4HX7A 2IXSA 1YX3A 3ULQB 2STTA 4M3FA 5D5VB 1TWCJ 1XDUA 4C3JJ 1V55H 4EQQA 5L3CA 3FMQA 1J9IA 1OFCX 4WXHA 3QU6A 1HQCA 5AIQA 2UXXA 4A3JJ 3BR5A 3FBIB 3B02A 2OA4A 3J81Z 1Q1VA 2R7OA 4CCOA 3HC7A 3JW4A 5D8KB 5L3DA 2VC0A 1N78A 3BQYA 3I58A 2I10A 3CCRI 5HVQC 1RC9A 4HNUA 5DS9A 3QODA 3TKYA 5A2QZ 4KIGA 3FHZA 2IPQX 1VQ8I 1X58A 1OCCH 4F3QA 4L9JA 2WAEA 4BAYA 3FF5A 2MH9A 4II3A 4ESBA 2YU3A 1WWXA 2HOAA 2HYJA 1YJWI 1UHMA 2K40A 2GA2A 2OCCH 5K5QA 3M3YJ 2CMPA 2HU9A 4HPQA 1L0OC 4DOZA 4FE7A 2Z2SB 3KIOA 2Y48A 2A07F 2A69F 3CF5F 1WJBA 2DT7B 4XNFA 3TGNA 2LTPA 1W36C 5M3MJ 1WFXA 4EJVA 1TQIA 2PJRA 4UNOA 3MKZA 2I5UA 3G2BA 3K10A 2QSFX 2ELHA 1E2XA 1QZYA 4F7ZA 1NG7A 1KQ0A 1U5TA 2R5ZB 1P7JA 4W1UA 2P7VB 1RETA 1QVUA 3RDIA 3Q0UA 1YJNI 3FXOA 4XR6A 2KRHA 2Y2ZA 4A0XA 1YITI 3KP5A 1NHAA 1W0TA 3F6OA 2JZYA 1UZCA 4EV0A 4IHVA 2CO5A 1SAUA 2M3AA 3G1MA 2JT1A 5IP7J 4FCYA 4M3DA 2GA1A 4O6JA 2W7NA 3PSFA 5FD5A 3UKGA 3GEZA 3GZ5A 3SYTA 3JREA 3PM1A 3DPLC 1ZTRA 2L4AA 5FFZA 3VYUB 2Q2EB 1BL0A 3RIRA 4C30A 4I99C 4HQMA 4CGZA 2IVMA 3F23A 2A68F 4EJOA 2A5YB 2KPMA 4RB1A 3D5SC 2EFPA 2P81A 2KRCA 3IH2A 2PLYA 5FRNA 1TC3C 3SZTA 5HDGA 3FXUA 3HOUJ 1IV6A 2CG4A 4U7DA 3F72A 2CGPA 3H5NA 3W2AA 2JA5J 3GCMA 3T8RA 5F0HA 4C3HJ 3LSIA 2L7KA 2QQAA 1WSUA 1A31A 1R1UA 3GTMJ 4XONA 3BTIA 3W2WA 4LLNA 5DM7F 1I6HJ 2K9LA 4EM0B 1FTTA 1S8NA 2KJBA 1TL8A 1LFUP 3BPVA 4V2FA 1G3WA 5KAIC 1U3EM 2EZKA 4BDYA 3FKJA 2XPUA 3NQOA 4R79A 3GLLA 3HKZA 3KYDB 4PK4A 1IXSB 3KE2A 1KU3A 1TQPA 2M4KA 1BI1A 3P9KA 4ENMA 1SVMA 4D5FA 4ZDOA 2HVSA 3KFWX 3MZYA 1JI8A 2DMTA 2QYOA 4ZDPA 4C2MJ 1ZRDA 1WQ2A 4LK1F 2LKPA 5CYVA 1ZN2A 2Y69H 2VBXA 5EG0A 4H4KC 2W1OA 1MJ9A 1SD4A 2BGCA 2P6TA 3VSKA 3FXMA 5K5RA 3KEYA 3IWFA 4ENKA 1WI9A 3WTUC 2JUCA 2G9WA 3T5XA 1HKQA 2P4WA 1H8AC 2LYCA 2DLLA 2FF4A 4LG3A 5HS8A 1S5LC 2XAGA 1W5SA 3M1EA 4LMYA 1TWAJ 1O7FA 1K6OA 1BJZA 1TTYA 3HSFA 3A03A 4RMNA 4I0BA 4C3IJ 2E5ZA 4I7HA 3DCFA 2P6SA 3GYHX 1DPUA 5FRMA 4DZJA 1KQ9A 1U8RA 2K7LA 4L5IA 3WU2C 4I02A 2M5WA 3BR2A 4BKXA 3CUOA 3W3CA 3PFYA 2GOMA 4A3BJ 1XSXA 1K4TA 4ENJA 2DT5A 2GAUA 5LEJA 3L2QA 4ZYGA 2O8KA 1S6LA 4BBSJ 2V6CA 1ZYRF 3LAPA 2ELJA 3BPXA 2VL8A 4V19K 3HKZN 2MGQA 3OL4A 4MEYF 3ZMDA 2DN0A 3K9TA 4RM2A 3ZXSA 5E18F 1R22A 1USSA 1UHWA 1USTA 2PN6A 2Q8KA 4BH9A 2M30A 1SD6A 4IHXA 1X4PA 3I64A 1LEBA 3V8LA 2H94A 3BTCA 3H0DA 2E1CA 2OPTA 3IWZA 4QLCU 1JKRC 4UVBA 2HKXA 2DK8A 3DBLB 1XMKA 4CUGA 2KQRA 1WHUA 1QRYA 3K0LA 1IUYA 4N4OB 4PJNA 2M0MA 2EFNA 2QENA 3IAM2 3R0JA 5F0CA 1TT0A 1LEAA 4A3FJ 4A3CJ 1YW9A 3HSEA 2DOEA 3PSIA 3MAJA 4PGHA 2Z9OA 2CFXA 4CYDA 3Q5FA 3HOTA 5D8LB 3CTAA 1D3YA 3A0HC 2Y30A 1VQ5I 1SEUA 1BW5A 2EV6A 3OYBA 3R61A 2K4BA 1G2HA 2ZFWA 6PAXA 3DV8A 3M07A 4ZDLA 4Q5SF 1VFCA 1NG6A 3QRFF 3HUGA 4PJMA 1ZELA 1H9TA 4P55A 5IOZA 3T8TA 1FOWA 2GOXB 5GAGJ 4BBRJ 1Z0XA 2PBIA 2VQLA 2BYVE 2BXZA 5HNHA 3LSJA 4BQOA 2XPWA 2XVCA 2H6CA 3KP3A 2WV0A 1QO0D 1D5YA 1LQ1A 5BPIA 1P4AA 3JSOA 4UUSA 2HXIA 3OYDA 3H5RA 2K27A 3QP5A 1EH7A 1XN7A 3L00A 4RB0A 1A5JA 1RI7A 3DWLE 1ZR2A 3I56I 5E17F 2MG4A 2MW8A 2O7OA 5E8IA 3IRQA 2EILH 2HZTA 5FKKA 3DKXA 1X19A 1X1CA 2CQQA 2FQ4A 2Z99A 4GYIA 4HX4A 4MFDA 1S7AA 2DA6A 1K78B 3DXJF 1X1BA 1OR7A 3MWMA 2YPRA 5JHFA 2D45A 2LY1A 3B73A 4BL0B 2JWTA 4IXAA 2FA5A 3W6JB 4BGDA 1TW2A 3BG6A 2CV0A 3GX4X 2QSGX 4DYCA 2STWA 3CC7I 3HOZJ 1ZG3A 2HDCA 2DK5A 3BJ6A 2MSYA 3QPSA 3WE3A 1UHSA 1R1VA 5TRDA 2H8RA 1MIJA 1XD7A 3KCCA 1MDMA 1T98A 5M5YJ 1E3HA 1KU7A 1IV8A 1Z6RA 2HI3A 2M9HA 4S04A 2GZWA 2XC7A 1XSVA 2KIFA 3H9QA 4NHJA 1IXCA 4L5JA 3JRGA 2K85A 3BR1A 1CQTA 1KONA 1LE8A 4MTDA 1MSEC 2FBIA 1IRGA 3OYLA 1FP1D 2DDBA 5DCFA 4BXFA 2CUJA 4J19A 3FXRA 3M9AA 2K9MA 5E3NA 5C4JJ 5DM6F 1TWFJ 4OAYA 3LFKA 3E6DA 5IP6A 2KDZA 1I1GA 2B0LA 3P9CA 4PUSA 3RCOA 5JHUA 4HA8A 4L18B 3FHNA 2JA2A 5LHHA 1TT5B 2DU9A 5AONA 1WVRA 2XAQA 3C3WA 3I3LA 2QEXI 4A3MJ 2FU4A 2BOLA 4HAMA 4KFCA 2HDDA 1JHFA 2KISA 2PG4A 2CJJA 3TQNA 2W84A 2V7FA 2E7WA 4BACA 1GV5A 4PZJA 3PNYA 1ZGWA 1IAWA 2PJPA 2VOPA 4IPAA 1G3SA 1OCRH 5FB2A 2K02A 1IW7F 3SJMA 1W1WE 2ZKZA 2ECBA 4XBFA 3SDBA 2GLOA 1IJWC 2GIVA 4QPQA 3ABUA 5K1YA 1F1ZA
chains in the Genus database with same CATH topology
3F8NA 2CYYA 4LLGF 2P5VA 3TO7A 1IN7A 1OPCA 1L3LA 4MHGA 2XROA 1RZ4A 5HOOA 3EETA 1QQIA 4R1HA 3F3XA 1Z9CA 1C0WA 2QWWA 2AXLA 3DFGA 1LB2A 4YG2F 4BHBA 3FXQA 4YIFA 4BYYA 1B1BA 2EA2A 2ESHA 3V7SA 5ICGA 3FM3A 3HOSA 1P2FA 2V9VA 1G6NA 5F1RA 4O3MA 4LJZF 3CUQC 1Z91A 1MJAA 1U5TB 2PMUA 1LNWA 4L0YB 4HQEA 4I0AA 1JHHA 4R8HA 4G8XA 3K69A 4IJAA 3JAMZ 5DDGA 5DUKA 3LQQA 5LRRA 1UB9A 2BE5F 3ECOA 2NAZA 2YSRA 4FHTA 3LAJA 2Z3YA 1PP8F 2UXNA 1F9NA 1R7JA 3RPUA 2HTSA 1IN4A 4RAZA 3LWFA 1OYIA 3HHGA 2CQKA 3GVAA 1R00A 3L7WA 2EFOA 2JTVA 5L3GA 4A6DA 5D5WB 1REPC 3ZMTA 1ZAOA 4AVPA 5KK1A 2BEOA 3BY6A 4WCGA 3E3VA 1IN6A 2KKOA 2MLKA 3KP7A 3L9FA 3N97A 3SZPA 3E6BA 3RJPA 2W24A 1JXSA 2ZXJA 5D6FA 2HQNA 1YG2A 4LLLA 4U0WA 1BM9A 2F5DA 1CF7A 2QLZA 1G4DA 1RUNA 1FLIA 2YX7A 3L09A 3CLOA 2VODA 4EMSA 1OYWA 4UV9A 3O3KA 2OBPA 2D2WA 3DF8A 1OKRA 1I5ZA 5JFRA 1U6GA 2IA0A 3N4MA 1YTYA 1RUOA 1TBXA 2HTJA 4HYEA 5D6EA 4S05A 4K2EA 4HF2A 3WTSC 4EVIA 2FNPA 4GCVA 1ULYA 1QBJA 3C1DA 2MH2A 4JQFA 3TDZC 4M72A 2HEOA 3V8KA 1O3TA 2FRHA 1UFMA 1LJ9A 4PDKA 2WC2A 2HR3A 5JI6A 5HS9A 1HW5A 2QBYA 4U0VA 2H6BA 5HDKA 1IRFA 3BWGA 1ONVA 1D8KA 2K4JA 4YFNF 2QVOA 5TJJA 5ILUA 2EK5A 2O6GE 2NS0A 4U0YA 4EGZA 5LBQA 2DPUA 1ZH5A 1T6SA 2HS5A 3U1DA 2OU2A 2UWMA 2LDUA 3MEXA 1Z1DA 1XCVA 4MTEA 1SAXA 4M6XA 2F5EA 4MQ9F 3E6MA 2NNNA 4A0YA 1YYVA 4A5NA 1ZLKA 3I5UA 4L9TA 3R4KA 2EA4A 5LGNA 4NQWA 3FMRA 2V79A 2RGVA 3Q9VA 3KZYA 1SD5A 3FM5A 4HV6A 5D5XB 1T39A 1FC3A 2O8XA 5IT9Z 4RGSA 5LHGA 2NNYA 3ELKA 1HXDA 4HF1A 1MDMB 2HQRA 3SQNA 2ESNA 3CDHA 4CHUA 3BDDA 1B6AA 1XMAA 1HKTA 1ZGAA 2QUFA 5BS6A 4RS8A 1I1SA 3DQVC 4CDGA 2L4MA 2DTRA 2JSCA 1TW3A 3FX3A 1R1TA 4PGGA 4XSZF 5IT3A 2QQ9A 4ZH4F 2EWNA 2VE8A 3E5UA 4RGXA 4ON0A 2LF7A 4XLNF 3R60A 1T2KA 2DI3A 2P7CB 3KZZA 4FX0A 2E7XA 4BHCA 3C7JA 3F22A 1ZRCA 4BNCA 1H0MA 1XGNA 3T1BA 3I59A 4BQAA 3R0AA 3VB2A 3T0YA 4RGUA 2ETHA 2ZO4A 2P5KA 3KP6A 1O57A 3ZMUA 2EV5A 2LNBA 1YQAA 3HYIA 4RB2C 3GW2A 1JE8A 1BI0A 3WU0A 5FGMA 2VBYA 2MLGA 5E1WA 1F4KA 1R23A 4GO1A 4LFUA 5BQTA 1K79A 2RV8A 4EJTA 3TO6A 4CO8A 3RKXA 4HDVA 3J7AO 5LGTA 2JPBA 1BIBA 2L54A 3DPTA 5F64A 4FX4A 1X3UA 1Z05A 4WK8F 3RKYA 1A04A 1ODDA 4UHTA 1J7KA 2O61A 1G3YA 4M73A 1I27A 1VTNC 3J81K 2J5OA 3QU3A 4N0BA 3LSTA 5HS7A 3M8EA 3VFZA 4ZZLA 1IN5A 2A3SA 5A2QK 4LK0F 2VE9A 1BI2A 4EM2A 3FZVA 2DQLA 2O03A 3H3ZA 4IF4A 1Y0UA 1DUXC 1YS6A 3ROUA 5D5UB 2W25A 1FBSA 4KUMA 2VXZA 2V1DA 4LGWA 5EEGA 4OU0A 1QGPA 1FZPB 2F5CA 4EM1A 4D0PA 4KNYA 5CLSA 1P4XA 1S3JA 1GVJA 5L3BA 3QPHA 4AIJA 1DP7P 3TDUC 1BOAA 2JPCA 2FOKA 3WTXC 2L01A 5JR3A 3MZHA 2EV0A 2R7FA 4UVAA 2IRFG 2G7HA 2KJCA 2DO7A 1R36A 1CF7B 4UUVA 4IRHA 4Y15A 3QPTA 2GXGA 3V8JA 4KMFA 5JVTA 4OMYA 3BJOA 3KEOA 3EUHA 1ZG1A 5FD6A 4CICA 1TLHB 3GZ6A 2KIMA 5LHIA 2VONA 4ZZDA 1YS7A 4M71A 5DYMA 5AIPA 1KQ8A 2HYFA 4CZZA 4DQ2A 3LQRA 4ESJA 2C6YA 1SMYF 4ZYDA 4PCQA 4M9SA 2X0LA 1FP2A 3WU1B 1GXPA 1HKSA 3GFLA 4P9FA 5ICEA 3BJAA 4KIFA 2QBYB 4M74A 3S2WA 2PQ8A 2R3SA 5D4RA 3BZ6A 1STZA 5D4SA 4BXUA 5EEHA 5FLXZ 4A5MA 3BP8A 3J80Z 4WXDA 5H6RA 1IF1A 4OIRF 2ADUA 1ON2A 1O7LA 5J8FA 2E1NA 4LB6B 4Y17A 4EJWA 1MZBA 3OOPA 1U2WA 1KU9A 5HLGA 3H92A 5ERIA 1XCBA 5FO5A 4KYWA 2O3FA 3BOQA 5HLHA 3V4GA 5HDNA 4YIIA 2IA2A 2A61A 1FNNA 1OMIA 2J5PA 4IVNA 5LLQA 4LB5A 3SFZA 3CJNA 5DCMA 2COMA 3QOPA 2XHKA 4WXCA 2XAFA 3FMSA 1E17A 1V4RA 4U88A 2O0YA 4HZFA 3CUQA 4G7ZF 3HTSB 1T0FA 4IRIA 3VODA 2OQGA 1IZ1A 2RC4A 5BOXA 4KN4X 3I71A 4ZYHA 5E20A 5ED4A 4YFXF 3ZMVA 4YFKF 1ZRFA 1RIOH 1FT9A 1AOYA 1KGSA 5CVVA 3IL2A 2FMYA 1J0RA 3ZQ7A 3WG9A 2PMHA 2K86A 3PQKA 4IRGA 4M9XA 1FYKA 2FMLA 3GUDA 3I53A 3IC7A 3I59B 1LDJA 2D1VA 3MQ0A 4HF0A 4RB3C 4JK1X 4B09A 2AS5F 1MJBA 2OZUA 3JSPA 5CVIA 4GXOA 1SFEA 2FXAA 3ZN1A 2XIGA 3REOA 3LA2A 2RVCA 5DUIA 3U9GA 1B4AA 2ZNYA 2V1UA 2FBHA 4RGRA 2VC1A 3GF2A 4HX8A 4G7HF 1FYLA 1W7PA 2VBZA 3WTTC 4MQVA 1B59A 5BPDA 5DD4A 2H27A 1D8JA 3WTWC 3I0TA 2VBWA 1AWCA 1W5TA 1UCRA 4RAYA 5CJ9A 4ESFA 4NB5A 4Z2YA 4A2UA 4LG0A 3LA3A 4A12A 2PFBA 1RNLA 1BN5A 1BIAA 5DD8A 5HLIA 3TO9A 2EJRA 1W7PD 3DEUA 2GXBA 1R5HA 1HW2A 2ZJ2A 2P5LC 4L9VA 3L2CA 2QZ8A 4M9ZA 2XUBA 1K7AA 5DV5A 4EGYA 4FT8A 1SMTA 4HOBA 2RDPA 1PUEE 5CVRA 1V3FA 4ETSA 1P92A 2G7UA 3QP6A 3U2RA 3OV8A 2HKOA 2IT0A 2M87A 4TV7A 4L9NA 2L3DA 3KETA 5ILSA 3RI4A 1MKMA 1HSTA 3GWZA 1EH6A 1LDKB 4OIOF 3E97A 3JAMK 4HW0A 3F8BA 4Q47A 3V7RA 3RYPA 2Z33A 2FQ3A 2BV6A 1FBQA 3F21A 3GFIA 1U5TC 1W4MA 2RKHA 5LGUA 3DKWA 3NRVA 3AAFA 2F5FA 3K1MA 4JBAA 3LA7A 3IRRA 3WTVC 2UZKA 1FPQA 1WKMA 2LSOA 3ZMSA 1LVAA 3GXOA 4XSXF 2OZ6A 3F6VA 1KYWA 2EFQA 5CVJA 2XKPA 1FSHA 3HRSA 2Z5UA 1O3RA 3HRTA 4KMUX 4QWQA 3M8FA 4BHPA 4N9IA 4GYGA 1F5TA 5H20A 4UXNA 2V1XA 1XSDA 4G6QA 2FEZA 1TQMA 2ZNZA 3HHHA 1BC7C 3W6KB 1Z7UA 2EB7A 1ZG5A 5F6FA 3KLNA 3G73A 2IJLA 2JRTA 1KU2A 2IW5A 3RTRA 1J5YA 1R5GA 2YX4A 2XV4S 4UV8A 4HDUA 3HRUA 3HIFA 2VN2A 4MGRA 2GQQA 4P9UA 4H0EA 2XKOA 2HWVA 2RN7A 4N9HA 4WX9A 1S7OA 1J75A 3WTZA 3GO5A 4AWXB 2A6HF 4IHTA 2LF8A 3C18A 4GGGA 3VOEA 5J8CA 2MC3A 1KYZA 3K1PA 1SFXA 3QAHA 2DPDA 3BROA 3M7GA 2CWEA 5K5OA 4G6DA 5DCMB 3V7CA 2L02A 2W85A 1MGTA 2MBFA 5L3FA 1XB4A 2Q0OA 3EQLF 4KDPA 3D5LA 4Q4ZF 2XGXA 1DDNA 1QPMA 4OIPF 2WWYA 2FBKA 1TNTA 3KEQA 5E1ZB 3CUQB 1BJAA 3KP2A 1SD7A 2ZBKA 3K1NA 3WGIA 1IXRC 2W57A 2P8TA 3Q9SA 4I09A 2F2EA 2ZMEA 1PDNC 1EV7A 3ML6A 1CGPA 4OMZA 2CW0F 1ZLJA 4KIBA 2HFHA 1EH8A 2XAHA 4U7BA 2VT3A 1YFHA 1JGSA 1ZREA 1J2XA 3JTHA 3GFMA 4KT5C 4KN7X 5IT9K 1LDDA 5LRSA 3PQJA 3ZMZA 4WF2A 1KA8A 5E1XA 4XLPF 1FBUA 3P9IA 3GFJA 1FY7A 1ZARA 3WE2A 2DW4A 3SHFA 2MD5A 2ISYA 5L3EA 3ZN0A 1J59A 5FFXA 1XGOA 4G7OF 4MEXF 2OD5A 1W7PB 1S29A 2HGCA 1ZGJA 5H6QA 2ACJA 4UVCA 1XDSA 1P6RA 1YIOA 1Q1HA 5KVRA 1FWZA 1R58A 1BBYA 3COAC 5CVUA 3FWEA 3F8CA 2HOEA 1FX7A 3SXYA 2XASA 4LG0B 4B8XA 1YO5C 3D0SA 2Q2EA 3IHUA 1HBXG 1DPRA 3R6SA 1O3SA 4DNCA 2VOOA 2FNAA 3E5XA 3ZPLA 1HSJA 1H9GA 1XGMA 3IKVA 4XRFA 3VEPA 1TNSA 2IA1A 4I2OA 3ERED 4Q48A 2DAOA 2ZCWA 3ZP5A 1FYMA 3KP4A 1ZHFA 4P5OA 2XRNA 4WWCA 3F8FA 3CO6C 2MA3A 3TOBA 2DBBA 2VT2A 1XGSA 3EYYA 3RPQA 2M45A 4MNUA 3G3ZA 1P4WA 3NEUA 5E8GA 1B9MA 2HYGD 3F8MA 4AD9A 3WTYC 4E70A 3JTGA 3E6CC 5DEQA 2EFWA 2NRAC 4OINF 3E5QA 4HV5A 5BMZA 3P7NA 3TOAA 4G9YA 2FE3A 3EYIA 1IN8A 5LEKA 3WODF 4I01A 4LD5A 4HLYA 5ICFA 1FSEA 1BC8C 2D1HA 3WGGA 1PP7U 3I54A 2CSOA 4ZYEA 3I4PA 3KLOA 5J6XA 4OIQF 4KICA 4L0ZB 2QM3A 1ON1A 1B9NA 4CXFA 2RNJA 3MFKA 3WGHA 3MCZA 3CO7C 1BI3A 1QZZA 1H9TA 4EJUA 1T38A 2XAJA 2R7DA 3GLXA 4A0ZA 1YW7A 1Z6TA 1U78A 3ECHA 2Y0MA 2TDXA 4Y13A 3K2ZA 4HLXA 2RQPA 2PI0A 1G3TA 4HBLA 4AIKA 3HSRA 4OOIA 4ASNA 1I6XA 2KRFA 2QQBA 3RKWA 3ABTA 5ILVA 1SFUA 3H3UA 2YR2A 2DFIA 2WTEA 1K78A 3DP7A 4M6YA 1FOKA 4A6EA 3RYRA 1WRJA 4AIHA 2Y75A 4G94A 3HTUA 2BBYA 2M1BA 1GXQA 2A6EF 2OAZA 4I98B 2NYXA 3EDPA 1YW8A 2KIUA 2DQRA 1YLFA 2X4HA 5FLXK 3J80K 1D5VA 4KA4A 3IKTA 2GWRA 2M8EA 5ICCA 1OYYA 1QNTA 3HRMA 3O2PE 4O5VA 4P96A 1HW1A 3ISPA 3O6BB 2IP2A 2PEXA 2ISZA 4IHSA 1MD0A 3PFIA 4ENNA 1GHCA 1O3QA 2FSWA 2OQRA 2ZMEB 2H09A 4HX7A 3ULQB 2STTA 5D5VB 1XDUA 1J9IA 4EQQA 5L3CA 3FMQA 4WXHA 3QU6A 1HQCA 5AIQA 2UXXA 3B02A 2OA4A 3J81Z 3JW4A 5D8KB 5L3DA 2VC0A 3I58A 5HVQC 3TKYA 5A2QZ 4KIGA 3FHZA 2IPQX 4L9JA 4BAYA 3FF5A 2MH9A 4ESBA 2YU3A 1WWXA 1UHMA 2GA2A 5K5QA 1L0OC 2Y48A 2A07F 2A69F 3TGNA 4EJVA 1TQIA 4UNOA 2ELHA 1E2XA 1QZYA 4F7ZA 1KQ0A 1U5TA 2P7VB 3RDIA 4A0XA 3KP5A 1NHAA 3F6OA 2JZYA 4EV0A 2CO5A 2JT1A 2GA1A 4O6JA 5FD5A 3GEZA 3GZ5A 3DPLC 2L4AA 5FFZA 3RIRA 4HQMA 4CGZA 2IVMA 3F23A 2A68F 4EJOA 2A5YB 4RB1A 2PLYA 2EFPA 3SZTA 5HDGA 3FXUA 2CG4A 4U7DA 3F72A 2CGPA 3T8RA 2QQAA 1WSUA 1R1UA 4LLNA 4EM0B 1S8NA 2KJBA 3BPVA 1G3WA 1U3EM 3NQOA 4R79A 1IXSB 3KE2A 1KU3A 1TQPA 1BI1A 3P9KA 4ENMA 3KFWX 3MZYA 2QYOA 1ZRDA 1WQ2A 4LK1F 2LKPA 5CYVA 1ZN2A 2VBXA 1MJ9A 1SD4A 2BGCA 2P6TA 5K5RA 3IWFA 4ENKA 1WI9A 3WTUC 2G9WA 3T5XA 1HKQA 2P4WA 2DLLA 2FF4A 5HS8A 2XAGA 1W5SA 3M1EA 4LMYA 1O7FA 1K6OA 1TTYA 3HSFA 4I0BA 4I7HA 2P6SA 3GYHX 1DPUA 1KQ9A 1U8RA 2K7LA 4L5IA 4I02A 2M5WA 3CUOA 1XSXA 4ENJA 2DT5A 2GAUA 5LEJA 4ZYGA 1S6LA 2V6CA 1ZYRF 3LAPA 3BPXA 4MEYF 3ZMDA 3K9TA 5E18F 1R22A 1USSA 1UHWA 1USTA 2PN6A 2Q8KA 4BH9A 2M30A 1SD6A 3I64A 1LEBA 3V8LA 2H94A 2E1CA 3IWZA 4QLCU 4UVBA 2HKXA 2DK8A 1XMKA 3K0LA 1IUYA 2EFNA 2QENA 3R0JA 1LEAA 1YW9A 3HSEA 3MAJA 4PGHA 2Z9OA 2CFXA 4CYDA 3Q5FA 3HOTA 5D8LB 3CTAA 1D3YA 2EV6A 3R61A 2K4BA 2ZFWA 6PAXA 3DV8A 4Q5SF 3QRFF 3HUGA 4P55A 3T8TA 2PBIA 2BYVE 2XVCA 2H6CA 3KP3A 2WV0A 1QO0D 1LQ1A 5BPIA 1P4AA 3JSOA 2K27A 3QP5A 1EH7A 1XN7A 3L00A 4RB0A 1RI7A 5E17F 5E8IA 3IRQA 2HZTA 4GYIA 4HX4A 2Z99A 1S7AA 1K78B 3DXJF 1OR7A 3MWMA 2YPRA 2D45A 3B73A 4IXAA 2FA5A 3W6JB 1TW2A 3GX4X 2STWA 1ZG3A 2HDCA 2DK5A 3BJ6A 3WE3A 1R1VA 5TRDA 1XD7A 3KCCA 1MDMA 1T98A 1KU7A 1Z6RA 4S04A 2GZWA 1XSVA 2KIFA 4NHJA 1IXCA 4L5JA 4MTDA 2FBIA 1IRGA 1FP1D 5DCFA 3FXRA 3M9AA 3LFKA 3E6DA 1I1GA 2B0LA 3P9CA 5JHUA 4HA8A 4L18B 5LHHA 2DU9A 5AONA 3C3WA 2XAQA 2FU4A 4HAMA 4KFCA 1JHFA 2PG4A 3TQNA 2W84A 2E7WA 4PZJA 1IAWA 2PJPA 2VOPA 4IPAA 1G3SA 5FB2A 2K02A 1IW7F 2ZKZA 4XBFA 2GIVA 3ABUA 5K1YA 1F1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8N A;  2CYY A;  4LLG F;  2P5V A;  3TO7 A;  1IN7 A;  1OPC A;  1L3L A;  4MHG A;  2XRO A;  1RZ4 A;  5HOO A;  3EET A;  1QQI A;  4R1H A;  3F3X A;  1Z9C A;  1C0W A;  2QWW A;  2AXL A;  3DFG A;  1LB2 A;  4YG2 F;  4BHB A;  3FXQ A;  4YIF A;  4BYY A;  1B1B A;  2EA2 A;  2ESH A;  3V7S A;  5ICG A;  3FM3 A;  3HOS A;  1P2F A;  2V9V A;  1G6N A;  5F1R A;  4O3M A;  4LJZ F;  3CUQ C;  1Z91 A;  1MJA A;  1U5T B;  2PMU A;  1LNW A;  4L0Y B;  4HQE A;  4I0A A;  1JHH A;  4R8H A;  4G8X A;  3K69 A;  4IJA A;  3JAM Z;  5DDG A;  5DUK A;  3LQQ A;  5LRR A;  1UB9 A;  2BE5 F;  3ECO A;  2NAZ A;  2YSR A;  4FHT A;  3LAJ A;  2Z3Y A;  1PP8 F;  2UXN A;  1F9N A;  1R7J A;  3RPU A;  2HTS A;  1IN4 A;  4RAZ A;  3LWF A;  1OYI A;  3HHG A;  2CQK A;  3GVA A;  1R00 A;  3L7W A;  2EFO A;  2JTV A;  5L3G A;  4A6D A;  5D5W B;  1REP C;  3ZMT A;  1ZAO A;  4AVP A;  5KK1 A;  2BEO A;  3BY6 A;  4WCG A;  3E3V A;  1IN6 A;  2KKO A;  2MLK A;  3KP7 A;  3L9F A;  3N97 A;  3SZP A;  3E6B A;  3RJP A;  2W24 A;  1JXS A;  2ZXJ A;  5D6F A;  2HQN A;  1YG2 A;  4LLL A;  4U0W A;  1BM9 A;  2F5D A;  1CF7 A;  2QLZ A;  1G4D A;  1RUN A;  1FLI A;  2YX7 A;  3L09 A;  3CLO A;  2VOD A;  4EMS A;  1OYW A;  4UV9 A;  3O3K A;  2OBP A;  2D2W A;  3DF8 A;  1OKR A;  1I5Z A;  5JFR A;  1U6G A;  2IA0 A;  3N4M A;  1YTY A;  1RUO A;  1TBX A;  2HTJ A;  4HYE A;  5D6E A;  4S05 A;  4K2E A;  4HF2 A;  3WTS C;  4EVI A;  2FNP A;  4GCV A;  1ULY A;  1QBJ A;  3C1D A;  2MH2 A;  4JQF A;  3TDZ C;  4M72 A;  2HEO A;  3V8K A;  1O3T A;  2FRH A;  1UFM A;  1LJ9 A;  4PDK A;  2WC2 A;  2HR3 A;  5JI6 A;  5HS9 A;  1HW5 A;  2QBY A;  4U0V A;  2H6B A;  5HDK A;  1IRF A;  3BWG A;  1ONV A;  1D8K A;  2K4J A;  4YFN F;  2QVO A;  5TJJ A;  5ILU A;  2EK5 A;  2O6G E;  2NS0 A;  4U0Y A;  4EGZ A;  5LBQ A;  2DPU A;  1ZH5 A;  1T6S A;  2HS5 A;  3U1D A;  2OU2 A;  2UWM A;  2LDU A;  3MEX A;  1Z1D A;  1XCV A;  4MTE A;  1SAX A;  4M6X A;  2F5E A;  4MQ9 F;  3E6M A;  2NNN A;  4A0Y A;  1YYV A;  4A5N A;  1ZLK A;  3I5U A;  4L9T A;  3R4K A;  2EA4 A;  5LGN A;  4NQW A;  3FMR A;  2V79 A;  2RGV A;  3Q9V A;  3KZY A;  1SD5 A;  3FM5 A;  4HV6 A;  5D5X B;  1T39 A;  1FC3 A;  2O8X A;  5IT9 Z;  4RGS A;  5LHG A;  2NNY A;  3ELK A;  1HXD A;  4HF1 A;  1MDM B;  2HQR A;  3SQN A;  2ESN A;  3CDH A;  4CHU A;  3BDD A;  1B6A A;  1XMA A;  1HKT A;  1ZGA A;  2QUF A;  5BS6 A;  4RS8 A;  1I1S A;  3DQV C;  4CDG A;  2L4M A;  2DTR A;  2JSC A;  1TW3 A;  3FX3 A;  1R1T A;  4PGG A;  4XSZ F;  5IT3 A;  2QQ9 A;  4ZH4 F;  2EWN A;  2VE8 A;  3E5U A;  4RGX A;  4ON0 A;  2LF7 A;  4XLN F;  3R60 A;  1T2K A;  2DI3 A;  2P7C B;  3KZZ A;  4FX0 A;  2E7X A;  4BHC A;  3C7J A;  3F22 A;  1ZRC A;  4BNC A;  1H0M A;  1XGN A;  3T1B A;  3I59 A;  4BQA A;  3R0A A;  3VB2 A;  3T0Y A;  4RGU A;  2ETH A;  2ZO4 A;  2P5K A;  3KP6 A;  1O57 A;  3ZMU A;  2EV5 A;  2LNB A;  1YQA A;  3HYI A;  4RB2 C;  3GW2 A;  1JE8 A;  1BI0 A;  3WU0 A;  5FGM A;  2VBY A;  2MLG A;  5E1W A;  1F4K A;  1R23 A;  4GO1 A;  4LFU A;  5BQT A;  1K79 A;  2RV8 A;  4EJT A;  3TO6 A;  4CO8 A;  3RKX A;  4HDV A;  3J7A O;  5LGT A;  2JPB A;  1BIB A;  2L54 A;  3DPT A;  5F64 A;  4FX4 A;  1X3U A;  1Z05 A;  4WK8 F;  3RKY A;  1A04 A;  1ODD A;  4UHT A;  1J7K A;  2O61 A;  1G3Y A;  4M73 A;  1I27 A;  1VTN C;  3J81 K;  2J5O A;  3QU3 A;  4N0B A;  3LST A;  5HS7 A;  3M8E A;  3VFZ A;  4ZZL A;  1IN5 A;  2A3S A;  5A2Q K;  4LK0 F;  2VE9 A;  1BI2 A;  4EM2 A;  3FZV A;  2DQL A;  2O03 A;  3H3Z A;  4IF4 A;  1Y0U A;  1DUX C;  1YS6 A;  3ROU A;  5D5U B;  2W25 A;  1FBS A;  4KUM A;  2VXZ A;  2V1D A;  4LGW A;  5EEG A;  4OU0 A;  1QGP A;  1FZP B;  2F5C A;  4EM1 A;  4D0P A;  4KNY A;  5CLS A;  1P4X A;  1S3J A;  1GVJ A;  5L3B A;  3QPH A;  4AIJ A;  1DP7 P;  3TDU C;  1BOA A;  2JPC A;  2FOK A;  3WTX C;  2L01 A;  5JR3 A;  3MZH A;  2EV0 A;  2R7F A;  4UVA A;  2IRF G;  2G7H A;  2KJC A;  2DO7 A;  1R36 A;  1CF7 B;  4UUV A;  4IRH A;  4Y15 A;  3QPT A;  2GXG A;  3V8J A;  4KMF A;  5JVT A;  4OMY A;  3BJO A;  3KEO A;  3EUH A;  1ZG1 A;  5FD6 A;  4CIC A;  1TLH B;  3GZ6 A;  2KIM A;  5LHI A;  2VON A;  4ZZD A;  1YS7 A;  4M71 A;  5DYM A;  5AIP A;  1KQ8 A;  2HYF A;  4CZZ A;  4DQ2 A;  3LQR A;  4ESJ A;  2C6Y A;  1SMY F;  4ZYD A;  4PCQ A;  4M9S A;  2X0L A;  1FP2 A;  3WU1 B;  1GXP A;  1HKS A;  3GFL A;  4P9F A;  5ICE A;  3BJA A;  4KIF A;  2QBY B;  4M74 A;  3S2W A;  2PQ8 A;  2R3S A;  5D4R A;  3BZ6 A;  1STZ A;  5D4S A;  4BXU A;  5EEH A;  5FLX Z;  4A5M A;  3BP8 A;  3J80 Z;  4WXD A;  5H6R A;  1IF1 A;  4OIR F;  2ADU A;  1ON2 A;  1O7L A;  5J8F A;  2E1N A;  4LB6 B;  4Y17 A;  4EJW A;  1MZB A;  3OOP A;  1U2W A;  1KU9 A;  5HLG A;  3H92 A;  5ERI A;  1XCB A;  5FO5 A;  4KYW A;  2O3F A;  3BOQ A;  5HLH A;  3V4G A;  5HDN A;  4YII A;  2IA2 A;  2A61 A;  1FNN A;  1OMI A;  2J5P A;  4IVN A;  5LLQ A;  4LB5 A;  3SFZ A;  3CJN A;  5DCM A;  2COM A;  3QOP A;  2XHK A;  4WXC A;  2XAF A;  3FMS A;  1E17 A;  1V4R A;  4U88 A;  2O0Y A;  4HZF A;  3CUQ A;  4G7Z F;  3HTS B;  1T0F A;  4IRI A;  3VOD A;  2OQG A;  1IZ1 A;  2RC4 A;  5BOX A;  4KN4 X;  3I71 A;  4ZYH A;  5E20 A;  5ED4 A;  4YFX F;  3ZMV A;  4YFK F;  1ZRF A;  1RIO H;  1FT9 A;  1AOY A;  1KGS A;  5CVV A;  3IL2 A;  2FMY A;  1J0R A;  3ZQ7 A;  3WG9 A;  2PMH A;  2K86 A;  3PQK A;  4IRG A;  4M9X A;  1FYK A;  2FML A;  3GUD A;  3I53 A;  3IC7 A;  3I59 B;  1LDJ A;  2D1V A;  3MQ0 A;  4HF0 A;  4RB3 C;  4JK1 X;  4B09 A;  2AS5 F;  1MJB A;  2OZU A;  3JSP A;  5CVI A;  4GXO A;  1SFE A;  2FXA A;  3ZN1 A;  2XIG A;  3REO A;  3LA2 A;  2RVC A;  5DUI A;  3U9G A;  1B4A A;  2ZNY A;  2V1U A;  2FBH A;  4RGR A;  2VC1 A;  3GF2 A;  4HX8 A;  4G7H F;  1FYL A;  1W7P A;  2VBZ A;  3WTT C;  4MQV A;  1B59 A;  5BPD A;  5DD4 A;  2H27 A;  1D8J A;  3WTW C;  3I0T A;  2VBW A;  1AWC A;  1W5T A;  1UCR A;  4RAY A;  5CJ9 A;  4ESF A;  4NB5 A;  4Z2Y A;  4A2U A;  4LG0 A;  3LA3 A;  4A12 A;  2PFB A;  1RNL A;  1BN5 A;  1BIA A;  5DD8 A;  5HLI A;  3TO9 A;  2EJR A;  1W7P D;  3DEU A;  2GXB A;  1R5H A;  1HW2 A;  2ZJ2 A;  2P5L C;  4L9V A;  3L2C A;  2QZ8 A;  4M9Z A;  2XUB A;  1K7A A;  5DV5 A;  4EGY A;  4FT8 A;  1SMT A;  4HOB A;  2RDP A;  1PUE E;  5CVR A;  1V3F A;  4ETS A;  1P92 A;  2G7U A;  3QP6 A;  3U2R A;  3OV8 A;  2HKO A;  2IT0 A;  2M87 A;  4TV7 A;  4L9N A;  2L3D A;  3KET A;  5ILS A;  3RI4 A;  1MKM A;  1HST A;  3GWZ A;  1EH6 A;  1LDK B;  4OIO F;  3E97 A;  3JAM K;  4HW0 A;  3F8B A;  4Q47 A;  3V7R A;  3RYP A;  2Z33 A;  2FQ3 A;  2BV6 A;  1FBQ A;  3F21 A;  3GFI A;  1U5T C;  1W4M A;  2RKH A;  5LGU A;  3DKW A;  3NRV A;  3AAF A;  2F5F A;  3K1M A;  4JBA A;  3LA7 A;  3IRR A;  3WTV C;  2UZK A;  1FPQ A;  1WKM A;  2LSO A;  3ZMS A;  1LVA A;  3GXO A;  4XSX F;  2OZ6 A;  3F6V A;  1KYW A;  2EFQ A;  5CVJ A;  2XKP A;  1FSH A;  3HRS A;  2Z5U A;  1O3R A;  3HRT A;  4KMU X;  4QWQ A;  3M8F A;  4BHP A;  4N9I A;  4GYG A;  1F5T A;  5H20 A;  4UXN A;  2V1X A;  1XSD A;  4G6Q A;  2FEZ A;  1TQM A;  2ZNZ A;  3HHH A;  1BC7 C;  3W6K B;  1Z7U A;  2EB7 A;  1ZG5 A;  5F6F A;  3KLN A;  3G73 A;  2IJL A;  2JRT A;  1KU2 A;  2IW5 A;  3RTR A;  1J5Y A;  1R5G A;  2YX4 A;  2XV4 S;  4UV8 A;  4HDU A;  3HRU A;  3HIF A;  2VN2 A;  4MGR A;  2GQQ A;  4P9U A;  4H0E A;  2XKO A;  2HWV A;  2RN7 A;  4N9H A;  4WX9 A;  1S7O A;  1J75 A;  3WTZ A;  3GO5 A;  4AWX B;  2A6H F;  4IHT A;  2LF8 A;  3C18 A;  4GGG A;  3VOE A;  5J8C A;  2MC3 A;  1KYZ A;  3K1P A;  1SFX A;  3QAH A;  2DPD A;  3BRO A;  3M7G A;  2CWE A;  5K5O A;  4G6D A;  5DCM B;  3V7C A;  2L02 A;  2W85 A;  1MGT A;  2MBF A;  5L3F A;  1XB4 A;  2Q0O A;  3EQL F;  4KDP A;  3D5L A;  4Q4Z F;  2XGX A;  1DDN A;  1QPM A;  4OIP F;  2WWY A;  2FBK A;  1TNT A;  3KEQ A;  5E1Z B;  3CUQ B;  1BJA A;  3KP2 A;  1SD7 A;  2ZBK A;  3K1N A;  3WGI A;  1IXR C;  2W57 A;  2P8T A;  3Q9S A;  4I09 A;  2F2E A;  2ZME A;  1PDN C;  1EV7 A;  3ML6 A;  1CGP A;  4OMZ A;  2CW0 F;  1ZLJ A;  4KIB A;  2HFH A;  1EH8 A;  2XAH A;  4U7B A;  2VT3 A;  1YFH A;  1JGS A;  1ZRE A;  1J2X A;  3JTH A;  3GFM A;  4KT5 C;  4KN7 X;  5IT9 K;  1LDD A;  5LRS A;  3PQJ A;  3ZMZ A;  4WF2 A;  1KA8 A;  5E1X A;  4XLP F;  1FBU A;  3P9I A;  3GFJ A;  1FY7 A;  1ZAR A;  3WE2 A;  2DW4 A;  3SHF A;  2MD5 A;  2ISY A;  5L3E A;  3ZN0 A;  1J59 A;  5FFX A;  1XGO A;  4G7O F;  4MEX F;  2OD5 A;  1W7P B;  1S29 A;  2HGC A;  1ZGJ A;  5H6Q A;  2ACJ A;  4UVC A;  1XDS A;  1P6R A;  1YIO A;  1Q1H A;  5KVR A;  1FWZ A;  1R58 A;  1BBY A;  3COA C;  5CVU A;  3FWE A;  3F8C A;  2HOE A;  1FX7 A;  3SXY A;  2XAS A;  4LG0 B;  4B8X A;  1YO5 C;  3D0S A;  2Q2E A;  3IHU A;  1HBX G;  1DPR A;  3R6S A;  1O3S A;  4DNC A;  2VOO A;  2FNA A;  3E5X A;  3ZPL A;  1HSJ A;  1H9G A;  1XGM A;  3IKV A;  4XRF A;  3VEP A;  1TNS A;  2IA1 A;  4I2O A;  3ERE D;  4Q48 A;  2DAO A;  2ZCW A;  3ZP5 A;  1FYM A;  3KP4 A;  1ZHF A;  4P5O A;  2XRN A;  4WWC A;  3F8F A;  3CO6 C;  2MA3 A;  3TOB A;  2DBB A;  2VT2 A;  1XGS A;  3EYY A;  3RPQ A;  2M45 A;  4MNU A;  3G3Z A;  1P4W A;  3NEU A;  5E8G A;  1B9M A;  2HYG D;  3F8M A;  4AD9 A;  3WTY C;  4E70 A;  3JTG A;  3E6C C;  5DEQ A;  2EFW A;  2NRA C;  4OIN F;  3E5Q A;  4HV5 A;  5BMZ A;  3P7N A;  3TOA A;  4G9Y A;  2FE3 A;  3EYI A;  1IN8 A;  5LEK A;  3WOD F;  4I01 A;  4LD5 A;  4HLY A;  5ICF A;  1FSE A;  1BC8 C;  2D1H A;  3WGG A;  1PP7 U;  3I54 A;  2CSO A;  4ZYE A;  3I4P A;  3KLO A;  5J6X A;  4OIQ F;  4KIC A;  4L0Z B;  2QM3 A;  1ON1 A;  1B9N A;  4CXF A;  2RNJ A;  3MFK A;  3WGH A;  3MCZ A;  3CO7 C;  1BI3 A;  1QZZ A;  1H9T A;  4EJU A;  1T38 A;  2XAJ A;  2R7D A;  3GLX A;  4A0Z A;  1YW7 A;  1Z6T A;  1U78 A;  3ECH A;  2Y0M A;  2TDX A;  4Y13 A;  3K2Z A;  4HLX A;  2RQP A;  2PI0 A;  1G3T A;  4HBL A;  4AIK A;  3HSR A;  4OOI A;  4ASN A;  1I6X A;  2KRF A;  2QQB A;  3RKW A;  3ABT A;  5ILV A;  1SFU A;  3H3U A;  2YR2 A;  2DFI A;  2WTE A;  1K78 A;  3DP7 A;  4M6Y A;  1FOK A;  4A6E A;  3RYR A;  1WRJ A;  4AIH A;  2Y75 A;  4G94 A;  3HTU A;  2BBY A;  2M1B A;  1GXQ A;  2A6E F;  2OAZ A;  4I98 B;  2NYX A;  3EDP A;  1YW8 A;  2KIU A;  2DQR A;  1YLF A;  2X4H A;  5FLX K;  3J80 K;  1D5V A;  4KA4 A;  3IKT A;  2GWR A;  2M8E A;  5ICC A;  1OYY A;  1QNT A;  3HRM A;  3O2P E;  4O5V A;  4P96 A;  1HW1 A;  3ISP A;  3O6B B;  2IP2 A;  2PEX A;  2ISZ A;  4IHS A;  1MD0 A;  3PFI A;  4ENN A;  1GHC A;  1O3Q A;  2FSW A;  2OQR A;  2ZME B;  2H09 A;  4HX7 A;  3ULQ B;  2STT A;  5D5V B;  1XDU A;  1J9I A;  4EQQ A;  5L3C A;  3FMQ A;  4WXH A;  3QU6 A;  1HQC A;  5AIQ A;  2UXX A;  3B02 A;  2OA4 A;  3J81 Z;  3JW4 A;  5D8K B;  5L3D A;  2VC0 A;  3I58 A;  5HVQ C;  3TKY A;  5A2Q Z;  4KIG A;  3FHZ A;  2IPQ X;  4L9J A;  4BAY A;  3FF5 A;  2MH9 A;  4ESB A;  2YU3 A;  1WWX A;  1UHM A;  2GA2 A;  5K5Q A;  1L0O C;  2Y48 A;  2A07 F;  2A69 F;  3TGN A;  4EJV A;  1TQI A;  4UNO A;  2ELH A;  1E2X A;  1QZY A;  4F7Z A;  1KQ0 A;  1U5T A;  2P7V B;  3RDI A;  4A0X A;  3KP5 A;  1NHA A;  3F6O A;  2JZY A;  4EV0 A;  2CO5 A;  2JT1 A;  2GA1 A;  4O6J A;  5FD5 A;  3GEZ A;  3GZ5 A;  3DPL C;  2L4A A;  5FFZ A;  3RIR A;  4HQM A;  4CGZ A;  2IVM A;  3F23 A;  2A68 F;  4EJO A;  2A5Y B;  4RB1 A;  2PLY A;  2EFP A;  3SZT A;  5HDG A;  3FXU A;  2CG4 A;  4U7D A;  3F72 A;  2CGP A;  3T8R A;  2QQA A;  1WSU A;  1R1U A;  4LLN A;  4EM0 B;  1S8N A;  2KJB A;  3BPV A;  1G3W A;  1U3E M;  3NQO A;  4R79 A;  1IXS B;  3KE2 A;  1KU3 A;  1TQP A;  1BI1 A;  3P9K A;  4ENM A;  3KFW X;  3MZY A;  2QYO A;  1ZRD A;  1WQ2 A;  4LK1 F;  2LKP A;  5CYV A;  1ZN2 A;  2VBX A;  1MJ9 A;  1SD4 A;  2BGC A;  2P6T A;  5K5R A;  3IWF A;  4ENK A;  1WI9 A;  3WTU C;  2G9W A;  3T5X A;  1HKQ A;  2P4W A;  2DLL A;  2FF4 A;  5HS8 A;  2XAG A;  1W5S A;  3M1E A;  4LMY A;  1O7F A;  1K6O A;  1TTY A;  3HSF A;  4I0B A;  4I7H A;  2P6S A;  3GYH X;  1DPU A;  1KQ9 A;  1U8R A;  2K7L A;  4L5I A;  4I02 A;  2M5W A;  3CUO A;  1XSX A;  4ENJ A;  2DT5 A;  2GAU A;  5LEJ A;  4ZYG A;  1S6L A;  2V6C A;  1ZYR F;  3LAP A;  3BPX A;  4MEY F;  3ZMD A;  3K9T A;  5E18 F;  1R22 A;  1USS A;  1UHW A;  1UST A;  2PN6 A;  2Q8K A;  4BH9 A;  2M30 A;  1SD6 A;  3I64 A;  1LEB A;  3V8L A;  2H94 A;  2E1C A;  3IWZ A;  4QLC U;  4UVB A;  2HKX A;  2DK8 A;  1XMK A;  3K0L A;  1IUY A;  2EFN A;  2QEN A;  3R0J A;  1LEA A;  1YW9 A;  3HSE A;  3MAJ A;  4PGH A;  2Z9O A;  2CFX A;  4CYD A;  3Q5F A;  3HOT A;  5D8L B;  3CTA A;  1D3Y A;  2EV6 A;  3R61 A;  2K4B A;  2ZFW A;  6PAX A;  3DV8 A;  4Q5S F;  3QRF F;  3HUG A;  4P55 A;  3T8T A;  2PBI A;  2BYV E;  2XVC A;  2H6C A;  3KP3 A;  2WV0 A;  1QO0 D;  1LQ1 A;  5BPI A;  1P4A A;  3JSO A;  2K27 A;  3QP5 A;  1EH7 A;  1XN7 A;  3L00 A;  4RB0 A;  1RI7 A;  5E17 F;  5E8I A;  3IRQ A;  2HZT A;  4GYI A;  4HX4 A;  2Z99 A;  1S7A A;  1K78 B;  3DXJ F;  1OR7 A;  3MWM A;  2YPR A;  2D45 A;  3B73 A;  4IXA A;  2FA5 A;  3W6J B;  1TW2 A;  3GX4 X;  2STW A;  1ZG3 A;  2HDC A;  2DK5 A;  3BJ6 A;  3WE3 A;  1R1V A;  5TRD A;  1XD7 A;  3KCC A;  1MDM A;  1T98 A;  1KU7 A;  1Z6R A;  4S04 A;  2GZW A;  1XSV A;  2KIF A;  4NHJ A;  1IXC A;  4L5J A;  4MTD A;  2FBI A;  1IRG A;  1FP1 D;  5DCF A;  3FXR A;  3M9A A;  3LFK A;  3E6D A;  1I1G A;  2B0L A;  3P9C A;  5JHU A;  4HA8 A;  4L18 B;  5LHH A;  2DU9 A;  5AON A;  3C3W A;  2XAQ A;  2FU4 A;  4HAM A;  4KFC A;  1JHF A;  2PG4 A;  3TQN A;  2W84 A;  2E7W A;  4PZJ A;  1IAW A;  2PJP A;  2VOP A;  4IPA A;  1G3S A;  5FB2 A;  2K02 A;  1IW7 F;  2ZKZ A;  4XBF A;  2GIV A;  3ABU A;  5K1Y A;  1F1Z A; 
#chains in the Genus database with same CATH topology
 2DFE A;  3F8N A;  4PSW A;  1A6Q A;  2CYY A;  4LLG F;  2P5V A;  2DFH A;  1IN7 A;  3TO7 A;  3DLL F;  3TW7 A;  4XK4 A;  2A6T A;  4PFP A;  1OPC A;  3FXL A;  1L3L A;  1Z67 A;  2IAI A;  4MHG A;  2ME0 A;  2XRO A;  2L9N A;  1RZ4 A;  4BEH A;  5HOO A;  1NH3 A;  3E7L A;  2JVH A;  3EET A;  1QQI A;  4R1H A;  3OS1 A;  3F3X A;  3HGG A;  4JOM A;  1Z9C A;  1YE9 A;  1LFP A;  2XB0 X;  1C0W A;  1HDD C;  2QWW A;  2OF7 A;  2AXL A;  1HC8 A;  3DFG A;  1D0Z A;  1PYV A;  2DMU A;  4AU7 A;  1LB2 A;  4YG2 F;  4BHB A;  3FXQ A;  4YIF A;  2LFB A;  4IO9 F;  4BYY A;  3ASN H;  3S2H J;  1DP3 A;  4DIQ A;  2OUM A;  1B1B A;  3G1O A;  1X1A A;  1JT6 A;  1I39 A;  2EA2 A;  2EPF A;  2CU7 A;  2V26 A;  2KZG A;  2HPI A;  2ZJP F;  2ESH A;  3V7S A;  5ICG A;  1GVD A;  3FM3 A;  1T56 A;  2LY2 A;  3DLA A;  2FUG 2;  3HOS A;  1P2F A;  3U21 A;  2PJR B;  1Y39 A;  2V9V A;  1G6N A;  1WJ5 A;  1VND A;  5F1R A;  2KL4 A;  3CUQ C;  1Z91 A;  4LJZ F;  4O3M A;  1TZL A;  3RZD J;  1MJA A;  2N8G A;  1FIP A;  3OYA A;  3CJT B;  1U5T B;  2PMU A;  1LNW A;  4L0Y B;  3DKY A;  4JYK A;  1QVT A;  4HQE A;  1Z3Y A;  3PNV A;  3Q0V A;  4I0A A;  1JHH A;  4R8H A;  4G8X A;  1QHG A;  3HGY A;  3K69 A;  3S1N J;  4IJA A;  3JAM Z;  5DDG A;  2O9L A;  3JCU C;  5DUK A;  2P0W A;  3OYM A;  1T8I A;  3P5J A;  2BY3 A;  1MBJ A;  3LQQ A;  3S1M J;  5LRR A;  1UB9 A;  2BE5 F;  5H2F C;  1OCT C;  3BZK A;  1K6Y A;  2VXD A;  4MFE A;  4MIM A;  3ECO A;  1Z3X A;  1DGR M;  2NAZ A;  4X0G A;  4LOC A;  2YSR A;  4FHT A;  3LAJ A;  1E3O C;  2Z3Y A;  1PP8 F;  2DOF A;  2UXN A;  4E4H A;  1F9N A;  1T95 A;  2L9V A;  2D5V A;  2EH3 A;  3A2K A;  1R7J A;  1FMV A;  3RPU A;  2MC4 A;  2PX9 A;  2HTS A;  5KNL A;  2HOS A;  1IN4 A;  2VKV A;  3OYF A;  4RAZ A;  3LWF A;  1OYI A;  2CRG A;  3HHG A;  2CQK A;  3GVA A;  1DGW Y;  1R00 A;  3L7W A;  4AVZ A;  2EZI A;  2EFO A;  2JTV A;  3HOY J;  3SEQ A;  3KYL A;  2EBI A;  3WG7 H;  5L3G A;  3ZQL A;  3K4K A;  1EKE A;  1G59 A;  4A6D A;  5D5W B;  4BY1 J;  3SFI A;  1REP C;  3ZMT A;  1ZAO A;  1SFK A;  1SC7 A;  2BY2 A;  4IL6 C;  3DPU A;  4FQG A;  4AVP A;  3KYC B;  5KK1 A;  2X9D A;  2BEO A;  3BY6 A;  4WCG A;  1Z7L A;  3E3V A;  1IN6 A;  2GIZ A;  3RPU D;  3BR6 A;  2GXA A;  3QYF A;  2KKO A;  2MLK A;  2JK3 A;  3KP7 A;  3L9F A;  3OR2 C;  3SZP A;  3N97 A;  3E6B A;  3RJP A;  3JRI A;  2QSH X;  2W24 A;  1JXS A;  2ZXJ A;  3PUF A;  5D6F A;  2HQN A;  5EG0 B;  5LD2 C;  1YG2 A;  4LLL A;  1GV2 A;  3S3O A;  4U0W A;  5F04 A;  1BM9 A;  2VJ5 A;  2KDO A;  2TRT A;  4PSX A;  2F5D A;  1CF7 A;  4XMY A;  1R6R A;  2QLZ A;  1G4D A;  1RUN A;  1FLI A;  2YX7 A;  3L09 A;  3A1Y A;  3CLO A;  2VOD A;  1B8I A;  2E71 A;  4EMS A;  1OYW A;  4UV9 A;  3O3K A;  4E7K A;  2OBP A;  2D2W A;  1U0J A;  2NS7 A;  1OKR A;  1I5Z A;  3DF8 A;  5JFR A;  3CMA I;  4ZTF A;  1U6G A;  3UR3 C;  2FX0 A;  2IA0 A;  3N4M A;  1YTY A;  1RUO A;  1TBX A;  2HTJ A;  4HYE A;  5D6E A;  4CYC A;  2R7T A;  4S05 A;  1S7E A;  1ZK8 A;  2E2I J;  4AUX A;  3HDD A;  4BUP A;  4K2E A;  1MNE A;  4HF2 A;  4CH7 A;  3WTS C;  2K9N A;  2DA2 A;  4EVI A;  4DGW B;  3OS0 A;  4W97 A;  3WHB A;  2DJN A;  2QA4 I;  1F36 A;  2AQE A;  2FNP A;  3LFU A;  4GCV A;  3ZOB A;  1ULY A;  4AYB A;  5F08 A;  1QBJ A;  3C1D A;  1X1D A;  2MH2 A;  4JQF A;  3TDZ C;  4M72 A;  2HEO A;  3V8K A;  2KZV A;  3RZO J;  2MFZ A;  1O3T A;  2FRH A;  4BXX J;  5FLV A;  1UFM A;  1LJ9 A;  4DBQ A;  4PDK A;  4DW6 A;  4RDU A;  2WC2 A;  2HR3 A;  5JI6 A;  5HS9 A;  2IBD A;  1HW5 A;  2QBY A;  1NTC A;  4Z6Y A;  3PUB A;  4RLF A;  4A3I J;  4U0V A;  2H6B A;  4ZC3 A;  2L9R A;  5HDK A;  1T33 A;  1IRF A;  4IZZ A;  1R4M B;  3BWG A;  1HOM A;  2VAS A;  2FJ1 A;  2DA4 A;  1ONV A;  5FKM A;  1D8K A;  2K4J A;  1BA5 A;  4J00 A;  4YFN F;  2QVO A;  1BR1 A;  5TJJ A;  5GTI C;  4NC8 A;  5ILU A;  2EK5 A;  2M8G X;  2O6G E;  2NS0 A;  5CPR B;  1VQN I;  2QKL B;  4CCN A;  2NVX J;  2X85 A;  3H35 A;  3KX2 A;  4U0Y A;  4A3D J;  2H1L A;  4EGZ A;  3HUG B;  2EIN H;  5LBQ A;  1X2N A;  2BXY A;  4NUB A;  3QYE A;  2DPU A;  2KFD A;  5IP9 J;  1ZH5 A;  4FAS D;  1T6S A;  2A05 A;  2HS5 A;  2HXO A;  3U1D A;  4EAT A;  2OU2 A;  1AU7 A;  4IX7 A;  5EJC A;  5LFA A;  4B1R A;  2UWM A;  2DMN A;  2LDU A;  3MEX A;  1ENH A;  1Z1D A;  1HCR A;  1XCV A;  3CCM I;  5M5W J;  1DU6 A;  4MTE A;  4AYB N;  1SAX A;  4M6X A;  3AG1 H;  4UUS B;  2F5E A;  1R9T J;  4MQ9 F;  3E6M A;  3J7A Y;  1VQ7 I;  2NNN A;  2X1D A;  4A0Y A;  3CES A;  1RES A;  1YYV A;  2CQX A;  4M3G A;  4A5N A;  3PL8 A;  1ZLK A;  2CS3 A;  3I5U A;  4L9T A;  3A0B C;  3R4K A;  2EA4 A;  5LGN A;  5GAD J;  4NQW A;  2DFF A;  3FMR A;  3NAU A;  3L2V A;  2V79 A;  3OYI A;  2RGV A;  2DOA A;  3Q9V A;  3KZY A;  4XRS A;  1SD5 A;  3FM5 A;  4HV6 A;  5D5X B;  1R5I D;  4XKV A;  3QWL A;  3A4C A;  2R4G A;  4M3B A;  1T39 A;  3K4B A;  1FC3 A;  3K4J A;  2O8X A;  3VSL A;  3ASO H;  4BQN A;  2COB A;  3DBR B;  2IS6 A;  3CQZ J;  5IT9 Z;  4RGS A;  5LHG A;  1FMW A;  2NNY A;  3ELK A;  3L2W A;  3L1P A;  1HXD A;  4HF1 A;  2LH9 A;  1VQM I;  3QPL A;  2BY0 A;  3LL7 A;  2HQR A;  3SQN A;  1MDM B;  2L5Q A;  4E7S A;  2ESN A;  3CDH A;  4CHU A;  2L9S A;  1Y8Q B;  3BDD A;  1B6A A;  3H9G A;  4GRI A;  1XMA A;  1WJD A;  1HKT A;  1ZGA A;  2OJE D;  2M2E A;  2DJI A;  2QUF A;  3CD6 I;  5BS6 A;  4RS8 A;  1I1S A;  2ZFU A;  4JX4 A;  1LE8 B;  5IOY A;  3DQV C;  3QYB A;  3PIP F;  3BG3 A;  1UEL B;  1HLV A;  4CDG A;  2L4M A;  2DTR A;  4A3E J;  1IDY A;  4XM3 A;  2JSC A;  1TW3 A;  3HOW J;  3FX3 A;  2WAD A;  1R1T A;  4PGG A;  4KIS A;  3HOX J;  4XSZ F;  3MVP A;  2ZJQ F;  4BY7 J;  5IT3 A;  2QQ9 A;  4ZH4 F;  1ZQ3 P;  4RA2 A;  2R7V A;  2WY7 Q;  2IGK A;  2EWN A;  2VE8 A;  3E5U A;  4II2 A;  1WCM J;  4RGX A;  4ON0 A;  2LF7 A;  2CUE A;  2QKM B;  4XLN F;  3R60 A;  1ETW A;  1T2K A;  2DI3 A;  2P7C B;  3KZZ A;  4QSH A;  2DTZ A;  2XRL A;  9ANT A;  4FX0 A;  3QQA A;  4F92 B;  3G4S I;  3EUA A;  2E7X A;  3DTE A;  4BHC A;  2IEK A;  3C7J A;  4A3K J;  3F22 A;  3BG9 A;  4AID A;  1ZRC A;  4BNC A;  1H0M A;  1XGN A;  3T1B A;  3CCJ I;  3GBG A;  1RKT A;  2F6C A;  1R4N B;  2Z1D A;  3I59 A;  3A01 A;  4BQA A;  3R0A A;  2CW8 A;  2ZXI A;  3VB2 A;  5HLT A;  4JX6 A;  3T0Y A;  4RGU A;  1S72 I;  2ETH A;  4FE4 A;  2ZO4 A;  2P5K A;  2VKE A;  2K5C A;  3D5R C;  3S32 A;  3KP6 A;  1O57 A;  2BY1 A;  3ZMU A;  1ZR4 A;  2EV5 A;  2LNB A;  1YQA A;  3HYI A;  4BEH B;  4RB2 C;  3GW2 A;  1JE8 A;  5JLX A;  1BI0 A;  5F0F A;  2ZJR F;  5HOD A;  2KLO A;  3WU0 A;  3NWS A;  3O8G A;  5FGM A;  4BQQ A;  2VBY A;  2MYS A;  2MLG A;  5E1W A;  1F4K A;  1R23 A;  1VQ6 I;  2WBM A;  3AKZ A;  1N25 A;  5CQG A;  4RLQ A;  4GO1 A;  2JJ7 A;  4LFU A;  5DTD A;  5BQT A;  3H3V K;  3OYJ A;  1K79 A;  2RV8 A;  4BE2 A;  1KZH A;  2ID3 A;  4EJT A;  2W82 A;  3TO6 A;  4CO8 A;  4RAF A;  4Y33 A;  2ECC A;  3RKX A;  4HDV A;  3J7A O;  5LGT A;  2JPB A;  1BIB A;  2L54 A;  3MMY B;  4A3G J;  3DPT A;  5F64 A;  4FX4 A;  1X3U A;  1Z05 A;  2HPM A;  4WK8 F;  1G8X A;  2F4M B;  1GUU A;  3RKY A;  1A04 A;  2E19 A;  1ODD A;  4UHT A;  1J7K A;  4E7J A;  2O61 A;  1G3Y A;  3OWT A;  2IS1 A;  4A93 J;  4M73 A;  4HNT A;  2E1O A;  2R7U A;  3ZQQ A;  1I27 A;  1VTN C;  3J81 K;  2X1C A;  2V1N A;  3CCL I;  1E3P A;  2J5O A;  2AQF A;  3QU3 A;  4N0B A;  3LST A;  5HS7 A;  4IQ4 A;  2ZME C;  3M8E A;  1BR2 A;  3VFZ A;  4ZZL A;  4DZP A;  1IN5 A;  2A3S A;  5A2Q K;  1LKX A;  4LK0 F;  2XF6 A;  1BI2 A;  2VE9 A;  4EM2 A;  3FZV A;  1OCO H;  2DQL A;  1JKQ C;  2IS4 A;  2O03 A;  2LP0 A;  3H3Z A;  4KIT B;  4IF4 A;  3CJR B;  1Y0U A;  1DUX C;  4HEA 2;  5E3O A;  3HEF A;  5J3L A;  4X1E A;  3S1Q J;  1YS6 A;  3ROU A;  4E6K G;  5D5U B;  1WJC A;  2W25 A;  2W00 A;  3U1K A;  1FBS A;  4KUM A;  2VXZ A;  2V1D A;  4LGW A;  3OS2 A;  4M6V A;  3TW6 A;  1W5C C;  5EEG A;  4OU0 A;  1EA3 A;  1QGP A;  1VF9 A;  2WV1 A;  1FZP B;  2F5C A;  4EM1 A;  3TL4 X;  4D0P A;  4KNY A;  2RNG A;  2IGN A;  3JRD A;  5CLS A;  1P4X A;  1S3J A;  1GVJ A;  5L3B A;  4XIC A;  3I4M J;  4XOR A;  3QPH A;  2I8D A;  4AIJ A;  4UB8 C;  1JTY A;  3IP4 B;  3I4N J;  1ERD A;  1W0U A;  3VPR A;  1DP7 P;  3TDU C;  1BOA A;  2JPC A;  3ONQ A;  2XDV A;  1MBK A;  1MMA A;  1UG2 A;  2BHZ A;  2FOK A;  2DT6 A;  4B3X A;  3B6C A;  3WTX C;  1D1B A;  2L01 A;  2O5R A;  5JR3 A;  3MZH A;  3CJQ B;  1ETX A;  2EV0 A;  2R7F A;  4UVA A;  3S93 A;  2IRF G;  1MND A;  2G7H A;  2KJC A;  2DO7 A;  3JRF A;  2YU9 J;  1LPQ A;  2JN6 A;  1R36 A;  1CF7 B;  4UUV A;  5FRO A;  4IRH A;  4Y15 A;  3W2V A;  1N77 A;  3QPT A;  2NVT J;  3W6V A;  1B8I B;  2WAQ A;  2GXG A;  3V8J A;  2M7B A;  5JLW A;  1HDP A;  5EF6 A;  4KMF A;  5JVT A;  4OMY A;  3BJO A;  3KEO A;  3AL0 B;  1GT0 C;  3F9K A;  3CCV I;  3CMM A;  3EUH A;  1ZG1 A;  5FD6 A;  4CIC A;  1TLH B;  4CYC B;  3GZ6 A;  1X4O A;  2BHY A;  2KIM A;  4V2G A;  5LHI A;  2LY9 A;  4S0H B;  2EZH A;  2VON A;  3S2D J;  2HDW A;  4ZZD A;  3K70 D;  1YS7 A;  2L7Z A;  4M71 A;  5DYM A;  5AIP A;  1D1C A;  1KQ8 A;  2L7M P;  2HYF A;  1XTA A;  4CZZ A;  4DQ2 A;  3OYC A;  2VB6 A;  2XF5 A;  3OYG A;  2DDA A;  3LQR A;  4ESJ A;  2C6Y A;  1SMY F;  3G1L A;  4CCM A;  1MMS A;  4ZYD A;  1POG A;  4XRS G;  4PCQ A;  4M9S A;  2X0L A;  1FP2 A;  3N05 A;  4XKC A;  3WU1 B;  4KJZ A;  1GXP A;  5IYD J;  1V5G A;  4QPO A;  3SZG A;  1HKS A;  2HVQ A;  2CUZ A;  3GFL A;  4P9F A;  2XGC A;  3BC8 A;  4RAG A;  4D7M A;  3BJA A;  5ICE A;  2Y0S A;  1IUF A;  4KIF A;  4BDZ A;  2QBY B;  2LRD A;  4M74 A;  3S2W A;  1PUF A;  1IC8 A;  2OTL I;  2DA1 A;  2ELK A;  3CP8 A;  4XN0 A;  5GTH C;  2PQ8 A;  2R3S A;  2WAQ N;  3MKL A;  2E34 A;  5D4R A;  3BZ6 A;  3TP0 A;  1STZ A;  2BVM A;  3CC2 I;  5D4S A;  2LC2 A;  4BXU A;  5EEH A;  5FLX Z;  4A5M A;  3BP8 A;  5GPC A;  3J80 Z;  1ORK A;  2V4J C;  4WXD A;  2E1M B;  4JX5 A;  1A35 A;  2XB5 A;  2JA8 J;  5H6R A;  1I3Q J;  1IF1 A;  1QA6 A;  4OIR F;  4HRI A;  2ADU A;  3OYK A;  2DA5 A;  1ON2 A;  4Y3O A;  1O7L A;  2CV2 A;  5J8F A;  1H89 C;  3LSM A;  5IPA A;  2E1N A;  4LB6 B;  4Y17 A;  4EJW A;  4DBR A;  1JKO C;  1MZB A;  2CUF A;  3OOP A;  2DMP A;  1U2W A;  1KU9 A;  5HLG A;  1ETV A;  1XC5 A;  3BLY A;  5KHD A;  2BW3 A;  1LFB A;  4YEJ A;  3M1C A;  3LMM A;  3H92 A;  5ERI A;  1B72 A;  1XCB A;  3MD2 A;  5FO5 A;  3BTJ A;  1JGG A;  3DBH B;  2LR8 A;  2ZB9 A;  4HNV A;  4KYW A;  3OY9 A;  2O3F A;  3BOQ A;  5HLH A;  3ZQH A;  3V4G A;  5HDN A;  1YHQ I;  4YII A;  1U9N A;  2ZXW H;  4NQW B;  5F27 A;  2IA2 A;  3IV5 A;  2A61 A;  3FBN B;  3BG5 A;  1BR4 A;  1FNN A;  2Y0S N;  1OMI A;  2J5P A;  4IVN A;  5LLQ A;  4LB5 A;  2QGU A;  3SFZ A;  3CJN A;  3GTG J;  5DCM A;  2COM A;  3HB9 A;  1AKH A;  4IOA F;  3TBI A;  3QOP A;  4KT6 A;  1RR8 C;  2XHK A;  4WXC A;  3S1R J;  2WY8 Q;  2XAF A;  5K7F A;  3FMS A;  1E17 A;  3BQZ A;  5EGO A;  1V4R A;  2VQG A;  1A36 A;  3BCA A;  4U88 A;  2O0Y A;  4HZF A;  2NOG A;  3CUQ A;  3K4L A;  3GTO J;  4G7Z F;  3HTS B;  1T0F A;  2XGD A;  2GM4 A;  1I50 J;  4IRI A;  3VOD A;  2OQG A;  1ITY A;  4ANJ A;  3MN2 A;  2JA7 J;  1WH5 A;  4HST A;  1IZ1 A;  5J1U A;  2DYR H;  2HVR A;  2RC4 A;  5BOX A;  1R71 A;  4KN4 X;  2NS8 A;  4NNJ A;  2OC6 A;  5J1R A;  2E36 A;  3I71 A;  2E2H J;  4ZYH A;  5E20 A;  5ED4 A;  4YFX F;  3ZMV A;  4YFK F;  2H1K A;  1ZRF A;  2WAF A;  1HA8 A;  1LVK A;  1RIO H;  3CME I;  1FT9 A;  5IYC J;  1AOY A;  1KGS A;  5CVV A;  3IL2 A;  1D0X A;  5FKO A;  1VZ0 A;  2FMY A;  3BG7 A;  5GAH J;  1J0R A;  4OWR B;  3WG9 A;  3ZQ7 A;  1VQ4 I;  2PMH A;  2K86 A;  5M3F J;  2QF7 A;  3PQK A;  4IRG A;  4HSR A;  4M9X A;  3Q3S A;  4NBQ A;  1FYK A;  4ITV A;  2FML A;  4NDL A;  4Y4R A;  3GUD A;  4E7Z A;  3I53 A;  3IC7 A;  3GTQ J;  3I59 B;  3VWB A;  1LDJ A;  3A01 B;  2D1V A;  3MQ0 A;  4HF0 A;  4RB3 C;  3NAR A;  4JK1 X;  2K3F A;  3RQI A;  4B09 A;  2AS5 F;  3HJE A;  5CQE A;  2VKD A;  1MJB A;  3J7Z I;  2JRM A;  2OZU A;  3JSP A;  5CVI A;  5E3L A;  4GXO A;  1SFE A;  3FXJ A;  2FXA A;  3SEZ A;  1JUP A;  2XGE A;  2JMW A;  1Y56 A;  5TGT A;  3ZN1 A;  2XIG A;  2HZD A;  3A02 A;  3REO A;  5B1B H;  4BJT A;  4XID A;  1R49 A;  3LA2 A;  3NWT A;  1MH4 A;  1U8B A;  2X6X A;  5J47 A;  2RVC A;  2DXI A;  5DUI A;  3U9G A;  3FDY A;  1B4A A;  2M34 A;  1IDZ A;  2ZNY A;  3QOE A;  3HPG A;  2V1U A;  2R5Y B;  3OIP A;  2R0Q C;  2FBH A;  2B63 J;  3CMY A;  4RGR A;  2VC1 A;  3GF2 A;  4HX8 A;  4G7H F;  4UY8 I;  1FYL A;  4XL9 A;  1W7P A;  2VBZ A;  3WTT C;  4MQV A;  3ZQI A;  1B59 A;  4E7H A;  5BPD A;  3PJR A;  5DD4 A;  2H27 A;  1D8J A;  3WTW C;  3E1S A;  2K3P A;  3I0T A;  2VBW A;  2FD5 A;  1AWC A;  2Y31 A;  5C44 J;  2IS2 A;  2ICW G;  1W5T A;  1UCR A;  1XG1 A;  4RAY A;  5CJ9 A;  3X2Q H;  3AG4 H;  4ESF A;  4NB5 A;  3CF2 A;  4Z2Y A;  4A2U A;  5B3S H;  4LG0 A;  2XAU A;  3IAS 2;  3LA3 A;  3FIS A;  4A12 A;  2PFB A;  3FKI J;  1RNL A;  1BN5 A;  1BIA A;  5DD8 A;  5HLI A;  3TO9 A;  1GLN A;  2EJR A;  1W7P D;  3DEU A;  2GXB A;  1R5H A;  1YX5 A;  4XKW A;  1OCP A;  1HW2 A;  2ZJ2 A;  2P5L C;  4L9V A;  2Y9Z A;  3L2C A;  2QZ8 A;  2F4O B;  4M9Z A;  2XUB A;  1K7A A;  3VYR B;  3PO3 J;  1GDT A;  5DV5 A;  4ZYA A;  4EGY A;  2EIJ H;  4FT8 A;  1WPK A;  2EQR A;  3DU6 A;  1SMT A;  4HOB A;  4QIW N;  1I3A A;  2KHM A;  2RDP A;  2E35 A;  4DYR A;  1PUE E;  3AG3 H;  5CVR A;  4E7I A;  3CLQ A;  2ME6 A;  1V3F A;  3DTI A;  4YEL A;  4B44 A;  5BNG A;  4ETS A;  3GTK J;  1QZE A;  5J4V A;  1XPX A;  1P92 A;  2UV1 A;  3S3M A;  1D1A A;  2G7U A;  3OIQ A;  1H88 C;  3TP3 A;  3QP6 A;  3U2R A;  3OSG A;  1ETQ A;  3Q0W A;  3OV8 A;  4YRV A;  2HKO A;  1PJR A;  2IT0 A;  2M87 A;  4TV7 A;  4B4C A;  4XOP A;  5K7H A;  1QU3 A;  3ERM A;  2VJ4 A;  2L3D A;  4L9N A;  3KET A;  4UUT A;  5ILS A;  1A6I A;  3RI4 A;  2EZL A;  1MKM A;  1HST A;  3GWZ A;  4M3E A;  1Y0N A;  3I55 I;  2R7Q A;  1Z21 A;  1EH6 A;  1LDK B;  4OIO F;  3E97 A;  2VKH A;  4XN3 A;  2RRE A;  3JAM K;  1YOV B;  2X6Y A;  4HW0 A;  2LKS A;  1JUS A;  4F52 A;  3F8B A;  4Q47 A;  4D9J A;  3V7R A;  1BW6 A;  4U87 A;  1E0E A;  3RYP A;  3O8H A;  2Z33 A;  2FQ3 A;  1YI2 I;  2BV6 A;  2VQH A;  1FBQ A;  5FJ8 J;  1ACI A;  1VQL I;  2HOT A;  4XRM A;  2YUS A;  3F21 A;  3GFI A;  3HXL A;  1U5T C;  1TP4 A;  3K4C A;  1FTZ A;  3K6G A;  2VIX A;  4A3L J;  5FLM J;  1VQO I;  1DU0 A;  1W4M A;  3FK6 A;  3PNT A;  2OTJ I;  1S9H A;  2VLA A;  2RKH A;  5LGU A;  3DKW A;  3NRV A;  3AAF A;  2F5F A;  3K1M A;  3F0C A;  4JBA A;  4B47 A;  2JVG A;  1WH7 A;  3LA7 A;  3EPZ A;  3IRR A;  3WTV C;  3K4N A;  2UZK A;  1FPQ A;  2CH0 A;  1WKM A;  3JRC A;  2LSO A;  5GPA A;  3ZMS A;  1LVA A;  2CQ7 A;  4PFO A;  3GXO A;  4XSX F;  2R7R A;  5HNF A;  2OZ6 A;  5EZG A;  3F6V A;  3LNQ A;  1KYW A;  2EFQ A;  5CVJ A;  3ZRG A;  2XKP A;  4D7N A;  1RRJ A;  2MAB A;  1FSH A;  1SAN A;  3HRS A;  2NOJ B;  2Z5U A;  4CCK A;  3DEW A;  2F48 A;  1O3R A;  3ZR8 X;  3HRT A;  3LSP A;  1JJ8 C;  1WJE A;  4KMU X;  1OJL A;  2LVS A;  4QWQ A;  3M8F A;  4BHP A;  2VPR A;  4N9I A;  4GYG A;  1W36 D;  1P9Q C;  3CCS I;  2LLK A;  1F5T A;  1K61 A;  5GAE J;  2DCE A;  2R7Z J;  5H20 A;  4UXN A;  2TCT A;  4XLC A;  2KIQ A;  2V1X A;  3CCY A;  1XSD A;  3S16 J;  1UG0 A;  4G6Q A;  1D0Y A;  2FEZ A;  1TQM A;  2ZNZ A;  3HHH A;  3I9V 2;  2NVY J;  1BC7 C;  3W6K B;  4EEF G;  1Z7U A;  2EB7 A;  3JRA A;  1ZG5 A;  1VI0 A;  2VUM J;  2A5W A;  2AHQ A;  5F6F A;  3GTL J;  2M4G A;  3KLN A;  3G73 A;  1PUF B;  2IJL A;  2JRT A;  1IRZ A;  1KU2 A;  2DA7 A;  2IW5 A;  3RTR A;  3HM5 A;  2WA0 A;  1J5Y A;  5EEA A;  3RQ4 A;  2BZT A;  1RPW A;  5GP9 A;  1MNM C;  1DQU A;  2V9P A;  1R5G A;  4IEJ A;  3HZJ A;  3S17 J;  2YX4 A;  2XV4 S;  4UV8 A;  2Y9Y A;  3LOC A;  4HDU A;  2LBF A;  2JSP A;  4XKB A;  3ZQC A;  2VPL A;  4E7L A;  5B1A H;  2EIM H;  3HRU A;  3H5A A;  2JA6 J;  3HIF A;  5TIS C;  2VN2 A;  4MGR A;  2GQQ A;  4P9U A;  4G6T B;  4H0E A;  3OOU A;  1Z77 A;  2B9S A;  2F5V A;  1IGN A;  3OSF A;  2XKO A;  2R7X A;  2HWV A;  2RN7 A;  4BS9 A;  4DJA A;  1X3W B;  4LIV A;  4N9H A;  3OR1 C;  3K7A J;  2VQC A;  2BW3 B;  2R5Y A;  3PIO F;  3ZQF A;  4WX9 A;  1B72 B;  3CCE I;  1S7O A;  1J75 A;  3V42 A;  2L7F P;  3LSH A;  3WTZ A;  1YRN A;  4LIT A;  3GO5 A;  4AWX B;  2A6H F;  4IKF A;  2M0C A;  2HNH A;  4IHT A;  2LF8 A;  2CFO A;  3C18 A;  4GGG A;  3VOE A;  2MC3 A;  5J8C A;  1EJ9 A;  1KYZ A;  1FJL A;  4BJ6 C;  3TED A;  2DOD A;  3K1P A;  1FOX A;  1SFX A;  1EF4 A;  3QAH A;  2DPD A;  3VYS B;  3BRO A;  1ETK A;  2NVQ J;  5IY5 H;  3M7G A;  2CWE A;  5K5O A;  1APL C;  1VQK I;  4G6D A;  5DCM B;  1AKH B;  3C2H A;  3V7C A;  1JTX A;  2L02 A;  2W85 A;  1MGT A;  2MBF A;  5L3F A;  1XB4 A;  2Q0O A;  3EQL F;  4GDF A;  4KDP A;  1IO2 A;  2XF7 A;  3D5L A;  2XGX A;  4Q4Z F;  1DDN A;  1QPM A;  4OIP F;  4MO7 A;  5EGO B;  1LUJ B;  2WWY A;  2FBK A;  1TNT A;  3KEQ A;  3ABM H;  2WB1 A;  3CUQ B;  2YS9 A;  5E1Z B;  1BJA A;  2NVU B;  2R92 J;  2LRE A;  2HQ5 A;  3KP2 A;  1P7I A;  1SD7 A;  4LIU A;  2ZXH A;  2ZBK A;  2DYS H;  3K1N A;  2DA3 A;  2L2O A;  1QHH D;  3WGI A;  1IXR C;  2W57 A;  2KT0 A;  2P8T A;  3Q9S A;  1ETO A;  4I09 A;  2F2E A;  2ZME A;  4CA0 A;  1O4X A;  3H9J A;  4I6Z A;  2LOO A;  2JQ7 A;  3CCQ I;  1PDN C;  1EV7 A;  3ML6 A;  2LK2 A;  2OCE A;  4D1Q A;  1Y6I A;  1CGP A;  3TMO A;  1UMQ A;  5K7Z A;  2G0E A;  1WZ2 A;  4OMZ A;  1FIA A;  5F1J A;  3ABK H;  2CW0 F;  1JJ6 C;  1AA7 A;  2R93 J;  1ZLJ A;  1MBH A;  2HFH A;  2NXN B;  1EH8 A;  4KIB A;  2XAH A;  4U7B A;  1TWH J;  4D5C A;  3AG2 H;  2VT3 A;  4RBO A;  3G71 I;  1JGS A;  1PVE A;  3ZQG A;  1YFH A;  1IG7 A;  4YIR X;  1ZRE A;  3CDI A;  1J2X A;  3JTH A;  3GFM A;  4KT5 C;  4KN7 X;  5IT9 K;  3MZ8 A;  4IHW A;  5JVG F;  1LDD A;  2H8W A;  5LRS A;  3J7Y J;  3OYN A;  3PQJ A;  3ZMZ A;  3HBL A;  4WF2 A;  4ZJZ A;  2UUZ A;  1KA8 A;  5E1X A;  3MKY B;  4XLP F;  4CCL A;  1MMN A;  3CDL A;  1Y1V J;  1FBU A;  3P9I A;  5FKL A;  3OYE A;  1OR7 C;  3GFJ A;  1FY7 A;  1ZAR A;  3WE2 A;  3K70 C;  1Y8R B;  4BE1 A;  2WB1 N;  3E0J B;  4F55 A;  4NC7 A;  3CZ6 A;  2DW4 A;  2E2J J;  2QQ8 A;  4JP0 A;  3SHF A;  3BZC A;  3LSG A;  2MD5 A;  2ISY A;  4FIS A;  5L3E A;  1MH3 A;  2M7A A;  3ZN0 A;  3JRB A;  1J59 A;  5C3E J;  1SVO A;  1ETY A;  2ID6 A;  3ABL H;  4B3A A;  3EUH C;  5FFX A;  2KMU A;  3FXK A;  3SDG A;  5J40 A;  1XGO A;  4G7O F;  4MEX F;  2OD5 A;  1W7P B;  1S29 A;  4MLO A;  3S8P A;  4Y7N J;  3JRH A;  2HGC A;  1ZGJ A;  2R5Z A;  4B43 A;  5H6Q A;  4Y52 J;  2ACJ A;  4UVC A;  1HF0 A;  1XDS A;  1P6R A;  1YIO A;  3K4M A;  2JUG A;  4C2T A;  3ZGK A;  3L2R A;  1Y1W J;  1Q1H A;  4XQF A;  5KVR A;  1FWZ A;  4I76 A;  4BE0 A;  4AC0 A;  1R58 A;  1XMX A;  2XSD C;  4AM3 A;  2V6E A;  1BBY A;  3COA C;  5CVU A;  3FWE A;  2K9S A;  4DYQ A;  3F8C A;  2HOE A;  1FX7 A;  3SXY A;  2XAS A;  4LG0 B;  4B8X A;  3CC4 I;  1BOB A;  3HL2 A;  1YO5 C;  3D0S A;  2Q2E A;  1X2M A;  2PMZ A;  1MMD A;  3IHU A;  2OV7 A;  2RAE A;  1HBX G;  1DPR A;  3H36 A;  3IH4 A;  3OIO A;  3R6S A;  1O3S A;  1WJA A;  2F4I A;  1QPI A;  3LSK A;  4DNC A;  2VOO A;  2FNA A;  3BT9 A;  3E5X A;  1MMG A;  3ZPL A;  3VYT B;  1HSJ A;  1H9G A;  1XGM A;  1SVL A;  1K83 J;  3LSR A;  2EIK H;  3IKV A;  4F91 B;  4XRF A;  3VEP A;  1TNS A;  2IA1 A;  3H0G J;  1FEX A;  4I2O A;  3ERE D;  2X48 A;  5FKN A;  1VQP I;  1YJ9 I;  3HOV J;  4Q48 A;  2DAO A;  1MBF A;  2ZCW A;  3ZP5 A;  1NK3 P;  1FYM A;  3PO2 J;  3KP4 A;  1ZHF A;  4P5O A;  2IGM A;  2XRN A;  4WWC A;  2AO9 A;  3F8F A;  2VI6 A;  4C9Y A;  3CO6 C;  2MA3 A;  3TOB A;  4BJ5 C;  3KZI C;  3C2B A;  2R7S A;  3FIW A;  3DU5 A;  1F43 A;  2CV1 A;  2DBB A;  2ZC2 A;  3OL3 A;  2VT2 A;  5IYB J;  3M4O J;  1XGS A;  5EDN A;  3EYY A;  3RPQ A;  2QCO A;  3GTJ J;  2M45 A;  2CQN A;  4MNU A;  3G3Z A;  3ESW B;  3G6E I;  4CCJ A;  2PMZ N;  1X1P A;  3JR9 A;  2L0K A;  1J09 A;  1P4W A;  4PJJ A;  1MBG A;  2GBY A;  3NEU A;  4X6A J;  1TWG J;  5E8G A;  5KAF C;  1WJF A;  1B9M A;  2HYG D;  3F8M A;  1OCZ H;  2W4S A;  4IQJ A;  4AD9 A;  3WTY C;  4E70 A;  3AFH A;  3EUK L;  3CCU I;  2CW7 A;  2DMQ A;  4RM3 A;  3JTG A;  4FTH A;  4ZTJ A;  2FOW A;  3E6C C;  5DEQ A;  2BVL A;  2EFW A;  3L2U A;  1VQ9 I;  1M1E B;  2NRA C;  1SFO J;  4OIN F;  1UJ8 A;  3MKW B;  2AXT C;  3E5Q A;  1RR7 A;  1X3Z B;  4HV5 A;  4BU2 A;  2MD0 A;  3P7N A;  3TOA A;  5BMZ A;  1WI3 A;  4G9Y A;  2FE3 A;  3EYI A;  3GTP J;  2LMD A;  1IN8 A;  5LEK A;  1T0F C;  3WOD F;  3OMY A;  4I01 A;  4LD5 A;  1YIJ I;  5M5X J;  4HLY A;  5ICF A;  1FSE A;  2R7W A;  1BC8 C;  2D1H A;  3WGG A;  1PP7 U;  3I54 A;  3IH3 A;  3BR3 A;  2CSO A;  3GZN B;  2IGO A;  1V5F A;  1ZKG A;  4ZYE A;  3I4P A;  1OIS A;  2LG4 A;  3DEE A;  4OAZ A;  4CSW A;  3KLO A;  4IHY A;  1RKW A;  3CP2 A;  5J6X A;  4OIQ F;  4KIC A;  4L0Z B;  4GFB A;  2QM3 A;  1ON1 A;  1JKP C;  1B9N A;  4CXF A;  2RNJ A;  3MFK A;  3WGH A;  3MCZ A;  1NK2 P;  3CO7 C;  3OYH A;  2X1E A;  4PJL A;  1BI3 A;  1QZZ A;  2ZSH B;  3HPH A;  4UB6 C;  2XAJ A;  2XSJ C;  4EJU A;  5E3M A;  1T38 A;  1V5E A;  3D1N I;  2R7D A;  2ZSI B;  2VJJ A;  1WGX A;  2X51 A;  3GLX A;  4A0Z A;  1YW7 A;  4FET A;  5B5E C;  1MBE A;  1Z6T A;  1U78 A;  3ECH A;  4A69 C;  3S3N A;  2VJI A;  1IRX A;  2Y0M A;  1FOY A;  2LBF B;  3BCB A;  3FK7 A;  2TDX A;  4Y13 A;  3K2Z A;  4HLX A;  5C4X J;  2RQP A;  2K9Q A;  2PI0 A;  4XLF A;  4P1W A;  3KPH A;  4XLH A;  5KCM A;  3K2A A;  2HQA A;  1G3T A;  4HBL A;  4AIK A;  3HSR A;  5J4Y A;  4OOI A;  3BTL A;  4ASN A;  5E79 C;  3WHC A;  1I6X A;  2KRF A;  3BR0 A;  4IOC F;  4CZC A;  1OQY A;  2QQB A;  5EYR A;  3RSN A;  5EZH A;  1JT0 A;  4XOT A;  3RKW A;  3ABT A;  5B66 C;  5ILV A;  3AL0 C;  1AHD P;  2XPV A;  1SFU A;  3DTK A;  2LKX A;  3S14 J;  3H3U A;  2YR2 A;  2DFI A;  1XX5 A;  3UNG C;  3GME A;  2WTE A;  1OLT A;  1K78 A;  4XLA A;  4C2U A;  2B7E A;  2E5N A;  2E60 A;  4J01 A;  1YRN B;  3DP7 A;  4M6Y A;  1FOK A;  4G12 A;  3M8J A;  4A6E A;  3S15 J;  3RYR A;  4NC6 A;  2RQQ A;  1WRJ A;  3B6A A;  3RKQ A;  4AIH A;  2Z16 A;  2Y75 A;  4G94 A;  3HTU A;  1MSF C;  2BBY A;  2M1B A;  3IUO A;  1GXQ A;  2V9K A;  1N75 A;  2A6E F;  2OAZ A;  4I98 B;  3ZCO A;  2W48 A;  2NYX A;  3EDP A;  1YW8 A;  5J1Y A;  2KIU A;  2DQR A;  1YLF A;  2X4H A;  4L5E A;  4N4N B;  1V54 H;  3C2G A;  4HG2 A;  4PJ0 C;  5FLX K;  3J80 K;  1D5V A;  4KA4 A;  3IKT A;  4QTR A;  2GWR A;  2KP6 A;  5CKT A;  3VDX A;  1MW7 A;  2M8E A;  5ICC A;  1UAA A;  2X6O A;  4XLE A;  3HG9 A;  1OYY A;  1QNT A;  4F93 B;  3HRM A;  3O2P E;  4O5V A;  4P96 A;  4B48 A;  1XS9 A;  1HW1 A;  1U9O A;  1T08 B;  1JUM A;  3ISP A;  2LD5 A;  3O6B B;  3H1C A;  2IP2 A;  1K4S A;  4ABZ A;  2PEX A;  2ISZ A;  4IHS A;  1MD0 A;  3PFI A;  4ENN A;  2Q1Z B;  1GHC A;  1O3Q A;  2FSW A;  2OQR A;  2ZME B;  2H09 A;  2X6W A;  2E1M C;  4HX7 A;  2IXS A;  1YX3 A;  3ULQ B;  2STT A;  4M3F A;  5D5V B;  1TWC J;  1XDU A;  4C3J J;  1V55 H;  4EQQ A;  5L3C A;  3FMQ A;  1J9I A;  1OFC X;  4WXH A;  3QU6 A;  1HQC A;  5AIQ A;  2UXX A;  4A3J J;  3BR5 A;  3FBI B;  3B02 A;  2OA4 A;  3J81 Z;  1Q1V A;  2R7O A;  4CCO A;  3HC7 A;  3JW4 A;  5D8K B;  5L3D A;  2VC0 A;  1N78 A;  3BQY A;  3I58 A;  2I10 A;  3CCR I;  5HVQ C;  1RC9 A;  4HNU A;  5DS9 A;  3QOD A;  3TKY A;  5A2Q Z;  4KIG A;  3FHZ A;  2IPQ X;  1VQ8 I;  1X58 A;  1OCC H;  4F3Q A;  4L9J A;  2WAE A;  4BAY A;  3FF5 A;  2MH9 A;  4II3 A;  4ESB A;  2YU3 A;  1WWX A;  2HOA A;  2HYJ A;  1YJW I;  1UHM A;  2K40 A;  2GA2 A;  2OCC H;  5K5Q A;  3M3Y J;  2CMP A;  2HU9 A;  4HPQ A;  1L0O C;  4DOZ A;  4FE7 A;  2Z2S B;  3KIO A;  2Y48 A;  2A07 F;  2A69 F;  3CF5 F;  1WJB A;  2DT7 B;  4XNF A;  3TGN A;  2LTP A;  1W36 C;  5M3M J;  1WFX A;  4EJV A;  1TQI A;  2PJR A;  4UNO A;  3MKZ A;  2I5U A;  3G2B A;  3K10 A;  2QSF X;  2ELH A;  1E2X A;  1QZY A;  4F7Z A;  1NG7 A;  1KQ0 A;  1U5T A;  2R5Z B;  1P7J A;  4W1U A;  2P7V B;  1RET A;  1QVU A;  3RDI A;  3Q0U A;  1YJN I;  3FXO A;  4XR6 A;  2KRH A;  2Y2Z A;  4A0X A;  1YIT I;  3KP5 A;  1NHA A;  1W0T A;  3F6O A;  2JZY A;  1UZC A;  4EV0 A;  4IHV A;  2CO5 A;  1SAU A;  2M3A A;  3G1M A;  2JT1 A;  5IP7 J;  4FCY A;  4M3D A;  2GA1 A;  4O6J A;  2W7N A;  3PSF A;  5FD5 A;  3UKG A;  3GEZ A;  3GZ5 A;  3SYT A;  3JRE A;  3PM1 A;  3DPL C;  1ZTR A;  2L4A A;  5FFZ A;  3VYU B;  2Q2E B;  1BL0 A;  3RIR A;  4C30 A;  4I99 C;  4HQM A;  4CGZ A;  2IVM A;  3F23 A;  2A68 F;  4EJO A;  2A5Y B;  2KPM A;  4RB1 A;  3D5S C;  2EFP A;  2P81 A;  2KRC A;  3IH2 A;  2PLY A;  5FRN A;  1TC3 C;  3SZT A;  5HDG A;  3FXU A;  3HOU J;  1IV6 A;  2CG4 A;  4U7D A;  3F72 A;  2CGP A;  3H5N A;  3W2A A;  2JA5 J;  3GCM A;  3T8R A;  5F0H A;  4C3H J;  3LSI A;  2L7K A;  2QQA A;  1WSU A;  1A31 A;  1R1U A;  3GTM J;  4XON A;  3BTI A;  3W2W A;  4LLN A;  5DM7 F;  1I6H J;  2K9L A;  4EM0 B;  1FTT A;  1S8N A;  2KJB A;  1TL8 A;  1LFU P;  3BPV A;  4V2F A;  1G3W A;  5KAI C;  1U3E M;  2EZK A;  4BDY A;  3FKJ A;  2XPU A;  3NQO A;  4R79 A;  3GLL A;  3HKZ A;  3KYD B;  4PK4 A;  1IXS B;  3KE2 A;  1KU3 A;  1TQP A;  2M4K A;  1BI1 A;  3P9K A;  4ENM A;  1SVM A;  4D5F A;  4ZDO A;  2HVS A;  3KFW X;  3MZY A;  1JI8 A;  2DMT A;  2QYO A;  4ZDP A;  4C2M J;  1ZRD A;  1WQ2 A;  4LK1 F;  2LKP A;  5CYV A;  1ZN2 A;  2Y69 H;  2VBX A;  5EG0 A;  4H4K C;  2W1O A;  1MJ9 A;  1SD4 A;  2BGC A;  2P6T A;  3VSK A;  3FXM A;  5K5R A;  3KEY A;  3IWF A;  4ENK A;  1WI9 A;  3WTU C;  2JUC A;  2G9W A;  3T5X A;  1HKQ A;  2P4W A;  1H8A C;  2LYC A;  2DLL A;  2FF4 A;  4LG3 A;  5HS8 A;  1S5L C;  2XAG A;  1W5S A;  3M1E A;  4LMY A;  1TWA J;  1O7F A;  1K6O A;  1BJZ A;  1TTY A;  3HSF A;  3A03 A;  4RMN A;  4I0B A;  4C3I J;  2E5Z A;  4I7H A;  3DCF A;  2P6S A;  3GYH X;  1DPU A;  5FRM A;  4DZJ A;  1KQ9 A;  1U8R A;  2K7L A;  4L5I A;  3WU2 C;  4I02 A;  2M5W A;  3BR2 A;  4BKX A;  3CUO A;  3W3C A;  3PFY A;  2GOM A;  4A3B J;  1XSX A;  1K4T A;  4ENJ A;  2DT5 A;  2GAU A;  5LEJ A;  3L2Q A;  4ZYG A;  2O8K A;  1S6L A;  4BBS J;  2V6C A;  1ZYR F;  3LAP A;  2ELJ A;  3BPX A;  2VL8 A;  4V19 K;  3HKZ N;  2MGQ A;  3OL4 A;  4MEY F;  3ZMD A;  2DN0 A;  3K9T A;  4RM2 A;  3ZXS A;  5E18 F;  1R22 A;  1USS A;  1UHW A;  1UST A;  2PN6 A;  2Q8K A;  4BH9 A;  2M30 A;  1SD6 A;  4IHX A;  1X4P A;  3I64 A;  1LEB A;  3V8L A;  2H94 A;  3BTC A;  3H0D A;  2E1C A;  2OPT A;  3IWZ A;  4QLC U;  1JKR C;  4UVB A;  2HKX A;  2DK8 A;  3DBL B;  1XMK A;  4CUG A;  2KQR A;  1WHU A;  1QRY A;  3K0L A;  1IUY A;  4N4O B;  4PJN A;  2M0M A;  2EFN A;  2QEN A;  3IAM 2;  3R0J A;  5F0C A;  1TT0 A;  1LEA A;  4A3F J;  4A3C J;  1YW9 A;  3HSE A;  2DOE A;  3PSI A;  3MAJ A;  4PGH A;  2Z9O A;  2CFX A;  4CYD A;  3Q5F A;  3HOT A;  5D8L B;  3CTA A;  1D3Y A;  3A0H C;  2Y30 A;  1VQ5 I;  1SEU A;  1BW5 A;  2EV6 A;  3OYB A;  3R61 A;  2K4B A;  1G2H A;  2ZFW A;  6PAX A;  3DV8 A;  3M07 A;  4ZDL A;  4Q5S F;  1VFC A;  1NG6 A;  3QRF F;  3HUG A;  4PJM A;  1ZEL A;  1H9T A;  4P55 A;  5IOZ A;  3T8T A;  1FOW A;  2GOX B;  5GAG J;  4BBR J;  1Z0X A;  2PBI A;  2VQL A;  2BYV E;  2BXZ A;  5HNH A;  3LSJ A;  4BQO A;  2XPW A;  2XVC A;  2H6C A;  3KP3 A;  2WV0 A;  1QO0 D;  1D5Y A;  1LQ1 A;  5BPI A;  1P4A A;  3JSO A;  4UUS A;  2HXI A;  3OYD A;  3H5R A;  2K27 A;  3QP5 A;  1EH7 A;  1XN7 A;  3L00 A;  4RB0 A;  1A5J A;  1RI7 A;  3DWL E;  1ZR2 A;  3I56 I;  5E17 F;  2MG4 A;  2MW8 A;  2O7O A;  5E8I A;  3IRQ A;  2EIL H;  2HZT A;  5FKK A;  3DKX A;  1X19 A;  1X1C A;  2CQQ A;  2FQ4 A;  2Z99 A;  4GYI A;  4HX4 A;  4MFD A;  1S7A A;  2DA6 A;  1K78 B;  3DXJ F;  1X1B A;  1OR7 A;  3MWM A;  2YPR A;  5JHF A;  2D45 A;  2LY1 A;  3B73 A;  4BL0 B;  2JWT A;  4IXA A;  2FA5 A;  3W6J B;  4BGD A;  1TW2 A;  3BG6 A;  2CV0 A;  3GX4 X;  2QSG X;  4DYC A;  2STW A;  3CC7 I;  3HOZ J;  1ZG3 A;  2HDC A;  2DK5 A;  3BJ6 A;  2MSY A;  3QPS A;  3WE3 A;  1UHS A;  1R1V A;  5TRD A;  2H8R A;  1MIJ A;  1XD7 A;  3KCC A;  1MDM A;  1T98 A;  5M5Y J;  1E3H A;  1KU7 A;  1IV8 A;  1Z6R A;  2HI3 A;  2M9H A;  4S04 A;  2GZW A;  2XC7 A;  1XSV A;  2KIF A;  3H9Q A;  4NHJ A;  1IXC A;  4L5J A;  3JRG A;  2K85 A;  3BR1 A;  1CQT A;  1KON A;  1LE8 A;  4MTD A;  1MSE C;  2FBI A;  1IRG A;  3OYL A;  1FP1 D;  2DDB A;  5DCF A;  4BXF A;  2CUJ A;  4J19 A;  3FXR A;  3M9A A;  2K9M A;  5E3N A;  5C4J J;  5DM6 F;  1TWF J;  4OAY A;  3LFK A;  3E6D A;  5IP6 A;  2KDZ A;  1I1G A;  2B0L A;  3P9C A;  4PUS A;  3RCO A;  5JHU A;  4HA8 A;  4L18 B;  3FHN A;  2JA2 A;  5LHH A;  1TT5 B;  2DU9 A;  5AON A;  1WVR A;  2XAQ A;  3C3W A;  3I3L A;  2QEX I;  4A3M J;  2FU4 A;  2BOL A;  4HAM A;  4KFC A;  2HDD A;  1JHF A;  2KIS A;  2PG4 A;  2CJJ A;  3TQN A;  2W84 A;  2V7F A;  2E7W A;  4BAC A;  1GV5 A;  4PZJ A;  3PNY A;  1ZGW A;  1IAW A;  2PJP A;  2VOP A;  4IPA A;  1G3S A;  1OCR H;  5FB2 A;  2K02 A;  1IW7 F;  3SJM A;  1W1W E;  2ZKZ A;  2ECB A;  4XBF A;  3SDB A;  2GLO A;  1IJW C;  2GIV A;  4QPQ A;  3ABU A;  5K1Y A;  1F1Z A; 
#chains in the Genus database with same CATH homology
 3F8N A;  2CYY A;  4LLG F;  2P5V A;  3TO7 A;  1IN7 A;  1OPC A;  1L3L A;  4MHG A;  2XRO A;  1RZ4 A;  5HOO A;  3EET A;  1QQI A;  4R1H A;  3F3X A;  1Z9C A;  1C0W A;  2QWW A;  2AXL A;  3DFG A;  1LB2 A;  4YG2 F;  4BHB A;  3FXQ A;  4YIF A;  4BYY A;  1B1B A;  2EA2 A;  2ESH A;  3V7S A;  5ICG A;  3FM3 A;  3HOS A;  1P2F A;  2V9V A;  1G6N A;  5F1R A;  4O3M A;  4LJZ F;  3CUQ C;  1Z91 A;  1MJA A;  1U5T B;  2PMU A;  1LNW A;  4L0Y B;  4HQE A;  4I0A A;  1JHH A;  4R8H A;  4G8X A;  3K69 A;  4IJA A;  3JAM Z;  5DDG A;  5DUK A;  3LQQ A;  5LRR A;  1UB9 A;  2BE5 F;  3ECO A;  2NAZ A;  2YSR A;  4FHT A;  3LAJ A;  2Z3Y A;  1PP8 F;  2UXN A;  1F9N A;  1R7J A;  3RPU A;  2HTS A;  1IN4 A;  4RAZ A;  3LWF A;  1OYI A;  3HHG A;  2CQK A;  3GVA A;  1R00 A;  3L7W A;  2EFO A;  2JTV A;  5L3G A;  4A6D A;  5D5W B;  1REP C;  3ZMT A;  1ZAO A;  4AVP A;  5KK1 A;  2BEO A;  3BY6 A;  4WCG A;  3E3V A;  1IN6 A;  2KKO A;  2MLK A;  3KP7 A;  3L9F A;  3N97 A;  3SZP A;  3E6B A;  3RJP A;  2W24 A;  1JXS A;  2ZXJ A;  5D6F A;  2HQN A;  1YG2 A;  4LLL A;  4U0W A;  1BM9 A;  2F5D A;  1CF7 A;  2QLZ A;  1G4D A;  1RUN A;  1FLI A;  2YX7 A;  3L09 A;  3CLO A;  2VOD A;  4EMS A;  1OYW A;  4UV9 A;  3O3K A;  2OBP A;  2D2W A;  3DF8 A;  1OKR A;  1I5Z A;  5JFR A;  1U6G A;  2IA0 A;  3N4M A;  1YTY A;  1RUO A;  1TBX A;  2HTJ A;  4HYE A;  5D6E A;  4S05 A;  4K2E A;  4HF2 A;  3WTS C;  4EVI A;  2FNP A;  4GCV A;  1ULY A;  1QBJ A;  3C1D A;  2MH2 A;  4JQF A;  3TDZ C;  4M72 A;  2HEO A;  3V8K A;  1O3T A;  2FRH A;  1UFM A;  1LJ9 A;  4PDK A;  2WC2 A;  2HR3 A;  5JI6 A;  5HS9 A;  1HW5 A;  2QBY A;  4U0V A;  2H6B A;  5HDK A;  1IRF A;  3BWG A;  1ONV A;  1D8K A;  2K4J A;  4YFN F;  2QVO A;  5TJJ A;  5ILU A;  2EK5 A;  2O6G E;  2NS0 A;  4U0Y A;  4EGZ A;  5LBQ A;  2DPU A;  1ZH5 A;  1T6S A;  2HS5 A;  3U1D A;  2OU2 A;  2UWM A;  2LDU A;  3MEX A;  1Z1D A;  1XCV A;  4MTE A;  1SAX A;  4M6X A;  2F5E A;  4MQ9 F;  3E6M A;  2NNN A;  4A0Y A;  1YYV A;  4A5N A;  1ZLK A;  3I5U A;  4L9T A;  3R4K A;  2EA4 A;  5LGN A;  4NQW A;  3FMR A;  2V79 A;  2RGV A;  3Q9V A;  3KZY A;  1SD5 A;  3FM5 A;  4HV6 A;  5D5X B;  1T39 A;  1FC3 A;  2O8X A;  5IT9 Z;  4RGS A;  5LHG A;  2NNY A;  3ELK A;  1HXD A;  4HF1 A;  1MDM B;  2HQR A;  3SQN A;  2ESN A;  3CDH A;  4CHU A;  3BDD A;  1B6A A;  1XMA A;  1HKT A;  1ZGA A;  2QUF A;  5BS6 A;  4RS8 A;  1I1S A;  3DQV C;  4CDG A;  2L4M A;  2DTR A;  2JSC A;  1TW3 A;  3FX3 A;  1R1T A;  4PGG A;  4XSZ F;  5IT3 A;  2QQ9 A;  4ZH4 F;  2EWN A;  2VE8 A;  3E5U A;  4RGX A;  4ON0 A;  2LF7 A;  4XLN F;  3R60 A;  1T2K A;  2DI3 A;  2P7C B;  3KZZ A;  4FX0 A;  2E7X A;  4BHC A;  3C7J A;  3F22 A;  1ZRC A;  4BNC A;  1H0M A;  1XGN A;  3T1B A;  3I59 A;  4BQA A;  3R0A A;  3VB2 A;  3T0Y A;  4RGU A;  2ETH A;  2ZO4 A;  2P5K A;  3KP6 A;  1O57 A;  3ZMU A;  2EV5 A;  2LNB A;  1YQA A;  3HYI A;  4RB2 C;  3GW2 A;  1JE8 A;  1BI0 A;  3WU0 A;  5FGM A;  2VBY A;  2MLG A;  5E1W A;  1F4K A;  1R23 A;  4GO1 A;  4LFU A;  5BQT A;  1K79 A;  2RV8 A;  4EJT A;  3TO6 A;  4CO8 A;  3RKX A;  4HDV A;  3J7A O;  5LGT A;  2JPB A;  1BIB A;  2L54 A;  3DPT A;  5F64 A;  4FX4 A;  1X3U A;  1Z05 A;  4WK8 F;  3RKY A;  1A04 A;  1ODD A;  4UHT A;  1J7K A;  2O61 A;  1G3Y A;  4M73 A;  1I27 A;  1VTN C;  3J81 K;  2J5O A;  3QU3 A;  4N0B A;  3LST A;  5HS7 A;  3M8E A;  3VFZ A;  4ZZL A;  1IN5 A;  2A3S A;  5A2Q K;  4LK0 F;  2VE9 A;  1BI2 A;  4EM2 A;  3FZV A;  2DQL A;  2O03 A;  3H3Z A;  4IF4 A;  1Y0U A;  1DUX C;  1YS6 A;  3ROU A;  5D5U B;  2W25 A;  1FBS A;  4KUM A;  2VXZ A;  2V1D A;  4LGW A;  5EEG A;  4OU0 A;  1QGP A;  1FZP B;  2F5C A;  4EM1 A;  4D0P A;  4KNY A;  5CLS A;  1P4X A;  1S3J A;  1GVJ A;  5L3B A;  3QPH A;  4AIJ A;  1DP7 P;  3TDU C;  1BOA A;  2JPC A;  2FOK A;  3WTX C;  2L01 A;  5JR3 A;  3MZH A;  2EV0 A;  2R7F A;  4UVA A;  2IRF G;  2G7H A;  2KJC A;  2DO7 A;  1R36 A;  1CF7 B;  4UUV A;  4IRH A;  4Y15 A;  3QPT A;  2GXG A;  3V8J A;  4KMF A;  5JVT A;  4OMY A;  3BJO A;  3KEO A;  3EUH A;  1ZG1 A;  5FD6 A;  4CIC A;  1TLH B;  3GZ6 A;  2KIM A;  5LHI A;  2VON A;  4ZZD A;  1YS7 A;  4M71 A;  5DYM A;  5AIP A;  1KQ8 A;  2HYF A;  4CZZ A;  4DQ2 A;  3LQR A;  4ESJ A;  2C6Y A;  1SMY F;  4ZYD A;  4PCQ A;  4M9S A;  2X0L A;  1FP2 A;  3WU1 B;  1GXP A;  1HKS A;  3GFL A;  4P9F A;  5ICE A;  3BJA A;  4KIF A;  2QBY B;  4M74 A;  3S2W A;  2PQ8 A;  2R3S A;  5D4R A;  3BZ6 A;  1STZ A;  5D4S A;  4BXU A;  5EEH A;  5FLX Z;  4A5M A;  3BP8 A;  3J80 Z;  4WXD A;  5H6R A;  1IF1 A;  4OIR F;  2ADU A;  1ON2 A;  1O7L A;  5J8F A;  2E1N A;  4LB6 B;  4Y17 A;  4EJW A;  1MZB A;  3OOP A;  1U2W A;  1KU9 A;  5HLG A;  3H92 A;  5ERI A;  1XCB A;  5FO5 A;  4KYW A;  2O3F A;  3BOQ A;  5HLH A;  3V4G A;  5HDN A;  4YII A;  2IA2 A;  2A61 A;  1FNN A;  1OMI A;  2J5P A;  4IVN A;  5LLQ A;  4LB5 A;  3SFZ A;  3CJN A;  5DCM A;  2COM A;  3QOP A;  2XHK A;  4WXC A;  2XAF A;  3FMS A;  1E17 A;  1V4R A;  4U88 A;  2O0Y A;  4HZF A;  3CUQ A;  4G7Z F;  3HTS B;  1T0F A;  4IRI A;  3VOD A;  2OQG A;  1IZ1 A;  2RC4 A;  5BOX A;  4KN4 X;  3I71 A;  4ZYH A;  5E20 A;  5ED4 A;  4YFX F;  3ZMV A;  4YFK F;  1ZRF A;  1RIO H;  1FT9 A;  1AOY A;  1KGS A;  5CVV A;  3IL2 A;  2FMY A;  1J0R A;  3ZQ7 A;  3WG9 A;  2PMH A;  2K86 A;  3PQK A;  4IRG A;  4M9X A;  1FYK A;  2FML A;  3GUD A;  3I53 A;  3IC7 A;  3I59 B;  1LDJ A;  2D1V A;  3MQ0 A;  4HF0 A;  4RB3 C;  4JK1 X;  4B09 A;  2AS5 F;  1MJB A;  2OZU A;  3JSP A;  5CVI A;  4GXO A;  1SFE A;  2FXA A;  3ZN1 A;  2XIG A;  3REO A;  3LA2 A;  2RVC A;  5DUI A;  3U9G A;  1B4A A;  2ZNY A;  2V1U A;  2FBH A;  4RGR A;  2VC1 A;  3GF2 A;  4HX8 A;  4G7H F;  1FYL A;  1W7P A;  2VBZ A;  3WTT C;  4MQV A;  1B59 A;  5BPD A;  5DD4 A;  2H27 A;  1D8J A;  3WTW C;  3I0T A;  2VBW A;  1AWC A;  1W5T A;  1UCR A;  4RAY A;  5CJ9 A;  4ESF A;  4NB5 A;  4Z2Y A;  4A2U A;  4LG0 A;  3LA3 A;  4A12 A;  2PFB A;  1RNL A;  1BN5 A;  1BIA A;  5DD8 A;  5HLI A;  3TO9 A;  2EJR A;  1W7P D;  3DEU A;  2GXB A;  1R5H A;  1HW2 A;  2ZJ2 A;  2P5L C;  4L9V A;  3L2C A;  2QZ8 A;  4M9Z A;  2XUB A;  1K7A A;  5DV5 A;  4EGY A;  4FT8 A;  1SMT A;  4HOB A;  2RDP A;  1PUE E;  5CVR A;  1V3F A;  4ETS A;  1P92 A;  2G7U A;  3QP6 A;  3U2R A;  3OV8 A;  2HKO A;  2IT0 A;  2M87 A;  4TV7 A;  4L9N A;  2L3D A;  3KET A;  5ILS A;  3RI4 A;  1MKM A;  1HST A;  3GWZ A;  1EH6 A;  1LDK B;  4OIO F;  3E97 A;  3JAM K;  4HW0 A;  3F8B A;  4Q47 A;  3V7R A;  3RYP A;  2Z33 A;  2FQ3 A;  2BV6 A;  1FBQ A;  3F21 A;  3GFI A;  1U5T C;  1W4M A;  2RKH A;  5LGU A;  3DKW A;  3NRV A;  3AAF A;  2F5F A;  3K1M A;  4JBA A;  3LA7 A;  3IRR A;  3WTV C;  2UZK A;  1FPQ A;  1WKM A;  2LSO A;  3ZMS A;  1LVA A;  3GXO A;  4XSX F;  2OZ6 A;  3F6V A;  1KYW A;  2EFQ A;  5CVJ A;  2XKP A;  1FSH A;  3HRS A;  2Z5U A;  1O3R A;  3HRT A;  4KMU X;  4QWQ A;  3M8F A;  4BHP A;  4N9I A;  4GYG A;  1F5T A;  5H20 A;  4UXN A;  2V1X A;  1XSD A;  4G6Q A;  2FEZ A;  1TQM A;  2ZNZ A;  3HHH A;  1BC7 C;  3W6K B;  1Z7U A;  2EB7 A;  1ZG5 A;  5F6F A;  3KLN A;  3G73 A;  2IJL A;  2JRT A;  1KU2 A;  2IW5 A;  3RTR A;  1J5Y A;  1R5G A;  2YX4 A;  2XV4 S;  4UV8 A;  4HDU A;  3HRU A;  3HIF A;  2VN2 A;  4MGR A;  2GQQ A;  4P9U A;  4H0E A;  2XKO A;  2HWV A;  2RN7 A;  4N9H A;  4WX9 A;  1S7O A;  1J75 A;  3WTZ A;  3GO5 A;  4AWX B;  2A6H F;  4IHT A;  2LF8 A;  3C18 A;  4GGG A;  3VOE A;  5J8C A;  2MC3 A;  1KYZ A;  3K1P A;  1SFX A;  3QAH A;  2DPD A;  3BRO A;  3M7G A;  2CWE A;  5K5O A;  4G6D A;  5DCM B;  3V7C A;  2L02 A;  2W85 A;  1MGT A;  2MBF A;  5L3F A;  1XB4 A;  2Q0O A;  3EQL F;  4KDP A;  3D5L A;  4Q4Z F;  2XGX A;  1DDN A;  1QPM A;  4OIP F;  2WWY A;  2FBK A;  1TNT A;  3KEQ A;  5E1Z B;  3CUQ B;  1BJA A;  3KP2 A;  1SD7 A;  2ZBK A;  3K1N A;  3WGI A;  1IXR C;  2W57 A;  2P8T A;  3Q9S A;  4I09 A;  2F2E A;  2ZME A;  1PDN C;  1EV7 A;  3ML6 A;  1CGP A;  4OMZ A;  2CW0 F;  1ZLJ A;  4KIB A;  2HFH A;  1EH8 A;  2XAH A;  4U7B A;  2VT3 A;  1YFH A;  1JGS A;  1ZRE A;  1J2X A;  3JTH A;  3GFM A;  4KT5 C;  4KN7 X;  5IT9 K;  1LDD A;  5LRS A;  3PQJ A;  3ZMZ A;  4WF2 A;  1KA8 A;  5E1X A;  4XLP F;  1FBU A;  3P9I A;  3GFJ A;  1FY7 A;  1ZAR A;  3WE2 A;  2DW4 A;  3SHF A;  2MD5 A;  2ISY A;  5L3E A;  3ZN0 A;  1J59 A;  5FFX A;  1XGO A;  4G7O F;  4MEX F;  2OD5 A;  1W7P B;  1S29 A;  2HGC A;  1ZGJ A;  5H6Q A;  2ACJ A;  4UVC A;  1XDS A;  1P6R A;  1YIO A;  1Q1H A;  5KVR A;  1FWZ A;  1R58 A;  1BBY A;  3COA C;  5CVU A;  3FWE A;  3F8C A;  2HOE A;  1FX7 A;  3SXY A;  2XAS A;  4LG0 B;  4B8X A;  1YO5 C;  3D0S A;  2Q2E A;  3IHU A;  1HBX G;  1DPR A;  3R6S A;  1O3S A;  4DNC A;  2VOO A;  2FNA A;  3E5X A;  3ZPL A;  1HSJ A;  1H9G A;  1XGM A;  3IKV A;  4XRF A;  3VEP A;  1TNS A;  2IA1 A;  4I2O A;  3ERE D;  4Q48 A;  2DAO A;  2ZCW A;  3ZP5 A;  1FYM A;  3KP4 A;  1ZHF A;  4P5O A;  2XRN A;  4WWC A;  3F8F A;  3CO6 C;  2MA3 A;  3TOB A;  2DBB A;  2VT2 A;  1XGS A;  3EYY A;  3RPQ A;  2M45 A;  4MNU A;  3G3Z A;  1P4W A;  3NEU A;  5E8G A;  1B9M A;  2HYG D;  3F8M A;  4AD9 A;  3WTY C;  4E70 A;  3JTG A;  3E6C C;  5DEQ A;  2EFW A;  2NRA C;  4OIN F;  3E5Q A;  4HV5 A;  5BMZ A;  3P7N A;  3TOA A;  4G9Y A;  2FE3 A;  3EYI A;  1IN8 A;  5LEK A;  3WOD F;  4I01 A;  4LD5 A;  4HLY A;  5ICF A;  1FSE A;  1BC8 C;  2D1H A;  3WGG A;  1PP7 U;  3I54 A;  2CSO A;  4ZYE A;  3I4P A;  3KLO A;  5J6X A;  4OIQ F;  4KIC A;  4L0Z B;  2QM3 A;  1ON1 A;  1B9N A;  4CXF A;  2RNJ A;  3MFK A;  3WGH A;  3MCZ A;  3CO7 C;  1BI3 A;  1QZZ A;  1H9T A;  4EJU A;  1T38 A;  2XAJ A;  2R7D A;  3GLX A;  4A0Z A;  1YW7 A;  1Z6T A;  1U78 A;  3ECH A;  2Y0M A;  2TDX A;  4Y13 A;  3K2Z A;  4HLX A;  2RQP A;  2PI0 A;  1G3T A;  4HBL A;  4AIK A;  3HSR A;  4OOI A;  4ASN A;  1I6X A;  2KRF A;  2QQB A;  3RKW A;  3ABT A;  5ILV A;  1SFU A;  3H3U A;  2YR2 A;  2DFI A;  2WTE A;  1K78 A;  3DP7 A;  4M6Y A;  1FOK A;  4A6E A;  3RYR A;  1WRJ A;  4AIH A;  2Y75 A;  4G94 A;  3HTU A;  2BBY A;  2M1B A;  1GXQ A;  2A6E F;  2OAZ A;  4I98 B;  2NYX A;  3EDP A;  1YW8 A;  2KIU A;  2DQR A;  1YLF A;  2X4H A;  5FLX K;  3J80 K;  1D5V A;  4KA4 A;  3IKT A;  2GWR A;  2M8E A;  5ICC A;  1OYY A;  1QNT A;  3HRM A;  3O2P E;  4O5V A;  4P96 A;  1HW1 A;  3ISP A;  3O6B B;  2IP2 A;  2PEX A;  2ISZ A;  4IHS A;  1MD0 A;  3PFI A;  4ENN A;  1GHC A;  1O3Q A;  2FSW A;  2OQR A;  2ZME B;  2H09 A;  4HX7 A;  3ULQ B;  2STT A;  5D5V B;  1XDU A;  1J9I A;  4EQQ A;  5L3C A;  3FMQ A;  4WXH A;  3QU6 A;  1HQC A;  5AIQ A;  2UXX A;  3B02 A;  2OA4 A;  3J81 Z;  3JW4 A;  5D8K B;  5L3D A;  2VC0 A;  3I58 A;  5HVQ C;  3TKY A;  5A2Q Z;  4KIG A;  3FHZ A;  2IPQ X;  4L9J A;  4BAY A;  3FF5 A;  2MH9 A;  4ESB A;  2YU3 A;  1WWX A;  1UHM A;  2GA2 A;  5K5Q A;  1L0O C;  2Y48 A;  2A07 F;  2A69 F;  3TGN A;  4EJV A;  1TQI A;  4UNO A;  2ELH A;  1E2X A;  1QZY A;  4F7Z A;  1KQ0 A;  1U5T A;  2P7V B;  3RDI A;  4A0X A;  3KP5 A;  1NHA A;  3F6O A;  2JZY A;  4EV0 A;  2CO5 A;  2JT1 A;  2GA1 A;  4O6J A;  5FD5 A;  3GEZ A;  3GZ5 A;  3DPL C;  2L4A A;  5FFZ A;  3RIR A;  4HQM A;  4CGZ A;  2IVM A;  3F23 A;  2A68 F;  4EJO A;  2A5Y B;  4RB1 A;  2PLY A;  2EFP A;  3SZT A;  5HDG A;  3FXU A;  2CG4 A;  4U7D A;  3F72 A;  2CGP A;  3T8R A;  2QQA A;  1WSU A;  1R1U A;  4LLN A;  4EM0 B;  1S8N A;  2KJB A;  3BPV A;  1G3W A;  1U3E M;  3NQO A;  4R79 A;  1IXS B;  3KE2 A;  1KU3 A;  1TQP A;  1BI1 A;  3P9K A;  4ENM A;  3KFW X;  3MZY A;  2QYO A;  1ZRD A;  1WQ2 A;  4LK1 F;  2LKP A;  5CYV A;  1ZN2 A;  2VBX A;  1MJ9 A;  1SD4 A;  2BGC A;  2P6T A;  5K5R A;  3IWF A;  4ENK A;  1WI9 A;  3WTU C;  2G9W A;  3T5X A;  1HKQ A;  2P4W A;  2DLL A;  2FF4 A;  5HS8 A;  2XAG A;  1W5S A;  3M1E A;  4LMY A;  1O7F A;  1K6O A;  1TTY A;  3HSF A;  4I0B A;  4I7H A;  2P6S A;  3GYH X;  1DPU A;  1KQ9 A;  1U8R A;  2K7L A;  4L5I A;  4I02 A;  2M5W A;  3CUO A;  1XSX A;  4ENJ A;  2DT5 A;  2GAU A;  5LEJ A;  4ZYG A;  1S6L A;  2V6C A;  1ZYR F;  3LAP A;  3BPX A;  4MEY F;  3ZMD A;  3K9T A;  5E18 F;  1R22 A;  1USS A;  1UHW A;  1UST A;  2PN6 A;  2Q8K A;  4BH9 A;  2M30 A;  1SD6 A;  3I64 A;  1LEB A;  3V8L A;  2H94 A;  2E1C A;  3IWZ A;  4QLC U;  4UVB A;  2HKX A;  2DK8 A;  1XMK A;  3K0L A;  1IUY A;  2EFN A;  2QEN A;  3R0J A;  1LEA A;  1YW9 A;  3HSE A;  3MAJ A;  4PGH A;  2Z9O A;  2CFX A;  4CYD A;  3Q5F A;  3HOT A;  5D8L B;  3CTA A;  1D3Y A;  2EV6 A;  3R61 A;  2K4B A;  2ZFW A;  6PAX A;  3DV8 A;  4Q5S F;  3QRF F;  3HUG A;  4P55 A;  3T8T A;  2PBI A;  2BYV E;  2XVC A;  2H6C A;  3KP3 A;  2WV0 A;  1QO0 D;  1LQ1 A;  5BPI A;  1P4A A;  3JSO A;  2K27 A;  3QP5 A;  1EH7 A;  1XN7 A;  3L00 A;  4RB0 A;  1RI7 A;  5E17 F;  5E8I A;  3IRQ A;  2HZT A;  4GYI A;  4HX4 A;  2Z99 A;  1S7A A;  1K78 B;  3DXJ F;  1OR7 A;  3MWM A;  2YPR A;  2D45 A;  3B73 A;  4IXA A;  2FA5 A;  3W6J B;  1TW2 A;  3GX4 X;  2STW A;  1ZG3 A;  2HDC A;  2DK5 A;  3BJ6 A;  3WE3 A;  1R1V A;  5TRD A;  1XD7 A;  3KCC A;  1MDM A;  1T98 A;  1KU7 A;  1Z6R A;  4S04 A;  2GZW A;  1XSV A;  2KIF A;  4NHJ A;  1IXC A;  4L5J A;  4MTD A;  2FBI A;  1IRG A;  1FP1 D;  5DCF A;  3FXR A;  3M9A A;  3LFK A;  3E6D A;  1I1G A;  2B0L A;  3P9C A;  5JHU A;  4HA8 A;  4L18 B;  5LHH A;  2DU9 A;  5AON A;  3C3W A;  2XAQ A;  2FU4 A;  4HAM A;  4KFC A;  1JHF A;  2PG4 A;  3TQN A;  2W84 A;  2E7W A;  4PZJ A;  1IAW A;  2PJP A;  2VOP A;  4IPA A;  1G3S A;  5FB2 A;  2K02 A;  1IW7 F;  2ZKZ A;  4XBF A;  2GIV A;  3ABU A;  5K1Y A;  1F1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...