2VE8A

Xray structure of ftsk gamma domain (p. aeruginosa)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
EDDPLYDEAVRFVTESRRASISAVQRKLKIGYNRAARMIEAMEMAGVVTPMNTNGSREVIAPAPVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Mechanism of Sequence-Directed DNA Loading and Translocation by Ftsk.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords DNA TRANSLOCASE FTSK
total genus 17
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09397 FtsK_gamma Ftsk gamma domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ve8A01
1JE8A 3KEQA 1IN7A 4ZYGA 2OA4A 4ZZDA 4G8XA 2OAZA 1O57A 2CGPA 2G7HA 1XGNA 3GFIA 2NS0A 3R0JA 4M72A 1Z6TA 2LF8A 1BIBA 1WWXA 2P7VB 2XAQA 4L0ZB 2QVOA 2IP2A 3CLOA 1C0WA 3F8NA 3SZTA 3RIRA 4ENKA 3BOQA 1YTYA 4R79A 3BJAA 1BN5A 1DDNA 2R3SA 4BQAA 4LLNA 2XAFA 2Q0OA 4I0AA 1YLFA 3ELKA 1AWCA 4HV5A 3F3XA 4EV0A 4CXFA 4P9FA 3F8MA 1TQMA 2YU3A 2W85A 2ESNA 1MJAA 2FNPA 4EM0B 1ZLJA 3ZMZA 1HXDA 2QQAA 5D5VB 3GO5A 2K4BA 4PCQA 2ZFWA 2ZMEB 4RB3C 1SFEA 4Q47A 1MD0A 1WI9A 2H6BA 1BC8C 3SHFA 5FLXK 4ENNA 2BBYA 2Z5UA 3HHHA 6PAXA 3F22A 2D1HA 1QQIA 3KP4A 3WGHA 1OKRA 3CO7C 1XN7A 3E5XA 3QU3A 2VBXA 3BWGA 1KU3A 3M8EA 4KT5C 3TO7A 1R5HA 1PP8F 1HSTA 3HRSA 4IJAA 1USSA 2GAUA 1E17A 1G3SA 2CSOA 3GLXA 5LGNA 2DAOA 5HS9A 3FMQA 5J8FA 3E6DA 2FBHA 4CO8A 1CF7A 2GA1A 1HW1A 5H20A 1FLIA 1WSUA 5DCMA 4IVNA 3ZN0A 3P9CA 4IXAA 1GXQA 2V79A 2FU4A 1FYMA 5ILSA 3SQNA 2PG4A 1KA8A 4HV6A 5HDKA 1SFUA 3KLOA 3TDUC 1BI1A 4WF2A 2QZ8A 4Y15A 1IF1A 2EFOA 4LB5A 3V7RA 1IUYA 5E1ZB 2HDCA 2FOKA 4G6DA 2JTVA 4OIOF 3HSFA 1IRFA 3ERED 4KIBA 2F5DA 5ED4A 2PQ8A 4RS8A 4AVPA 1SD6A 4XRFA 2XKOA 3ULQB 1KQ8A 4IRHA 4QWQA 5HLIA 3FF5A 4RAZA 5E20A 2A6HF 4MHGA 4EM1A 2RV8A 4MTDA 3DP7A 4R8HA 1U8RA 4I98B 3G73A 1MJBA 3R60A 3J7AO 1XSXA 5L3DA 2EB7A 5JI6A 4MEXF 3T1BA 4EQQA 1FP1D 1IAWA 4M9SA 2WTEA 2WV0A 3I53A 4UVCA 1DPUA 3U1DA 3FM3A 5HDNA 2YPRA 3CUQB 4R1HA 4MQ9F 3OOPA 2CFXA 4BHBA 3I59B 5ICGA 4CGZA 3I59A 1A04A 1HW2A 4P9UA 3GFMA 3DFGA 2VT2A 1I6XA 4YIIA 1DPRA 3D5LA 3KEOA 1OMIA 3ISPA 3EYIA 1YG2A 3HSRA 1TTYA 2L3DA 1MDMA 1IN4A 4H0EA 1EV7A 2FBIA 5FGMA 1K78B 4KN4X 3IWFA 2FA5A 3L09A 2VONA 3SFZA 2Z3YA 4WWCA 2HTSA 1O7FA 5ICCA 4M6YA 4LGWA 4I01A 4CICA 5L3BA 3LQQA 3RTRA 3JAMK 2EA4A 3CDHA 4HF0A 2WC2A 2XRNA 4HBLA 1T98A 5IT9K 3VOEA 1QZYA 2PFBA 4WXCA 4WCGA 2OBPA 3HTSB 1ONVA 4OIQF 2YSRA 1S7OA 1XSDA 3ROUA 1FBUA 2OU2A 4RGXA 2KJCA 2MH9A 2IA2A 4IPAA 2GWRA 3SXYA 4IHSA 5K1YA 4A2UA 4OU0A 3LFKA 4HF1A 2V6CA 4PGGA 2PI0A 4HZFA 3LAJA 4ZYEA 2GXGA 4RAYA 4E70A 5LEKA 1Z1DA 5J8CA 2EFWA 3TOBA 1H9GA 4HA8A 4OIPF 3BPVA 1MGTA 5H6RA 1PDNC 1XCBA 5LLQA 1QBJA 1Z9CA 4L18B 4G94A 4UV9A 2HQNA 4LLGF 4EJOA 2A68F 2CYYA 3O2PE 2M87A 1RUNA 3GZ6A 3QPHA 3RDIA 4G7OF 2NAZA 3FX3A 1D8KA 3VEPA 4GYIA 3ZMSA 1Z91A 3WTTC 3KCCA 3I64A 2ZNYA 2KIUA 1F5TA 2YX7A 1TQIA 2ADUA 3M7GA 2FMYA 3T8RA 2PMHA 1RNLA 1ZARA 4WXHA 5CVVA 4Q5SF 3QP6A 1B4AA 3CUQC 2DQRA 4M9ZA 4EJUA 5EEGA 5DDGA 1X3UA 2F2EA 3KP2A 2P5LC 2IA1A 3MZYA 2AXLA 3IC7A 5LGUA 1JHFA 3IHUA 3BPXA 4GCVA 1OR7A 4I0BA 1ZRFA 5E8GA 3VODA 3L9FA 5J6XA 1P2FA 3WU0A 4UNOA 1Z05A 3V7CA 2QQBA 5ICEA 4HQMA 3TDZC 4KNYA 4EGYA 3QU6A 2IRFG 4U88A 1K78A 3M8FA 5F1RA 4KMFA 3WE3A 2XAJA 5JR3A 5ILVA 5BOXA 1BI2A 2H6CA 2W25A 2CG4A 4M9XA 1ODDA 3LA7A 2HOEA 3BDDA 2DPUA 2VOOA 5TJJA 5E1WA 1JHHA 3OV8A 1OYIA 4G7ZF 4YG2F 3ZP5A 2Y48A 2K02A 5CVIA 1TNSA 2DBBA 2BEOA 3K1NA 2A69F 3I4PA 3NRVA 5DCMB 4ENJA 3ZMDA 5A2QZ 3BJOA 2GQQA 3ZQ7A 4WXDA 5CVRA 2HYFA 2M45A 4CYDA 3GYHX 4HOBA 3KP3A 1F4KA 2QWWA 1LEAA 1IRGA 2VT3A 3RKXA 3RPQA 2Z99A 3BY6A 3TGNA 3E6CC 3Q9SA 1ZG1A 2ZKZA 3DPTA 3M9AA 1ZGJA 3LAPA 4G9YA 1FY7A 1SD7A 4G6QA 1ZG5A 2RC4A 4LK1F 1UB9A 3DKWA 4NHJA 3GVAA 5F64A 1G3TA 2CQKA 3ZPLA 4EJVA 4RB2C 3KP7A 5K5OA 1P4WA 1KQ0A 3TO9A 4HW0A 2PN6A 3GX4X 3LWFA 3HTUA 2BV6A 3FXRA 1XMAA 4WX9A 4AIHA 5H6QA 2VE9A 2L01A 2FRHA 2E1CA 3MWMA 4L5IA 4BNCA 2UXNA 1YYVA 2W24A 4AWXB 2RNJA 4LD5A 5CYVA 1YS7A 2ESHA 1R5GA 1XGMA 3F6OA 3I54A 3HRMA 3WU1B 5HOOA 1XSVA 4L0YB 4S05A 3WTSC 3W6KB 4KDPA 3GEZA 3JSOA 2BYVE 4CDGA 2NNYA 4GYGA 2HS5A 1FC3A 3V8LA 2R7DA 1I1SA 1TLHB 2EK5A 1HKQA 3HOSA 3E5QA 2IVMA 2EJRA 4NB5A 2A07F 1LJ9A 1IZ1A 2RGVA 4DNCA 2E7XA 5CLSA 3LSTA 2F5CA 5D5WB 1FSHA 2ISYA 1O3QA 4HX7A 4HLXA 2DO7A 4L5JA 4BH9A 1JXSA 4A5NA 1HKTA 4RB0A 1FYKA 2COMA 2EFNA 1YO5C 3IKTA 3L7WA 2HKXA 2ZBKA 2ZMEA 1TNTA 3WTWC 2P5VA 3F23A 3FXQA 3R4KA 2DU9A 3AAFA 2XAGA 4ZH4F 4O3MA 3EUHA 2V1XA 4L9VA 5LRSA 4P96A 2O0YA 3GF2A 4L9NA 5HS7A 2ISZA 5FB2A 5JFRA 2RDPA 1T39A 2B0LA 3FMSA 2VE8A 3C1DA 1LQ1A 2GXBA 1B9NA 2EFPA 2KIMA 4A0YA 3WTUC 3KFWX 1U5TA 3KZYA 1O7LA 3K1PA 1W7PA 2DLLA 1L0OC 4D0PA 2KIFA 5D6EA 5E18F 2YX4A 3VB2A 4O6JA 1IXSB 4BAYA 2MLGA 1QGPA 3F21A 3J81K 4EJWA 1QPMA 2V9VA 4CZZA 3KZZA 1ZRDA 2XGXA 1FX7A 1HBXG 1RI7A 2EA2A 4FX0A 3MQ0A 3H92A 2H27A 3U9GA 5E8IA 4KN7X 1R58A 4N0BA 3R0AA 2STWA 2PEXA 1L3LA 3DV8A 5HDGA 5ICFA 2QYOA 4N9IA 1LB2A 1KGSA 2MLKA 2RQPA 4IF4A 4YFXF 2MA3A 3NEUA 1REPC 1FNNA 1BJAA 4PZJA 3ZMVA 2X4HA 2TDXA 1LNWA 2PMUA 2STTA 2A3SA 3J81Z 1D3YA 4XLPF 1BC7C 1P4XA 4BXUA 2DTRA 2IJLA 2ZCWA 3ABUA 2V1DA 5E17F 3CUQA 3WGGA 3KETA 4TV7A 4ETSA 4I02A 4JK1X 4MNUA 2F5EA 3RPUA 1WRJA 1W5TA 3ZN1A 3JAMZ 2K86A 2A61A 2P5KA 1O3RA 2LF7A 4A0XA 2AS5F 5AIPA 4ZYDA 1PP7U 4S04A 3QOPA 4LFUA 3GFLA 2E7WA 2FXAA 2FQ3A 1Y0UA 2VBZA 3P9IA 1BM9A 4RGUA 3PQJA 4F7ZA 1SFXA 1T2KA 4HF2A 3S2WA 3TO6A 5KVRA 1B6AA 3WG9A 2DPDA 1U5TB 4UVAA 1V3FA 1Z6RA 1RIOH 1S6LA 2DI3A 4GXOA 2P6SA 2FBKA 1S7AA 2XAHA 4LJZF 5DV5A 1H9TA 2FMLA 3WTVC 3BROA 1E2XA 2DT5A 1W7PD 2K7LA 3MEXA 3DQVC 4NQWA 1LDDA 3HHGA 2L02A 3D0SA 4ZYHA 4KMUX 3F72A 1SMTA 2DFIA 1RUOA 3JSPA 1I1GA 5FLXZ 5LEJA 3PQKA 3V8JA 1B59A 3T8TA 1R1VA 3RYPA 3IRRA 5HLHA 1ZLKA 1MDMB 5F6FA 5CJ9A 5BPIA 4AIJA 1K7AA 3Q9VA 2IPQX 1D8JA 4IRGA 4EGZA 1SAXA 2H09A 1TW2A 2ETHA 1ZN2A 5TRDA 2FEZA 1R1TA 2WWYA 4A0ZA 4P55A 1BIAA 4EJTA 1J75A 2XVCA 4IHTA 2A6EF 1UFMA 2MD5A 2VC0A 2VN2A 1Z7UA 1GHCA 3RI4A 2P8TA 5IT9Z 3GXOA 4A6EA 1J7KA 4A6DA 2YR2A 3FZVA 1LDKB 4WK8F 3DEUA 2CW0F 2R7FA 1O3SA 2UXXA 3LA2A 5FD5A 1R7JA 3J80K 2GIVA 2LNBA 2HR3A 5DYMA 3EETA 3MFKA 4U7BA 4XBFA 2P7CB 4EM2A 2VOPA 1XGSA 4RGRA 1SD5A 5CVJA 4BHCA 5K5RA 2P4WA 2G9WA 2FNAA 3JTHA 3BJ6A 2XASA 2FE3A 4KYWA 1UCRA 3B73A 1YS6A 1WKMA 2IW5A 2BE5F 4UVBA 1R1UA 3FM5A 3F6VA 2DK5A 4LG0B 1B1BA 3I58A 1IXCA 1P4AA 4G7HF 4MTEA 3TKYA 1EH8A 4FHTA 4A12A 1FOKA 3LQRA 1ULYA 2Q8KA 1LDJA 2PBIA 1UHWA 2L4AA 2UWMA 1VTNC 5EEHA 4ESBA 1J5YA 3MAJA 2QQ9A 1XCVA 2H94A 3JTGA 3R6SA 3HIFA 2JRTA 4M6XA 3E5UA 5HS8A 3W6JB 5LBQA 2VODA 3DPLC 4HDVA 1EH6A 2RKHA 1STZA 2GA2A 1YW9A 1AOYA 2HFHA 1WQ2A 1B9MA 1BBYA 3F8FA 5DCFA 1I27A 1W4MA 1GXPA 4UXNA 1U3EM 4LMYA 3QAHA 2XROA 2M30A 2EFQA 4YFKF 4KIGA 1V4RA 4OIRF 3U2RA 5HLGA 1XDUA 1G4DA 3V8KA 1FP2A 5D4RA 1USTA 1FT9A 2DQLA 4PGHA 3HYIA 4M74A 2HTJA 3HUGA 1OYYA 1KYWA 1U5TC 1EH7A 3FXUA 5DEQA 1ON2A 3EQLF 1XMKA 3T0YA 3MZHA 1MKMA 1Q1HA 1U6GA 3E6BA 4UV8A 1J9IA 3ZMTA 2EWNA 2QBYB 4B09A 4O5VA 4P5OA 3K69A 5DUKA 2JPBA 3KE2A 2HEOA 1YFHA 3QP5A 4KUMA 2QENA 4BYYA 1R00A 2HQRA 4M73A 4I7HA 3N4MA 3IKVA 1R36A 4I09A 1ZHFA 2XKPA 4RB1A 4CHUA 3FMRA 3GZ5A 3KLNA 5FO5A 5HVQC 3P9KA 1FYLA 5BS6A 5FFXA 3WGIA 1F9NA 1DP7P 5BMZA 1W5SA 2VXZA 5E1XA 2D1VA 4AD9A 2ZXJA 2EV6A 1ZYRF 1XDSA 5D5XB 2O6GE 4HAMA 2CO5A 2KRFA 1K79A 3K2ZA 3HRUA 3E3VA 2Y0MA 1LEBA 2Z9OA 1G3WA 2OQRA 4Y17A 4RGSA 3HOTA 4LB6B 1YW7A 2JT1A 4Z2YA 2M8EA 2QM3A 4XSZF 3ABTA 2EV0A 2OZ6A 5L3CA 4UHTA 5L3FA 4JBAA 2K4JA 4HYEA 2EV5A 4K2EA 3C18A 1YW8A 5AONA 1BOAA 5L3GA 3I0TA 2J5PA 1SD4A 3FWEA 2ACJA 5JHUA 2XUBA 4MEYF 2L54A 5ILUA 2Y75A 4OINF 3N97A 2C6YA 3DXJF 2RN7A 1P6RA 3H3ZA 2LKPA 1T38A 1UHMA 3TQNA 2LSOA 2ELHA 3WTZA 1CGPA 1FSEA 2MH2A 4HDUA 5KK1A 2HYGD 3O3KA 4ENMA 2XIGA 3B02A 2HWVA 1IN6A 3M1EA 1TW3A 3WE2A 4U0VA 1ZRCA 2QBYA 1QZZA 2BGCA 3ECOA 2UZKA 1MZBA 2K27A 1HQCA 1RZ4A 3EDPA 2Q2EA 4LK0F 2W84A 1CF7B 2E1NA 4OOIA 2CWEA 4L9TA 3WODF 1QNTA 5LHHA 1T6SA 2XHKA 1U2WA 2FSWA 3WTXC 3JW4A 2ZO4A 4XSXF 2V1UA 4UUVA 4FX4A 3BP8A 4KA4A 2NYXA 3HRTA 3RYRA 4OMYA 1SMYF 2PLYA 3E97A 1XGOA 4AIKA 4A5MA 2J5OA 3R61A 1ZREA 5LRRA 2M5WA 2MC3A 4U0WA 3I5UA 1XB4A 2HKOA 2OD5A 3O6BB 2W57A 4Y13A 2FF4A 3REOA 1KQ9A 3ML6A 4ZZLA 4JQFA 5A2QK 2NNNA 1J59A 2MBFA 4ON0A 4BHPA 4EMSA 3DF8A 2P6TA 3K0LA 5JVTA 5AIQA 4MGRA 1ZH5A 5D8LB 1NHAA 4FT8A 2VBYA 5D6FA 5DUIA 1J2XA 1IW7F 3T5XA 2KKOA 3E6MA 3ZMUA 1HSJA 1FBSA 5BPDA 3IWZA 4KICA 1TBXA 2QUFA 3RKYA 2HZTA 2VBWA 4HLYA 1ON1A 3F8CA 3K9TA 2JSCA 2ZJ2A 1FWZA 1T0FA 4ESFA 3GWZA 3GFJA 1ZG3A 2LDUA 2OZUA 4N9HA 1ZGAA 2RVCA 4HX4A 2GZWA 2DW4A 2M1BA 4LG0A 4HX8A 1YQAA 3P7NA 1FBQA 3CTAA 4ESJA 1G3YA 2F5FA 3C7JA 3CUOA 1BI0A 5DD4A 2O3FA 2ZNZA 1S8NA 1R22A 1QO0D 4L9JA 2PJPA 4U0YA 2DK8A 3BZ6A 1O3TA 1DUXC 1PUEE 1YIOA 1IN8A 1FPQA 4Q48A 1FZPB 3RJPA 3SZPA 1IN5A 3F8BA 3QRFF 1JGSA 2Z33A 3PFIA 4GGGA 2IT0A 1XD7A 3CO6C 3VFZA 2VC1A 1OYWA 2O61A 5ERIA 4MQVA 5LHIA 1ZAOA 4I2OA 5CVUA 3KP5A 1F1ZA 4YFNF 4GO1A 4PDKA 4XLNF 2L4MA 3QPTA 3K1MA 3L2CA 2JPCA 5K5QA 3EYYA 3Q5FA 2D2WA 1D5VA 4EVIA 2QLZA 3GW2A 5D5UB 2HGCA 3IL2A 2A5YB 3FHZA 3CJNA 4OMZA 1KYZA 2O03A 1I5ZA 2IA0A 3KP6A 1TQPA 4HQEA 1LVAA 1J0RA 2KJBA 1KU2A 4IRIA 2JZYA 4Q4ZF 4ASNA 3GUDA 4KFCA 3IRQA 4YIFA 3I71A 5FD6A 5L3EA 1IXRC 5DD8A 1G6NA 5LHGA 5D4SA 5LGTA 1MJ9A 1K6OA 1KU7A 4DQ2A 3ECHA 3C3WA 1KU9A 3L00A 3LA3A 4M71A 4U7DA 1H0MA 4QLCU 1P92A 3WTYC 3NQOA 2G7UA 1S29A 5FFZA 5D8KB 2X0LA 3V4GA 1U78A 1GVJA 1R23A 2NRAC 1BI3A 2OQGA 1W7PB 4LLLA 3V7SA 1HKSA 2O8XA 1HW5A 5IT3A 2XV4S 3MCZA 5BQTA 3RKWA 3HSEA 3COAC 3J80Z 4B8XA 1S3JA 1OPCA 3H3UA 3G3ZA 2D45A 3TOAA 4KIFA
chains in the Genus database with same CATH superfamily
1JE8A 3AL0C 2FUG2 3KEQA 1IN7A 1ZELA 3I55I 1RKWA 5BNGA 4ZYGA 1TWCJ 2EH3A 3FXKA 3M3YJ 2OA4A 4IHYA 3HB9A 5EGOA 5GP9A 3U1KA 4ZZDA 4G8XA 2L7FP 5EGOB 3E7LA 2OAZA 3AG2H 1HCRA 1O57A 3QOEA 3SDGA 2CGPA 2G7HA 2XPVA 1A6QA 1XGNA 3CQZJ 1DGRM 3GFIA 3CCRI 2NS0A 3OYEA 1P7JA 3R0JA 4M72A 3OYJA 1LVKA 2DJIA 1Z6TA 1ETOA 2LF8A 2NVTJ 1BIBA 1WWXA 2P7VB 2XAQA 4XK4A 3MKYB 4L0ZB 1X3WB 2QVOA 1NTCA 2IP2A 3CLOA 4HNTA 4E7HA 1C0WA 1YX5A 3F8NA 2MFZA 3SZTA 4UUSB 3RIRA 4ENKA 3BOQA 1RPWA 3IH2A 4A3KJ 3OS1A 1YTYA 4R79A 3BJAA 3OYKA 1BN5A 2E34A 1DDNA 2R3SA 3I56I 2A05A 4XL9A 3PL8A 1ORKA 3OYDA 2HI3A 5IPAA 1H89C 4E7LA 4BQAA 3S2DJ 4LLNA 2XAFA 3K10A 5C4JJ 1ZQ3P 2Q0OA 4I0AA 1TT0A 3PNVA 4G6TB 1YLFA 1A31A 2L9RA 3ELKA 2GBYA 2EIKH 1AWCA 2IXSA 4HV5A 3ERMA 3F3XA 4EV0A 4CXFA 4P9FA 3F8MA 3W2WA 1TQMA 2WAQN 4U87A 2YU3A 2GOXB 2HVQA 2XGDA 2W85A 4YIRX 2ESNA 1MJAA 3BG6A 2FNPA 4EM0B 1BR1A 1ZLJA 4PJJA 3OYAA 3ZMZA 1NG6A 3IV5A 3E0JB 1HXDA 2NOJB 2QQAA 5D5VB 3CJQB 3GO5A 2K4BA 4PCQA 2ZFWA 2DOEA 2DT6A 2OTLI 4HSTA 2ZMEB 4JP0A 4RB3C 3H9JA 1SFEA 3PO2J 4Q47A 1MD0A 1WI9A 2WA0A 2H6BA 5GAEJ 1RR8C 2JWTA 1BC8C 5IP6A 3SHFA 4BE2A 5FLXK 1F36A 4ENNA 2DA5A 4DZPA 2BBYA 2Z5UA 3HHHA 3SEQA 6PAXA 3F22A 2D1HA 1QQIA 3KP4A 3TP3A 1IUFA 3JR9A 1IJWC 3RPUD 5EJCA 3WGHA 1OKRA 3CO7C 1XN7A 3BG7A 3E5XA 3QU3A 2VBXA 3BWGA 5CQGA 1KU3A 2CU7A 1HLVA 3CC7I 3M8EA 1JKOC 4KT5C 3TO7A 1R5HA 2CQNA 2CV1A 1PP8F 1HSTA 2VLAA 5EDNA 3HRSA 1A6IA 1TZLA 5KAFC 1O4XA 4IJAA 1USSA 2GAUA 3PIPF 1E17A 1OCTC 3LSHA 1G3SA 3CF2A 2CSOA 3GLXA 3UNGC 5LGNA 1W36C 2ZXWH 2DAOA 5HS9A 3FMQA 3G1MA 5J8FA 3E6DA 4BEHA 2FBHA 4CO8A 1CF7A 2DCEA 4A3JJ 2GA1A 1HW1A 5H20A 2DA1A 3NWSA 1U9OA 2R7XA 2XPWA 3LOCA 2QGUA 3RQIA 1FLIA 1WSUA 3D5SC 4CCMA 1CQTA 3CP2A 1H9TA 5DCMA 1ETQA 2R92J 4IVNA 1YE9A 3ZN0A 2O7OA 3P9CA 4IXAA 1GXQA 2V79A 2FU4A 1FYMA 5ILSA 3SQNA 2WB1A 1R4MB 2PG4A 4IOAF 2QQ8A 3PIOF 5E79C 1KA8A 1Y8QB 2Z2SB 4HV6A 3OMYA 1FIPA 3S14J 2ECBA 5HDKA 5J1RA 1SFUA 3KLOA 2K3PA 3TDUC 3Q0WA 3S3NA 1BI1A 4WF2A 1ZR4A 3SYTA 2QZ8A 4Y15A 3VPRA 1IF1A 1V55H 2EFOA 3BG5A 4LB5A 3HOUJ 1UMQA 1FTZA 3V7RA 1IUYA 5E1ZB 2HDCA 3ZQGA 2FOKA 1D1CA 4G6DA 3LSRA 1K61A 2JTVA 4OIOF 4MIMA 3HSFA 1SANA 2CUZA 1IRFA 3ERED 3ESWB 4KIBA 2F5DA 2ICWG 3DPUA 5ED4A 3AL0B 2PQ8A 1Y1VJ 1QZEA 3WG7H 4RS8A 4AVPA 1MMAA 2CRGA 2YS9A 2E1OA 1SD6A 4XRFA 2XRLA 4Y52J 2XKOA 3OYBA 3BR2A 3ULQB 1MMNA 1KQ8A 4IRHA 4QWQA 5HLIA 2H1LA 2ZSHB 2W7NA 3FF5A 2LBFB 5M3FJ 4RAZA 2OPTA 1KONA 1RRJA 5E20A 4IL6C 1TWFJ 1MNMC 2A6HF 1VI0A 3WHCA 4D7MA 4MHGA 4EM1A 3DEEA 2RV8A 3G1OA 4AIDA 4MTDA 1Y0NA 5KAIC 3DP7A 4R8HA 1U8RA 1ZR2A 4I98B 3H0DA 3G73A 1MJBA 2VQHA 3NARA 3V42A 4II3A 3R60A 3RSNA 4UB8C 3J7AO 4JX4A 1XSXA 5L3DA 2P81A 1MMDA 2EB7A 1WGXA 5JI6A 3AG3H 1H8AC 1RESA 4A3MJ 1KZHA 2PMZA 4MEXF 3K2AA 5EG0B 4A3GJ 3T1BA 4Y3OA 2K9NA 4EQQA 4PSWA 1FP1D 3GTQJ 5DTDA 2BY2A 3A2KA 5JHFA 1MMSA 2R7RA 1IAWA 2D5VA 4M9SA 2WTEA 2WV0A 3H5RA 3I53A 1SVLA 3QPLA 4UVCA 3U1DA 1DPUA 1VNDA 3FM3A 5HDNA 2YPRA 4ZDOA 3CUQB 4R1HA 1Z67A 1ETWA 4MQ9F 3B6AA 3OOPA 2LK2A 2CFXA 4BHBA 3KYCB 3I59B 5ICGA 5C4XJ 2W82A 5FKLA 1HW2A 3I59A 1A04A 4CGZA 3K7AJ 4P9UA 3GFMA 3DFGA 2E2IJ 2VT2A 4W97A 1I6XA 4YIIA 3JRHA 1DPRA 3D5LA 3HKZA 3KEOA 2RAEA 3OL3A 1OMIA 3ISPA 3EYIA 4NBQA 1HC8A 1YG2A 3HSRA 3KYLA 3CMAI 1TTYA 2L3DA 2IGNA 2OF7A 3J7AY 3TW7A 2HZDA 2ECCA 1MDMA 1IN4A 2K9QA 4H0EA 1EV7A 3I4MJ 2FBIA 5FGMA 1K78B 4E7IA 3K70C 4KN4X 2VKDA 1GUUA 3C2GA 3GTMJ 2JVGA 3IWFA 2FA5A 3L09A 5B3SH 2VONA 3SFZA 4ZDPA 2Z3YA 2IEKA 1YJ9I 4II2A 4WWCA 1R9TJ 3JCUC 2GXAA 3S1NJ 2HTSA 1O7FA 1X1PA 4IKFA 5ICCA 2AHQA 4M6YA 3S8PA 2L2OA 4LGWA 4I01A 4CICA 5L3BA 3LQQA 5H2FC 1DQUA 3RTRA 2BY0A 3JAMK 1BA5A 2I10A 2X48A 3CCUI 2EA4A 4BUPA 2IS2A 4ZJZA 2KQRA 3CDHA 4HF0A 3K4NA 2K40A 1J09A 3IP4B 1X19A 2CH0A 1BW6A 2DDBA 4XLCA 3K70D 2WC2A 2XRNA 4CUGA 3CDLA 5JLXA 4HBLA 5DS9A 1VQLI 1T98A 4I6ZA 5IT9K 3VOEA 3HOZJ 1QZYA 4RDUA 1Y56A 4BDYA 2KRCA 2HPMA 2PFBA 2EBIA 3DLLF 4WXCA 4WCGA 2OBPA 3HTSB 3S17J 3FBIB 1ONVA 2NS8A 4OIQF 2YSRA 1S7OA 4BBRJ 1XSDA 3ROUA 1FBUA 3A02A 2OU2A 4RGXA 2KJCA 4CCKA 2MH9A 2IA2A 2DJNA 5TGTA 4IPAA 2GWRA 2EZLA 2QCOA 1MBGA 4Y7NJ 3HOVJ 3SXYA 4IHSA 4AC0A 5K1YA 2LVSA 4A2UA 1HDDC 2K5CA 4OU0A 2XB0X 3C2HA 2QSFX 3LFKA 3NAUA 4I76A 4HF1A 1VFCA 1VQ6I 2V6CA 3LNQA 4PGGA 2PI0A 4HZFA 3LAJA 3IH4A 1POGA 4ZYEA 2VXDA 1JUPA 2GXGA 4RAYA 4E70A 1K6YA 5LEKA 4FETA 2VJ4A 4CYCB 2BW3B 2OJED 4BS9A 1HF0A 1Z1DA 5J8CA 2EFWA 3KX2A 3TOBA 2WV1A 1H9GA 3NWTA 4HA8A 4IQJA 4OIPF 1W0TA 2KP6A 3BPVA 1MGTA 5H6RA 1PDNC 4BXXJ 3CCVI 4C2MJ 1YIJI 1XCBA 3ABKH 5LLQA 9ANTA 1QBJA 4XN3A 2MGQA 2R0QC 1Z9CA 4L18B 3BCAA 1P7IA 4G94A 5C3EJ 4FQGA 1Z0XA 3ZQHA 2HVSA 4UV9A 1WHUA 2HQNA 4LLGF 3ABMH 4QIWN 2CQQA 4EJOA 2A68F 2CYYA 2F4MB 3CD6I 3O2PE 2M87A 1RUNA 3GZ6A 4A3LJ 4XOTA 3QPHA 3RDIA 3SDBA 1MNEA 4G7OF 2NAZA 3FX3A 1D8KA 3Q0UA 1X4OA 3VEPA 1U0JA 4GYIA 3ZMSA 3MKWB 1Z91A 1RETA 3WTTC 3KCCA 2EIMH 3I64A 2ZNYA 1A36A 2KIUA 5JVGF 1F5TA 2YX7A 1TQIA 2ADUA 2DMPA 3M7GA 3QQAA 4DBQA 4X6AJ 2FMYA 3T8RA 3CMMA 4BKXA 2PMHA 4DIQA 3W2AA 2E36A 1RNLA 1NK2P 1ZARA 4WXHA 2K9SA 4M6VA 5CVVA 4Q5SF 2HOAA 2R7SA 4E7KA 1GLNA 2JA2A 4JX6A 1WCMJ 3QP6A 2FQ4A 5K7HA 1WH7A 2XAUA 1QVTA 1B4AA 1B8IB 3CUQC 2DQRA 3WHBA 2LTPA 4M9ZA 1YI2I 1EA3A 4EJUA 3UKGA 2XF5A 1VQ4I 5EEGA 3QWLA 5DDGA 1EJ9A 4HRIA 1X3UA 2XF6A 4A93J 4KJZA 2F2EA 3KP2A 3CC2I 2CS3A 3CCQI 2P5LC 3J7YJ 2IA1A 3DBRB 3MZYA 2R7TA 2R5YA 2AXLA 3IC7A 1ETKA 5LGUA 1JHFA 1UELB 1WFXA 3IHUA 3BPXA 1AU7A 3QYBA 4GCVA 2R7UA 3SZGA 1OR7A 2OCCH 4I0BA 1ZRFA 5E8GA 3HZJA 4NC6A 3VODA 2DFEA 3HEFA 2OCEA 3L9FA 5J6XA 3BR6A 1P2FA 5EG0A 4XLHA 2V4JC 3K4CA 3WU0A 4UNOA 1Z05A 1DGWY 3LSGA 2DODA 3V7CA 2QQBA 5CKTA 5ICEA 3MKLA 1MBEA 4HQMA 3TDZC 3PJRA 4HNUA 4KNYA 2HVRA 5GAGJ 4EGYA 3QU6A 5J40A 2IRFG 4U88A 1JT0A 3L2VA 1K78A 4RM3A 4DW6A 3M8FA 4RAFA 2M3AA 5F1RA 3L2RA 3WE3A 3PUBA 3CCLI 4KMFA 4XRMA 2XAJA 2EQRA 5JR3A 5ILVA 4MFDA 2PJRB 5BOXA 4I99C 1BI2A 2JK3A 1MBHA 2B9SA 2H6CA 2W25A 2PMZN 2CG4A 4M9XA 1ODDA 2GOMA 2HOEA 3BDDA 3LA7A 2DPUA 2VOOA 5TJJA 1TP4A 3BG9A 5E1WA 1JHHA 2IS6A 1JTXA 3OV8A 2Q2EB 1OYIA 4RAGA 4G7ZF 2KL4A 1LFPA 2BW3A 4YG2F 3ZP5A 2ZJPF 2Y48A 4B47A 4LIVA 2MYSA 1OQYA 2K02A 5CVIA 1JUMA 4BQOA 1TNSA 2DBBA 2TRTA 2BEOA 3K1NA 2A69F 1VQPI 3I4PA 3NRVA 2I5UA 4MFEA 4C3JJ 4PSXA 1JKQC 5DCMB 4ENJA 3ZMDA 1XMXA 5A2QZ 3BJOA 2E1MB 2GQQA 4JOMA 1IDZA 2ZB9A 3ZQ7A 2WY8Q 4WXDA 3JRDA 3CCSI 5CVRA 2HYFA 3BR3A 3OR2C 1WJ5A 3VYRB 4V2GA 2M45A 4CYDA 3GYHX 4HOBA 1IC8A 3KP3A 1F4KA 1NK3P 2QWWA 1LEAA 4QTRA 1IRGA 2VT3A 2X51A 3PM1A 3RKXA 2BXYA 4YRVA 4ANJA 1LE8B 1UAAA 3RPQA 2Z99A 1GV2A 3BY6A 4A3BJ 2EIJH 3TGNA 3E6CC 2DA4A 3HL2A 3Q9SA 3DBHB 4ZTFA 1ZG1A 2E60A 1T0FC 4P1WA 2ZKZA 3DPTA 2X9DA 3M9AA 1MW7A 1ZGJA 5GAHJ 2KISA 3LAPA 4G9YA 1FY7A 1ZTRA 2E5NA 2X6XA 1SD7A 2NVQJ 1E3PA 2XPUA 4G6QA 1W36D 4CCLA 1ZG5A 5B66C 2B7EA 2RC4A 4LK1F 1UB9A 2M0MA 3DKWA 3GVAA 4A69C 4NHJA 5F64A 4F92B 1G3TA 2CQKA 3AG1H 3JRFA 3ZPLA 1FOWA 4EJVA 4E7JA 5K7FA 1D1AA 4RB2C 3KP7A 5K5OA 4FASD 1P4WA 4A3CJ 4ZDLA 1QVUA 1KQ0A 3TO9A 4HW0A 2PN6A 3GX4X 3LWFA 3DU6A 2H1KA 3CZ6A 3HTUA 2E35A 4C2TA 2TCTA 1FOXA 2BV6A 3FXRA 3VDXA 3K4LA 1XMAA 3A0BC 4WX9A 4BL0B 4Y33A 2WAQA 2IGKA 3ASOH 3HOWJ 4AIHA 2DDAA 3ZGKA 5H6QA 3ZQQA 2VE9A 2L01A 2FRHA 3M4OJ 3EPZA 4IHWA 5GPAA 1X3ZB 2E1CA 3MWMA 4L5IA 1BL0A 4BNCA 2UXNA 3JRGA 2LP0A 5F1JA 1YYVA 2W24A 1PUFB 1LFBA 3GMEA 4AWXB 2RNJA 4F52A 3H0GJ 4D5FA 4LD5A 5CYVA 2KPMA 1FTTA 1YS7A 1XS9A 2ESHA 1JGGA 3ZQFA 1R5GA 1XGMA 2FOWA 2E2JJ 1Y39A 3F6OA 4NC8A 3I54A 3PNTA 5M3MJ 2JUCA 3HRMA 1H88C 3VSLA 3WU1B 2L5QA 1X1BA 1X1AA 5IYBJ 2DFFA 1XSVA 5HOOA 4L0YB 3J7ZI 4S05A 2BY3A 3WTSC 5FKOA 3OYFA 3W6KB 4KDPA 3GEZA 3H5NA 3JSOA 2BYVE 3BQZA 4PFOA 2LG4A 2M8GX 4CDGA 2V9KA 2NNYA 3CCJI 4GYGA 2HS5A 3OS2A 1FC3A 2JQ7A 2MW8A 3OY9A 3V8LA 4ZC3A 2LY9A 1IRZA 1OFCX 2R7DA 1I1SA 1TLHB 1MH3A 2EK5A 1HKQA 1T33A 3HOSA 3E5QA 2IVMA 2EJRA 4NB5A 2A07F 3SFIA 1U9NA 3KIOA 3TMOA 2LKXA 1LJ9A 2DXIA 1IZ1A 2RGVA 1OCPA 1M1EB 4Y4RA 4YEJA 4DNCA 2E7XA 3ZXSA 5CLSA 4HPQA 5F08A 3LSTA 1X4PA 2WY7Q 1JT6A 2CW7A 2MG4A 2F5CA 5D5WB 4XLEA 2EZKA 3G1LA 2ISYA 3OYGA 2O8KA 1FSHA 1O3QA 4HX7A 1PVEA 4HLXA 2DO7A 4L5JA 4BH9A 4E7SA 2DMQA 1JXSA 3FK7A 2NVUB 4A5NA 4RB0A 1HKTA 2CUFA 1FYKA 2COMA 2WBMA 3DBLB 2EFNA 1QA6A 1YO5C 3IKTA 3L7WA 3MKZA 2HKXA 2HXIA 2OV7A 2ZBKA 4DOZA 2ZMEA 2YUSA 2LD5A 1TNTA 3WTWC 2P5VA 4J00A 3F23A 1UG0A 1JI8A 3FXQA 2JA7J 1Q1VA 3GBGA 3R4KA 2DU9A 3AAFA 2VKEA 2XAGA 4HEA2 4ZH4F 1S72I 4O3MA 3EUHA 4KITB 2V1XA 1VQ8I 3BT9A 1D0ZA 4L9VA 5IY5H 2CV2A 1VZ0A 5LRSA 4P96A 2O0YA 3GF2A 1G2HA 4L9NA 2VIXA 2EILH 5HS7A 3G4SI 5DM7F 1YITI 4H4KC 2ISZA 3FK6A 4LIUA 1I50J 1Z3YA 3MD2A 5FB2A 5LD2C 5JFRA 2DT7B 1QHHD 1R4NB 2RDPA 1T39A 2B0LA 3FMSA 4JYKA 1UJ8A 1MMGA 2VE8A 2KDZA 3C1DA 3F9KA 1LQ1A 1AA7A 2GXBA 1B9NA 2EFPA 2E1MC 2KIMA 4A0YA 4CCNA 3WTUC 2LREA 1ETXA 2BY1A 2KMUA 3KFWX 5FKMA 2OTJI 1U5TA 3KZYA 3BC8A 1O7LA 3K1PA 1W7PA 2E19A 4KIFA 2DLLA 2F4OB 1L0OC 4D0PA 2KIFA 2VKHA 3A01B 2JSPA 1D1BA 5D6EA 5E18F 2YX4A 3VB2A 4M3EA 5F04A 2MSYA 3H5AA 4O6JA 1R49A 3EUAA 1IXSB 4BAYA 1Y1WJ 2MLGA 1TWAJ 1QGPA 3F21A 3J81K 4EJWA 1QPMA 2E71A 2V9VA 4IHXA 2BHYA 2Y9YA 4XNFA 4CZZA 2AQEA 3KZZA 1ZRDA 2XGXA 1FX7A 1HBXG 1BW5A 1RI7A 2EA2A 2XGCA 5GTIC 3IH3A 1QPIA 2IS1A 3BTJA 3N05A 2KZVA 4KISA 4FX0A 2HOSA 3MQ0A 3CCYA 3H92A 2H27A 3U9GA 3A1YA 2M9HA 5E8IA 1IV8A 4KN7X 1S9HA 3CCMI 2Z1DA 1R58A 4N0BA 5B5EC 5HODA 3HC7A 1YRNA 3R0AA 2STWA 2PEXA 1L3LA 3DV8A 3CESA 5HDGA 5ICFA 2Y31A 2QYOA 1BR2A 4N9IA 2HXOA 1LB2A 2G0EA 1KGSA 2MLKA 2RQPA 4IF4A 2PX9A 4YFXF 4BXFA 2MA3A 3NEUA 1REPC 3C2BA 1FNNA 3QODA 2IBDA 1BJAA 4PZJA 2IS4A 4GFBA 4CYCA 4D9JA 3ZMVA 1ERDA 4S0HB 3OOUA 1BOBA 2QKLB 2X4HA 1OCOH 2O5RA 1VQKI 2TDXA 5J1UA 4XMYA 3ZQCA 1LNWA 4XKBA 3QYEA 4IEJA 2BOLA 2PMUA 4LITA 4KT6A 3RCOA 2CJJA 2STTA 3OSGA 2A3SA 3J81Z 1D3YA 5HNFA 4XLPF 1BC7C 1P4XA 3BLYA 4XM3A 4BXUA 1VQ9I 4XRSA 2DTRA 2IJLA 2ZCWA 3BCBA 3ABUA 2V1DA 3X2QH 3CUQA 3ZQIA 5GPCA 3ZCOA 5E17F 5EZHA 4NC7A 3K4BA 3P5JA 3WGGA 3KETA 4C9YA 3OYLA 4TV7A 4ETSA 3SJMA 1BR4A 1JKRC 1X1DA 4I02A 4BE0A 4JK1X 4MNUA 2F5EA 3RPUA 1VQNI 1JUSA 1OLTA 1WRJA 4XKVA 1W5TA 3ZN1A 3JAMZ 2K86A 2A61A 2P5KA 5FLVA 1O3RA 4IQ4A 4BGDA 1ZK8A 2LF7A 4A0XA 2AS5F 1T08B 1W5CC 3AKZA 5AIPA 4ZYDA 2HYJA 1PP7U 4S04A 3QOPA 4ITVA 2HPIA 4XKWA 4LFUA 3GFLA 3ONQA 2E7WA 2FXAA 3AFHA 2FQ3A 1Y0UA 3OIPA 4BJTA 2VBZA 3AG4H 4PJ0C 3P9IA 4AUXA 1BM9A 4RGUA 3PQJA 2M34A 2BVLA 4F7ZA 1ENHA 1SFXA 5J1YA 1T2KA 2ME0A 3I4NJ 4HF2A 3S2WA 3S32A 2IGMA 1XX5A 3BR5A 3TO6A 5KVRA 2HDDA 3BTCA 2NOGA 1B6AA 2VUMJ 3WG9A 4F3QA 2DPDA 2VI6A 2VKVA 2CV0A 1T8IA 5M5WJ 1U5TB 4YELA 2M7AA 3HJEA 4UVAA 1V3FA 3M8JA 1P9QC 1Z6RA 2L7KA 2XSDC 1S6LA 1RIOH 2DI3A 4GXOA 2P6SA 5GTHC 2FBKA 3QYFA 1S7AA 2XAHA 4LJZF 5DV5A 2DA2A 3LMMA 5FKNA 1JTYA 2FMLA 3BROA 5HNHA 3WTVC 4BDZA 1GT0C 1E2XA 5EF6A 4IZZA 3BTIA 2DT5A 2XC7A 1W7PD 2K7LA 3MEXA 2ID6A 2WAFA 1S5LC 3DQVC 4NQWA 2PJRA 2ID3A 1VQ5I 1LDDA 3HHGA 3UR3C 3LSMA 3L2QA 2L02A 2M2EA 3D0SA 2V1NA 3H9QA 4PFPA 1GDTA 5J4YA 3RZOJ 2EPFA 4ZYHA 4KMUX 3F72A 1SMTA 2DFIA 4M3GA 3JSPA 1RUOA 2NXNB 2JMWA 2QA4I 1I1GA 5FLXZ 1XG1A 1IO2A 5LEJA 3PQKA 3V8JA 1B59A 5CPRB 5JLWA 1I6HJ 4E4HA 1PJRA 3T8TA 1R1VA 3RYPA 3LSPA 2N8GA 3M07A 1SAUA 3IRRA 5HLHA 1ZLKA 1MDMB 4Z6YA 2CFOA 5F6FA 5CJ9A 3K6GA 5BPIA 4AIJA 3CMYA 3FXLA 1ACIA 1K7AA 3Q9VA 2IPQX 5M5XJ 3TP0A 1D8JA 2ZMEC 1V5GA 4IRGA 4EGZA 4B1RA 2NS7A 1R6RA 3VSKA 1SAXA 2H09A 4BE1A 1TW2A 2JN6A 3VYSB 2LC2A 1OJLA 2ETHA 1ZN2A 5TRDA 3S1RJ 2FEZA 1R1TA 2WWYA 2W4SA 1MSFC 2BHZA 3S3MA 4PUSA 2VASA 3DKYA 5B1BH 4A0ZA 4D5CA 4P55A 1BIAA 4EJTA 1J75A 2XVCA 4IHTA 2A6EF 1UFMA 2MD5A 2VC0A 1D0YA 4HG2A 4BJ5C 1YJWI 3BZKA 1Z3XA 2VN2A 4B44A 4UUTA 1Z7UA 1GHCA 3ABLH 3RI4A 2P8TA 2QF7A 1FOYA 4MLOA 5IT9Z 2F4IA 3GXOA 4A6EA 2JA5J 3GCMA 1J7KA 1K4SA 5FRNA 2L0KA 2RNGA 4A6DA 2YR2A 1EKEA 1TWGJ 3H3VK 3FZVA 1ETYA 3JRCA 1LDKB 4GRIA 4F93B 4WK8F 4X0GA 3DEUA 1SVOA 2CW0F 2R7FA 1IG7A 1O3SA 2UXXA 3PO3J 3LA2A 5FD5A 1R7JA 2A6TA 3J80K 4XOPA 2GIVA 2LNBA 1JJ6C 2HR3A 2LLKA 2JA6J 3I9V2 3EETA 5DYMA 2R4GA 3MFKA 1YRNB 3GTOJ 1K83J 4U7BA 2CMPA 1DP3A 2BZTA 4XBFA 2KHMA 4W1UA 1T95A 2L9VA 1S7EA 4F91B 2P7CB 1ETVA 1MIJA 4EM2A 3D1NI 3L2WA 4FE4A 2VOPA 2ZSIB 1XGSA 5IYCJ 5LFAA 4RGRA 1SD5A 1WJFA 2VJJA 1IGNA 5CVJA 4PJNA 4F55A 4BHCA 3LSJA 5K5RA 2P4WA 1VQ7I 4B4CA 5CQEA 2G9WA 2FNAA 3JTHA 1YOVB 3BJ6A 2JUGA 2XASA 3BZCA 2FE3A 4KYWA 1UCRA 4NNJA 3CLQA 3B73A 2KDOA 3OWTA 1YS6A 1WKMA 5DM6F 2IW5A 3W3CA 4ZYAA 2BE5F 4UVBA 1GVDA 4A3IJ 1R1UA 1K4TA 2HNHA 3FM5A 3F6VA 3H36A 1YX3A 3KZIC 4DYCA 2IAIA 1Y6IA 2DK5A 2Y0SA 3IAS2 4LG0B 4UUSA 1B1BA 3I58A 1IXCA 2X85A 4B3XA 1P4AA 4G7HF 5F0HA 4MTEA 5F27A 3TKYA 1MBFA 1EH8A 4FHTA 4A12A 3ZR8X 1FOKA 2KLOA 3LQRA 2VJIA 2L9SA 4QPOA 1ULYA 3BR1A 2LFBA 2Q8KA 4LOCA 1RR7A 3IUOA 1N77A 1LDJA 2PBIA 1IDYA 2Y0SN 1UHWA 2L4AA 4FISA 5F0FA 3L2UA 1VTNC 5EEHA 2UWMA 3L1PA 4OWRB 2X6OA 4ESBA 1J5YA 3MAJA 2QQ9A 3OYIA 2LY1A 1XCVA 2H94A 4ABZA 2IGOA 3A03A 3JTGA 3R6SA 3CF5F 2P0WA 5KHDA 5J4VA 2X1CA 3HIFA 2JRTA 1TWHJ 4M6XA 3E5UA 5HS8A 3W6JB 5LBQA 2XDVA 4FCYA 3DKXA 2VODA 3DPLC 3RZDJ 3DU5A 4HDVA 1EH6A 2RKHA 1UG2A 1STZA 2L7ZA 2GA2A 3M1CA 3HUGB 1X2NA 3O8HA 5E3OA 2HQAA 3PSIA 4AYBA 2DMUA 3JRBA 1YW9A 3TL4X 1AOYA 2HFHA 1WQ2A 2JRMA 1B9MA 1BBYA 3FIWA 3F8FA 2EZIA 3H1CA 2ME6A 1AKHB 5DCFA 1I27A 1W4MA 4XICA 2R7VA 1GXPA 4UXNA 2E2HJ 2DMTA 1U3EM 3LFUA 4AU7A 4LMYA 4C2UA 3S93A 1X2MA 3QAHA 3G6EI 2KT0A 2XROA 2M30A 2EFQA 4YFKF 1I39A 3EUKL 2DMNA 3GTKJ 4KIGA 4RBOA 3A01A 1V4RA 1R5ID 2ZJQF 4OIRF 3U2RA 5HLGA 1XDUA 1G4DA 3V8KA 2F5VA 2LY2A 1FP2A 4JX5A 5D4RA 1USTA 4A3FJ 1FT9A 2DQLA 4B3AA 4PGHA 2KRHA 3VYTB 1Z7LA 3HYIA 3O8GA 4M74A 1TT5B 2HTJA 3S1MJ 3HUGA 1OYYA 2MD0A 3DTIA 3OS0A 2QKMB 1KYWA 2V9PA 2GM4A 2VQLA 1U5TC 2R7WA 2ZXHA 1EH7A 1R71A 3FXUA 1MBKA 1FIAA 5DEQA 1ON2A 3EQLF 1XMKA 4MO7A 1ITYA 5KCMA 3T0YA 4N4OB 4G12A 3EUHC 4BBSJ 3MZHA 2Y2ZA 1MKMA 1Q1HA 1RKTA 1V5EA 4XLFA 2DYRH 1U6GA 3E6BA 3G2BA 2FJ1A 4UV8A 2LRDA 1J9IA 1LKXA 2X6WA 3ZMTA 4FTHA 4CZCA 2DOFA 2EWNA 1WVRA 4B09A 4J19A 4IX7A 2QBYB 4O5VA 5GADJ 4P5OA 3K69A 5DUKA 4M3FA 2VQGA 2UV1A 5K7ZA 3OYCA 1LFUP 2JPBA 4DBRA 4XQFA 3KE2A 2HEOA 2R7QA 1YFHA 3QP5A 1WPKA 2BXZA 2Y30A 2ZFUA 4KUMA 2QENA 3GTLJ 4DZJA 4BYYA 1R00A 2HQRA 4M73A 1ZKGA 4I7HA 3N4MA 3IKVA 2XB5A 2H8RA 2K85A 3W6VA 1R36A 3GZNB 4I09A 1ZHFA 3HXLA 2XKPA 4RB1A 4CHUA 1FMVA 3FMRA 2VL8A 2W48A 3GZ5A 2XSJC 3KLNA 5FO5A 5HVQC 3P9KA 1QHGA 5BS6A 1FYLA 1WJEA 1ZGWA 2I8DA 5FFXA 3WGIA 1F9NA 1DP7P 3ASNH 2W00A 5BMZA 3OR1C 3CJRB 3OYHA 1XPXA 3VWBA 1LE8A 1QRYA 3S2HJ 1W5SA 1N25A 2LYCA 2Y9ZA 3FISA 2AO9A 3G71I 1I3AA 2R5ZB 2VXZA 5E1XA 2D1VA 5FKKA 1X58A 5B1AH 2NVXJ 4AD9A 2ZXJA 5C44J 2EV6A 2R93J 2WADA 1YHQI 2ZXIA 2CQ7A 1ZYRF 1XDSA 5IOYA 3FXMA 3PFYA 5D5XB 3RKQA 4DYRA 2O6GE 3DLAA 2CO5A 4HAMA 5KNLA 3S1QJ 2KRFA 1K79A 3CP8A 5FLMJ 3K2ZA 3HRUA 3E3VA 4ZTJA 3K4MA 2Y0MA 1LEBA 4CA0A 4CCJA 2Z9OA 3IAM2 4NUBA 1G3WA 2OQRA 4Y17A 3FBNB 2CUEA 4RGSA 3HOTA 1MBJA 4LB6B 1YW7A 4M3BA 1E3OC 4DGWB 2JT1A 4Z2YA 2QEXI 1F43A 4FE7A 4DYQA 3BR0A 2M8EA 2QM3A 1QU3A 4XSZF 3GLLA 3ABTA 2EV0A 3CJTB 2OZ6A 1FMWA 2OC6A 1AKHA 5L3CA 2ELKA 4UHTA 4AYBN 1VQOI 4NDLA 3Q3SA 5L3FA 4JBAA 2K4JA 4HYEA 2F6CA 3HGYA 4XLAA 2QSHX 2HU9A 2EV5A 2VPRA 4K2EA 3C18A 2DYSH 3FHNA 1YW8A 2VJ5A 5AONA 2O9LA 1BOAA 2W1OA 5L3GA 3I0TA 2J5PA 1SD4A 3FWEA 1AHDP 3FKJA 5TISC 2K9MA 1TC3C 2ACJA 3BQYA 2ZJRF 1E0EA 3ZRGA 5JHUA 2XUBA 4MEYF 2L54A 3JRIA 5ILUA 2Y75A 4OINF 3N97A 4UY8I 2C6YA 3DXJF 2RN7A 1WH5A 3HG9A 2EINH 4PK4A 1P6RA 3H3ZA 2LKPA 2R7ZJ 2MABA 2COBA 1T38A 1UHMA 1B72A 3KEYA 3TQNA 2VB6A 2LSOA 2ELHA 3WTZA 1CGPA 3HPHA 1FSEA 5FRMA 2MH2A 4HDUA 2LMDA 2MC4A 5KK1A 2HYGD 5IP9J 3O3KA 4XIDA 4A3DJ 2M4KA 1Y8RB 3DTKA 4ENMA 2XIGA 4D1QA 4AM3A 4AVZA 3RQ4A 3B02A 2HWVA 4QPQA 3FDYA 4DJAA 1IN6A 3M1EA 1TW3A 3WE2A 4U0VA 1ZRCA 2QBYA 1QZZA 2BGCA 1WJBA 3ECOA 3K4KA 2UZKA 1NG7A 4BACA 2DN0A 1MZBA 1N78A 2H8WA 2M7BA 2K27A 1HQCA 1RZ4A 3EDPA 1SC7A 3HGGA 1HDPA 2Q2EA 1SFOJ 4LK0F 2W84A 1FJLA 5EEAA 5EZGA 1CF7B 4OAZA 4CCOA 1V54H 2E1NA 4OOIA 4CSWA 2CWEA 2LH9A 4L9TA 3WODF 1QNTA 5LHHA 2HOTA 1T6SA 4V2FA 2XHKA 4BU2A 1U2WA 1JKPC 2Z16A 3TEDA 1UZCA 2FSWA 3WTXC 3JW4A 3OL4A 2JA8J 2BVMA 2CW8A 3PUFA 5J47A 1FEXA 1OCZH 2ZO4A 1DU6A 2L9NA 4XSXF 2V1UA 3A0HC 3HKZN 1JJ8C 3HPGA 2JVHA 1A35A 2K3FA 4FX4A 4UUVA 3D5RC 2K9LA 3BP8A 4KA4A 2NYXA 1OISA 4IO9F 2YU9J 3HRTA 3RYRA 4OMYA 1SMYF 2PLYA 2LBFA 3CDIA 1W1WE 4J01A 2A5WA 3E97A 5FJ8J 1XGOA 2EZHA 4XONA 4C3IJ 4AIKA 4A5MA 2J5OA 3S3OA 1XC5A 1MH4A 2V26A 3R61A 5E3NA 1ZREA 5LRRA 2M5WA 2MC3A 2RREA 3F0CA 2CQXA 3H35A 4U0WA 1OCCH 3HDDA 1I3QJ 3I5UA 3TW6A 1XB4A 2HKOA 4V19K 2QSGX 2OD5A 3O6BB 2W57A 4Y13A 3KYDB 4RMNA 2FF4A 2WAEA 3REOA 3HOXJ 1IRXA 4RA2A 1KQ9A 3OSFA 3ML6A 1TL8A 3CC4I 1X1CA 1N75A 3DCFA 3TBIA 4ZZLA 4XORA 4JQFA 4LG3A 1OR7C 2VPLA 2AQFA 5A2QK 2NNNA 3QPSA 4XRSG 1J59A 2MBFA 4ON0A 4BHPA 4EMSA 2KFDA 3DF8A 1VQMI 1B8IA 4EATA 2P6TA 3HBLA 2DA3A 3K0LA 5JVTA 1D5YA 3GTJJ 5AIQA 4MGRA 1ZH5A 4HSRA 4E6KG 5D8LB 1NHAA 2WB1N 4FT8A 5FROA 3DEWA 2Q1ZB 2VBYA 5D6FA 5DUIA 1LUJB 1J2XA 4C30A 1IW7F 4EEFG 4C3HJ 1WJCA 3T5XA 2KKOA 2X1DA 3E6MA 2GLOA 2RQQA 3ZMUA 1HSJA 1FBSA 3CCEI 3PSFA 1VF9A 5BPDA 1WJDA 3IWZA 4KICA 1TBXA 3BG3A 2QUFA 3FXOA 3RKYA 2HZTA 2VBWA 4RLQA 1SFKA 1GV5A 4HLYA 1ON1A 1MNDA 3F8CA 4N4NB 2X1EA 3K9TA 1UHSA 2FX0A 2KIQA 4BQQA 2JSCA 2ZJ2A 1B72B 1LPQA 4XKCA 1FWZA 4HNVA 1T0FA 4ESFA 3K4JA 3GWZA 3GFJA 1Z77A 1ZG3A 2LDUA 3DTEA 4RM2A 2V6EA 2OZUA 4N9HA 1ZGAA 2RVCA 3OYMA 3HOYJ 1PYVA 4HX4A 2GZWA 2DW4A 2M1BA 1D0XA 4LG0A 4HX8A 1V5FA 1YQAA 3Q0VA 1PUFA 3P7NA 1FBQA 3A4CA 3CTAA 4ESJA 2HDWA 2ZC2A 3MMYB 1G3YA 4X1EA 2F5FA 1YJNI 1WJAA 1W0UA 1A5JA 2B63J 3C7JA 3CUOA 4BY1J 1BI0A 2FD5A 5DD4A 2O3FA 5IOZA 2ZNZA 1S8NA 4QSHA 2VQCA 3JREA 1R22A 1QO0D 1NH3A 4L9JA 2PJPA 1HOMA 3MN2A 5HLTA 4IHVA 1WI3A 3WU2C 2DK8A 3BZ6A 4U0YA 1O3TA 1DUXC 3OYNA 1PUEE 1YIOA 3B6CA 1IN8A 1FPQA 4Q48A 3S16J 1FZPB 1SVMA 3RJPA 3SZPA 1IN5A 4A3EJ 3F8BA 3QRFF 1JGSA 2LR8A 2V7FA 2Z33A 3PFIA 2R5YB 4GGGA 2IT0A 3VYUB 1XD7A 3CO6C 3VFZA 2VC1A 1WZ2A 2UUZA 1OYWA 2LKSA 2O61A 3JRAA 5ERIA 4MQVA 5LHIA 2AXTC 4XN0A 1ZAOA 4I2OA 5CVUA 3KP5A 5M5YJ 1F1ZA 4B48A 1HA8A 4YFNF 4OAYA 3S15J 2DFHA 4IOCF 4BQNA 4GO1A 4PJMA 3LSKA 4PDKA 5E3LA 4XLNF 3PNYA 2F48A 2L4MA 5J3LA 3QPTA 3K1MA 2Y69H 4M3DA 3L2CA 2JPCA 5K5QA 4RLFA 1E3HA 3EYYA 3Q5FA 2D2WA 2M4GA 5EYRA 1MSEC 4EVIA 2QLZA 1D5VA 4BEHB 2HQ5A 3GW2A 4PJLA 2DA6A 5D5UB 2HGCA 3IL2A 3DWLE 1BJZA 2A5YB 3MVPA 3FHZA 3CJNA 4OMZA 5IP7J 1KYZA 2O03A 4GDFA 1I5ZA 2IA0A 3KP6A 1TQPA 4HQEA 1LVAA 4L5EA 3E1SA 1J0RA 2KJBA 2GIZA 1KU2A 2NVYJ 4D7NA 4E7ZA 1G59A 4IRIA 2DTZA 4BJ6C 1G8XA 2JZYA 4Q4ZF 5IYDJ 1OCRH 4ASNA 3GUDA 4KFCA 3SEZA 3IRQA 4YIFA 2CUJA 3I71A 5FD6A 2DOAA 1IXRC 5L3EA 5DD8A 1G6NA 2E5ZA 2XGEA 4B43A 5LHGA 2L7MP 3ZOBA 5D4SA 5E3MA 3W2VA 5LGTA 1DU0A 1MJ9A 1K6OA 1KU7A 1SEUA 4DQ2A 3ECHA 3C3WA 1KU9A 2M0CA 4XR6A 2DA7A 1RC9A 3L00A 5F0CA 3LA3A 4M71A 4U7DA 2JJ7A 3HM5A 2R7OA 3CMEI 1H0MA 4QLCU 1APLC 1P92A 4NQWB 3WTYC 3NQOA 2G7UA 2XF7A 3OIOA 1S29A 5FFZA 3ZQLA 5D8KB 2X0LA 3OIQA 3U21A 3I3LA 3V4GA 1U78A 3KPHA 1GVJA 3FXJA 1R23A 2NRAC 1XTAA 1BI3A 3MZ8A 1U8BA 3GTPJ 2OUMA 2R5ZA 2OQGA 1W7PB 2LOOA 4LLLA 1IV6A 3GTGJ 1EF4A 3V7SA 1HKSA 2O8XA 1HW5A 3LSIA 2ELJA 5IT3A 3FKIJ 2XV4S 4BY7J 2KZGA 3LL7A 4CH7A 3MCZA 5BQTA 3RKWA 3HSEA 3COAC 3J80Z 1S3JA 3BTLA 1OPCA 3H3UA 4B8XA 3G3ZA 2D45A 4UB6C 1Z21A 3TOAA 3H9GA 2X6YA 1T56A
chains in the Genus database with same CATH topology
1JE8A 3KEQA 1IN7A 4ZYGA 2OA4A 4ZZDA 4G8XA 2OAZA 1O57A 2CGPA 2G7HA 1XGNA 3GFIA 2NS0A 3R0JA 4M72A 1Z6TA 2LF8A 1BIBA 1WWXA 2P7VB 2XAQA 4L0ZB 2QVOA 2IP2A 3CLOA 1C0WA 3F8NA 3SZTA 3RIRA 4ENKA 3BOQA 1YTYA 4R79A 3BJAA 1BN5A 1DDNA 2R3SA 4BQAA 4LLNA 2XAFA 2Q0OA 4I0AA 1YLFA 3ELKA 1AWCA 4HV5A 3F3XA 4EV0A 4CXFA 4P9FA 3F8MA 1TQMA 2YU3A 2W85A 2ESNA 1MJAA 2FNPA 4EM0B 1ZLJA 3ZMZA 1HXDA 2QQAA 5D5VB 3GO5A 2K4BA 4PCQA 2ZFWA 2ZMEB 4RB3C 1SFEA 4Q47A 1MD0A 1WI9A 2H6BA 1BC8C 3SHFA 5FLXK 4ENNA 2BBYA 2Z5UA 3HHHA 6PAXA 3F22A 2D1HA 1QQIA 3KP4A 3WGHA 1OKRA 3CO7C 1XN7A 3E5XA 3QU3A 2VBXA 3BWGA 1KU3A 3M8EA 4KT5C 3TO7A 1R5HA 1PP8F 1HSTA 3HRSA 4IJAA 1USSA 2GAUA 1E17A 1G3SA 2CSOA 3GLXA 5LGNA 2DAOA 5HS9A 3FMQA 5J8FA 3E6DA 2FBHA 4CO8A 1CF7A 2GA1A 1HW1A 5H20A 1FLIA 1WSUA 5DCMA 4IVNA 3ZN0A 3P9CA 4IXAA 1GXQA 2V79A 2FU4A 1FYMA 5ILSA 3SQNA 2PG4A 1KA8A 4HV6A 5HDKA 1SFUA 3KLOA 3TDUC 1BI1A 4WF2A 2QZ8A 4Y15A 1IF1A 2EFOA 4LB5A 3V7RA 1IUYA 5E1ZB 2HDCA 2FOKA 4G6DA 2JTVA 4OIOF 3HSFA 1IRFA 3ERED 4KIBA 2F5DA 5ED4A 2PQ8A 4RS8A 4AVPA 1SD6A 4XRFA 2XKOA 3ULQB 1KQ8A 4IRHA 4QWQA 5HLIA 3FF5A 4RAZA 5E20A 2A6HF 4MHGA 4EM1A 2RV8A 4MTDA 3DP7A 4R8HA 1U8RA 4I98B 3G73A 1MJBA 3R60A 3J7AO 1XSXA 5L3DA 2EB7A 5JI6A 4MEXF 3T1BA 4EQQA 1FP1D 1IAWA 4M9SA 2WTEA 2WV0A 3I53A 4UVCA 1DPUA 3U1DA 3FM3A 5HDNA 2YPRA 3CUQB 4R1HA 4MQ9F 3OOPA 2CFXA 4BHBA 3I59B 5ICGA 4CGZA 3I59A 1A04A 1HW2A 4P9UA 3GFMA 3DFGA 2VT2A 1I6XA 4YIIA 1DPRA 3D5LA 3KEOA 1OMIA 3ISPA 3EYIA 1YG2A 3HSRA 1TTYA 2L3DA 1MDMA 1IN4A 4H0EA 1EV7A 2FBIA 5FGMA 1K78B 4KN4X 3IWFA 2FA5A 3L09A 2VONA 3SFZA 2Z3YA 4WWCA 2HTSA 1O7FA 5ICCA 4M6YA 4LGWA 4I01A 4CICA 5L3BA 3LQQA 3RTRA 3JAMK 2EA4A 3CDHA 4HF0A 2WC2A 2XRNA 4HBLA 1T98A 5IT9K 3VOEA 1QZYA 2PFBA 4WXCA 4WCGA 2OBPA 3HTSB 1ONVA 4OIQF 2YSRA 1S7OA 1XSDA 3ROUA 1FBUA 2OU2A 4RGXA 2KJCA 2MH9A 2IA2A 4IPAA 2GWRA 3SXYA 4IHSA 5K1YA 4A2UA 4OU0A 3LFKA 4HF1A 2V6CA 4PGGA 2PI0A 4HZFA 3LAJA 4ZYEA 2GXGA 4RAYA 4E70A 5LEKA 1Z1DA 5J8CA 2EFWA 3TOBA 1H9GA 4HA8A 4OIPF 3BPVA 1MGTA 5H6RA 1PDNC 1XCBA 5LLQA 1QBJA 1Z9CA 4L18B 4G94A 4UV9A 2HQNA 4LLGF 4EJOA 2A68F 2CYYA 3O2PE 2M87A 1RUNA 3GZ6A 3QPHA 3RDIA 4G7OF 2NAZA 3FX3A 1D8KA 3VEPA 4GYIA 3ZMSA 1Z91A 3WTTC 3KCCA 3I64A 2ZNYA 2KIUA 1F5TA 2YX7A 1TQIA 2ADUA 3M7GA 2FMYA 3T8RA 2PMHA 1RNLA 1ZARA 4WXHA 5CVVA 4Q5SF 3QP6A 1B4AA 3CUQC 2DQRA 4M9ZA 4EJUA 5EEGA 5DDGA 1X3UA 2F2EA 3KP2A 2P5LC 2IA1A 3MZYA 2AXLA 3IC7A 5LGUA 1JHFA 3IHUA 3BPXA 4GCVA 1OR7A 4I0BA 1ZRFA 5E8GA 3VODA 3L9FA 5J6XA 1P2FA 3WU0A 4UNOA 1Z05A 3V7CA 2QQBA 5ICEA 4HQMA 3TDZC 4KNYA 4EGYA 3QU6A 2IRFG 4U88A 1K78A 3M8FA 5F1RA 4KMFA 3WE3A 2XAJA 5JR3A 5ILVA 5BOXA 1BI2A 2H6CA 2W25A 2CG4A 4M9XA 1ODDA 3LA7A 2HOEA 3BDDA 2DPUA 2VOOA 5TJJA 5E1WA 1JHHA 3OV8A 1OYIA 4G7ZF 4YG2F 3ZP5A 2Y48A 2K02A 5CVIA 1TNSA 2DBBA 2BEOA 3K1NA 2A69F 3I4PA 3NRVA 5DCMB 4ENJA 3ZMDA 5A2QZ 3BJOA 2GQQA 3ZQ7A 4WXDA 5CVRA 2HYFA 2M45A 4CYDA 3GYHX 4HOBA 3KP3A 1F4KA 2QWWA 1LEAA 1IRGA 2VT3A 3RKXA 3RPQA 2Z99A 3BY6A 3TGNA 3E6CC 3Q9SA 1ZG1A 2ZKZA 3DPTA 3M9AA 1ZGJA 3LAPA 4G9YA 1FY7A 1SD7A 4G6QA 1ZG5A 2RC4A 4LK1F 1UB9A 3DKWA 4NHJA 3GVAA 5F64A 1G3TA 2CQKA 3ZPLA 4EJVA 4RB2C 3KP7A 5K5OA 1P4WA 1KQ0A 3TO9A 4HW0A 2PN6A 3GX4X 3LWFA 3HTUA 2BV6A 3FXRA 1XMAA 4WX9A 4AIHA 5H6QA 2VE9A 2L01A 2FRHA 2E1CA 3MWMA 4L5IA 4BNCA 2UXNA 1YYVA 2W24A 4AWXB 2RNJA 4LD5A 5CYVA 1YS7A 2ESHA 1R5GA 1XGMA 3F6OA 3I54A 3HRMA 3WU1B 5HOOA 1XSVA 4L0YB 4S05A 3WTSC 3W6KB 4KDPA 3GEZA 3JSOA 2BYVE 4CDGA 2NNYA 4GYGA 2HS5A 1FC3A 3V8LA 2R7DA 1I1SA 1TLHB 2EK5A 1HKQA 3HOSA 3E5QA 2IVMA 2EJRA 4NB5A 2A07F 1LJ9A 1IZ1A 2RGVA 4DNCA 2E7XA 5CLSA 3LSTA 2F5CA 5D5WB 1FSHA 2ISYA 1O3QA 4HX7A 4HLXA 2DO7A 4L5JA 4BH9A 1JXSA 4A5NA 1HKTA 4RB0A 1FYKA 2COMA 2EFNA 1YO5C 3IKTA 3L7WA 2HKXA 2ZBKA 2ZMEA 1TNTA 3WTWC 2P5VA 3F23A 3FXQA 3R4KA 2DU9A 3AAFA 2XAGA 4ZH4F 4O3MA 3EUHA 2V1XA 4L9VA 5LRSA 4P96A 2O0YA 3GF2A 4L9NA 5HS7A 2ISZA 5FB2A 5JFRA 2RDPA 1T39A 2B0LA 3FMSA 2VE8A 3C1DA 1LQ1A 2GXBA 1B9NA 2EFPA 2KIMA 4A0YA 3WTUC 3KFWX 1U5TA 3KZYA 1O7LA 3K1PA 1W7PA 2DLLA 1L0OC 4D0PA 2KIFA 5D6EA 5E18F 2YX4A 3VB2A 4O6JA 1IXSB 4BAYA 2MLGA 1QGPA 3F21A 3J81K 4EJWA 1QPMA 2V9VA 4CZZA 3KZZA 1ZRDA 2XGXA 1FX7A 1HBXG 1RI7A 2EA2A 4FX0A 3MQ0A 3H92A 2H27A 3U9GA 5E8IA 4KN7X 1R58A 4N0BA 3R0AA 2STWA 2PEXA 1L3LA 3DV8A 5HDGA 5ICFA 2QYOA 4N9IA 1LB2A 1KGSA 2MLKA 2RQPA 4IF4A 4YFXF 2MA3A 3NEUA 1REPC 1FNNA 1BJAA 4PZJA 3ZMVA 2X4HA 2TDXA 1LNWA 2PMUA 2STTA 2A3SA 3J81Z 1D3YA 4XLPF 1BC7C 1P4XA 4BXUA 2DTRA 2IJLA 2ZCWA 3ABUA 2V1DA 5E17F 3CUQA 3WGGA 3KETA 4TV7A 4ETSA 4I02A 4JK1X 4MNUA 2F5EA 3RPUA 1WRJA 1W5TA 3ZN1A 3JAMZ 2K86A 2A61A 2P5KA 1O3RA 2LF7A 4A0XA 2AS5F 5AIPA 4ZYDA 1PP7U 4S04A 3QOPA 4LFUA 3GFLA 2E7WA 2FXAA 2FQ3A 1Y0UA 2VBZA 3P9IA 1BM9A 4RGUA 3PQJA 4F7ZA 1SFXA 1T2KA 4HF2A 3S2WA 3TO6A 5KVRA 1B6AA 3WG9A 2DPDA 1U5TB 4UVAA 1V3FA 1Z6RA 1RIOH 1S6LA 2DI3A 4GXOA 2P6SA 2FBKA 1S7AA 2XAHA 4LJZF 5DV5A 1H9TA 2FMLA 3WTVC 3BROA 1E2XA 2DT5A 1W7PD 2K7LA 3MEXA 3DQVC 4NQWA 1LDDA 3HHGA 2L02A 3D0SA 4ZYHA 4KMUX 3F72A 1SMTA 2DFIA 1RUOA 3JSPA 1I1GA 5FLXZ 5LEJA 3PQKA 3V8JA 1B59A 3T8TA 1R1VA 3RYPA 3IRRA 5HLHA 1ZLKA 1MDMB 5F6FA 5CJ9A 5BPIA 4AIJA 1K7AA 3Q9VA 2IPQX 1D8JA 4IRGA 4EGZA 1SAXA 2H09A 1TW2A 2ETHA 1ZN2A 5TRDA 2FEZA 1R1TA 2WWYA 4A0ZA 4P55A 1BIAA 4EJTA 1J75A 2XVCA 4IHTA 2A6EF 1UFMA 2MD5A 2VC0A 2VN2A 1Z7UA 1GHCA 3RI4A 2P8TA 5IT9Z 3GXOA 4A6EA 1J7KA 4A6DA 2YR2A 3FZVA 1LDKB 4WK8F 3DEUA 2CW0F 2R7FA 1O3SA 2UXXA 3LA2A 5FD5A 1R7JA 3J80K 2GIVA 2LNBA 2HR3A 5DYMA 3EETA 3MFKA 4U7BA 4XBFA 2P7CB 4EM2A 2VOPA 1XGSA 4RGRA 1SD5A 5CVJA 4BHCA 5K5RA 2P4WA 2G9WA 2FNAA 3JTHA 3BJ6A 2XASA 2FE3A 4KYWA 1UCRA 3B73A 1YS6A 1WKMA 2IW5A 2BE5F 4UVBA 1R1UA 3FM5A 3F6VA 2DK5A 4LG0B 1B1BA 3I58A 1IXCA 1P4AA 4G7HF 4MTEA 3TKYA 1EH8A 4FHTA 4A12A 1FOKA 3LQRA 1ULYA 2Q8KA 1LDJA 2PBIA 1UHWA 2L4AA 2UWMA 1VTNC 5EEHA 4ESBA 1J5YA 3MAJA 2QQ9A 1XCVA 2H94A 3JTGA 3R6SA 3HIFA 2JRTA 4M6XA 3E5UA 5HS8A 3W6JB 5LBQA 2VODA 3DPLC 4HDVA 1EH6A 2RKHA 1STZA 2GA2A 1YW9A 1AOYA 2HFHA 1WQ2A 1B9MA 1BBYA 3F8FA 5DCFA 1I27A 1W4MA 1GXPA 4UXNA 1U3EM 4LMYA 3QAHA 2XROA 2M30A 2EFQA 4YFKF 4KIGA 1V4RA 4OIRF 3U2RA 5HLGA 1XDUA 1G4DA 3V8KA 1FP2A 5D4RA 1USTA 1FT9A 2DQLA 4PGHA 3HYIA 4M74A 2HTJA 3HUGA 1OYYA 1KYWA 1U5TC 1EH7A 3FXUA 5DEQA 1ON2A 3EQLF 1XMKA 3T0YA 3MZHA 1MKMA 1Q1HA 1U6GA 3E6BA 4UV8A 1J9IA 3ZMTA 2EWNA 2QBYB 4B09A 4O5VA 4P5OA 3K69A 5DUKA 2JPBA 3KE2A 2HEOA 1YFHA 3QP5A 4KUMA 2QENA 4BYYA 1R00A 2HQRA 4M73A 4I7HA 3N4MA 3IKVA 1R36A 4I09A 1ZHFA 2XKPA 4RB1A 4CHUA 3FMRA 3GZ5A 3KLNA 5FO5A 5HVQC 3P9KA 1FYLA 5BS6A 5FFXA 3WGIA 1F9NA 1DP7P 5BMZA 1W5SA 2VXZA 5E1XA 2D1VA 4AD9A 2ZXJA 2EV6A 1ZYRF 1XDSA 5D5XB 2O6GE 4HAMA 2CO5A 2KRFA 1K79A 3K2ZA 3HRUA 3E3VA 2Y0MA 1LEBA 2Z9OA 1G3WA 2OQRA 4Y17A 4RGSA 3HOTA 4LB6B 1YW7A 2JT1A 4Z2YA 2M8EA 2QM3A 4XSZF 3ABTA 2EV0A 2OZ6A 5L3CA 4UHTA 5L3FA 4JBAA 2K4JA 4HYEA 2EV5A 4K2EA 3C18A 1YW8A 5AONA 1BOAA 5L3GA 3I0TA 2J5PA 1SD4A 3FWEA 2ACJA 5JHUA 2XUBA 4MEYF 2L54A 5ILUA 2Y75A 4OINF 3N97A 2C6YA 3DXJF 2RN7A 1P6RA 3H3ZA 2LKPA 1T38A 1UHMA 3TQNA 2LSOA 2ELHA 3WTZA 1CGPA 1FSEA 2MH2A 4HDUA 5KK1A 2HYGD 3O3KA 4ENMA 2XIGA 3B02A 2HWVA 1IN6A 3M1EA 1TW3A 3WE2A 4U0VA 1ZRCA 2QBYA 1QZZA 2BGCA 3ECOA 2UZKA 1MZBA 2K27A 1HQCA 1RZ4A 3EDPA 2Q2EA 4LK0F 2W84A 1CF7B 2E1NA 4OOIA 2CWEA 4L9TA 3WODF 1QNTA 5LHHA 1T6SA 2XHKA 1U2WA 2FSWA 3WTXC 3JW4A 2ZO4A 4XSXF 2V1UA 4UUVA 4FX4A 3BP8A 4KA4A 2NYXA 3HRTA 3RYRA 4OMYA 1SMYF 2PLYA 3E97A 1XGOA 4AIKA 4A5MA 2J5OA 3R61A 1ZREA 5LRRA 2M5WA 2MC3A 4U0WA 3I5UA 1XB4A 2HKOA 2OD5A 3O6BB 2W57A 4Y13A 2FF4A 3REOA 1KQ9A 3ML6A 4ZZLA 4JQFA 5A2QK 2NNNA 1J59A 2MBFA 4ON0A 4BHPA 4EMSA 3DF8A 2P6TA 3K0LA 5JVTA 5AIQA 4MGRA 1ZH5A 5D8LB 1NHAA 4FT8A 2VBYA 5D6FA 5DUIA 1J2XA 1IW7F 3T5XA 2KKOA 3E6MA 3ZMUA 1HSJA 1FBSA 5BPDA 3IWZA 4KICA 1TBXA 2QUFA 3RKYA 2HZTA 2VBWA 4HLYA 1ON1A 3F8CA 3K9TA 2JSCA 2ZJ2A 1FWZA 1T0FA 4ESFA 3GWZA 3GFJA 1ZG3A 2LDUA 2OZUA 4N9HA 1ZGAA 2RVCA 4HX4A 2GZWA 2DW4A 2M1BA 4LG0A 4HX8A 1YQAA 3P7NA 1FBQA 3CTAA 4ESJA 1G3YA 2F5FA 3C7JA 3CUOA 1BI0A 5DD4A 2O3FA 2ZNZA 1S8NA 1R22A 1QO0D 4L9JA 2PJPA 4U0YA 2DK8A 3BZ6A 1O3TA 1DUXC 1PUEE 1YIOA 1IN8A 1FPQA 4Q48A 1FZPB 3RJPA 3SZPA 1IN5A 3F8BA 3QRFF 1JGSA 2Z33A 3PFIA 4GGGA 2IT0A 1XD7A 3CO6C 3VFZA 2VC1A 1OYWA 2O61A 5ERIA 4MQVA 5LHIA 1ZAOA 4I2OA 5CVUA 3KP5A 1F1ZA 4YFNF 4GO1A 4PDKA 4XLNF 2L4MA 3QPTA 3K1MA 3L2CA 2JPCA 5K5QA 3EYYA 3Q5FA 2D2WA 1D5VA 4EVIA 2QLZA 3GW2A 5D5UB 2HGCA 3IL2A 2A5YB 3FHZA 3CJNA 4OMZA 1KYZA 2O03A 1I5ZA 2IA0A 3KP6A 1TQPA 4HQEA 1LVAA 1J0RA 2KJBA 1KU2A 4IRIA 2JZYA 4Q4ZF 4ASNA 3GUDA 4KFCA 3IRQA 4YIFA 3I71A 5FD6A 5L3EA 1IXRC 5DD8A 1G6NA 5LHGA 5D4SA 5LGTA 1MJ9A 1K6OA 1KU7A 4DQ2A 3ECHA 3C3WA 1KU9A 3L00A 3LA3A 4M71A 4U7DA 1H0MA 4QLCU 1P92A 3WTYC 3NQOA 2G7UA 1S29A 5FFZA 5D8KB 2X0LA 3V4GA 1U78A 1GVJA 1R23A 2NRAC 1BI3A 2OQGA 1W7PB 4LLLA 3V7SA 1HKSA 2O8XA 1HW5A 5IT3A 2XV4S 3MCZA 5BQTA 3RKWA 3HSEA 3COAC 3J80Z 4B8XA 1S3JA 1OPCA 3H3UA 3G3ZA 2D45A 3TOAA 4KIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JE8 A;  3KEQ A;  1IN7 A;  4ZYG A;  2OA4 A;  4ZZD A;  4G8X A;  2OAZ A;  1O57 A;  2CGP A;  2G7H A;  1XGN A;  3GFI A;  2NS0 A;  3R0J A;  4M72 A;  1Z6T A;  2LF8 A;  1BIB A;  1WWX A;  2P7V B;  2XAQ A;  4L0Z B;  2QVO A;  2IP2 A;  3CLO A;  1C0W A;  3F8N A;  3SZT A;  3RIR A;  4ENK A;  3BOQ A;  1YTY A;  4R79 A;  3BJA A;  1BN5 A;  1DDN A;  2R3S A;  4BQA A;  4LLN A;  2XAF A;  2Q0O A;  4I0A A;  1YLF A;  3ELK A;  1AWC A;  4HV5 A;  3F3X A;  4EV0 A;  4CXF A;  4P9F A;  3F8M A;  1TQM A;  2YU3 A;  2W85 A;  2ESN A;  1MJA A;  2FNP A;  4EM0 B;  1ZLJ A;  3ZMZ A;  1HXD A;  2QQA A;  5D5V B;  3GO5 A;  2K4B A;  4PCQ A;  2ZFW A;  2ZME B;  4RB3 C;  1SFE A;  4Q47 A;  1MD0 A;  1WI9 A;  2H6B A;  1BC8 C;  3SHF A;  5FLX K;  4ENN A;  2BBY A;  2Z5U A;  3HHH A;  6PAX A;  3F22 A;  2D1H A;  1QQI A;  3KP4 A;  3WGH A;  1OKR A;  3CO7 C;  1XN7 A;  3E5X A;  3QU3 A;  2VBX A;  3BWG A;  1KU3 A;  3M8E A;  4KT5 C;  3TO7 A;  1R5H A;  1PP8 F;  1HST A;  3HRS A;  4IJA A;  1USS A;  2GAU A;  1E17 A;  1G3S A;  2CSO A;  3GLX A;  5LGN A;  2DAO A;  5HS9 A;  3FMQ A;  5J8F A;  3E6D A;  2FBH A;  4CO8 A;  1CF7 A;  2GA1 A;  1HW1 A;  5H20 A;  1FLI A;  1WSU A;  5DCM A;  4IVN A;  3ZN0 A;  3P9C A;  4IXA A;  1GXQ A;  2V79 A;  2FU4 A;  1FYM A;  5ILS A;  3SQN A;  2PG4 A;  1KA8 A;  4HV6 A;  5HDK A;  1SFU A;  3KLO A;  3TDU C;  1BI1 A;  4WF2 A;  2QZ8 A;  4Y15 A;  1IF1 A;  2EFO A;  4LB5 A;  3V7R A;  1IUY A;  5E1Z B;  2HDC A;  2FOK A;  4G6D A;  2JTV A;  4OIO F;  3HSF A;  1IRF A;  3ERE D;  4KIB A;  2F5D A;  5ED4 A;  2PQ8 A;  4RS8 A;  4AVP A;  1SD6 A;  4XRF A;  2XKO A;  3ULQ B;  1KQ8 A;  4IRH A;  4QWQ A;  5HLI A;  3FF5 A;  4RAZ A;  5E20 A;  2A6H F;  4MHG A;  4EM1 A;  2RV8 A;  4MTD A;  3DP7 A;  4R8H A;  1U8R A;  4I98 B;  3G73 A;  1MJB A;  3R60 A;  3J7A O;  1XSX A;  5L3D A;  2EB7 A;  5JI6 A;  4MEX F;  3T1B A;  4EQQ A;  1FP1 D;  1IAW A;  4M9S A;  2WTE A;  2WV0 A;  3I53 A;  4UVC A;  1DPU A;  3U1D A;  3FM3 A;  5HDN A;  2YPR A;  3CUQ B;  4R1H A;  4MQ9 F;  3OOP A;  2CFX A;  4BHB A;  3I59 B;  5ICG A;  4CGZ A;  3I59 A;  1A04 A;  1HW2 A;  4P9U A;  3GFM A;  3DFG A;  2VT2 A;  1I6X A;  4YII A;  1DPR A;  3D5L A;  3KEO A;  1OMI A;  3ISP A;  3EYI A;  1YG2 A;  3HSR A;  1TTY A;  2L3D A;  1MDM A;  1IN4 A;  4H0E A;  1EV7 A;  2FBI A;  5FGM A;  1K78 B;  4KN4 X;  3IWF A;  2FA5 A;  3L09 A;  2VON A;  3SFZ A;  2Z3Y A;  4WWC A;  2HTS A;  1O7F A;  5ICC A;  4M6Y A;  4LGW A;  4I01 A;  4CIC A;  5L3B A;  3LQQ A;  3RTR A;  3JAM K;  2EA4 A;  3CDH A;  4HF0 A;  2WC2 A;  2XRN A;  4HBL A;  1T98 A;  5IT9 K;  3VOE A;  1QZY A;  2PFB A;  4WXC A;  4WCG A;  2OBP A;  3HTS B;  1ONV A;  4OIQ F;  2YSR A;  1S7O A;  1XSD A;  3ROU A;  1FBU A;  2OU2 A;  4RGX A;  2KJC A;  2MH9 A;  2IA2 A;  4IPA A;  2GWR A;  3SXY A;  4IHS A;  5K1Y A;  4A2U A;  4OU0 A;  3LFK A;  4HF1 A;  2V6C A;  4PGG A;  2PI0 A;  4HZF A;  3LAJ A;  4ZYE A;  2GXG A;  4RAY A;  4E70 A;  5LEK A;  1Z1D A;  5J8C A;  2EFW A;  3TOB A;  1H9G A;  4HA8 A;  4OIP F;  3BPV A;  1MGT A;  5H6R A;  1PDN C;  1XCB A;  5LLQ A;  1QBJ A;  1Z9C A;  4L18 B;  4G94 A;  4UV9 A;  2HQN A;  4LLG F;  4EJO A;  2A68 F;  2CYY A;  3O2P E;  2M87 A;  1RUN A;  3GZ6 A;  3QPH A;  3RDI A;  4G7O F;  2NAZ A;  3FX3 A;  1D8K A;  3VEP A;  4GYI A;  3ZMS A;  1Z91 A;  3WTT C;  3KCC A;  3I64 A;  2ZNY A;  2KIU A;  1F5T A;  2YX7 A;  1TQI A;  2ADU A;  3M7G A;  2FMY A;  3T8R A;  2PMH A;  1RNL A;  1ZAR A;  4WXH A;  5CVV A;  4Q5S F;  3QP6 A;  1B4A A;  3CUQ C;  2DQR A;  4M9Z A;  4EJU A;  5EEG A;  5DDG A;  1X3U A;  2F2E A;  3KP2 A;  2P5L C;  2IA1 A;  3MZY A;  2AXL A;  3IC7 A;  5LGU A;  1JHF A;  3IHU A;  3BPX A;  4GCV A;  1OR7 A;  4I0B A;  1ZRF A;  5E8G A;  3VOD A;  3L9F A;  5J6X A;  1P2F A;  3WU0 A;  4UNO A;  1Z05 A;  3V7C A;  2QQB A;  5ICE A;  4HQM A;  3TDZ C;  4KNY A;  4EGY A;  3QU6 A;  2IRF G;  4U88 A;  1K78 A;  3M8F A;  5F1R A;  4KMF A;  3WE3 A;  2XAJ A;  5JR3 A;  5ILV A;  5BOX A;  1BI2 A;  2H6C A;  2W25 A;  2CG4 A;  4M9X A;  1ODD A;  3LA7 A;  2HOE A;  3BDD A;  2DPU A;  2VOO A;  5TJJ A;  5E1W A;  1JHH A;  3OV8 A;  1OYI A;  4G7Z F;  4YG2 F;  3ZP5 A;  2Y48 A;  2K02 A;  5CVI A;  1TNS A;  2DBB A;  2BEO A;  3K1N A;  2A69 F;  3I4P A;  3NRV A;  5DCM B;  4ENJ A;  3ZMD A;  5A2Q Z;  3BJO A;  2GQQ A;  3ZQ7 A;  4WXD A;  5CVR A;  2HYF A;  2M45 A;  4CYD A;  3GYH X;  4HOB A;  3KP3 A;  1F4K A;  2QWW A;  1LEA A;  1IRG A;  2VT3 A;  3RKX A;  3RPQ A;  2Z99 A;  3BY6 A;  3TGN A;  3E6C C;  3Q9S A;  1ZG1 A;  2ZKZ A;  3DPT A;  3M9A A;  1ZGJ A;  3LAP A;  4G9Y A;  1FY7 A;  1SD7 A;  4G6Q A;  1ZG5 A;  2RC4 A;  4LK1 F;  1UB9 A;  3DKW A;  4NHJ A;  3GVA A;  5F64 A;  1G3T A;  2CQK A;  3ZPL A;  4EJV A;  4RB2 C;  3KP7 A;  5K5O A;  1P4W A;  1KQ0 A;  3TO9 A;  4HW0 A;  2PN6 A;  3GX4 X;  3LWF A;  3HTU A;  2BV6 A;  3FXR A;  1XMA A;  4WX9 A;  4AIH A;  5H6Q A;  2VE9 A;  2L01 A;  2FRH A;  2E1C A;  3MWM A;  4L5I A;  4BNC A;  2UXN A;  1YYV A;  2W24 A;  4AWX B;  2RNJ A;  4LD5 A;  5CYV A;  1YS7 A;  2ESH A;  1R5G A;  1XGM A;  3F6O A;  3I54 A;  3HRM A;  3WU1 B;  5HOO A;  1XSV A;  4L0Y B;  4S05 A;  3WTS C;  3W6K B;  4KDP A;  3GEZ A;  3JSO A;  2BYV E;  4CDG A;  2NNY A;  4GYG A;  2HS5 A;  1FC3 A;  3V8L A;  2R7D A;  1I1S A;  1TLH B;  2EK5 A;  1HKQ A;  3HOS A;  3E5Q A;  2IVM A;  2EJR A;  4NB5 A;  2A07 F;  1LJ9 A;  1IZ1 A;  2RGV A;  4DNC A;  2E7X A;  5CLS A;  3LST A;  2F5C A;  5D5W B;  1FSH A;  2ISY A;  1O3Q A;  4HX7 A;  4HLX A;  2DO7 A;  4L5J A;  4BH9 A;  1JXS A;  4A5N A;  1HKT A;  4RB0 A;  1FYK A;  2COM A;  2EFN A;  1YO5 C;  3IKT A;  3L7W A;  2HKX A;  2ZBK A;  2ZME A;  1TNT A;  3WTW C;  2P5V A;  3F23 A;  3FXQ A;  3R4K A;  2DU9 A;  3AAF A;  2XAG A;  4ZH4 F;  4O3M A;  3EUH A;  2V1X A;  4L9V A;  5LRS A;  4P96 A;  2O0Y A;  3GF2 A;  4L9N A;  5HS7 A;  2ISZ A;  5FB2 A;  5JFR A;  2RDP A;  1T39 A;  2B0L A;  3FMS A;  2VE8 A;  3C1D A;  1LQ1 A;  2GXB A;  1B9N A;  2EFP A;  2KIM A;  4A0Y A;  3WTU C;  3KFW X;  1U5T A;  3KZY A;  1O7L A;  3K1P A;  1W7P A;  2DLL A;  1L0O C;  4D0P A;  2KIF A;  5D6E A;  5E18 F;  2YX4 A;  3VB2 A;  4O6J A;  1IXS B;  4BAY A;  2MLG A;  1QGP A;  3F21 A;  3J81 K;  4EJW A;  1QPM A;  2V9V A;  4CZZ A;  3KZZ A;  1ZRD A;  2XGX A;  1FX7 A;  1HBX G;  1RI7 A;  2EA2 A;  4FX0 A;  3MQ0 A;  3H92 A;  2H27 A;  3U9G A;  5E8I A;  4KN7 X;  1R58 A;  4N0B A;  3R0A A;  2STW A;  2PEX A;  1L3L A;  3DV8 A;  5HDG A;  5ICF A;  2QYO A;  4N9I A;  1LB2 A;  1KGS A;  2MLK A;  2RQP A;  4IF4 A;  4YFX F;  2MA3 A;  3NEU A;  1REP C;  1FNN A;  1BJA A;  4PZJ A;  3ZMV A;  2X4H A;  2TDX A;  1LNW A;  2PMU A;  2STT A;  2A3S A;  3J81 Z;  1D3Y A;  4XLP F;  1BC7 C;  1P4X A;  4BXU A;  2DTR A;  2IJL A;  2ZCW A;  3ABU A;  2V1D A;  5E17 F;  3CUQ A;  3WGG A;  3KET A;  4TV7 A;  4ETS A;  4I02 A;  4JK1 X;  4MNU A;  2F5E A;  3RPU A;  1WRJ A;  1W5T A;  3ZN1 A;  3JAM Z;  2K86 A;  2A61 A;  2P5K A;  1O3R A;  2LF7 A;  4A0X A;  2AS5 F;  5AIP A;  4ZYD A;  1PP7 U;  4S04 A;  3QOP A;  4LFU A;  3GFL A;  2E7W A;  2FXA A;  2FQ3 A;  1Y0U A;  2VBZ A;  3P9I A;  1BM9 A;  4RGU A;  3PQJ A;  4F7Z A;  1SFX A;  1T2K A;  4HF2 A;  3S2W A;  3TO6 A;  5KVR A;  1B6A A;  3WG9 A;  2DPD A;  1U5T B;  4UVA A;  1V3F A;  1Z6R A;  1RIO H;  1S6L A;  2DI3 A;  4GXO A;  2P6S A;  2FBK A;  1S7A A;  2XAH A;  4LJZ F;  5DV5 A;  1H9T A;  2FML A;  3WTV C;  3BRO A;  1E2X A;  2DT5 A;  1W7P D;  2K7L A;  3MEX A;  3DQV C;  4NQW A;  1LDD A;  3HHG A;  2L02 A;  3D0S A;  4ZYH A;  4KMU X;  3F72 A;  1SMT A;  2DFI A;  1RUO A;  3JSP A;  1I1G A;  5FLX Z;  5LEJ A;  3PQK A;  3V8J A;  1B59 A;  3T8T A;  1R1V A;  3RYP A;  3IRR A;  5HLH A;  1ZLK A;  1MDM B;  5F6F A;  5CJ9 A;  5BPI A;  4AIJ A;  1K7A A;  3Q9V A;  2IPQ X;  1D8J A;  4IRG A;  4EGZ A;  1SAX A;  2H09 A;  1TW2 A;  2ETH A;  1ZN2 A;  5TRD A;  2FEZ A;  1R1T A;  2WWY A;  4A0Z A;  4P55 A;  1BIA A;  4EJT A;  1J75 A;  2XVC A;  4IHT A;  2A6E F;  1UFM A;  2MD5 A;  2VC0 A;  2VN2 A;  1Z7U A;  1GHC A;  3RI4 A;  2P8T A;  5IT9 Z;  3GXO A;  4A6E A;  1J7K A;  4A6D A;  2YR2 A;  3FZV A;  1LDK B;  4WK8 F;  3DEU A;  2CW0 F;  2R7F A;  1O3S A;  2UXX A;  3LA2 A;  5FD5 A;  1R7J A;  3J80 K;  2GIV A;  2LNB A;  2HR3 A;  5DYM A;  3EET A;  3MFK A;  4U7B A;  4XBF A;  2P7C B;  4EM2 A;  2VOP A;  1XGS A;  4RGR A;  1SD5 A;  5CVJ A;  4BHC A;  5K5R A;  2P4W A;  2G9W A;  2FNA A;  3JTH A;  3BJ6 A;  2XAS A;  2FE3 A;  4KYW A;  1UCR A;  3B73 A;  1YS6 A;  1WKM A;  2IW5 A;  2BE5 F;  4UVB A;  1R1U A;  3FM5 A;  3F6V A;  2DK5 A;  4LG0 B;  1B1B A;  3I58 A;  1IXC A;  1P4A A;  4G7H F;  4MTE A;  3TKY A;  1EH8 A;  4FHT A;  4A12 A;  1FOK A;  3LQR A;  1ULY A;  2Q8K A;  1LDJ A;  2PBI A;  1UHW A;  2L4A A;  2UWM A;  1VTN C;  5EEH A;  4ESB A;  1J5Y A;  3MAJ A;  2QQ9 A;  1XCV A;  2H94 A;  3JTG A;  3R6S A;  3HIF A;  2JRT A;  4M6X A;  3E5U A;  5HS8 A;  3W6J B;  5LBQ A;  2VOD A;  3DPL C;  4HDV A;  1EH6 A;  2RKH A;  1STZ A;  2GA2 A;  1YW9 A;  1AOY A;  2HFH A;  1WQ2 A;  1B9M A;  1BBY A;  3F8F A;  5DCF A;  1I27 A;  1W4M A;  1GXP A;  4UXN A;  1U3E M;  4LMY A;  3QAH A;  2XRO A;  2M30 A;  2EFQ A;  4YFK F;  4KIG A;  1V4R A;  4OIR F;  3U2R A;  5HLG A;  1XDU A;  1G4D A;  3V8K A;  1FP2 A;  5D4R A;  1UST A;  1FT9 A;  2DQL A;  4PGH A;  3HYI A;  4M74 A;  2HTJ A;  3HUG A;  1OYY A;  1KYW A;  1U5T C;  1EH7 A;  3FXU A;  5DEQ A;  1ON2 A;  3EQL F;  1XMK A;  3T0Y A;  3MZH A;  1MKM A;  1Q1H A;  1U6G A;  3E6B A;  4UV8 A;  1J9I A;  3ZMT A;  2EWN A;  2QBY B;  4B09 A;  4O5V A;  4P5O A;  3K69 A;  5DUK A;  2JPB A;  3KE2 A;  2HEO A;  1YFH A;  3QP5 A;  4KUM A;  2QEN A;  4BYY A;  1R00 A;  2HQR A;  4M73 A;  4I7H A;  3N4M A;  3IKV A;  1R36 A;  4I09 A;  1ZHF A;  2XKP A;  4RB1 A;  4CHU A;  3FMR A;  3GZ5 A;  3KLN A;  5FO5 A;  5HVQ C;  3P9K A;  1FYL A;  5BS6 A;  5FFX A;  3WGI A;  1F9N A;  1DP7 P;  5BMZ A;  1W5S A;  2VXZ A;  5E1X A;  2D1V A;  4AD9 A;  2ZXJ A;  2EV6 A;  1ZYR F;  1XDS A;  5D5X B;  2O6G E;  4HAM A;  2CO5 A;  2KRF A;  1K79 A;  3K2Z A;  3HRU A;  3E3V A;  2Y0M A;  1LEB A;  2Z9O A;  1G3W A;  2OQR A;  4Y17 A;  4RGS A;  3HOT A;  4LB6 B;  1YW7 A;  2JT1 A;  4Z2Y A;  2M8E A;  2QM3 A;  4XSZ F;  3ABT A;  2EV0 A;  2OZ6 A;  5L3C A;  4UHT A;  5L3F A;  4JBA A;  2K4J A;  4HYE A;  2EV5 A;  4K2E A;  3C18 A;  1YW8 A;  5AON A;  1BOA A;  5L3G A;  3I0T A;  2J5P A;  1SD4 A;  3FWE A;  2ACJ A;  5JHU A;  2XUB A;  4MEY F;  2L54 A;  5ILU A;  2Y75 A;  4OIN F;  3N97 A;  2C6Y A;  3DXJ F;  2RN7 A;  1P6R A;  3H3Z A;  2LKP A;  1T38 A;  1UHM A;  3TQN A;  2LSO A;  2ELH A;  3WTZ A;  1CGP A;  1FSE A;  2MH2 A;  4HDU A;  5KK1 A;  2HYG D;  3O3K A;  4ENM A;  2XIG A;  3B02 A;  2HWV A;  1IN6 A;  3M1E A;  1TW3 A;  3WE2 A;  4U0V A;  1ZRC A;  2QBY A;  1QZZ A;  2BGC A;  3ECO A;  2UZK A;  1MZB A;  2K27 A;  1HQC A;  1RZ4 A;  3EDP A;  2Q2E A;  4LK0 F;  2W84 A;  1CF7 B;  2E1N A;  4OOI A;  2CWE A;  4L9T A;  3WOD F;  1QNT A;  5LHH A;  1T6S A;  2XHK A;  1U2W A;  2FSW A;  3WTX C;  3JW4 A;  2ZO4 A;  4XSX F;  2V1U A;  4UUV A;  4FX4 A;  3BP8 A;  4KA4 A;  2NYX A;  3HRT A;  3RYR A;  4OMY A;  1SMY F;  2PLY A;  3E97 A;  1XGO A;  4AIK A;  4A5M A;  2J5O A;  3R61 A;  1ZRE A;  5LRR A;  2M5W A;  2MC3 A;  4U0W A;  3I5U A;  1XB4 A;  2HKO A;  2OD5 A;  3O6B B;  2W57 A;  4Y13 A;  2FF4 A;  3REO A;  1KQ9 A;  3ML6 A;  4ZZL A;  4JQF A;  5A2Q K;  2NNN A;  1J59 A;  2MBF A;  4ON0 A;  4BHP A;  4EMS A;  3DF8 A;  2P6T A;  3K0L A;  5JVT A;  5AIQ A;  4MGR A;  1ZH5 A;  5D8L B;  1NHA A;  4FT8 A;  2VBY A;  5D6F A;  5DUI A;  1J2X A;  1IW7 F;  3T5X A;  2KKO A;  3E6M A;  3ZMU A;  1HSJ A;  1FBS A;  5BPD A;  3IWZ A;  4KIC A;  1TBX A;  2QUF A;  3RKY A;  2HZT A;  2VBW A;  4HLY A;  1ON1 A;  3F8C A;  3K9T A;  2JSC A;  2ZJ2 A;  1FWZ A;  1T0F A;  4ESF A;  3GWZ A;  3GFJ A;  1ZG3 A;  2LDU A;  2OZU A;  4N9H A;  1ZGA A;  2RVC A;  4HX4 A;  2GZW A;  2DW4 A;  2M1B A;  4LG0 A;  4HX8 A;  1YQA A;  3P7N A;  1FBQ A;  3CTA A;  4ESJ A;  1G3Y A;  2F5F A;  3C7J A;  3CUO A;  1BI0 A;  5DD4 A;  2O3F A;  2ZNZ A;  1S8N A;  1R22 A;  1QO0 D;  4L9J A;  2PJP A;  4U0Y A;  2DK8 A;  3BZ6 A;  1O3T A;  1DUX C;  1PUE E;  1YIO A;  1IN8 A;  1FPQ A;  4Q48 A;  1FZP B;  3RJP A;  3SZP A;  1IN5 A;  3F8B A;  3QRF F;  1JGS A;  2Z33 A;  3PFI A;  4GGG A;  2IT0 A;  1XD7 A;  3CO6 C;  3VFZ A;  2VC1 A;  1OYW A;  2O61 A;  5ERI A;  4MQV A;  5LHI A;  1ZAO A;  4I2O A;  5CVU A;  3KP5 A;  1F1Z A;  4YFN F;  4GO1 A;  4PDK A;  4XLN F;  2L4M A;  3QPT A;  3K1M A;  3L2C A;  2JPC A;  5K5Q A;  3EYY A;  3Q5F A;  2D2W A;  1D5V A;  4EVI A;  2QLZ A;  3GW2 A;  5D5U B;  2HGC A;  3IL2 A;  2A5Y B;  3FHZ A;  3CJN A;  4OMZ A;  1KYZ A;  2O03 A;  1I5Z A;  2IA0 A;  3KP6 A;  1TQP A;  4HQE A;  1LVA A;  1J0R A;  2KJB A;  1KU2 A;  4IRI A;  2JZY A;  4Q4Z F;  4ASN A;  3GUD A;  4KFC A;  3IRQ A;  4YIF A;  3I71 A;  5FD6 A;  5L3E A;  1IXR C;  5DD8 A;  1G6N A;  5LHG A;  5D4S A;  5LGT A;  1MJ9 A;  1K6O A;  1KU7 A;  4DQ2 A;  3ECH A;  3C3W A;  1KU9 A;  3L00 A;  3LA3 A;  4M71 A;  4U7D A;  1H0M A;  4QLC U;  1P92 A;  3WTY C;  3NQO A;  2G7U A;  1S29 A;  5FFZ A;  5D8K B;  2X0L A;  3V4G A;  1U78 A;  1GVJ A;  1R23 A;  2NRA C;  1BI3 A;  2OQG A;  1W7P B;  4LLL A;  3V7S A;  1HKS A;  2O8X A;  1HW5 A;  5IT3 A;  2XV4 S;  3MCZ A;  5BQT A;  3RKW A;  3HSE A;  3COA C;  3J80 Z;  4B8X A;  1S3J A;  1OPC A;  3H3U A;  3G3Z A;  2D45 A;  3TOA A;  4KIF A; 
#chains in the Genus database with same CATH topology
 1JE8 A;  3AL0 C;  2FUG 2;  3KEQ A;  1IN7 A;  1ZEL A;  3I55 I;  1RKW A;  5BNG A;  4ZYG A;  1TWC J;  2EH3 A;  3FXK A;  3M3Y J;  2OA4 A;  4IHY A;  3HB9 A;  5EGO A;  5GP9 A;  3U1K A;  4ZZD A;  4G8X A;  2L7F P;  5EGO B;  3E7L A;  2OAZ A;  3AG2 H;  1HCR A;  1O57 A;  3QOE A;  3SDG A;  2CGP A;  2G7H A;  2XPV A;  1A6Q A;  1XGN A;  3CQZ J;  1DGR M;  3GFI A;  3CCR I;  2NS0 A;  3OYE A;  1P7J A;  3R0J A;  4M72 A;  3OYJ A;  1LVK A;  2DJI A;  1Z6T A;  1ETO A;  2LF8 A;  2NVT J;  1BIB A;  1WWX A;  2P7V B;  2XAQ A;  4XK4 A;  3MKY B;  4L0Z B;  1X3W B;  2QVO A;  1NTC A;  2IP2 A;  3CLO A;  4HNT A;  4E7H A;  1C0W A;  1YX5 A;  3F8N A;  2MFZ A;  3SZT A;  4UUS B;  3RIR A;  4ENK A;  3BOQ A;  1RPW A;  3IH2 A;  4A3K J;  3OS1 A;  1YTY A;  4R79 A;  3BJA A;  3OYK A;  1BN5 A;  2E34 A;  1DDN A;  2R3S A;  3I56 I;  2A05 A;  4XL9 A;  3PL8 A;  1ORK A;  3OYD A;  2HI3 A;  5IPA A;  1H89 C;  4E7L A;  4BQA A;  3S2D J;  4LLN A;  2XAF A;  3K10 A;  5C4J J;  1ZQ3 P;  2Q0O A;  4I0A A;  1TT0 A;  3PNV A;  4G6T B;  1YLF A;  1A31 A;  2L9R A;  3ELK A;  2GBY A;  2EIK H;  1AWC A;  2IXS A;  4HV5 A;  3ERM A;  3F3X A;  4EV0 A;  4CXF A;  4P9F A;  3F8M A;  3W2W A;  1TQM A;  2WAQ N;  4U87 A;  2YU3 A;  2GOX B;  2HVQ A;  2XGD A;  2W85 A;  4YIR X;  2ESN A;  1MJA A;  3BG6 A;  2FNP A;  4EM0 B;  1BR1 A;  1ZLJ A;  4PJJ A;  3OYA A;  3ZMZ A;  1NG6 A;  3IV5 A;  3E0J B;  1HXD A;  2NOJ B;  2QQA A;  5D5V B;  3CJQ B;  3GO5 A;  2K4B A;  4PCQ A;  2ZFW A;  2DOE A;  2DT6 A;  2OTL I;  4HST A;  2ZME B;  4JP0 A;  4RB3 C;  3H9J A;  1SFE A;  3PO2 J;  4Q47 A;  1MD0 A;  1WI9 A;  2WA0 A;  2H6B A;  5GAE J;  1RR8 C;  2JWT A;  1BC8 C;  5IP6 A;  3SHF A;  4BE2 A;  5FLX K;  1F36 A;  4ENN A;  2DA5 A;  4DZP A;  2BBY A;  2Z5U A;  3HHH A;  3SEQ A;  6PAX A;  3F22 A;  2D1H A;  1QQI A;  3KP4 A;  3TP3 A;  1IUF A;  3JR9 A;  1IJW C;  3RPU D;  5EJC A;  3WGH A;  1OKR A;  3CO7 C;  1XN7 A;  3BG7 A;  3E5X A;  3QU3 A;  2VBX A;  3BWG A;  5CQG A;  1KU3 A;  2CU7 A;  1HLV A;  3CC7 I;  3M8E A;  1JKO C;  4KT5 C;  3TO7 A;  1R5H A;  2CQN A;  2CV1 A;  1PP8 F;  1HST A;  2VLA A;  5EDN A;  3HRS A;  1A6I A;  1TZL A;  5KAF C;  1O4X A;  4IJA A;  1USS A;  2GAU A;  3PIP F;  1E17 A;  1OCT C;  3LSH A;  1G3S A;  3CF2 A;  2CSO A;  3GLX A;  3UNG C;  5LGN A;  1W36 C;  2ZXW H;  2DAO A;  5HS9 A;  3FMQ A;  3G1M A;  5J8F A;  3E6D A;  4BEH A;  2FBH A;  4CO8 A;  1CF7 A;  2DCE A;  4A3J J;  2GA1 A;  1HW1 A;  5H20 A;  2DA1 A;  3NWS A;  1U9O A;  2R7X A;  2XPW A;  3LOC A;  2QGU A;  3RQI A;  1FLI A;  1WSU A;  3D5S C;  4CCM A;  1CQT A;  3CP2 A;  1H9T A;  5DCM A;  1ETQ A;  2R92 J;  4IVN A;  1YE9 A;  3ZN0 A;  2O7O A;  3P9C A;  4IXA A;  1GXQ A;  2V79 A;  2FU4 A;  1FYM A;  5ILS A;  3SQN A;  2WB1 A;  1R4M B;  2PG4 A;  4IOA F;  2QQ8 A;  3PIO F;  5E79 C;  1KA8 A;  1Y8Q B;  2Z2S B;  4HV6 A;  3OMY A;  1FIP A;  3S14 J;  2ECB A;  5HDK A;  5J1R A;  1SFU A;  3KLO A;  2K3P A;  3TDU C;  3Q0W A;  3S3N A;  1BI1 A;  4WF2 A;  1ZR4 A;  3SYT A;  2QZ8 A;  4Y15 A;  3VPR A;  1IF1 A;  1V55 H;  2EFO A;  3BG5 A;  4LB5 A;  3HOU J;  1UMQ A;  1FTZ A;  3V7R A;  1IUY A;  5E1Z B;  2HDC A;  3ZQG A;  2FOK A;  1D1C A;  4G6D A;  3LSR A;  1K61 A;  2JTV A;  4OIO F;  4MIM A;  3HSF A;  1SAN A;  2CUZ A;  1IRF A;  3ERE D;  3ESW B;  4KIB A;  2F5D A;  2ICW G;  3DPU A;  5ED4 A;  3AL0 B;  2PQ8 A;  1Y1V J;  1QZE A;  3WG7 H;  4RS8 A;  4AVP A;  1MMA A;  2CRG A;  2YS9 A;  2E1O A;  1SD6 A;  4XRF A;  2XRL A;  4Y52 J;  2XKO A;  3OYB A;  3BR2 A;  3ULQ B;  1MMN A;  1KQ8 A;  4IRH A;  4QWQ A;  5HLI A;  2H1L A;  2ZSH B;  2W7N A;  3FF5 A;  2LBF B;  5M3F J;  4RAZ A;  2OPT A;  1KON A;  1RRJ A;  5E20 A;  4IL6 C;  1TWF J;  1MNM C;  2A6H F;  1VI0 A;  3WHC A;  4D7M A;  4MHG A;  4EM1 A;  3DEE A;  2RV8 A;  3G1O A;  4AID A;  4MTD A;  1Y0N A;  5KAI C;  3DP7 A;  4R8H A;  1U8R A;  1ZR2 A;  4I98 B;  3H0D A;  3G73 A;  1MJB A;  2VQH A;  3NAR A;  3V42 A;  4II3 A;  3R60 A;  3RSN A;  4UB8 C;  3J7A O;  4JX4 A;  1XSX A;  5L3D A;  2P81 A;  1MMD A;  2EB7 A;  1WGX A;  5JI6 A;  3AG3 H;  1H8A C;  1RES A;  4A3M J;  1KZH A;  2PMZ A;  4MEX F;  3K2A A;  5EG0 B;  4A3G J;  3T1B A;  4Y3O A;  2K9N A;  4EQQ A;  4PSW A;  1FP1 D;  3GTQ J;  5DTD A;  2BY2 A;  3A2K A;  5JHF A;  1MMS A;  2R7R A;  1IAW A;  2D5V A;  4M9S A;  2WTE A;  2WV0 A;  3H5R A;  3I53 A;  1SVL A;  3QPL A;  4UVC A;  3U1D A;  1DPU A;  1VND A;  3FM3 A;  5HDN A;  2YPR A;  4ZDO A;  3CUQ B;  4R1H A;  1Z67 A;  1ETW A;  4MQ9 F;  3B6A A;  3OOP A;  2LK2 A;  2CFX A;  4BHB A;  3KYC B;  3I59 B;  5ICG A;  5C4X J;  2W82 A;  5FKL A;  1HW2 A;  3I59 A;  1A04 A;  4CGZ A;  3K7A J;  4P9U A;  3GFM A;  3DFG A;  2E2I J;  2VT2 A;  4W97 A;  1I6X A;  4YII A;  3JRH A;  1DPR A;  3D5L A;  3HKZ A;  3KEO A;  2RAE A;  3OL3 A;  1OMI A;  3ISP A;  3EYI A;  4NBQ A;  1HC8 A;  1YG2 A;  3HSR A;  3KYL A;  3CMA I;  1TTY A;  2L3D A;  2IGN A;  2OF7 A;  3J7A Y;  3TW7 A;  2HZD A;  2ECC A;  1MDM A;  1IN4 A;  2K9Q A;  4H0E A;  1EV7 A;  3I4M J;  2FBI A;  5FGM A;  1K78 B;  4E7I A;  3K70 C;  4KN4 X;  2VKD A;  1GUU A;  3C2G A;  3GTM J;  2JVG A;  3IWF A;  2FA5 A;  3L09 A;  5B3S H;  2VON A;  3SFZ A;  4ZDP A;  2Z3Y A;  2IEK A;  1YJ9 I;  4II2 A;  4WWC A;  1R9T J;  3JCU C;  2GXA A;  3S1N J;  2HTS A;  1O7F A;  1X1P A;  4IKF A;  5ICC A;  2AHQ A;  4M6Y A;  3S8P A;  2L2O A;  4LGW A;  4I01 A;  4CIC A;  5L3B A;  3LQQ A;  5H2F C;  1DQU A;  3RTR A;  2BY0 A;  3JAM K;  1BA5 A;  2I10 A;  2X48 A;  3CCU I;  2EA4 A;  4BUP A;  2IS2 A;  4ZJZ A;  2KQR A;  3CDH A;  4HF0 A;  3K4N A;  2K40 A;  1J09 A;  3IP4 B;  1X19 A;  2CH0 A;  1BW6 A;  2DDB A;  4XLC A;  3K70 D;  2WC2 A;  2XRN A;  4CUG A;  3CDL A;  5JLX A;  4HBL A;  5DS9 A;  1VQL I;  1T98 A;  4I6Z A;  5IT9 K;  3VOE A;  3HOZ J;  1QZY A;  4RDU A;  1Y56 A;  4BDY A;  2KRC A;  2HPM A;  2PFB A;  2EBI A;  3DLL F;  4WXC A;  4WCG A;  2OBP A;  3HTS B;  3S17 J;  3FBI B;  1ONV A;  2NS8 A;  4OIQ F;  2YSR A;  1S7O A;  4BBR J;  1XSD A;  3ROU A;  1FBU A;  3A02 A;  2OU2 A;  4RGX A;  2KJC A;  4CCK A;  2MH9 A;  2IA2 A;  2DJN A;  5TGT A;  4IPA A;  2GWR A;  2EZL A;  2QCO A;  1MBG A;  4Y7N J;  3HOV J;  3SXY A;  4IHS A;  4AC0 A;  5K1Y A;  2LVS A;  4A2U A;  1HDD C;  2K5C A;  4OU0 A;  2XB0 X;  3C2H A;  2QSF X;  3LFK A;  3NAU A;  4I76 A;  4HF1 A;  1VFC A;  1VQ6 I;  2V6C A;  3LNQ A;  4PGG A;  2PI0 A;  4HZF A;  3LAJ A;  3IH4 A;  1POG A;  4ZYE A;  2VXD A;  1JUP A;  2GXG A;  4RAY A;  4E70 A;  1K6Y A;  5LEK A;  4FET A;  2VJ4 A;  4CYC B;  2BW3 B;  2OJE D;  4BS9 A;  1HF0 A;  1Z1D A;  5J8C A;  2EFW A;  3KX2 A;  3TOB A;  2WV1 A;  1H9G A;  3NWT A;  4HA8 A;  4IQJ A;  4OIP F;  1W0T A;  2KP6 A;  3BPV A;  1MGT A;  5H6R A;  1PDN C;  4BXX J;  3CCV I;  4C2M J;  1YIJ I;  1XCB A;  3ABK H;  5LLQ A;  9ANT A;  1QBJ A;  4XN3 A;  2MGQ A;  2R0Q C;  1Z9C A;  4L18 B;  3BCA A;  1P7I A;  4G94 A;  5C3E J;  4FQG A;  1Z0X A;  3ZQH A;  2HVS A;  4UV9 A;  1WHU A;  2HQN A;  4LLG F;  3ABM H;  4QIW N;  2CQQ A;  4EJO A;  2A68 F;  2CYY A;  2F4M B;  3CD6 I;  3O2P E;  2M87 A;  1RUN A;  3GZ6 A;  4A3L J;  4XOT A;  3QPH A;  3RDI A;  3SDB A;  1MNE A;  4G7O F;  2NAZ A;  3FX3 A;  1D8K A;  3Q0U A;  1X4O A;  3VEP A;  1U0J A;  4GYI A;  3ZMS A;  3MKW B;  1Z91 A;  1RET A;  3WTT C;  3KCC A;  2EIM H;  3I64 A;  2ZNY A;  1A36 A;  2KIU A;  5JVG F;  1F5T A;  2YX7 A;  1TQI A;  2ADU A;  2DMP A;  3M7G A;  3QQA A;  4DBQ A;  4X6A J;  2FMY A;  3T8R A;  3CMM A;  4BKX A;  2PMH A;  4DIQ A;  3W2A A;  2E36 A;  1RNL A;  1NK2 P;  1ZAR A;  4WXH A;  2K9S A;  4M6V A;  5CVV A;  4Q5S F;  2HOA A;  2R7S A;  4E7K A;  1GLN A;  2JA2 A;  4JX6 A;  1WCM J;  3QP6 A;  2FQ4 A;  5K7H A;  1WH7 A;  2XAU A;  1QVT A;  1B4A A;  1B8I B;  3CUQ C;  2DQR A;  3WHB A;  2LTP A;  4M9Z A;  1YI2 I;  1EA3 A;  4EJU A;  3UKG A;  2XF5 A;  1VQ4 I;  5EEG A;  3QWL A;  5DDG A;  1EJ9 A;  4HRI A;  1X3U A;  2XF6 A;  4A93 J;  4KJZ A;  2F2E A;  3KP2 A;  3CC2 I;  2CS3 A;  3CCQ I;  2P5L C;  3J7Y J;  2IA1 A;  3DBR B;  3MZY A;  2R7T A;  2R5Y A;  2AXL A;  3IC7 A;  1ETK A;  5LGU A;  1JHF A;  1UEL B;  1WFX A;  3IHU A;  3BPX A;  1AU7 A;  3QYB A;  4GCV A;  2R7U A;  3SZG A;  1OR7 A;  2OCC H;  4I0B A;  1ZRF A;  5E8G A;  3HZJ A;  4NC6 A;  3VOD A;  2DFE A;  3HEF A;  2OCE A;  3L9F A;  5J6X A;  3BR6 A;  1P2F A;  5EG0 A;  4XLH A;  2V4J C;  3K4C A;  3WU0 A;  4UNO A;  1Z05 A;  1DGW Y;  3LSG A;  2DOD A;  3V7C A;  2QQB A;  5CKT A;  5ICE A;  3MKL A;  1MBE A;  4HQM A;  3TDZ C;  3PJR A;  4HNU A;  4KNY A;  2HVR A;  5GAG J;  4EGY A;  3QU6 A;  5J40 A;  2IRF G;  4U88 A;  1JT0 A;  3L2V A;  1K78 A;  4RM3 A;  4DW6 A;  3M8F A;  4RAF A;  2M3A A;  5F1R A;  3L2R A;  3WE3 A;  3PUB A;  3CCL I;  4KMF A;  4XRM A;  2XAJ A;  2EQR A;  5JR3 A;  5ILV A;  4MFD A;  2PJR B;  5BOX A;  4I99 C;  1BI2 A;  2JK3 A;  1MBH A;  2B9S A;  2H6C A;  2W25 A;  2PMZ N;  2CG4 A;  4M9X A;  1ODD A;  2GOM A;  2HOE A;  3BDD A;  3LA7 A;  2DPU A;  2VOO A;  5TJJ A;  1TP4 A;  3BG9 A;  5E1W A;  1JHH A;  2IS6 A;  1JTX A;  3OV8 A;  2Q2E B;  1OYI A;  4RAG A;  4G7Z F;  2KL4 A;  1LFP A;  2BW3 A;  4YG2 F;  3ZP5 A;  2ZJP F;  2Y48 A;  4B47 A;  4LIV A;  2MYS A;  1OQY A;  2K02 A;  5CVI A;  1JUM A;  4BQO A;  1TNS A;  2DBB A;  2TRT A;  2BEO A;  3K1N A;  2A69 F;  1VQP I;  3I4P A;  3NRV A;  2I5U A;  4MFE A;  4C3J J;  4PSX A;  1JKQ C;  5DCM B;  4ENJ A;  3ZMD A;  1XMX A;  5A2Q Z;  3BJO A;  2E1M B;  2GQQ A;  4JOM A;  1IDZ A;  2ZB9 A;  3ZQ7 A;  2WY8 Q;  4WXD A;  3JRD A;  3CCS I;  5CVR A;  2HYF A;  3BR3 A;  3OR2 C;  1WJ5 A;  3VYR B;  4V2G A;  2M45 A;  4CYD A;  3GYH X;  4HOB A;  1IC8 A;  3KP3 A;  1F4K A;  1NK3 P;  2QWW A;  1LEA A;  4QTR A;  1IRG A;  2VT3 A;  2X51 A;  3PM1 A;  3RKX A;  2BXY A;  4YRV A;  4ANJ A;  1LE8 B;  1UAA A;  3RPQ A;  2Z99 A;  1GV2 A;  3BY6 A;  4A3B J;  2EIJ H;  3TGN A;  3E6C C;  2DA4 A;  3HL2 A;  3Q9S A;  3DBH B;  4ZTF A;  1ZG1 A;  2E60 A;  1T0F C;  4P1W A;  2ZKZ A;  3DPT A;  2X9D A;  3M9A A;  1MW7 A;  1ZGJ A;  5GAH J;  2KIS A;  3LAP A;  4G9Y A;  1FY7 A;  1ZTR A;  2E5N A;  2X6X A;  1SD7 A;  2NVQ J;  1E3P A;  2XPU A;  4G6Q A;  1W36 D;  4CCL A;  1ZG5 A;  5B66 C;  2B7E A;  2RC4 A;  4LK1 F;  1UB9 A;  2M0M A;  3DKW A;  3GVA A;  4A69 C;  4NHJ A;  5F64 A;  4F92 B;  1G3T A;  2CQK A;  3AG1 H;  3JRF A;  3ZPL A;  1FOW A;  4EJV A;  4E7J A;  5K7F A;  1D1A A;  4RB2 C;  3KP7 A;  5K5O A;  4FAS D;  1P4W A;  4A3C J;  4ZDL A;  1QVU A;  1KQ0 A;  3TO9 A;  4HW0 A;  2PN6 A;  3GX4 X;  3LWF A;  3DU6 A;  2H1K A;  3CZ6 A;  3HTU A;  2E35 A;  4C2T A;  2TCT A;  1FOX A;  2BV6 A;  3FXR A;  3VDX A;  3K4L A;  1XMA A;  3A0B C;  4WX9 A;  4BL0 B;  4Y33 A;  2WAQ A;  2IGK A;  3ASO H;  3HOW J;  4AIH A;  2DDA A;  3ZGK A;  5H6Q A;  3ZQQ A;  2VE9 A;  2L01 A;  2FRH A;  3M4O J;  3EPZ A;  4IHW A;  5GPA A;  1X3Z B;  2E1C A;  3MWM A;  4L5I A;  1BL0 A;  4BNC A;  2UXN A;  3JRG A;  2LP0 A;  5F1J A;  1YYV A;  2W24 A;  1PUF B;  1LFB A;  3GME A;  4AWX B;  2RNJ A;  4F52 A;  3H0G J;  4D5F A;  4LD5 A;  5CYV A;  2KPM A;  1FTT A;  1YS7 A;  1XS9 A;  2ESH A;  1JGG A;  3ZQF A;  1R5G A;  1XGM A;  2FOW A;  2E2J J;  1Y39 A;  3F6O A;  4NC8 A;  3I54 A;  3PNT A;  5M3M J;  2JUC A;  3HRM A;  1H88 C;  3VSL A;  3WU1 B;  2L5Q A;  1X1B A;  1X1A A;  5IYB J;  2DFF A;  1XSV A;  5HOO A;  4L0Y B;  3J7Z I;  4S05 A;  2BY3 A;  3WTS C;  5FKO A;  3OYF A;  3W6K B;  4KDP A;  3GEZ A;  3H5N A;  3JSO A;  2BYV E;  3BQZ A;  4PFO A;  2LG4 A;  2M8G X;  4CDG A;  2V9K A;  2NNY A;  3CCJ I;  4GYG A;  2HS5 A;  3OS2 A;  1FC3 A;  2JQ7 A;  2MW8 A;  3OY9 A;  3V8L A;  4ZC3 A;  2LY9 A;  1IRZ A;  1OFC X;  2R7D A;  1I1S A;  1TLH B;  1MH3 A;  2EK5 A;  1HKQ A;  1T33 A;  3HOS A;  3E5Q A;  2IVM A;  2EJR A;  4NB5 A;  2A07 F;  3SFI A;  1U9N A;  3KIO A;  3TMO A;  2LKX A;  1LJ9 A;  2DXI A;  1IZ1 A;  2RGV A;  1OCP A;  1M1E B;  4Y4R A;  4YEJ A;  4DNC A;  2E7X A;  3ZXS A;  5CLS A;  4HPQ A;  5F08 A;  3LST A;  1X4P A;  2WY7 Q;  1JT6 A;  2CW7 A;  2MG4 A;  2F5C A;  5D5W B;  4XLE A;  2EZK A;  3G1L A;  2ISY A;  3OYG A;  2O8K A;  1FSH A;  1O3Q A;  4HX7 A;  1PVE A;  4HLX A;  2DO7 A;  4L5J A;  4BH9 A;  4E7S A;  2DMQ A;  1JXS A;  3FK7 A;  2NVU B;  4A5N A;  4RB0 A;  1HKT A;  2CUF A;  1FYK A;  2COM A;  2WBM A;  3DBL B;  2EFN A;  1QA6 A;  1YO5 C;  3IKT A;  3L7W A;  3MKZ A;  2HKX A;  2HXI A;  2OV7 A;  2ZBK A;  4DOZ A;  2ZME A;  2YUS A;  2LD5 A;  1TNT A;  3WTW C;  2P5V A;  4J00 A;  3F23 A;  1UG0 A;  1JI8 A;  3FXQ A;  2JA7 J;  1Q1V A;  3GBG A;  3R4K A;  2DU9 A;  3AAF A;  2VKE A;  2XAG A;  4HEA 2;  4ZH4 F;  1S72 I;  4O3M A;  3EUH A;  4KIT B;  2V1X A;  1VQ8 I;  3BT9 A;  1D0Z A;  4L9V A;  5IY5 H;  2CV2 A;  1VZ0 A;  5LRS A;  4P96 A;  2O0Y A;  3GF2 A;  1G2H A;  4L9N A;  2VIX A;  2EIL H;  5HS7 A;  3G4S I;  5DM7 F;  1YIT I;  4H4K C;  2ISZ A;  3FK6 A;  4LIU A;  1I50 J;  1Z3Y A;  3MD2 A;  5FB2 A;  5LD2 C;  5JFR A;  2DT7 B;  1QHH D;  1R4N B;  2RDP A;  1T39 A;  2B0L A;  3FMS A;  4JYK A;  1UJ8 A;  1MMG A;  2VE8 A;  2KDZ A;  3C1D A;  3F9K A;  1LQ1 A;  1AA7 A;  2GXB A;  1B9N A;  2EFP A;  2E1M C;  2KIM A;  4A0Y A;  4CCN A;  3WTU C;  2LRE A;  1ETX A;  2BY1 A;  2KMU A;  3KFW X;  5FKM A;  2OTJ I;  1U5T A;  3KZY A;  3BC8 A;  1O7L A;  3K1P A;  1W7P A;  2E19 A;  4KIF A;  2DLL A;  2F4O B;  1L0O C;  4D0P A;  2KIF A;  2VKH A;  3A01 B;  2JSP A;  1D1B A;  5D6E A;  5E18 F;  2YX4 A;  3VB2 A;  4M3E A;  5F04 A;  2MSY A;  3H5A A;  4O6J A;  1R49 A;  3EUA A;  1IXS B;  4BAY A;  1Y1W J;  2MLG A;  1TWA J;  1QGP A;  3F21 A;  3J81 K;  4EJW A;  1QPM A;  2E71 A;  2V9V A;  4IHX A;  2BHY A;  2Y9Y A;  4XNF A;  4CZZ A;  2AQE A;  3KZZ A;  1ZRD A;  2XGX A;  1FX7 A;  1HBX G;  1BW5 A;  1RI7 A;  2EA2 A;  2XGC A;  5GTI C;  3IH3 A;  1QPI A;  2IS1 A;  3BTJ A;  3N05 A;  2KZV A;  4KIS A;  4FX0 A;  2HOS A;  3MQ0 A;  3CCY A;  3H92 A;  2H27 A;  3U9G A;  3A1Y A;  2M9H A;  5E8I A;  1IV8 A;  4KN7 X;  1S9H A;  3CCM I;  2Z1D A;  1R58 A;  4N0B A;  5B5E C;  5HOD A;  3HC7 A;  1YRN A;  3R0A A;  2STW A;  2PEX A;  1L3L A;  3DV8 A;  3CES A;  5HDG A;  5ICF A;  2Y31 A;  2QYO A;  1BR2 A;  4N9I A;  2HXO A;  1LB2 A;  2G0E A;  1KGS A;  2MLK A;  2RQP A;  4IF4 A;  2PX9 A;  4YFX F;  4BXF A;  2MA3 A;  3NEU A;  1REP C;  3C2B A;  1FNN A;  3QOD A;  2IBD A;  1BJA A;  4PZJ A;  2IS4 A;  4GFB A;  4CYC A;  4D9J A;  3ZMV A;  1ERD A;  4S0H B;  3OOU A;  1BOB A;  2QKL B;  2X4H A;  1OCO H;  2O5R A;  1VQK I;  2TDX A;  5J1U A;  4XMY A;  3ZQC A;  1LNW A;  4XKB A;  3QYE A;  4IEJ A;  2BOL A;  2PMU A;  4LIT A;  4KT6 A;  3RCO A;  2CJJ A;  2STT A;  3OSG A;  2A3S A;  3J81 Z;  1D3Y A;  5HNF A;  4XLP F;  1BC7 C;  1P4X A;  3BLY A;  4XM3 A;  4BXU A;  1VQ9 I;  4XRS A;  2DTR A;  2IJL A;  2ZCW A;  3BCB A;  3ABU A;  2V1D A;  3X2Q H;  3CUQ A;  3ZQI A;  5GPC A;  3ZCO A;  5E17 F;  5EZH A;  4NC7 A;  3K4B A;  3P5J A;  3WGG A;  3KET A;  4C9Y A;  3OYL A;  4TV7 A;  4ETS A;  3SJM A;  1BR4 A;  1JKR C;  1X1D A;  4I02 A;  4BE0 A;  4JK1 X;  4MNU A;  2F5E A;  3RPU A;  1VQN I;  1JUS A;  1OLT A;  1WRJ A;  4XKV A;  1W5T A;  3ZN1 A;  3JAM Z;  2K86 A;  2A61 A;  2P5K A;  5FLV A;  1O3R A;  4IQ4 A;  4BGD A;  1ZK8 A;  2LF7 A;  4A0X A;  2AS5 F;  1T08 B;  1W5C C;  3AKZ A;  5AIP A;  4ZYD A;  2HYJ A;  1PP7 U;  4S04 A;  3QOP A;  4ITV A;  2HPI A;  4XKW A;  4LFU A;  3GFL A;  3ONQ A;  2E7W A;  2FXA A;  3AFH A;  2FQ3 A;  1Y0U A;  3OIP A;  4BJT A;  2VBZ A;  3AG4 H;  4PJ0 C;  3P9I A;  4AUX A;  1BM9 A;  4RGU A;  3PQJ A;  2M34 A;  2BVL A;  4F7Z A;  1ENH A;  1SFX A;  5J1Y A;  1T2K A;  2ME0 A;  3I4N J;  4HF2 A;  3S2W A;  3S32 A;  2IGM A;  1XX5 A;  3BR5 A;  3TO6 A;  5KVR A;  2HDD A;  3BTC A;  2NOG A;  1B6A A;  2VUM J;  3WG9 A;  4F3Q A;  2DPD A;  2VI6 A;  2VKV A;  2CV0 A;  1T8I A;  5M5W J;  1U5T B;  4YEL A;  2M7A A;  3HJE A;  4UVA A;  1V3F A;  3M8J A;  1P9Q C;  1Z6R A;  2L7K A;  2XSD C;  1S6L A;  1RIO H;  2DI3 A;  4GXO A;  2P6S A;  5GTH C;  2FBK A;  3QYF A;  1S7A A;  2XAH A;  4LJZ F;  5DV5 A;  2DA2 A;  3LMM A;  5FKN A;  1JTY A;  2FML A;  3BRO A;  5HNH A;  3WTV C;  4BDZ A;  1GT0 C;  1E2X A;  5EF6 A;  4IZZ A;  3BTI A;  2DT5 A;  2XC7 A;  1W7P D;  2K7L A;  3MEX A;  2ID6 A;  2WAF A;  1S5L C;  3DQV C;  4NQW A;  2PJR A;  2ID3 A;  1VQ5 I;  1LDD A;  3HHG A;  3UR3 C;  3LSM A;  3L2Q A;  2L02 A;  2M2E A;  3D0S A;  2V1N A;  3H9Q A;  4PFP A;  1GDT A;  5J4Y A;  3RZO J;  2EPF A;  4ZYH A;  4KMU X;  3F72 A;  1SMT A;  2DFI A;  4M3G A;  3JSP A;  1RUO A;  2NXN B;  2JMW A;  2QA4 I;  1I1G A;  5FLX Z;  1XG1 A;  1IO2 A;  5LEJ A;  3PQK A;  3V8J A;  1B59 A;  5CPR B;  5JLW A;  1I6H J;  4E4H A;  1PJR A;  3T8T A;  1R1V A;  3RYP A;  3LSP A;  2N8G A;  3M07 A;  1SAU A;  3IRR A;  5HLH A;  1ZLK A;  1MDM B;  4Z6Y A;  2CFO A;  5F6F A;  5CJ9 A;  3K6G A;  5BPI A;  4AIJ A;  3CMY A;  3FXL A;  1ACI A;  1K7A A;  3Q9V A;  2IPQ X;  5M5X J;  3TP0 A;  1D8J A;  2ZME C;  1V5G A;  4IRG A;  4EGZ A;  4B1R A;  2NS7 A;  1R6R A;  3VSK A;  1SAX A;  2H09 A;  4BE1 A;  1TW2 A;  2JN6 A;  3VYS B;  2LC2 A;  1OJL A;  2ETH A;  1ZN2 A;  5TRD A;  3S1R J;  2FEZ A;  1R1T A;  2WWY A;  2W4S A;  1MSF C;  2BHZ A;  3S3M A;  4PUS A;  2VAS A;  3DKY A;  5B1B H;  4A0Z A;  4D5C A;  4P55 A;  1BIA A;  4EJT A;  1J75 A;  2XVC A;  4IHT A;  2A6E F;  1UFM A;  2MD5 A;  2VC0 A;  1D0Y A;  4HG2 A;  4BJ5 C;  1YJW I;  3BZK A;  1Z3X A;  2VN2 A;  4B44 A;  4UUT A;  1Z7U A;  1GHC A;  3ABL H;  3RI4 A;  2P8T A;  2QF7 A;  1FOY A;  4MLO A;  5IT9 Z;  2F4I A;  3GXO A;  4A6E A;  2JA5 J;  3GCM A;  1J7K A;  1K4S A;  5FRN A;  2L0K A;  2RNG A;  4A6D A;  2YR2 A;  1EKE A;  1TWG J;  3H3V K;  3FZV A;  1ETY A;  3JRC A;  1LDK B;  4GRI A;  4F93 B;  4WK8 F;  4X0G A;  3DEU A;  1SVO A;  2CW0 F;  2R7F A;  1IG7 A;  1O3S A;  2UXX A;  3PO3 J;  3LA2 A;  5FD5 A;  1R7J A;  2A6T A;  3J80 K;  4XOP A;  2GIV A;  2LNB A;  1JJ6 C;  2HR3 A;  2LLK A;  2JA6 J;  3I9V 2;  3EET A;  5DYM A;  2R4G A;  3MFK A;  1YRN B;  3GTO J;  1K83 J;  4U7B A;  2CMP A;  1DP3 A;  2BZT A;  4XBF A;  2KHM A;  4W1U A;  1T95 A;  2L9V A;  1S7E A;  4F91 B;  2P7C B;  1ETV A;  1MIJ A;  4EM2 A;  3D1N I;  3L2W A;  4FE4 A;  2VOP A;  2ZSI B;  1XGS A;  5IYC J;  5LFA A;  4RGR A;  1SD5 A;  1WJF A;  2VJJ A;  1IGN A;  5CVJ A;  4PJN A;  4F55 A;  4BHC A;  3LSJ A;  5K5R A;  2P4W A;  1VQ7 I;  4B4C A;  5CQE A;  2G9W A;  2FNA A;  3JTH A;  1YOV B;  3BJ6 A;  2JUG A;  2XAS A;  3BZC A;  2FE3 A;  4KYW A;  1UCR A;  4NNJ A;  3CLQ A;  3B73 A;  2KDO A;  3OWT A;  1YS6 A;  1WKM A;  5DM6 F;  2IW5 A;  3W3C A;  4ZYA A;  2BE5 F;  4UVB A;  1GVD A;  4A3I J;  1R1U A;  1K4T A;  2HNH A;  3FM5 A;  3F6V A;  3H36 A;  1YX3 A;  3KZI C;  4DYC A;  2IAI A;  1Y6I A;  2DK5 A;  2Y0S A;  3IAS 2;  4LG0 B;  4UUS A;  1B1B A;  3I58 A;  1IXC A;  2X85 A;  4B3X A;  1P4A A;  4G7H F;  5F0H A;  4MTE A;  5F27 A;  3TKY A;  1MBF A;  1EH8 A;  4FHT A;  4A12 A;  3ZR8 X;  1FOK A;  2KLO A;  3LQR A;  2VJI A;  2L9S A;  4QPO A;  1ULY A;  3BR1 A;  2LFB A;  2Q8K A;  4LOC A;  1RR7 A;  3IUO A;  1N77 A;  1LDJ A;  2PBI A;  1IDY A;  2Y0S N;  1UHW A;  2L4A A;  4FIS A;  5F0F A;  3L2U A;  1VTN C;  5EEH A;  2UWM A;  3L1P A;  4OWR B;  2X6O A;  4ESB A;  1J5Y A;  3MAJ A;  2QQ9 A;  3OYI A;  2LY1 A;  1XCV A;  2H94 A;  4ABZ A;  2IGO A;  3A03 A;  3JTG A;  3R6S A;  3CF5 F;  2P0W A;  5KHD A;  5J4V A;  2X1C A;  3HIF A;  2JRT A;  1TWH J;  4M6X A;  3E5U A;  5HS8 A;  3W6J B;  5LBQ A;  2XDV A;  4FCY A;  3DKX A;  2VOD A;  3DPL C;  3RZD J;  3DU5 A;  4HDV A;  1EH6 A;  2RKH A;  1UG2 A;  1STZ A;  2L7Z A;  2GA2 A;  3M1C A;  3HUG B;  1X2N A;  3O8H A;  5E3O A;  2HQA A;  3PSI A;  4AYB A;  2DMU A;  3JRB A;  1YW9 A;  3TL4 X;  1AOY A;  2HFH A;  1WQ2 A;  2JRM A;  1B9M A;  1BBY A;  3FIW A;  3F8F A;  2EZI A;  3H1C A;  2ME6 A;  1AKH B;  5DCF A;  1I27 A;  1W4M A;  4XIC A;  2R7V A;  1GXP A;  4UXN A;  2E2H J;  2DMT A;  1U3E M;  3LFU A;  4AU7 A;  4LMY A;  4C2U A;  3S93 A;  1X2M A;  3QAH A;  3G6E I;  2KT0 A;  2XRO A;  2M30 A;  2EFQ A;  4YFK F;  1I39 A;  3EUK L;  2DMN A;  3GTK J;  4KIG A;  4RBO A;  3A01 A;  1V4R A;  1R5I D;  2ZJQ F;  4OIR F;  3U2R A;  5HLG A;  1XDU A;  1G4D A;  3V8K A;  2F5V A;  2LY2 A;  1FP2 A;  4JX5 A;  5D4R A;  1UST A;  4A3F J;  1FT9 A;  2DQL A;  4B3A A;  4PGH A;  2KRH A;  3VYT B;  1Z7L A;  3HYI A;  3O8G A;  4M74 A;  1TT5 B;  2HTJ A;  3S1M J;  3HUG A;  1OYY A;  2MD0 A;  3DTI A;  3OS0 A;  2QKM B;  1KYW A;  2V9P A;  2GM4 A;  2VQL A;  1U5T C;  2R7W A;  2ZXH A;  1EH7 A;  1R71 A;  3FXU A;  1MBK A;  1FIA A;  5DEQ A;  1ON2 A;  3EQL F;  1XMK A;  4MO7 A;  1ITY A;  5KCM A;  3T0Y A;  4N4O B;  4G12 A;  3EUH C;  4BBS J;  3MZH A;  2Y2Z A;  1MKM A;  1Q1H A;  1RKT A;  1V5E A;  4XLF A;  2DYR H;  1U6G A;  3E6B A;  3G2B A;  2FJ1 A;  4UV8 A;  2LRD A;  1J9I A;  1LKX A;  2X6W A;  3ZMT A;  4FTH A;  4CZC A;  2DOF A;  2EWN A;  1WVR A;  4B09 A;  4J19 A;  4IX7 A;  2QBY B;  4O5V A;  5GAD J;  4P5O A;  3K69 A;  5DUK A;  4M3F A;  2VQG A;  2UV1 A;  5K7Z A;  3OYC A;  1LFU P;  2JPB A;  4DBR A;  4XQF A;  3KE2 A;  2HEO A;  2R7Q A;  1YFH A;  3QP5 A;  1WPK A;  2BXZ A;  2Y30 A;  2ZFU A;  4KUM A;  2QEN A;  3GTL J;  4DZJ A;  4BYY A;  1R00 A;  2HQR A;  4M73 A;  1ZKG A;  4I7H A;  3N4M A;  3IKV A;  2XB5 A;  2H8R A;  2K85 A;  3W6V A;  1R36 A;  3GZN B;  4I09 A;  1ZHF A;  3HXL A;  2XKP A;  4RB1 A;  4CHU A;  1FMV A;  3FMR A;  2VL8 A;  2W48 A;  3GZ5 A;  2XSJ C;  3KLN A;  5FO5 A;  5HVQ C;  3P9K A;  1QHG A;  5BS6 A;  1FYL A;  1WJE A;  1ZGW A;  2I8D A;  5FFX A;  3WGI A;  1F9N A;  1DP7 P;  3ASN H;  2W00 A;  5BMZ A;  3OR1 C;  3CJR B;  3OYH A;  1XPX A;  3VWB A;  1LE8 A;  1QRY A;  3S2H J;  1W5S A;  1N25 A;  2LYC A;  2Y9Z A;  3FIS A;  2AO9 A;  3G71 I;  1I3A A;  2R5Z B;  2VXZ A;  5E1X A;  2D1V A;  5FKK A;  1X58 A;  5B1A H;  2NVX J;  4AD9 A;  2ZXJ A;  5C44 J;  2EV6 A;  2R93 J;  2WAD A;  1YHQ I;  2ZXI A;  2CQ7 A;  1ZYR F;  1XDS A;  5IOY A;  3FXM A;  3PFY A;  5D5X B;  3RKQ A;  4DYR A;  2O6G E;  3DLA A;  2CO5 A;  4HAM A;  5KNL A;  3S1Q J;  2KRF A;  1K79 A;  3CP8 A;  5FLM J;  3K2Z A;  3HRU A;  3E3V A;  4ZTJ A;  3K4M A;  2Y0M A;  1LEB A;  4CA0 A;  4CCJ A;  2Z9O A;  3IAM 2;  4NUB A;  1G3W A;  2OQR A;  4Y17 A;  3FBN B;  2CUE A;  4RGS A;  3HOT A;  1MBJ A;  4LB6 B;  1YW7 A;  4M3B A;  1E3O C;  4DGW B;  2JT1 A;  4Z2Y A;  2QEX I;  1F43 A;  4FE7 A;  4DYQ A;  3BR0 A;  2M8E A;  2QM3 A;  1QU3 A;  4XSZ F;  3GLL A;  3ABT A;  2EV0 A;  3CJT B;  2OZ6 A;  1FMW A;  2OC6 A;  1AKH A;  5L3C A;  2ELK A;  4UHT A;  4AYB N;  1VQO I;  4NDL A;  3Q3S A;  5L3F A;  4JBA A;  2K4J A;  4HYE A;  2F6C A;  3HGY A;  4XLA A;  2QSH X;  2HU9 A;  2EV5 A;  2VPR A;  4K2E A;  3C18 A;  2DYS H;  3FHN A;  1YW8 A;  2VJ5 A;  5AON A;  2O9L A;  1BOA A;  2W1O A;  5L3G A;  3I0T A;  2J5P A;  1SD4 A;  3FWE A;  1AHD P;  3FKJ A;  5TIS C;  2K9M A;  1TC3 C;  2ACJ A;  3BQY A;  2ZJR F;  1E0E A;  3ZRG A;  5JHU A;  2XUB A;  4MEY F;  2L54 A;  3JRI A;  5ILU A;  2Y75 A;  4OIN F;  3N97 A;  4UY8 I;  2C6Y A;  3DXJ F;  2RN7 A;  1WH5 A;  3HG9 A;  2EIN H;  4PK4 A;  1P6R A;  3H3Z A;  2LKP A;  2R7Z J;  2MAB A;  2COB A;  1T38 A;  1UHM A;  1B72 A;  3KEY A;  3TQN A;  2VB6 A;  2LSO A;  2ELH A;  3WTZ A;  1CGP A;  3HPH A;  1FSE A;  5FRM A;  2MH2 A;  4HDU A;  2LMD A;  2MC4 A;  5KK1 A;  2HYG D;  5IP9 J;  3O3K A;  4XID A;  4A3D J;  2M4K A;  1Y8R B;  3DTK A;  4ENM A;  2XIG A;  4D1Q A;  4AM3 A;  4AVZ A;  3RQ4 A;  3B02 A;  2HWV A;  4QPQ A;  3FDY A;  4DJA A;  1IN6 A;  3M1E A;  1TW3 A;  3WE2 A;  4U0V A;  1ZRC A;  2QBY A;  1QZZ A;  2BGC A;  1WJB A;  3ECO A;  3K4K A;  2UZK A;  1NG7 A;  4BAC A;  2DN0 A;  1MZB A;  1N78 A;  2H8W A;  2M7B A;  2K27 A;  1HQC A;  1RZ4 A;  3EDP A;  1SC7 A;  3HGG A;  1HDP A;  2Q2E A;  1SFO J;  4LK0 F;  2W84 A;  1FJL A;  5EEA A;  5EZG A;  1CF7 B;  4OAZ A;  4CCO A;  1V54 H;  2E1N A;  4OOI A;  4CSW A;  2CWE A;  2LH9 A;  4L9T A;  3WOD F;  1QNT A;  5LHH A;  2HOT A;  1T6S A;  4V2F A;  2XHK A;  4BU2 A;  1U2W A;  1JKP C;  2Z16 A;  3TED A;  1UZC A;  2FSW A;  3WTX C;  3JW4 A;  3OL4 A;  2JA8 J;  2BVM A;  2CW8 A;  3PUF A;  5J47 A;  1FEX A;  1OCZ H;  2ZO4 A;  1DU6 A;  2L9N A;  4XSX F;  2V1U A;  3A0H C;  3HKZ N;  1JJ8 C;  3HPG A;  2JVH A;  1A35 A;  2K3F A;  4FX4 A;  4UUV A;  3D5R C;  2K9L A;  3BP8 A;  4KA4 A;  2NYX A;  1OIS A;  4IO9 F;  2YU9 J;  3HRT A;  3RYR A;  4OMY A;  1SMY F;  2PLY A;  2LBF A;  3CDI A;  1W1W E;  4J01 A;  2A5W A;  3E97 A;  5FJ8 J;  1XGO A;  2EZH A;  4XON A;  4C3I J;  4AIK A;  4A5M A;  2J5O A;  3S3O A;  1XC5 A;  1MH4 A;  2V26 A;  3R61 A;  5E3N A;  1ZRE A;  5LRR A;  2M5W A;  2MC3 A;  2RRE A;  3F0C A;  2CQX A;  3H35 A;  4U0W A;  1OCC H;  3HDD A;  1I3Q J;  3I5U A;  3TW6 A;  1XB4 A;  2HKO A;  4V19 K;  2QSG X;  2OD5 A;  3O6B B;  2W57 A;  4Y13 A;  3KYD B;  4RMN A;  2FF4 A;  2WAE A;  3REO A;  3HOX J;  1IRX A;  4RA2 A;  1KQ9 A;  3OSF A;  3ML6 A;  1TL8 A;  3CC4 I;  1X1C A;  1N75 A;  3DCF A;  3TBI A;  4ZZL A;  4XOR A;  4JQF A;  4LG3 A;  1OR7 C;  2VPL A;  2AQF A;  5A2Q K;  2NNN A;  3QPS A;  4XRS G;  1J59 A;  2MBF A;  4ON0 A;  4BHP A;  4EMS A;  2KFD A;  3DF8 A;  1VQM I;  1B8I A;  4EAT A;  2P6T A;  3HBL A;  2DA3 A;  3K0L A;  5JVT A;  1D5Y A;  3GTJ J;  5AIQ A;  4MGR A;  1ZH5 A;  4HSR A;  4E6K G;  5D8L B;  1NHA A;  2WB1 N;  4FT8 A;  5FRO A;  3DEW A;  2Q1Z B;  2VBY A;  5D6F A;  5DUI A;  1LUJ B;  1J2X A;  4C30 A;  1IW7 F;  4EEF G;  4C3H J;  1WJC A;  3T5X A;  2KKO A;  2X1D A;  3E6M A;  2GLO A;  2RQQ A;  3ZMU A;  1HSJ A;  1FBS A;  3CCE I;  3PSF A;  1VF9 A;  5BPD A;  1WJD A;  3IWZ A;  4KIC A;  1TBX A;  3BG3 A;  2QUF A;  3FXO A;  3RKY A;  2HZT A;  2VBW A;  4RLQ A;  1SFK A;  1GV5 A;  4HLY A;  1ON1 A;  1MND A;  3F8C A;  4N4N B;  2X1E A;  3K9T A;  1UHS A;  2FX0 A;  2KIQ A;  4BQQ A;  2JSC A;  2ZJ2 A;  1B72 B;  1LPQ A;  4XKC A;  1FWZ A;  4HNV A;  1T0F A;  4ESF A;  3K4J A;  3GWZ A;  3GFJ A;  1Z77 A;  1ZG3 A;  2LDU A;  3DTE A;  4RM2 A;  2V6E A;  2OZU A;  4N9H A;  1ZGA A;  2RVC A;  3OYM A;  3HOY J;  1PYV A;  4HX4 A;  2GZW A;  2DW4 A;  2M1B A;  1D0X A;  4LG0 A;  4HX8 A;  1V5F A;  1YQA A;  3Q0V A;  1PUF A;  3P7N A;  1FBQ A;  3A4C A;  3CTA A;  4ESJ A;  2HDW A;  2ZC2 A;  3MMY B;  1G3Y A;  4X1E A;  2F5F A;  1YJN I;  1WJA A;  1W0U A;  1A5J A;  2B63 J;  3C7J A;  3CUO A;  4BY1 J;  1BI0 A;  2FD5 A;  5DD4 A;  2O3F A;  5IOZ A;  2ZNZ A;  1S8N A;  4QSH A;  2VQC A;  3JRE A;  1R22 A;  1QO0 D;  1NH3 A;  4L9J A;  2PJP A;  1HOM A;  3MN2 A;  5HLT A;  4IHV A;  1WI3 A;  3WU2 C;  2DK8 A;  3BZ6 A;  4U0Y A;  1O3T A;  1DUX C;  3OYN A;  1PUE E;  1YIO A;  3B6C A;  1IN8 A;  1FPQ A;  4Q48 A;  3S16 J;  1FZP B;  1SVM A;  3RJP A;  3SZP A;  1IN5 A;  4A3E J;  3F8B A;  3QRF F;  1JGS A;  2LR8 A;  2V7F A;  2Z33 A;  3PFI A;  2R5Y B;  4GGG A;  2IT0 A;  3VYU B;  1XD7 A;  3CO6 C;  3VFZ A;  2VC1 A;  1WZ2 A;  2UUZ A;  1OYW A;  2LKS A;  2O61 A;  3JRA A;  5ERI A;  4MQV A;  5LHI A;  2AXT C;  4XN0 A;  1ZAO A;  4I2O A;  5CVU A;  3KP5 A;  5M5Y J;  1F1Z A;  4B48 A;  1HA8 A;  4YFN F;  4OAY A;  3S15 J;  2DFH A;  4IOC F;  4BQN A;  4GO1 A;  4PJM A;  3LSK A;  4PDK A;  5E3L A;  4XLN F;  3PNY A;  2F48 A;  2L4M A;  5J3L A;  3QPT A;  3K1M A;  2Y69 H;  4M3D A;  3L2C A;  2JPC A;  5K5Q A;  4RLF A;  1E3H A;  3EYY A;  3Q5F A;  2D2W A;  2M4G A;  5EYR A;  1MSE C;  4EVI A;  2QLZ A;  1D5V A;  4BEH B;  2HQ5 A;  3GW2 A;  4PJL A;  2DA6 A;  5D5U B;  2HGC A;  3IL2 A;  3DWL E;  1BJZ A;  2A5Y B;  3MVP A;  3FHZ A;  3CJN A;  4OMZ A;  5IP7 J;  1KYZ A;  2O03 A;  4GDF A;  1I5Z A;  2IA0 A;  3KP6 A;  1TQP A;  4HQE A;  1LVA A;  4L5E A;  3E1S A;  1J0R A;  2KJB A;  2GIZ A;  1KU2 A;  2NVY J;  4D7N A;  4E7Z A;  1G59 A;  4IRI A;  2DTZ A;  4BJ6 C;  1G8X A;  2JZY A;  4Q4Z F;  5IYD J;  1OCR H;  4ASN A;  3GUD A;  4KFC A;  3SEZ A;  3IRQ A;  4YIF A;  2CUJ A;  3I71 A;  5FD6 A;  2DOA A;  1IXR C;  5L3E A;  5DD8 A;  1G6N A;  2E5Z A;  2XGE A;  4B43 A;  5LHG A;  2L7M P;  3ZOB A;  5D4S A;  5E3M A;  3W2V A;  5LGT A;  1DU0 A;  1MJ9 A;  1K6O A;  1KU7 A;  1SEU A;  4DQ2 A;  3ECH A;  3C3W A;  1KU9 A;  2M0C A;  4XR6 A;  2DA7 A;  1RC9 A;  3L00 A;  5F0C A;  3LA3 A;  4M71 A;  4U7D A;  2JJ7 A;  3HM5 A;  2R7O A;  3CME I;  1H0M A;  4QLC U;  1APL C;  1P92 A;  4NQW B;  3WTY C;  3NQO A;  2G7U A;  2XF7 A;  3OIO A;  1S29 A;  5FFZ A;  3ZQL A;  5D8K B;  2X0L A;  3OIQ A;  3U21 A;  3I3L A;  3V4G A;  1U78 A;  3KPH A;  1GVJ A;  3FXJ A;  1R23 A;  2NRA C;  1XTA A;  1BI3 A;  3MZ8 A;  1U8B A;  3GTP J;  2OUM A;  2R5Z A;  2OQG A;  1W7P B;  2LOO A;  4LLL A;  1IV6 A;  3GTG J;  1EF4 A;  3V7S A;  1HKS A;  2O8X A;  1HW5 A;  3LSI A;  2ELJ A;  5IT3 A;  3FKI J;  2XV4 S;  4BY7 J;  2KZG A;  3LL7 A;  4CH7 A;  3MCZ A;  5BQT A;  3RKW A;  3HSE A;  3COA C;  3J80 Z;  1S3J A;  3BTL A;  1OPC A;  3H3U A;  4B8X A;  3G3Z A;  2D45 A;  4UB6 C;  1Z21 A;  3TOA A;  3H9G A;  2X6Y A;  1T56 A; 
#chains in the Genus database with same CATH homology
 1JE8 A;  3KEQ A;  1IN7 A;  4ZYG A;  2OA4 A;  4ZZD A;  4G8X A;  2OAZ A;  1O57 A;  2CGP A;  2G7H A;  1XGN A;  3GFI A;  2NS0 A;  3R0J A;  4M72 A;  1Z6T A;  2LF8 A;  1BIB A;  1WWX A;  2P7V B;  2XAQ A;  4L0Z B;  2QVO A;  2IP2 A;  3CLO A;  1C0W A;  3F8N A;  3SZT A;  3RIR A;  4ENK A;  3BOQ A;  1YTY A;  4R79 A;  3BJA A;  1BN5 A;  1DDN A;  2R3S A;  4BQA A;  4LLN A;  2XAF A;  2Q0O A;  4I0A A;  1YLF A;  3ELK A;  1AWC A;  4HV5 A;  3F3X A;  4EV0 A;  4CXF A;  4P9F A;  3F8M A;  1TQM A;  2YU3 A;  2W85 A;  2ESN A;  1MJA A;  2FNP A;  4EM0 B;  1ZLJ A;  3ZMZ A;  1HXD A;  2QQA A;  5D5V B;  3GO5 A;  2K4B A;  4PCQ A;  2ZFW A;  2ZME B;  4RB3 C;  1SFE A;  4Q47 A;  1MD0 A;  1WI9 A;  2H6B A;  1BC8 C;  3SHF A;  5FLX K;  4ENN A;  2BBY A;  2Z5U A;  3HHH A;  6PAX A;  3F22 A;  2D1H A;  1QQI A;  3KP4 A;  3WGH A;  1OKR A;  3CO7 C;  1XN7 A;  3E5X A;  3QU3 A;  2VBX A;  3BWG A;  1KU3 A;  3M8E A;  4KT5 C;  3TO7 A;  1R5H A;  1PP8 F;  1HST A;  3HRS A;  4IJA A;  1USS A;  2GAU A;  1E17 A;  1G3S A;  2CSO A;  3GLX A;  5LGN A;  2DAO A;  5HS9 A;  3FMQ A;  5J8F A;  3E6D A;  2FBH A;  4CO8 A;  1CF7 A;  2GA1 A;  1HW1 A;  5H20 A;  1FLI A;  1WSU A;  5DCM A;  4IVN A;  3ZN0 A;  3P9C A;  4IXA A;  1GXQ A;  2V79 A;  2FU4 A;  1FYM A;  5ILS A;  3SQN A;  2PG4 A;  1KA8 A;  4HV6 A;  5HDK A;  1SFU A;  3KLO A;  3TDU C;  1BI1 A;  4WF2 A;  2QZ8 A;  4Y15 A;  1IF1 A;  2EFO A;  4LB5 A;  3V7R A;  1IUY A;  5E1Z B;  2HDC A;  2FOK A;  4G6D A;  2JTV A;  4OIO F;  3HSF A;  1IRF A;  3ERE D;  4KIB A;  2F5D A;  5ED4 A;  2PQ8 A;  4RS8 A;  4AVP A;  1SD6 A;  4XRF A;  2XKO A;  3ULQ B;  1KQ8 A;  4IRH A;  4QWQ A;  5HLI A;  3FF5 A;  4RAZ A;  5E20 A;  2A6H F;  4MHG A;  4EM1 A;  2RV8 A;  4MTD A;  3DP7 A;  4R8H A;  1U8R A;  4I98 B;  3G73 A;  1MJB A;  3R60 A;  3J7A O;  1XSX A;  5L3D A;  2EB7 A;  5JI6 A;  4MEX F;  3T1B A;  4EQQ A;  1FP1 D;  1IAW A;  4M9S A;  2WTE A;  2WV0 A;  3I53 A;  4UVC A;  1DPU A;  3U1D A;  3FM3 A;  5HDN A;  2YPR A;  3CUQ B;  4R1H A;  4MQ9 F;  3OOP A;  2CFX A;  4BHB A;  3I59 B;  5ICG A;  4CGZ A;  3I59 A;  1A04 A;  1HW2 A;  4P9U A;  3GFM A;  3DFG A;  2VT2 A;  1I6X A;  4YII A;  1DPR A;  3D5L A;  3KEO A;  1OMI A;  3ISP A;  3EYI A;  1YG2 A;  3HSR A;  1TTY A;  2L3D A;  1MDM A;  1IN4 A;  4H0E A;  1EV7 A;  2FBI A;  5FGM A;  1K78 B;  4KN4 X;  3IWF A;  2FA5 A;  3L09 A;  2VON A;  3SFZ A;  2Z3Y A;  4WWC A;  2HTS A;  1O7F A;  5ICC A;  4M6Y A;  4LGW A;  4I01 A;  4CIC A;  5L3B A;  3LQQ A;  3RTR A;  3JAM K;  2EA4 A;  3CDH A;  4HF0 A;  2WC2 A;  2XRN A;  4HBL A;  1T98 A;  5IT9 K;  3VOE A;  1QZY A;  2PFB A;  4WXC A;  4WCG A;  2OBP A;  3HTS B;  1ONV A;  4OIQ F;  2YSR A;  1S7O A;  1XSD A;  3ROU A;  1FBU A;  2OU2 A;  4RGX A;  2KJC A;  2MH9 A;  2IA2 A;  4IPA A;  2GWR A;  3SXY A;  4IHS A;  5K1Y A;  4A2U A;  4OU0 A;  3LFK A;  4HF1 A;  2V6C A;  4PGG A;  2PI0 A;  4HZF A;  3LAJ A;  4ZYE A;  2GXG A;  4RAY A;  4E70 A;  5LEK A;  1Z1D A;  5J8C A;  2EFW A;  3TOB A;  1H9G A;  4HA8 A;  4OIP F;  3BPV A;  1MGT A;  5H6R A;  1PDN C;  1XCB A;  5LLQ A;  1QBJ A;  1Z9C A;  4L18 B;  4G94 A;  4UV9 A;  2HQN A;  4LLG F;  4EJO A;  2A68 F;  2CYY A;  3O2P E;  2M87 A;  1RUN A;  3GZ6 A;  3QPH A;  3RDI A;  4G7O F;  2NAZ A;  3FX3 A;  1D8K A;  3VEP A;  4GYI A;  3ZMS A;  1Z91 A;  3WTT C;  3KCC A;  3I64 A;  2ZNY A;  2KIU A;  1F5T A;  2YX7 A;  1TQI A;  2ADU A;  3M7G A;  2FMY A;  3T8R A;  2PMH A;  1RNL A;  1ZAR A;  4WXH A;  5CVV A;  4Q5S F;  3QP6 A;  1B4A A;  3CUQ C;  2DQR A;  4M9Z A;  4EJU A;  5EEG A;  5DDG A;  1X3U A;  2F2E A;  3KP2 A;  2P5L C;  2IA1 A;  3MZY A;  2AXL A;  3IC7 A;  5LGU A;  1JHF A;  3IHU A;  3BPX A;  4GCV A;  1OR7 A;  4I0B A;  1ZRF A;  5E8G A;  3VOD A;  3L9F A;  5J6X A;  1P2F A;  3WU0 A;  4UNO A;  1Z05 A;  3V7C A;  2QQB A;  5ICE A;  4HQM A;  3TDZ C;  4KNY A;  4EGY A;  3QU6 A;  2IRF G;  4U88 A;  1K78 A;  3M8F A;  5F1R A;  4KMF A;  3WE3 A;  2XAJ A;  5JR3 A;  5ILV A;  5BOX A;  1BI2 A;  2H6C A;  2W25 A;  2CG4 A;  4M9X A;  1ODD A;  3LA7 A;  2HOE A;  3BDD A;  2DPU A;  2VOO A;  5TJJ A;  5E1W A;  1JHH A;  3OV8 A;  1OYI A;  4G7Z F;  4YG2 F;  3ZP5 A;  2Y48 A;  2K02 A;  5CVI A;  1TNS A;  2DBB A;  2BEO A;  3K1N A;  2A69 F;  3I4P A;  3NRV A;  5DCM B;  4ENJ A;  3ZMD A;  5A2Q Z;  3BJO A;  2GQQ A;  3ZQ7 A;  4WXD A;  5CVR A;  2HYF A;  2M45 A;  4CYD A;  3GYH X;  4HOB A;  3KP3 A;  1F4K A;  2QWW A;  1LEA A;  1IRG A;  2VT3 A;  3RKX A;  3RPQ A;  2Z99 A;  3BY6 A;  3TGN A;  3E6C C;  3Q9S A;  1ZG1 A;  2ZKZ A;  3DPT A;  3M9A A;  1ZGJ A;  3LAP A;  4G9Y A;  1FY7 A;  1SD7 A;  4G6Q A;  1ZG5 A;  2RC4 A;  4LK1 F;  1UB9 A;  3DKW A;  4NHJ A;  3GVA A;  5F64 A;  1G3T A;  2CQK A;  3ZPL A;  4EJV A;  4RB2 C;  3KP7 A;  5K5O A;  1P4W A;  1KQ0 A;  3TO9 A;  4HW0 A;  2PN6 A;  3GX4 X;  3LWF A;  3HTU A;  2BV6 A;  3FXR A;  1XMA A;  4WX9 A;  4AIH A;  5H6Q A;  2VE9 A;  2L01 A;  2FRH A;  2E1C A;  3MWM A;  4L5I A;  4BNC A;  2UXN A;  1YYV A;  2W24 A;  4AWX B;  2RNJ A;  4LD5 A;  5CYV A;  1YS7 A;  2ESH A;  1R5G A;  1XGM A;  3F6O A;  3I54 A;  3HRM A;  3WU1 B;  5HOO A;  1XSV A;  4L0Y B;  4S05 A;  3WTS C;  3W6K B;  4KDP A;  3GEZ A;  3JSO A;  2BYV E;  4CDG A;  2NNY A;  4GYG A;  2HS5 A;  1FC3 A;  3V8L A;  2R7D A;  1I1S A;  1TLH B;  2EK5 A;  1HKQ A;  3HOS A;  3E5Q A;  2IVM A;  2EJR A;  4NB5 A;  2A07 F;  1LJ9 A;  1IZ1 A;  2RGV A;  4DNC A;  2E7X A;  5CLS A;  3LST A;  2F5C A;  5D5W B;  1FSH A;  2ISY A;  1O3Q A;  4HX7 A;  4HLX A;  2DO7 A;  4L5J A;  4BH9 A;  1JXS A;  4A5N A;  1HKT A;  4RB0 A;  1FYK A;  2COM A;  2EFN A;  1YO5 C;  3IKT A;  3L7W A;  2HKX A;  2ZBK A;  2ZME A;  1TNT A;  3WTW C;  2P5V A;  3F23 A;  3FXQ A;  3R4K A;  2DU9 A;  3AAF A;  2XAG A;  4ZH4 F;  4O3M A;  3EUH A;  2V1X A;  4L9V A;  5LRS A;  4P96 A;  2O0Y A;  3GF2 A;  4L9N A;  5HS7 A;  2ISZ A;  5FB2 A;  5JFR A;  2RDP A;  1T39 A;  2B0L A;  3FMS A;  2VE8 A;  3C1D A;  1LQ1 A;  2GXB A;  1B9N A;  2EFP A;  2KIM A;  4A0Y A;  3WTU C;  3KFW X;  1U5T A;  3KZY A;  1O7L A;  3K1P A;  1W7P A;  2DLL A;  1L0O C;  4D0P A;  2KIF A;  5D6E A;  5E18 F;  2YX4 A;  3VB2 A;  4O6J A;  1IXS B;  4BAY A;  2MLG A;  1QGP A;  3F21 A;  3J81 K;  4EJW A;  1QPM A;  2V9V A;  4CZZ A;  3KZZ A;  1ZRD A;  2XGX A;  1FX7 A;  1HBX G;  1RI7 A;  2EA2 A;  4FX0 A;  3MQ0 A;  3H92 A;  2H27 A;  3U9G A;  5E8I A;  4KN7 X;  1R58 A;  4N0B A;  3R0A A;  2STW A;  2PEX A;  1L3L A;  3DV8 A;  5HDG A;  5ICF A;  2QYO A;  4N9I A;  1LB2 A;  1KGS A;  2MLK A;  2RQP A;  4IF4 A;  4YFX F;  2MA3 A;  3NEU A;  1REP C;  1FNN A;  1BJA A;  4PZJ A;  3ZMV A;  2X4H A;  2TDX A;  1LNW A;  2PMU A;  2STT A;  2A3S A;  3J81 Z;  1D3Y A;  4XLP F;  1BC7 C;  1P4X A;  4BXU A;  2DTR A;  2IJL A;  2ZCW A;  3ABU A;  2V1D A;  5E17 F;  3CUQ A;  3WGG A;  3KET A;  4TV7 A;  4ETS A;  4I02 A;  4JK1 X;  4MNU A;  2F5E A;  3RPU A;  1WRJ A;  1W5T A;  3ZN1 A;  3JAM Z;  2K86 A;  2A61 A;  2P5K A;  1O3R A;  2LF7 A;  4A0X A;  2AS5 F;  5AIP A;  4ZYD A;  1PP7 U;  4S04 A;  3QOP A;  4LFU A;  3GFL A;  2E7W A;  2FXA A;  2FQ3 A;  1Y0U A;  2VBZ A;  3P9I A;  1BM9 A;  4RGU A;  3PQJ A;  4F7Z A;  1SFX A;  1T2K A;  4HF2 A;  3S2W A;  3TO6 A;  5KVR A;  1B6A A;  3WG9 A;  2DPD A;  1U5T B;  4UVA A;  1V3F A;  1Z6R A;  1RIO H;  1S6L A;  2DI3 A;  4GXO A;  2P6S A;  2FBK A;  1S7A A;  2XAH A;  4LJZ F;  5DV5 A;  1H9T A;  2FML A;  3WTV C;  3BRO A;  1E2X A;  2DT5 A;  1W7P D;  2K7L A;  3MEX A;  3DQV C;  4NQW A;  1LDD A;  3HHG A;  2L02 A;  3D0S A;  4ZYH A;  4KMU X;  3F72 A;  1SMT A;  2DFI A;  1RUO A;  3JSP A;  1I1G A;  5FLX Z;  5LEJ A;  3PQK A;  3V8J A;  1B59 A;  3T8T A;  1R1V A;  3RYP A;  3IRR A;  5HLH A;  1ZLK A;  1MDM B;  5F6F A;  5CJ9 A;  5BPI A;  4AIJ A;  1K7A A;  3Q9V A;  2IPQ X;  1D8J A;  4IRG A;  4EGZ A;  1SAX A;  2H09 A;  1TW2 A;  2ETH A;  1ZN2 A;  5TRD A;  2FEZ A;  1R1T A;  2WWY A;  4A0Z A;  4P55 A;  1BIA A;  4EJT A;  1J75 A;  2XVC A;  4IHT A;  2A6E F;  1UFM A;  2MD5 A;  2VC0 A;  2VN2 A;  1Z7U A;  1GHC A;  3RI4 A;  2P8T A;  5IT9 Z;  3GXO A;  4A6E A;  1J7K A;  4A6D A;  2YR2 A;  3FZV A;  1LDK B;  4WK8 F;  3DEU A;  2CW0 F;  2R7F A;  1O3S A;  2UXX A;  3LA2 A;  5FD5 A;  1R7J A;  3J80 K;  2GIV A;  2LNB A;  2HR3 A;  5DYM A;  3EET A;  3MFK A;  4U7B A;  4XBF A;  2P7C B;  4EM2 A;  2VOP A;  1XGS A;  4RGR A;  1SD5 A;  5CVJ A;  4BHC A;  5K5R A;  2P4W A;  2G9W A;  2FNA A;  3JTH A;  3BJ6 A;  2XAS A;  2FE3 A;  4KYW A;  1UCR A;  3B73 A;  1YS6 A;  1WKM A;  2IW5 A;  2BE5 F;  4UVB A;  1R1U A;  3FM5 A;  3F6V A;  2DK5 A;  4LG0 B;  1B1B A;  3I58 A;  1IXC A;  1P4A A;  4G7H F;  4MTE A;  3TKY A;  1EH8 A;  4FHT A;  4A12 A;  1FOK A;  3LQR A;  1ULY A;  2Q8K A;  1LDJ A;  2PBI A;  1UHW A;  2L4A A;  2UWM A;  1VTN C;  5EEH A;  4ESB A;  1J5Y A;  3MAJ A;  2QQ9 A;  1XCV A;  2H94 A;  3JTG A;  3R6S A;  3HIF A;  2JRT A;  4M6X A;  3E5U A;  5HS8 A;  3W6J B;  5LBQ A;  2VOD A;  3DPL C;  4HDV A;  1EH6 A;  2RKH A;  1STZ A;  2GA2 A;  1YW9 A;  1AOY A;  2HFH A;  1WQ2 A;  1B9M A;  1BBY A;  3F8F A;  5DCF A;  1I27 A;  1W4M A;  1GXP A;  4UXN A;  1U3E M;  4LMY A;  3QAH A;  2XRO A;  2M30 A;  2EFQ A;  4YFK F;  4KIG A;  1V4R A;  4OIR F;  3U2R A;  5HLG A;  1XDU A;  1G4D A;  3V8K A;  1FP2 A;  5D4R A;  1UST A;  1FT9 A;  2DQL A;  4PGH A;  3HYI A;  4M74 A;  2HTJ A;  3HUG A;  1OYY A;  1KYW A;  1U5T C;  1EH7 A;  3FXU A;  5DEQ A;  1ON2 A;  3EQL F;  1XMK A;  3T0Y A;  3MZH A;  1MKM A;  1Q1H A;  1U6G A;  3E6B A;  4UV8 A;  1J9I A;  3ZMT A;  2EWN A;  2QBY B;  4B09 A;  4O5V A;  4P5O A;  3K69 A;  5DUK A;  2JPB A;  3KE2 A;  2HEO A;  1YFH A;  3QP5 A;  4KUM A;  2QEN A;  4BYY A;  1R00 A;  2HQR A;  4M73 A;  4I7H A;  3N4M A;  3IKV A;  1R36 A;  4I09 A;  1ZHF A;  2XKP A;  4RB1 A;  4CHU A;  3FMR A;  3GZ5 A;  3KLN A;  5FO5 A;  5HVQ C;  3P9K A;  1FYL A;  5BS6 A;  5FFX A;  3WGI A;  1F9N A;  1DP7 P;  5BMZ A;  1W5S A;  2VXZ A;  5E1X A;  2D1V A;  4AD9 A;  2ZXJ A;  2EV6 A;  1ZYR F;  1XDS A;  5D5X B;  2O6G E;  4HAM A;  2CO5 A;  2KRF A;  1K79 A;  3K2Z A;  3HRU A;  3E3V A;  2Y0M A;  1LEB A;  2Z9O A;  1G3W A;  2OQR A;  4Y17 A;  4RGS A;  3HOT A;  4LB6 B;  1YW7 A;  2JT1 A;  4Z2Y A;  2M8E A;  2QM3 A;  4XSZ F;  3ABT A;  2EV0 A;  2OZ6 A;  5L3C A;  4UHT A;  5L3F A;  4JBA A;  2K4J A;  4HYE A;  2EV5 A;  4K2E A;  3C18 A;  1YW8 A;  5AON A;  1BOA A;  5L3G A;  3I0T A;  2J5P A;  1SD4 A;  3FWE A;  2ACJ A;  5JHU A;  2XUB A;  4MEY F;  2L54 A;  5ILU A;  2Y75 A;  4OIN F;  3N97 A;  2C6Y A;  3DXJ F;  2RN7 A;  1P6R A;  3H3Z A;  2LKP A;  1T38 A;  1UHM A;  3TQN A;  2LSO A;  2ELH A;  3WTZ A;  1CGP A;  1FSE A;  2MH2 A;  4HDU A;  5KK1 A;  2HYG D;  3O3K A;  4ENM A;  2XIG A;  3B02 A;  2HWV A;  1IN6 A;  3M1E A;  1TW3 A;  3WE2 A;  4U0V A;  1ZRC A;  2QBY A;  1QZZ A;  2BGC A;  3ECO A;  2UZK A;  1MZB A;  2K27 A;  1HQC A;  1RZ4 A;  3EDP A;  2Q2E A;  4LK0 F;  2W84 A;  1CF7 B;  2E1N A;  4OOI A;  2CWE A;  4L9T A;  3WOD F;  1QNT A;  5LHH A;  1T6S A;  2XHK A;  1U2W A;  2FSW A;  3WTX C;  3JW4 A;  2ZO4 A;  4XSX F;  2V1U A;  4UUV A;  4FX4 A;  3BP8 A;  4KA4 A;  2NYX A;  3HRT A;  3RYR A;  4OMY A;  1SMY F;  2PLY A;  3E97 A;  1XGO A;  4AIK A;  4A5M A;  2J5O A;  3R61 A;  1ZRE A;  5LRR A;  2M5W A;  2MC3 A;  4U0W A;  3I5U A;  1XB4 A;  2HKO A;  2OD5 A;  3O6B B;  2W57 A;  4Y13 A;  2FF4 A;  3REO A;  1KQ9 A;  3ML6 A;  4ZZL A;  4JQF A;  5A2Q K;  2NNN A;  1J59 A;  2MBF A;  4ON0 A;  4BHP A;  4EMS A;  3DF8 A;  2P6T A;  3K0L A;  5JVT A;  5AIQ A;  4MGR A;  1ZH5 A;  5D8L B;  1NHA A;  4FT8 A;  2VBY A;  5D6F A;  5DUI A;  1J2X A;  1IW7 F;  3T5X A;  2KKO A;  3E6M A;  3ZMU A;  1HSJ A;  1FBS A;  5BPD A;  3IWZ A;  4KIC A;  1TBX A;  2QUF A;  3RKY A;  2HZT A;  2VBW A;  4HLY A;  1ON1 A;  3F8C A;  3K9T A;  2JSC A;  2ZJ2 A;  1FWZ A;  1T0F A;  4ESF A;  3GWZ A;  3GFJ A;  1ZG3 A;  2LDU A;  2OZU A;  4N9H A;  1ZGA A;  2RVC A;  4HX4 A;  2GZW A;  2DW4 A;  2M1B A;  4LG0 A;  4HX8 A;  1YQA A;  3P7N A;  1FBQ A;  3CTA A;  4ESJ A;  1G3Y A;  2F5F A;  3C7J A;  3CUO A;  1BI0 A;  5DD4 A;  2O3F A;  2ZNZ A;  1S8N A;  1R22 A;  1QO0 D;  4L9J A;  2PJP A;  4U0Y A;  2DK8 A;  3BZ6 A;  1O3T A;  1DUX C;  1PUE E;  1YIO A;  1IN8 A;  1FPQ A;  4Q48 A;  1FZP B;  3RJP A;  3SZP A;  1IN5 A;  3F8B A;  3QRF F;  1JGS A;  2Z33 A;  3PFI A;  4GGG A;  2IT0 A;  1XD7 A;  3CO6 C;  3VFZ A;  2VC1 A;  1OYW A;  2O61 A;  5ERI A;  4MQV A;  5LHI A;  1ZAO A;  4I2O A;  5CVU A;  3KP5 A;  1F1Z A;  4YFN F;  4GO1 A;  4PDK A;  4XLN F;  2L4M A;  3QPT A;  3K1M A;  3L2C A;  2JPC A;  5K5Q A;  3EYY A;  3Q5F A;  2D2W A;  1D5V A;  4EVI A;  2QLZ A;  3GW2 A;  5D5U B;  2HGC A;  3IL2 A;  2A5Y B;  3FHZ A;  3CJN A;  4OMZ A;  1KYZ A;  2O03 A;  1I5Z A;  2IA0 A;  3KP6 A;  1TQP A;  4HQE A;  1LVA A;  1J0R A;  2KJB A;  1KU2 A;  4IRI A;  2JZY A;  4Q4Z F;  4ASN A;  3GUD A;  4KFC A;  3IRQ A;  4YIF A;  3I71 A;  5FD6 A;  5L3E A;  1IXR C;  5DD8 A;  1G6N A;  5LHG A;  5D4S A;  5LGT A;  1MJ9 A;  1K6O A;  1KU7 A;  4DQ2 A;  3ECH A;  3C3W A;  1KU9 A;  3L00 A;  3LA3 A;  4M71 A;  4U7D A;  1H0M A;  4QLC U;  1P92 A;  3WTY C;  3NQO A;  2G7U A;  1S29 A;  5FFZ A;  5D8K B;  2X0L A;  3V4G A;  1U78 A;  1GVJ A;  1R23 A;  2NRA C;  1BI3 A;  2OQG A;  1W7P B;  4LLL A;  3V7S A;  1HKS A;  2O8X A;  1HW5 A;  5IT3 A;  2XV4 S;  3MCZ A;  5BQT A;  3RKW A;  3HSE A;  3COA C;  3J80 Z;  4B8X A;  1S3J A;  1OPC A;  3H3U A;  3G3Z A;  2D45 A;  3TOA A;  4KIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...