2VEOA

X-ray structure of candida antarctica lipase a in its closed state.
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
430
structure length
430
Chain Sequence
b'AALPNPYDDPFYTTPSNIGTFAKGQVIQSRKVPTDIGNANNAASFQLQYRTTNTQNEAVADVATVWIPAKPASPPKIFSYQVYEDATALDCAPSYSYLTGLDQPNKVTAVLDTPIIIGWALQQGYYVVSSDHEGFKAAFIAGYEEGMAILDGIRALKNYQNLPSDSKVALEGYSGGAHATVWATSLADSYAPELNIVGASHGGTPVSAKDTFTFLNGGPFAGFALAGVSGLSLAHPDMESFIEARLNAKGQQTLKQIRGRGFCLPQVVLTYPFLNVFSLVNDTNLLNEAPIAGILKQETVVQAEASYTVSVPKFPRFIWHAIPDEIVPYQPAATYVKEQCAKGANINFSPYPIAEHLTAEIFGLVPSLWFIKQAFDGTTPKVICGTPIPAIAGITTPSADQVLGSDLANQLRSLNGKQSAFGKPFGPITP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIPASE A
molecule tags Hydrolase
source organism Pseudozyma antarctica
publication title X-Ray Structure of Candida Antarctica Lipase a Shows a Novel Lid Structure and a Likely Mode of Interfacial Activation.
pubmed doi rcsb
total genus 157
structure length 430
sequence length 430
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03583 LIP Secretory lipase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.130 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2veoA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2veoA01
4H7DA 4U2BA 3DD5A 5D6OA 1FFCA 3D59A 4G9GA 3ICVA 5AI8A 4TVKA 1SCKA 4GI1A 2PSEA 2JGJA 4ZWNA 1UOOA 1JJBA 3C8HA 1CUDA 3K6KA 5YASA 1EDBA 4G4GA 3KXPA 2DQYA 5AKXA 2FJPA 4J7AA 3BF7A 2GYWA 1LNSA 5CTAA 4BTLA 3F9CA 4RE6A 4WY5A 2PM8A 3R3ZA 5HK8A 1DU4A 3QM1A 5AKEA 4DSZA 4X93A 1PFQA 3WKBA 2IIVA 5DNUA 1Q0ZA 3KWFA 3EQ8A 2XDWA 5CT8A 3V1LA 5CXUA 4EY6A 5ALJA 2CBGA 4EHBA 5LIPA 3WWPA 4J0DA 2R11A 3KSRA 1O6GA 4H18A 3H0CA 2CZQA 5AKGA 3UMJA 3O4JA 3ESDA 2QVBA 4B85A 4F60A 1UK9A 3PFBA 1YASA 3WJ2A 2OQVA 5K5EA 1E3QA 2WLSA 4X6YA 1E8NA 3M3DA 5LKRA 1T4MA 5AM4A 3VISA 3WIOA 5FXMA 5JZ9A 2XUAA 4WY8A 1MU0A 2WHPA 2WHQA 2WJ6A 5F4ZA 2JEZA 2BCEA 2HA3A 3BXPA 2QR5A 4O08A 2WJ3A 1YB6A 1JI3A 5K3DA 1VOTA 1W76A 4QWWA 3G9XA 3H04A 2WFLA 4DMCA 4Y2XA 1G4HA 4JYMA 4INZA 2VAXA 1IZ7A 4EY8A 4J0HA 1XZBA 3H17A 5K3CA 4Y9SA 1ZD4A 3C5WP 2RGUA 5HKAA 3OC0A 4AB1A 5CT5A 3GBSA 4UBOA 3AZOA 2P8SA 1VKHA 1T2NA 5JAOA 2PX6A 3S8YA 3AJAA 5K3EA 5ALYA 4AO6A 2WU3A 4BC1A 5LZ7A 1OXMA 4CCYA 4P9NA 4PNZA 3M81A 3YASA 4G8CA 4KEAA 1ZIYA 3ESCA 5HF9A 2OGZA 4IH1A 5D3ZA 4Y7DA 4KE6A 5CT6A 2CMFA 4LYEA 2XMDA 4X94A 1GKLA 3DYIA 4FKBA 1QFMA 2WFLB 5CT4A 5CH8A 1VE6A 2J3DA 5IVDA 3VJLA 5KWJA 1BE0A 3PUIA 3HLKA 4DMFA 4FBLA 4FLEA 3S2ZA 2XQJA 3I6ZA 1ORWA 2BJHA 5KREA 2ES4A 3O4HA 1QIIA 2XMBA 2XMQA 1K6EA 4Q3KA 2VF2A 1G5FA 3H1BA 2GBGA 3G0IA 4Y2YA 3F67A 5AI6A 1VE7A 1XRPA 3L1HA 5BWBA 1J06A 3BL8A 3HABA 2HA6A 4X92A 2WQZA 2BGNA 4HTAA 1F8UA 4B9AA 5KWIA 3WKCA 1XZFA 1QJ4A 2VATA 4P08A 4N8SA 5A62A 2OGTA 1SOMA 4H77A 4BRSA 1UFOA 4C6HA 1HPLA 3B12A 5AIBA 1HDEA 4KYVA 1QOZA 2XUQA 4X6UA 4UFPA 2DFPA 1YSCA 4X97A 1VLQA 2XMGA 3H1AA 2DHCA 3BIWA 3W05A 1UWCA 1MPXA 1QIFA 1CUSA 5AP9A 2RAUA 4GDMA 4YX9A 4N5HX 2XE4A 1WHTA 2ZJFA 1X2BA 1L7AA 3DYVA 4KJXA 4BATA 2XUOA 4B82A 1TIBA 1QLWA 2C0QA 2WG2A 4E14A 4NMWA 4G4IA 3WA7A 2C58A 4X71A 1CUWA 3IUMA 1M33A 5CT9A 4XWGA 2D0DA 1TCCA 4BVJA 4JNCA 2C0PA 3ED1A 1LPAB 5KBYA 1ZI9A 4ETWA 1H2ZA 3R3XA 3FSGA 3PDCA 1BN6A 5HF6A 3DQZA 3A70A 3DJYA 2V9ZA 1E8MA 4B9EA 3LCRA 2C5FA 3E1GA 5JADA 3JYHA 3D2AA 3H2HA 4X3CA 4KACA 3DOIA 4K6KA 1N5RA 1BU8A 3R0VA 4IHAA 3E3AA 2EDCA 1RWQA 2C5GA 2WJ4A 2PVSA 2GZSA 4OU4A 3O4IA 1R9NA 3V1KA 1KU0A 4DMHA 1XZLA 3B5EA 3VDXA 5A7FA 2BKLA 4HXFB 3I2HA 2XMSA 1HL7A 2Z5GA 3ANSA 4X00A 1I6WA 5A7HA 4H7EA 4B0PA 3RK4A 4C89A 4CCWA 3R3UA 1X2EA 1WB4A 1H23A 3SK0A 4BCDA 2VAVA 3PI6A 4DNPA 3QPCA 5AK3A 5ESRA 2OLEA 3D0KA 3H2JA 2FX5A 3FYUC 4V2IA 4BTVA 1JJIA 3V1MA 1CUGA 3PE6A 4K5QA 5SYNA 1R1DA 1XZGA 3C6YA 3QMVA 5EHZA 4L72A 3V9AA 1BROA 3TEJA 4Y2PA 3T52A 5AKZA 2JGEA 3GELA 4W1RA 2E3JA 3C6XA 1ZJ5A 3DDUA 5FV4A 1DT3A 2WG0A 4K6HA 4AX4A 4HRXA 5AOCA 1YAHA 2QUAA 5ALRA 2WFZA 2GYUA 3HEAA 2VSQA 4ARBA 2WSLA 3DL7A 3R41A 3IUNA 4GEGA 5ALSA 1XRRA 3PFCA 4BE9A 4J0GA 4G9EA 4W1SA 1F0NA 4HRYA 4DNOA 1Z68A 3EQ7A 1R88A 3G0BA 5LZ4A 4LYDA 2ECFA 3FCXA 3WMRA 2JGKA 4WFKA 2ZSHA 2LIPA 3UUEA 4RNCA 5CH3A 5K3FB 1AQLA 3U0VA 2H1IA 2VTVA 4W63A 3I2JA 4OYLA 2XUDA 3D5EA 2YH2A 1MNAA 5AM5A 4G8BA 5AOBA 4GWLA 4W1PA 1JU4A 2WUEA 3LIPA 1CEXA 2BGRA 4BDTA 2PBLA 4UHFA 5I7UA 1Y7IA 1TQHA 4LXGA 1XRMA 1JMYA 2DHDA 2PUJA 1PV1A 4LIPD 2B20A 3NOXA 3D7RA 1IUOA 2HM7A 4WCVA 1UXOA 4BE4A 1AX9A 2WFMA 2OCIA 2AJ8A 2HADA 1CUYA 2VJBA 1DX6A 3QBJA 4G1FA 4ITVA 4PF1A 3OG9A 1WPRA 1AGYA 3C8DA 4EZIA 1R9MA 2RONA 3CCBA 1WB6A 3QYJA 3MGAA 2RI6A 5AI4A 2WUGA 5JIBA 4BBZA 1DQYA 3DS8A 3FLEA 3C45A 4XX1A 5ALHA 3QMWA 1A8SA 4FWBA 1CIJA 3QITA 5BWCA 3WK8A 2W6CX 2CJPA 3EQ9A 1SFRA 3RARA 4BVKA 2QKYA 4GW3A 3DKKA 4H35A 1QGED 4UBJA 5ISMA 2VJAA 5FP0A 1N1MA 4DM7A 3WZLA 3H2IA 5LP1A 4AO7A 5A6VA 1HLGA 4PV7A 2CEKA 4MWSA 4YK7A 2CKMA 4DNFA 4G4JA 1E5TA 1WM1A 4ZI5A 3WWDA 3G02A 3ZLTA 3O0DA 1P0PA 5ALMA 5IVHA 2JGIA 3DL4A 4HS9A 1QIDA 3AILA 5A71A 4EA6A 3IIIA 4A16A 4Y2UA 1UT6A 5AKJA 4FHZA 4DIUA 2QTBA 3FWHA 1RP1A 3G0GA 5AM2A 1NX9A 3DEAA 2QRUA 1MAHA 4I19A 1J07A 2VJDA 2BUCA 3WYNA 4HZGA 3U1TA 1CPYA 4QDOA 2AJCA 1XZMA 5ALQA 4X91A 1VA4A 1YAJA 2NW6A 1ACJA 4GBGA 3G9TA 4J0CA 4N5IX 1D07A 3AIMA 1EDDA 3ZI7A 1ZIXA 1SC9A 4OD0A 5AI0A 4DMKA 4AN1A 4P92A 5AH0A 4BZZA 3EIOA 3IA2A 4OUKX 5EIEA 1CFJA 1UKAA 4FNGA 1XFDA 3PICA 4EY4A 1ZD5A 3WWOA 4G5XA 4DGQA 4D9JA 5JASA 1ODCA 2WHRA 5AHXA 5JALA 1P0MA 1U65A 4KE8A 2QXUA 4CG2A 2Z8XA 4BVLA 5AOAA 1VXRA 2VJCA 5FPQA 1R4ZA 2B61A 5AM1A 1P0IA 3V1NA 2PL5A 4J0IA 1LPOA 1FSSA 3VVLA 4UFNA 1XKTA 3O4GA 2OCGA 3OPMA 3WWEA 3C5VA 4X85A 3JWEA 1AURA 3I1IA 3A2MA 4XIIA 1WPXA 5HFNA 3AFIA 5I9IA 4A23A 3ZWQA 3ANTA 1MN6A 2QMQA 1AMNA 2XUFA 5AI9A 3RKSA 3F8SA 5D7BA 5C7YA 3FVTA 5JAPA 3ZLVA 4WJLA 1XRLA 5ALPA 4QLOA 1U4NA 4I4CA 3GFFA 3STUA 4J0JA 2HHAA 1USWA 2OCLA 1AUOA 4HXEB 3A2NA 1FJ2A 4U2DA 1EVQA 4BCBA 1YS2X 5JD6A 3EF3A 5AI5A 4Q3OA 4BAZA 5JD4A 3WYDA 5CBKA 3IURA 4Q1VA 2JBWA 2X8BA 4CIAA 3RM3A 3L1JA 1CUZA 4N8DA 5JARA 4CI9A 4F0JA 2V98A 1UOPA 5EIAA 4Y2TA 2H7XA 1QTIA 2WIFA 4C4YA 3WKAA 1NU6A 1KU6A 1XLVA 1KEZA 2XMZA 2XUJA 1ZGCA 1WB5A 4Y2JA 1B6GA 1SCQA 3HC7A 3BJMA 4CCYB 3STXA 4QEKA 1EDEA 3AZQA 1BCRA 3EBLA 4AZ3A 2XUGA 1ETHA 2C4HA 4N8EA 4J0KA 5ALIA 3I2FA 1CQWA 4FBMA 3R3WA 1EB8A 4GLBA 2PUHA 5DLPA 3CCCA 1EI9A 2HA7A 1TAHA 5J3JA 1GQSA 2HU8A 1CUBA 5AKIA 3PF8A 4KR0A 1XRNA 1THGA 4KAJA 2VA9A 3NWOA 2WIKA 2BFNA 2VEOA 4F5ZA 4B81A 1W1IA 3MUOA 2RHTA 5FDFA 3X3HA 4C01A 1FFDA 5T4HA 2WIDA 3HJUA 2HFJA 4BB0A 3NGMA 4Y2SA 4NS4A 4FOLA 4QDXA 2R8BA 1BS9A 2AXEA 1UK8A 4U2CA 4F21A 1IVYA 3W06A 3H2KA 3LS2A 5HQ3B 3QPDA 1UZAA 5HQ3A 1H2WA 4KAAA 1E8DA 1YR2A 3ZV7A 2XQFA 2J4CA 2ONCA 3ZLUA 4BAUA 2H7CA 2PSHA 1C7JA 1MNQA 1CUVA 1A88A 5T4EA 1MX1A 1EH5A 3E0XA 3OM8A 4BRZA 2G63A 1EA5A 1N8SA 1XZIA 3HRHA 1LLFA 2RHWA 1CVLA 3P2MA 2O7RA 3VJKA 2GBCA 2QM0A 2XUPA 1LPBB 4HXGA 3R40A 4ZV9A 1XLUA 3V48A 1BEEA 5CXXA 2WIJA 3FBWA 2ORYA 4MYSA 3FSGD 3OOSA 5CMLA 2QOEA 1TRHA 3M83A 5ALGA 1BEZA 2OG1A 1L7RA 1AKNA 5DWDA 1ZI8A 2I78A 1WHSA 5AK4A 3HYSA 1OILA 5EIHA 2FJ0A 2BAGA 2Z8ZA 4B80A 4MQLA 1LGYA 4QDTA 5AM3A 4CG3A 3D2BA 4BZWA 2AJDA 4UBNA 4LXHA 4FFVA 4X7BA 3I1YA 1ZD3A 3AIOA 4U2EA 5HCUA 4B84A 2EDAA 3G9ZA 1LPSA 4B0OA 5FLKA 5LKAA 1CR6A 2QXTA 2QUBA 2ZJ7A 3OTQA 1XKLA 1Q0RA 1W4LA 1BN7A 4OB8A 4FLFA 3WL6A 2ZYHA 1Y7HA 2Y1KA 3FLAA 4CG1A 4W1QA 5DNWA 5C8XA 2WTMA 1YA4A 3B3QA 4JUIA 3TJMA 2O2IA 1H22A 4MQMA 4QDUA 4YASA 3LLCA 4MYDA 4MEAA 4BAGA 1CUJA 3C87A 1U8EA 3QMMA 2W22A 2XQKA 3G9UA 4XJVA 4U2GA 1XZCA 1K4YA 4EY7A 3RLIA 3WJ1A 4BDSA 3IDAA 4H7KA 2HL6A 1DQZA 4BP9A 4LHEA 5AK5A 3GROA 2JF0A 3F96A 1HBJA 5ALTA 1K63A 1TCAA 2X76A 1MX9A 3R3VA 5JZBA 1LZLA 1ZI6A 3STTA 3N0TA 3FYTA 5JD5A 4AZ0A 2VT7A 1GQRA 4BC0A 4ZGBA 3VJMA 3WL8A 4EBBA 5AO9A 5EHXA 3KWJA 4OCZA 2I03A 2WILA 5BV7A 2DCMA 1W6RA 6YASA 2WU4A 3IVMA 2VQ6A 4FDMA 4PW0A 2C7BA 3I6YA 1DT5A 3BJRA 1AC5A 4MEBA 1EK1A 2JGLA 3Q8WA 1CUIA 1QIJA 5K3FA 4OYYA 2DR0A 2O2HA 4PSCA 3QH4A 1YCDA 1E89A 2PSFA 3AZPA 5T4BA 2XQIA 3F97A 3LP5A 4C4XA 4CIBA 3TGLA 1THTA 5E4TA 1YS1X 5D3KA 2Y6UA 3H19A 3IBTA 4C88A 2Y2UA 3GZJA 5C81A 1VZ2A 2GZRA 1LPMA 1N5MA 1JT2A 5IKXA 5HKBA 1GPNA 5AK6A 5JAHA 5FOQA 2WIGA 1FFBA 5AIAA 4FLMA 3WWCA 3W2TA 4HVTA 1CUUA 2Y2VA 1E66A 5EGNA 2HIHA 1ZGBA 4DSAA 1K8QA 2GYVA 3STWA 5DYWA 3WI7A 1O6FA 5CW2A 3A2LA 4UPDA 2XB6A 2YASA 3FYUB 3C43A 3FVRA 1XQVA 2WG1A 1L7QA 5K3BA 1QFSA 2XQGA 4M0EA 4EB0A 1MJ5A 1QIKA 1LZKA 5IH7A 2HRQA 2OQIA 4AMYA 1R3DA 1WCYA 1CUXA 3BF8A 4ZREA 4S0XA 4FNMA 2PSDA 2WM2A 5ALZA 5FRDA 3I2GA 1JKMA 2HA0A 5HZGA 3ESBA 2OCKA 3LIIA 1J2EA 1X70A 1IMJA 2XT0A 4MWTA 4H7HA 2X5XA 4PSUA 2Q0XA 2ZVDA 3VXKA 2PU7A 4PSDA 3AINA 4QWMA 5ALEA 2UZ0A 3IUJA 2JEYA 2B4KA 1G42A 5AKHA 5AJHA 2ZYIA 4KE9A 1IUPA 2OAGA 1TK3A 3WK6A 1GXSA 3W04A 1ACLA 4HAIA 4M0FA 3DCNA 4AMZA 5HK9A 4QLAA 5HF5A 3BIXA 1MAAA 4QZVA 2QT9A 1XQXA 2HU5A 2B9VA 1CUEA 1A8QA 3BE8A 1J1IA 3C6ZA 4QNNA 4Z49A 1QIMA 4DYHA 4BYMA 3JW8A 1B41A 3NUZA 4WDQA 3HACA 2JGFA 1JFRA 5LZ9A 5HFAA 4UBMA 2H9YA 2DQZA 2XUIA 4UHCA 3I6MA 1TKRA 3TRDA 1XLWA 4RGYA 1ODSA 2QS9A 4E15A 3G0CA 4LXIA 4QA9A 2OXEA 3FYUA 4H0CA 1CQZA 2Z3ZA 2QZPA 3GA7A 1MO2A 4NZZA 5E2IA 2G5TA 3IB3A 3CN7A 2ZYSA 5ALFA 1OCEA 5JATA 3I2IA 1ZD2P 3SWWA 3MUNA 3OURA 3K9BA 1Q84A 4UUQA 2RIPA 3CN9A 1HQDA 4J03A 3PF9A 5FUMA 3WK7A 1XZDA 4AQDA 4A5SA 3WZMA 1GGVA 1EB9A 1W75A 3WKEA 4Q05A 1LPNA 4L3WA 1QTRA 5JAUA 5LYYA 4TPKA 1CUAA 2J3QA 4Y2QA 5AICA 1ODTC 5JANA 1XZHA 2WKWA 4KRYA 2H7YA 5LZ5A 1IUNA 1H2XA 2YXPX 4JEIA 4ROTA 1QZ3A 4IH4A 3WIBA 1DWOA 2PSJA 3WLAA 1ZICA 5IVKA 3QVMA 4Q82A 3WK4A 2ZJ6A 1G66A 1A8UA 3K2IA 2G4LA 2J4FA 1CUCA 5ALOA 4UBIA 3VVMA 1DWQA 1QIHA 4B6GA 4DLNA 2DHEA 3G0DA 4WDRA 4EY5A 3G7NA 2CB9A 3PUHA 4B83A 3KD2A 2XUKA 1Q83A 1CUHA 2I3DA 1QIEA 4E46A 5LLSA 1GZ7A 1MX5A 3WKDA 3C6BA 2OPHA 1SCIA 2Y6VA 3O9VA 5ALDA 3F98A 3FOBA 5LZ8A 4KE7A 2VT6A 1QO9A 4J3JA 3A6ZA 4IO0A 2O7VA 1ORVA 2JIDA 3W9UA 1GPLA 3D2CA 3W9BA 4H7IA 1CV2A 3DKRA 5IVIA 1MT3A 2XLCA 3AUKA 2ACEA 1EINA 1EVEA 2HU7A 5AKKA 1XZKA 3IUQA 1YA8A 2XMCA 4X6XA 1C4XA 1MTZA 3VKFA 3H18A 4FTWA 1XZJA 1JU3A 1A7UA 1BCSA 5K3AA 3HZOA 3WK5A 4XVCA 2PU5A 1P0QA 4QE3A 1UKCA 3E4DA 5C8ZA 4DTCA 4MJ3A 4H7FA 2V96A 2BUAA 2O2GA 4Q34A 4C87A 1R50A 1ZJ4A 3HXKA 4UHBA 1QIGA 3UUFA 1U2EA 2WUFA 5EI5A 4BP8A 4L0CA 1RYYA 1Y37A 3M82A 2V97A 3T4UA 1K5PA 2DSNA 1EHYA 1FFAA 1PJAA 3ESAA 5ALKA 4CFSA 3O9MA 5BOVA 4AO8A 4W9RA 5FPPA 1FFEA 1GT6A 3DNMA 5DTIA 2GBFA 2IX9A 5JYCA 4P93A 4UBLA 4AXBA 4OB6A 4WFJA 3QPAA 1XRQA 2WHPB 3WL5A 4ZV7A 1LBSA 3G8YA 5H3HA 4M0MA 4OPMA 5EHNA 1UK7A 4L9AA 4X95A 4UHHA 3ZPXA 5ALLA 5FKJA 4PQEA 1CRLA 2XUHA 4K2AA 3GUUA 5I8PA 4U2FA 5ALXA 4IQ4A 2HRRA 5DYTA 5AKYA 1WOMA 4OB7A 3I28A 1ISPA 5CURA 5JZSA 4FMPA 5LZ2A 5C8VA 3ICWA 2AJLI 4I3FA 1C7IA 1DINA 4OU5A 4Y2VA 5ALUA 5CH5A 1TCBA 2HDWA 1XROA 1DWPA 1EXWA 3BDIA 4C4ZA 5A2GA 1VZ3A 1QONA 3D4LA 2WUDA 2AJBA 3WK9A 1F6WA 2I3ZA 2QJRA 2GBIA 3H2GA 3N2ZB 3MVEA 5ALWA 1XZEA 3BWXA 3WA6A 3WL7A 2PKYX 4K6GA 4DNQA 4NVRA 5SYMA 1EK2A 4Q3LA 3O95A 3STYA 1H2YA 3FLBA 4QDZA 2QJWA 4H7JA 5E4YA 1XQYA 2WTNA 2ZYRA 2XMRA 1QO7A 1UKBA 2OGSA 5ALVA 2ROQA 4UHDA 2G5PA 3IULA 4GXNA 3D3NA 3Q0TA 5EFZA 1JMKC 5CRIA 5AM0A 4FFWA 5A7GA 2ACKA 2PPLA 4BCCA 2FUKA 3STVA 1UOQA 4EUSA 4JH0A 4LKOA 5AKLA 1IZ8A 5T4FA 4KAFA 4KRXA 2JGMA 4WFIA 2XLBA 3FNBA 4E11A 4ZRDA 1LBTA 4AN0A 3WQHA 4UBKA 3HI4A 4ZXFA 2HA2A 1ZOIA 2OAEA 4RE5A 3BDVA 1GKKA 3CXUA 3ILSA 3KOOA 4YPVA 1NU8A 4PO3X 4UFOA 2BUBA 5E4JA 4MXDA 4GHWA 4RPCA 5DYYA 2XI4A 4B7ZA 3DOHA 1XQWA 3DLTA 2Z3WA 1VJ5A 1HKHA 4OSEA 1XZAA 1AZWA 2HA5A 1EX9A 2K2QB 2EEPA 1CLEA 1UK6A 3I2KA 2CUTA 1BRTA 1VXOA 3FAKA 4GECA 4X90A 1VA5A 1DTEA 4ARAA 3QZUA 4UHEA 7YASA 3FCYA 3SX4A 1CUFA 4G8DA 4IH9A 1GPKA 2HA4A 4Y2RA 1YB7A 3C70A 4TGLA 2ZSIA 5EHQA 3SC2A 4JYPA 2YYSA 3HSSA 5DJ5A 1W52X 3L1IA 1DX4A 1JJFA 1LPPA 2HFKA 1S8OA 2IITA 5DTJA 1F0PA 5HF8A 1QE3A 3KDAA 2D5LA 5ALNA 3AIKA 3R3YA 5DNVA
chains in the Genus database with same CATH superfamily
2GD2A 3AR6A 4H7DA 1D5WA 3NAZA 1BXRA 2ZI7A 3R24A 4LRYA 2QT0A 4R31A 1RXUA 3S5JA 4D92A 1P29A 2AN3A 1AU9A 2LTAA 2QQGA 5GPBA 3VPSA 2P9BA 1EZ1A 1FFCA 2FSIA 2R6FA 2C83A 2WABA 3M4JA 3ZXIA 4WA7A 4G9GA 3GG9A 5IULC 1JA0A 5GIOE 3WHPA 4PLYA 4C6RA 4EPYA 2VDLB 2LDBA 1FVFA 2JIOA 3DB1A 4JUFA 1BDHA 1IXKA 1M75A 4R2MA 3U3OA 2J0SA 4XUCA 2ZJ2A 3OHPA 1BXGA 2PH1A 4TLDA 5D3MA 4EKNB 5C8DA 4X61A 4ZWNA 4HGQA 4Q1FA 3VZDA 1T4DA 2HZ7A 1PZMA 1JJBA 1GN8A 2H1HA 2ONYA 3NM5A 5ANRB 2QRQA 1CUDA 5DWVA 4EI7A 1EDBA 4G4GA 1KZ1A 4MTCA 3KOZA 4UHKA 1FPMA 2ZTMA 5CLGA 4BZXA 1T3ZA 1Y4SA 2A0XA 3G5TA 5EIFA 2FEAA 4IR7A 1ZJJA 1G59A 1Q0QA 1DE0A 2W0MA 2ISQA 2PKXA 5A5GA 1W46A 1O0SA 4EKGA 2C5EA 4PX2A 2P2GA 1L7XA 2P4HX 1F8XA 2R47A 1V96A 1GQFA 3EF0A 2Z83A 1Q50A 1V7PC 2W4QA 4LC0A 4MR8A 4BNTA 3GARA 2HK8A 5L4LA 2ZE6A 4ENWA 1JPNA 2XB9A 1HYEA 1ZIPA 5IANA 2GZ2A 3IXLA 5B7NA 2V0GA 1DU4A 2NQ2C 3QM1A 5JCXA 2FE1A 5HDQA 4L5JA 2IIVA 3HDHA 1Q1ZA 4URWR 3ENZA 2X2OA 3JYPA 4UXHA 4WE3A 1U0BB 5DNUA 4JJGA 4RTSA 2Y4OA 1EWYA 4TS4A 1DXQA 2GILA 3ETEA 3QVVA 5EKDA 1NDQA 2AFHB 3IVXA 3LC7O 4LBVA 2MCFA 1Z73A 2A5FA 3GBPA 3KFLA 4BNIA 3G5AA 4EY6A 1QG4A 2CNKA 2FMFA 2GK4A 2NXWA 2YVQA 4GI5A 4K9RA 2QPLA 4Y1RB 1F0YA 1GG8A 4EGAA 1QYDA 2DMRA 3HV0A 2ZBFA 1VLJA 5BPHA 1MFQC 1C30B 1NMQA 3CV3A 4L6IA 4HNSA 4KNWA 3HCNA 5AUOB 1UP7A 1RCTE 3OBIA 2ICAA 1NJSA 3HJGA 2YX1A 4WXEA 1TMGE 3OQNA 2VF8A 2QG6A 4PQGA 1HURA 3PEFA 3KKPA 3O9ZA 1PQPA 3FUWA 3GAFA 1PL6A 2YN2A 1E2FA 4UUMA 3KLPX 1W0CA 1ZWLA 5JFTA 3CH4B 5I8ZA 4D8TA 3NBZC 2CZQA 2CJFA 2FEPA 4WRRA 1WXQA 3O8CA 2YRWA 3R5JA 4TZTA 2ODNA 2AOVA 1XOIA 1PYOA 1RABA 2X4DA 5JS2A 2DU8A 2YDXA 2QHXA 3GLFB 2YMQA 5DX0A 3G68A 1X57A 3W3ZB 1L7NA 1P75A 2FGJA 4KAXA 3KQYA 5EE3A 5ENVA 3C7CB 5REQB 2BHSA 3UFBA 2HNBA 1Y9AA 4K6MA 4ETMA 4LRWA 3DDHA 3M1IA 3PVCA 3U13A 1JYFA 2HQSA 3P45A 3TWOA 3PRJA 1U7DA 3PFBA 1VHWA 1HSOA 9ABPA 5BN3B 5K5EA 4I6TA 4JXXA 1QYXA 4GPIB 2JDIA 2JEOA 3LNCA 4F5ZA 2WR8A 1NVBA 3LZ6A 3M3DA 4OXKA 3IE0A 1UJ4A 3T9EA 4D9IA 1T4MA 3NH9A 2BFWA 2B25A 2FRDA 4HLQB 5IUNC 5JZ9A 4WY8A 3NP7A 1MU0A 4N49A 2CDAA 5F1YA 2WHPA 3LECA 2WHQA 4GS5A 3R7NA 1WV0A 5A6SA 5IS2A 3FMIA 3VOAA 4JR0A 2JHGA 2O2SA 3ZHBA 2I33A 2WIBA 2ZPAA 1L6IA 3HU2A 1XK7A 4NWIA 1EWRA 1ONSA 1G8FA 1Z0SA 5DTMA 2FZEA 4N3GA 1SHJA 3QE0A 1XDBA 1ZNXA 1T0HB 2ECQA 2VIIA 4A73A 4F1WA 1SXIA 4I08A 4W5HA 3UAXA 1XB2A 5M04A 2DBRA 2W8BB 5GWXA 4EHDA 4IIJF 3R7DA 4RHYA 1JI3A 1M34B 3LSTA 1XYGA 3JD1A 4COKA 1XKXA 3KNZA 4EELA 1VOTA 3AKCA 3OWOA 1CB7A 1F1JA 4QWWA 5I7AA 1U94A 2UZ1B 4EA9A 5K0BA 1PT9A 2VJOA 3MWYW 2BZ0A 2TRSB 2POQX 2WFLA 4KMOA 1N2ZA 4AJKA 1NJ1A 2Q2QA 3BMQB 3HKCB 1CZNA 1KH2A 3TQOA 2JRCA 2VAXA 3OCJA 1TUGA 5TB5A 1IZ7A 3GOHA 3A9YA 1NBAA 2BRUC 3TZ6A 3NHPA 4CFZA 4EVIA 4EHIA 4YG1A 4EAAA 2ONJA 4J0FA 1TTTA 2VNKA 1ZGHA 3PT9A 3ADDA 5K3CA 2YIVX 3I72A 4EPXA 4C7BA 4FIZA 5TX7A 3CUTA 3CG0A 5I45A 3HBJA 3NTRA 2X9NA 5CT5A 3GCZA 1X1CA 2Q3HA 2W2KA 3CLUD 3ON5A 4FDLA 4JLNA 5CK4A 4LJSA 1VE3A 2FMIA 2QYOA 2I6UA 2P8SA 3RSFA 2NU6A 4F04A 3GJYA 4I1UA 4E07A 4BQRA 1AO3A 4RQAA 1UXIA 1CIPA 4DN6A 1KZHA 2OC4A 1W8DA 5IJ9B 3AJAA 5DI3A 2Q28A 1XEFA 4AUMA 1ZLYA 3KFXA 1JFSA 2WU3A 1W4ZA 5HTKA 2VDKB 4V0RA 4EJMA 3AUYA 4LN1A 2BVNA 3EY9A 4RIGA 1R5NA 4KDFA 1KQPA 2J0UB 1RU3A 4D98A 3QA3E 3EIFA 5KUTA 3ROKA 4PNZA 1PW5A 3WGYA 1EPUA 1U5BB 3DAPA 3ZOZA 2QMZA 3ESYA 4FEEA 4LG1A 4UOQA 5E6UA 1H9AA 1RQGA 1T9GR 3MERA 2GSWA 5I7EA 5AVJA 3FG9A 1DJQA 2UAGA 1Q3HA 2J6HA 1A9PA 2LWIA 2YVAA 3JQEA 2CYCA 2X1LA 3ESCA 4LVNA 3CMCO 5D3ZA 1U2GA 4IUBS 2X8WA 3LUJA 4L02A 2YZKA 3LT2A 1F3LA 4WIAA 4LEIA 3U7FB 5JO0A 2VRCA 1Z2EA 2LCIA 1GGFA 4JY7A 2XMDA 4JDPA 1RTTA 4LYEA 4OJTA 3MMPA 2RCYA 2R6ZA 4IDQA 4LW8A 4OTZA 4ZVNA 1ZIDA 3DYIA 3VRHA 4E31A 5EJ4A 1IEWA 1GLGA 2Y1EA 3QLEA 3RJ9A 4AMVA 4EVRA 4FMCF 1K75A 2JCBA 2X19A 3AFNA 3RAJA 3TVTA 1WY5A 3X43A 1ZITA 4E5SA 3CZ4A 1D04A 4X7PA 3ONNA 1PT8A 4WNIA 2B4RO 2XITA 3I01M 3PYLA 4BB9A 1LSOA 1N6OA 3PCXA 4I4TA 5DXJA 1DO8A 3HLKA 5FL7A 4GKBA 5FTJA 5JLJA 4N3CA 4NE7A 4PCVA 1CZKA 5EJ2A 3OCZA 1Z4LA 2Z2YA 3IQWA 1D4OA 1KP9A 3D3WB 4ZCLA 4EJSA 2H54A 3JTEA 3K9GA 5D84A 2G72A 2VDMB 4GGPA 2P9YA 4XGRA 1U6JA 3SS7X 2QL9A 2XMBA 3KZMA 1E59A 1G5FA 3AM3A 1CDEA 3OF5A 4M0EA 2QTLA 4HDNA 5LLTA 5EE9A 1VE7A 2BJVA 3OQVA 4BNKA 1QPGA 3OPYA 1K08A 1XKQA 1P3DA 3L1HA 3CZMA 4MUGA 5BWBA 2Q62A 2YHIB 5JDIC 5LQKA 1QDEA 2C78A 5FUVA 3QPWA 3R9WA 3DMPA 3PXCX 1E6CA 2CFOA 1QLJA 1BW9B 3TCNA 3HVJA 3D7LA 1QP0A 2QORA 1PRVA 1MJGM 1RPEL 1VLHA 3A06A 1WZEA 3IQFA 3NNDA 3PUKA 5HZMA 5KOJB 2DSTA 2M32A 5LWHA 1V8ZA 4TTSA 3IBCA 3R4VA 1I7SB 4AFNA 3KYDA 5KWIA 4FFBB 5H3LA 1ZJWA 1XTUA 2JLQA 2VATA 4NDAA 4TS3A 5F1KA 2NT4A 2P2SA 4XASA 4P08A 3S68A 3WGKA 3F1LA 2VF5X 1WQ1R 2ZEJA 4OP3A 5B1EA 5ICCA 4WCFC 1O96B 1SOMA 4H77A 5L3QB 2AA3A 1DC8A 1A5ZA 1NOIA 4DRXB 3VH4A 5AIBA 3GT4A 1LWOA 3LPMA 1WUYA 5B30A 1U0SY 3DAFA 3TUJC 4QEZA 2PGXA 1U6KA 4UEOA 2LZ0A 3IT3A 3V4FA 3ZUGA 3G1WA 2DFPA 2JIRA 2VK8A 2AVNA 3NKFA 3V4VB 1YSCA 3SR4A 4X97A 2XMGA 4LWQA 4XSVA 3TZQA 2IQ5A 4F3KA 3FTNA 3H1AA 3CLCA 4TZ6A 1Q91A 3CSDA 2QE6A 1KQOA 1N2JA 4ZAFA 3VC7A 3ZBPA 1FX0B 1ESDA 3W05A 1GXSB 2I66A 1XRJA 2NSLA 2FDXA 1EHCA 1QIFA 1USVA 3H16A 2M9MA 2JVIA 2P9EA 4YX9A 1T35A 1MV5A 2AUTA 3FDIA 4MMYB 4N5HX 5GV7A 1AH2A 1O54A 1OU0A 1QS0B 3PKIA 1JQDA 1ZZEA 4QGFA 2ZJFA 4LWZA 4B2LA 1NNSA 3X1KA 1L7AA 3KV1A 3E82A 4JSTA 4YRCA 4M8SA 2A3NA 3NG1A 3QEMB 4HJRA 4E5VA 3TG8A 4X9XA 3K0CA 3K70B 2BTOA 2WWFA 2G1UA 5KJ1A 1N9GA 4B3IA 1KEVA 4RVSA 3RAGA 1N92A 3OP1A 4EEKA 5EGSA 1G7TA 1U3UA 3CZPA 4RVOA 5IDWA 1FP4B 4O4IF 2BDTA 5LJLA 5LQMA 4FR5A 3VV2A 4N3BA 4BUJA 5MN4A 1DRWA 1RRVA 4IOKA 3HL0A 1SVKA 1X3LA 4MVJG 3IUMA 4TRMA 1Z4MA 5C80A 5K09A 1MQSA 1BW9A 4Q3BA 3ZX5A 1NASA 4R2JA 3PUWA 2XA1A 2XF2A 3H2YA 3IAXA 3DE4X 4B3DA 3QEAZ 4DLRA 4XWGA 2DBQA 4XEUA 2J5KA 3WWEA 4A2WA 1ZSNA 1A50B 1TCCA 4EPTA 1E1QD 1FY2A 1Y6RA 3ZC3A 1JDUA 4A8JB 2I87A 3VTKA 3RRYA 3D64A 3ED1A 1RXVA 3PGXA 1R0LA 2NPFA 1B0NA 3FWZA 3DFKA 4JFAA 1H2ZA 1GL9B 4DQXA 1Z6GA 3JARA 1YSEA 1Y3CE 1ZFNA 2VDUE 3KB1A 3PG5A 4DW8A 1BN6A 2OD9A 3F71A 4JSRA 3ZHUA 4G0MA 4DYDA 1M8KA 5KTOA 4JKOA 3OY7A 2O19A 3LCRA 3SS8A 2VUHB 2PLNA 3BK7A 1PU2A 1TLLA 1E79D 4D25A 5IT5A 5TSDA 3E1GA 5JADA 1Z35A 1Y7TA 3EF1A 3D2AA 3L7NA 3NBFA 1SULA 3H2HA 1S2LA 2HRBA 1ZZGA 5JHGB 4X3CA 4BU0A 4KACA 4JQOA 2A9JA 4ZXPA 1OAOC 3AB7A 2H1WA 2V0NA 3GBFA 4HZUA 2O8NA 1N5RA 1X8JA 3D81A 4ND3A 3DPIA 3SI7A 1AQ6A 4OLHA 3E3AA 4RVNA 1S9DA 3WP1B 2B1IA 4EYSA 1I0IA 4PO9A 5JVDA 2Q99A 3CZQA 3JYQA 1P4RA 2HQOA 1U8FO 1J6UA 1QHNA 3AFGA 4FYJA 4Q1BA 5ECDA 4J1SA 3WOHA 2C3MA 4PSAA 4QGHA 4RK6A 5HHTA 4U9IS 4MGHA 1T0BA 3D3EA 5FPYA 3OQOA 2ZE8A 1APBA 3PC8A 2JRLA 3BH7A 3BILA 2ADMA 2JHPA 3V1KA 5IZCA 1ADBA 4DMHA 3UPTA 3ISTA 4X4EA 1W1UA 2OVFA 3ZE1B 1YDMA 2I2XB 1EXVA 4KH0A 2F8MA 1AK9A 5AOVA 3VDXA 3NBAA 2BKLA 3CW8X 1OT5A 1KZGB 5BQ5A 3VOTA 5L3QA 1SQ8A 3S8MA 3SQWA 3HJRA 3Q8LA 4HMPA 4OQNA 1L4MA 3R6GA 3ZZ0A 2J0UA 2O1SA 3LQQA 4HWRA 4TS9A 2NYUA 1D0SA 4X00A 3LU1A 1KI6A 1H42A 3Q7RA 3BTVA 5L9AA 4M87A 4EL0A 2VZ8A 3N6RA 3RODA 4CGYA 1RYNA 3DPSA 5IJ9A 5LMCA 1V95A 1H1TA 1IQRA 2W6NA 2XXJA 4U02A 4HGZA 5C52B 2D2XA 4CCWA 3QU2A 4LZNA 3CNBA 3FM9A 5AJUA 4AICA 4ENUA 1NUHA 2VAVA 4KQKA 5FBRB 5B3AA 4MW1A 4LCEA 4UU0A 3RSGA 4FGKA 1LLQA 4C5AA 4CT4B 4D3DA 3I04A 1B76A 1LJUA 2B7CA 1O58A 2FETA 3AXTA 2YJ3A 4UVGA 2PQ0A 3MWDB 4I8IA 1JT9A 3T35A 2PKRA 4A92A 5A3JA 4BTVA 2JIZD 2LUOA 5IUJC 2P4SA 1E61A 3ORQA 3B8EA 3TLEA 5KSZA 4NAHA 2W9XA 4BTEA 3LQFA 1J2RA 3PE6A 1VPEA 2UU9B 3RT7A 2LDXA 3QVSA 3C6YA 2NVBA 2X6QA 5EWLA 4BMVA 1ZOLA 3IHLA 5EE5B 2D1FA 1SH7A 4D4IA 3PFIA 5HOEA 3SJZA 1A2OA 2YZNA 4GC9A 4JD5A 3DWGA 5AKZA 4ZT7A 3V1UA 1KEKA 2IBSA 4DXHA 3GN5A 4ENSA 1JZSA 1II9A 2QN2A 1IZYA 3C6XA 1ZJ5A 3H1FA 5KCMA 3O2NA 2WUSR 5FV4A 4LDZA 3BMCA 2GN1A 3VTZA 3B6KA 3S4YA 5CG2A 2GXQA 1N9KA 5AOCA 4DJ5X 3T94A 4V38A 4L5YA 3DGEC 1E3IA 2CF5A 2Z1NA 4B79A 5AW3A 2NNWB 3OA0A 1XRSB 1XDZA 2QUAA 3WB2A 3UB3A 3WSVA 2OWEA 2NU7A 3JQAB 3BXGA 3ECAA 4PYOA 4ZT4A 4PC6A 5G3YA 4Z1MA 2QF7A 3KOWA 3TLMA 3V8VA 3ZE6A 4RHCA 1NG1A 4EHKA 3BQ9A 3QW4B 1RZVA 2YV1A 3HEAA 3G89A 2WSLA 3E23A 4PWYA 4Y9DA 4KSYA 5L40A 3QV1A 4JOQA 3T9BA 3IUNA 3MTJA 1NNEA 1XRRA 3ZQ4A 3PFCA 3QVWA 1LDGA 4K6CA 4FXOA 2Z2KA 1WULS 3O82A 2AT1A 1C4KA 1T43A 1UMBA 1V1MB 2QRJA 2VP6A 4G9EA 4NBSA 3GJ0A 2X14A 1UT5A 4R7TA 3JZDA 4H0NA 1RMYA 2IYAA 2VN8A 1TD9A 2X0IA 4X8MA 1XU7A 1QQ5A 1Z2OX 1IBKB 4RJLA 3A3NA 3NHSA 3C3CA 4HNUA 4P58A 4ZODA 2CLKB 3GRKA 3QV2A 4MQFB 2J1LA 1BQEA 2YJGA 4A0GA 2DX7A 4KP7A 1GZDA 1PVDA 4RDIA 4OLAA 4ERXA 3HWWA 4KQCA 5K0SA 5KEIA 3HN2A 4IINA 4MJXA 4RL4A 1Z5VA 2X15A 2ZSHA 4F93B 1M73E 4P54A 1E9DA 3KE9A 5JZBA 1QK5A 4BJHB 3ZV6A 2F8LA 3EHEA 2PAAA 4R5HA 2VWGA 1ZRMA 4BP3A 1XMQB 4LHYA 4W63A 4FEGA 5TQ2B 3GCGA 2PZGA 1XTKA 3TR5A 3ZDQA 1CJGA 1C30A 2A5GA 1MNAA 4RV5A 5DMXA 5AM5A 3B70A 2GHQA 2XNHA 1ENOA 2HI0A 2Y3IA 2PRSA 5KOHA 1SU6A 1ZW6A 4I46A 4QO8A 3SSOA 3JQQA 3EWNA 1C7EA 1V3UA 2ZBDA 1TGYA 3IO5A 3ZK8A 4R9SA 1USGA 1JU4A 4M8LA 2AQ8A 4TKUA 5DK4A 3HXTA 3VDNB 2CL7X 1EVKA 4MCIA 4EB8A 3T1HB 2XGJA 4KOEC 1SKYB 2WUEA 3D4NA 1CEXA 2PL9A 2BGRA 3QG1A 3PEWA 2C2GA 2PXBA 4BEVA 2ZYAA 2LYJA 2WKQA 3MS7A 3NX4A 1H2AS 1SCUB 1HY3A 1IB0A 2CNWA 1CDZA 1PF7E 1YRAA 3MM4A 4LXGA 5B3JC 2JA1A 5CU7A 4ESEA 3WMGA 2VH2A 3W6ZA 3SZMA 3I12A 1N3YA 5HIIA 2Q9CA 4B71A 4FCWA 2G9VA 1G6KA 1NKVA 3K2BA 3A31A 4LXXA 2CE2X 3RUEA 3ZHIA 4F46A 4IHQA 1NUSA 2YWHA 1M1UA 1SU8A 4QXOA 4WXMA 1SK8A 5CB8A 5KS2A 2NU9B 2FVXA 3LKVA 1XEWY 4CQMA 5E9QA 1WXHA 3VYWA 1VPVA 4GRAA 4YGYA 3EC2A 5TF0A 2Z3VA 3K8QA 1AX9A 4X4GA 1D7AA 1RLUA 1ZHHA 2CC2A 3RTGA 4S05A 5AXDA 2HADA 4ZOBA 1NURA 1LSUA 4IGIA 1TKBA 2VJBA 1CR0A 4G1FA 3HHPA 4PLPA 3DF7A 4CIVA 1B74A 1N6RA 2JFHA 3N0WA 3W5JA 3NWPA 5TY0A 3KOUA 2FFJA 2GHRA 3W5VA 3B3AA 3RABA 3V8MA 1T6NA 1YI0A 3GLFA 2BCJQ 4PF1A 2M6KA 3RBVA 3FR8A 3OG9A 4G4SP 1WPRA 3VYTB 4M1QA 1R0SA 3C8DA 1OHHA 2ODQA 3UOWA 3F7MA 1WB6A 4RMHA 3TTXA 4MLDA 1V39A 5A3RA 5J1TB 4KXVA 5E4FA 4OL9A 4TLMB 1QF6A 4ER6A 4JVMA 3AUTA 5JDIA 4JOCA 3DTVA 4KLNA 4G24A 1I7QB 2YBDA 2G06A 5EA2A 2ZYDA 3NHUA 3D3JA 3ENNA 5JIBA 3AOGA 2FZKA 3AR5A 3EVEA 3CCFA 3WSWA 2Q4OA 2PKEA 1ZH6A 2L1PA 5KWEA 3W7BA 1RVDA 5EPEA 5TGTA 3JXEA 3TKAA 3MGGA 4UARA 4U0KA 4BZQA 5LB4A 2W6CX 3B1XA 3CZAA 3NAGA 3TBHA 5ITZB 1IPEA 3EA5A 3GRYA 4GPEA 3H75A 4MKIA 4XSHA 4V03A 5AW7A 4B8ZA 3DDOA 1SZDA 8AT1A 4BO2A 3RARA 1WQ4A 3FDFA 2FPRA 3CE6A 5JSKA 1V45E 2PUAA 4UBJA 1E6KA 2VJAA 5FP0A 2HC9A 1ZOOA 4A0HA 4FN3A 4LZZA 2OV4A 2BR3A 2DUJA 2OZEA 1P4GA 3N5CA 1VLVA 4LSZA 3GJSA 4EZEA 4PV7A 3RYFA 1KYZA 4HDMA 4JBWA 2P69A 4LV6A 4IJKA 2F67A 3BGWA 4MWSA 4YK7A 5KNBA 1P45A 2CKMA 1TM3E 3AYZB 5DEIA 4UMVA 3OX4A 3SFVA 4BNWA 2DH6A 1YACA 3T3NA 1JDJA 3I9JA 1NLMA 1QFXA 4RDHA 4ZI5A 5BPFA 3G0HA 3OMWA 2BNOA 5HFJA 1TOAA 5G0UA 4ALJA 1GA1A 1PT5A 2ZDHA 1P74A 3NHKA 1UXDA 1JSRA 3KQMA 5JJBA 2I3AA 1RMQA 3N6VA 3RC1A 4GKAA 5I8WA 2VJNA 4QPJC 3FX2A 3DV2A 2R7LA 1I51A 3V8NA 1RYBA 4K88A 4TV9B 2H8KA 1VHTA 1H0KA 1GO2A 2NU8B 5I48A 1QIDA 3EXIB 4R3WA 4P33A 4AJ2A 3AILA 4C2TA 1J00A 4PG7A 1F2TB 1YDFA 4E2WA 2CGEA 4BNYA 4EFKA 3OIUA 1GRQA 4BX3A 2ILTA 1V7QA 9MHTA 3H11B 3IIIA 3J81k 3B7PA 4DB2A 1W29A 3HP7A 4A16A 5FOSA 4Y2UA 3MSCA 5C51B 4FKMA 2OA0A 3V42A 4DQVA 2CSFA 3FFBA 5BV0A 3A4MA 3JASA 2QUZA 1HTTA 1KDVA 4P7GA 4BKQA 4E7OA 4TZ0A 2CCGA 4JYCA 3FWHA 2PR7A 4DR4B 1RI2A 1UBEA 4QOEA 1JKFA 4BV2A 3C6KA 3R3JA 1VYTA 2R8EA 3PGA1 4Y6RA 4I19A 1PSDA 1IC8A 2M1ZA 1UKEA 4QXRA 4C0WA 3I5XA 3D1NI 2KX7A 3WZ2A 3VSAA 3FMPB 2YWEA 721PA 4EQ6A 1BH6A 1NRXA 3NCTA 2BM9A 3HFGA 4ZQFA 3KVYA 5KTKA 1F8FA 1BCSB 1EQUA 3KZCA 5CB6A 2VJDA 1TEZA 1TYEB 1VKNA 4HG2A 3SF0A 3KAKA 2FWMX 4W5OA 3U1TA 5EWJA 5HJ2A 3L8DA 3L8ZA 1GTG1 2WRZA 1QP4A 3DEHA 3W1WA 4EMUA 3A0RB 2QR3A 1JA1A 1W85A 2OXCA 4M9RA 1GWNA 1UT8A 2D1YA 2L2QA 1RQ7A 3H1PA 3RVBA 4B2YA 1W7AA 5FBKA 2VQEB 1XDDA 2MYUA 4QYIB 2JAHA 4ZI3A 1ACJA 4CYMA 3SE0A 1ZD9A 1NYLA 3LVBA 2O5VA 5JYBA 4IICA 2TYSB 2MYTA 3C39A 3BERA 1XCPA 2OFYA 1CZRA 3VVBA 3M5CA 4D4JA 2Z8YA 5DM0A 4XIYA 2HWXA 4WEOA 4U9HS 3KQSA 3EGOA 5DO9A 3TKLA 2P3OA 4RELA 4EW2A 2XA9A 2ENWA 6GPBA 2ZBUA 3OE1A 4H6VA 4BNNA 3WLRA 3KSZO 4KQ9A 5D5PA 4Y6GB 1YZVA 1EAMA 1BCRB 4P92A 4ZOEA 3THXB 3UWDA 3MTAA 3SHWA 3W8EA 1S8NA 4MWBA 2FW1A 2IVBA 3QOWA 4DIEA 1IY1A 4Y18A 2IOQA 4FNGA 2BMWA 4EFLA 2LYQA 4F2HA 4FHCA 3B7WA 2QVXX 3JCZA 2ID9A 1U6IA 4EY4A 3VKGA 1HYBA 3I76A 4MRMA 4GNRA 4QUJA 4BBPA 2CDCA 3WWOA 3DO5A 5FTNA 4B4KA 1SBIA 4ASUD 4D9JA 4DGQA 1EX1A 1RWXA 2C2WA 2J59A 2JD0A 2R65A 2H11A 2QN3A 3IHTA 4IFEA 4LOKA 3JQ7B 4MB6A 3GDHA 2OOKA 3KKMA 1XD2B 3VR5H 4BE7B 3RWBA 5LU8A 3UMFA 1Y6FA 1G2PA 3KUXA 1U9IC 4FX5A 3Q9SA 2QXUA 4E2ZA 5A9SB 4CLRA 3I6IA 3AHDA 5AW9A 4O1HA 5EZYA 3F6SA 3VC1A 4XQGA 1AS2A 5B7GA 1JIIA 2O2ZA 2Z8XA 4R8LA 5JSYA 4UM5A 1SG9A 3Q7TA 1AIPA 4W7SA 1JJAA 1Q44A 1MVNA 1F2UA 2VXYA 1XVIA 5F4BA 1E1RD 1KYYA 2X58A 2Q3EA 1P0IA 1OHHD 3KJXA 1CQJB 4AWBA 4MPTA 1L3IA 3WO1A 2PL5A 4L4YA 4RGBA 2QMHA 1NUPA 3RYIA 3JQ8A 5LC1A 4A36A 4J90A 2IIPA 3ROZA 4GG1A 5KVCA 4Y42A 1E2LA 4UFNA 2CNOA 3R76A 2ZWIA 1XKTA 3CB4A 4JBIA 1J2TA 4MARA 2WVAA 3NANA 4XGQA 1EDZA 3OPMA 3MMXA 3KAPA 2R1UA 1AURA 3X1XA 1E3EA 3MEQA 2WU0A 3A2MA 3NWJA 4Y6SA 3VPAA 1QAOA 4FMDF 3H3FA 5I9IA 1ZVMA 2A92A 4X4IA 3O31A 3ZWQA 3VKHA 1MN6A 2QMQA 5I9MA 5BYKA 3ZJYA 3CYFA 2LLWA 4HSEA 3EUEA 3OOYA 5CW1A 5AI9A 2IPAB 3MCTA 4NH4A 4PEVA 4RZHA 1CY6A 4URUR 3WOVA 3K53A 3MUFA 3FVTA 5ER6A 5HCNA 1EDOA 1HQKA 2XI8A 3A9CA 1UKZA 1P72A 2PMCA 1YC5A 3LX4A 4YAJA 3ZLVA 5JAPA 1SUSA 2CW5A 4U7GA 2AYZA 1V7CA 3OT4A 4V0OA 1U4NA 1SM4A 2IXFA 3IAM1 3BCUA 3PYMA 5ALPA 5L6LB 4N41A 3TDKA 3WWZA 4BASA 3MJTA 3BREA 4IHKA 3HDQA 3ZWWA 1BE8A 5L3ZA 3FSJX 4PPNA 4GYWA 1NLFA 1DHTA 1FDSA 3QY0A 1V1RB 4GPD1 4HXEB 2FQ1A 1TCUA 1FJ2A 4OXXA 4DJJA 1IBCA 3N76A 2PG3A 4YNBA 1NNUA 4U2DA 4XDHA 2ZG6A 3FKJA 5D00A 5LOVF 3GCDA 1KJ9A 3DFZA 4TTTS 1POUA 4JQSA 4PN7A 4YRGA 4TRRA 4PG5A 3VKVA 4F92B 5JD4A 4FCVA 1B15A 3OESA 1TGVA 4KVAA 4MR9A 5EEHA 2GCOA 3NC0C 4MP6A 3PXDA 2X8BA 2D74A 3TKYA 3RM3A 2OL4A 4XAQA 3KTFA 1YZNA 3BE6A 1SA0B 1E7QA 2V45A 3FGZA 4JC5A 4XCXA 4L5AA 5ARBA 2BFCB 3EARA 3KXLA 5H9VA 3W2HA 3HCDA 2GXUA 4JJ7A 4XPZA 4QM7A 1E98A 1RJ9A 5KTTA 1P60A 4JLOA 4GOJA 2WWYA 2BMVA 1HORA 1PR2A 5EIAA 5T6MA 4HNHA 4Q39A 1NJFA 1QTIA 5KDLA 3S2SA 1T1SA 4WOBA 4HQOA 2G80A 4BGVA 4PRLA 4ZD6A 4EKDA 1QHHA 2X7HA 2DWCA 2EKQA 4LDQA 1FXWA 3G2NA 1RHMA 1XZPA 2AR7A 3CPSA 5IT4A 4O2BF 1W0KD 1DO0A 1O8CA 3MFQA 4FJ1A 2A8YA 1KEZA 3LQKA 4AUNA 4F9FA 2XUJA 1QYWA 1ZGCA 4KWHA 4MGEA 1WB5A 3ABRB 3EVDA 4HNQA 5FYQA 4NTZA 3WXMA 3FUXA 2FEWB 3FETA 4D2IA 3AZQA 1SUPA 3CWZA 4M1OA 1IXZA 5DPMA 2MTBA 5TPWA 3EBLA 4YC7A 2YC4C 3NXKA 4D42A 3DUWA 2A9QA 1UXJA 3O1IC 1HETA 3N39C 4N8EA 3SVTA 3KZ3A 5JT1A 3F2VA 4J0KA 4NFLA 4DJEC 5CA0B 1ATIA 3OFNA 3TOXA 4ZCSA 1T2UA 3CCCA 2JFQA 3QX9A 2A3RA 2HA7A 3AONB 3M2PA 2MR5A 4V2UA 2F48A 2O50A 2XRMA 1GQSA 2EFYA 2XZOA 2HU8A 4DZTA 1HYQA 2A59A 1YQWA 2C2BA 3Q98A 1CRWG 4QJ5A 1KTVA 2LYRA 1R4MB 1OB2A 4ATNA 2X0RA 4IILA 1ORTA 3K9HA 4MKZA 2VA9A 3Q88A 1G98A 4YBAA 2Z2ZA 3L40A 3NOOA 4MV1A 1ECBA 5I4BA 3BA6A 4GQBA 3IOMA 1SC6A 2HIAA 1RFGE 2XCLA 3NWOA 3DWEX 2PD3A 3DA8A 1XBTA 3CH6A 3G5MA 1WNFA 4IOJA 4P3KA 4WACA 2ZGVA 1W5EA 4MVJF 5AHRA 5JSZB 9LDTA 3MK31 4LC1A 3TE7A 1O1YA 2FEOA 2QW0X 4YQFA 1G18A 2IYVA 2WVGA 1MAUA 2I2BA 4BNUA 3DMHA 3X3HA 4MPDA 3GQBA 4C01A 2YOGA 3I34X 1ZH0A 4LY0A 2DPXA 3K8ZA 3UYLA 4DHEA 1P4AA 3S2FA 1ILEA 1IN8A 2WIDA 4NPCA 4G1VA 3DD1A 3HJUA 4MIEA 4AK9A 1DC4A 5LOVA 5TLSA 1BFUA 2Q50A 2ZT6A 1DI0A 2DPHA 1V1RA 3N3AC 1RBMA 5NULA 4DUZB 1M0EA 5BUSA 2IK8A 1N0WA 2FW0A 3PHJA 4L85A 2H7VA 1XU9A 2CLLB 2UYOA 1ZWKA 3G8DA 4ZYLA 1G4UR 4F5DA 1DEAA 2E2WA 3EGCA 3HXMA 1VJGA 2AG6A 3LYAA 1UK8A 5KI6A 1C2TA 3R9KA 4R1OA 1PJ4A 4ZYWA 3FRIA 4MV0A 3L8EA 4FR2A 4LOHA 1R2QA 1AQIA 2GEBA 1C7ZA 2WJWA 1ZUNA 3OT1B 1SUAA 1UZAA 2NZXA 1RM3A 3PNPA 3PQ4A 3QPDA 1H2WA 2XNJA 5HQ3A 1D4ZA 1E8DA 1U3VA 1YR2A 4FI3F 1VG0B 3A9WA 3ASVA 1N2SA 2RHBA 4KXFB 2P6OA 3DUFB 1XVAA 3LLMA 4DA4A 1OV4A 3H4MA 4QJ3A 3O8LA 4II3A 3H2ZA 3OPVA 4CR8A 4KU4A 1YRHA 3QF4A 5FX2A 2E21A 2KZ8A 3TPZA 3PX3A 1PBNA 3SMQA 1FJGB 2HJSA 3DZKA 1U3GA 2D59A 3HPRA 3O84A 3HJTA 1A88A 4MK4A 3HU1A 3AHGA 5SY4A 3OM8A 4U7HA 3WAGA 4I50B 3F73A 1XZIA 3R7SA 3HRHA 1MUUA 2WB2A 1XWRA 1GAEO 3A10A 3PX2A 1GT0C 4NBKA 3TW6A 3NFYA 3ZCQA 1QDLB 4AJ9A 3FJOA 2YY6A 1J0BA 2XWQA 1MOSA 2D1QA 2GCIA 4NATA 3CLSD 4QXQA 3K0FA 3T7AA 2EBHX 3RB8A 3VJKA 4MW5A 2QTCA 1J24A 1V3VA 3K31A 4MUAA 1D6MA 1TIKA 5E8JA 5DGDA 1Z62A 4HX5A 3TTSA 1BFDA 3EB9A 2FP4B 3ZVNA 3LBNA 5E3HA 4JJKA 4YFYA 4AY4A 1BEEA 3TDNA 4C14A 1I14A 2C9ZA 3HBLA 2WIJA 4OXRA 5CXXA 4ZOLA 4MYSA 1QHFA 2ZTVA 4HH4A 3ZN2A 3H6HA 4J94A 3KAQA 1DAIA 3KSAC 2LGJA 2PXVA 3H84A 3E03A 5LXTB 2PBFA 1RHKA 2QMOA 4W8GA 5FTWA 4PAQA 3ZW7A 1U2SA 4GOXA 3R5KA 5TVKA 4Z7QB 3OZEA 4J1TC 1OWOA 4R2HA 4YRTA 1QHYA 5DWDA 1BMFD 1TLTA 2TMYA 4YRRA 1Q2UA 2AGVA 2XCQA 2ZDQA 1OILA 3FDZB 4XPIB 5GVRA 2BMAA 1P73A 4XB1A 5KU1A 3DPUA 1H8EA 3CW2A 3L46A 2J32A 2Z8ZA 3LT1A 3W8RA 3WLKX 1JQEA 3UH1A 3NTUA 3DZDA 1B1CA 1E2HA 2TMKA 3ZBQA 2Z9DA 1NWHA 1D2GA 1Y4AE 2OKCA 3MWEA 1Z83A 3PHCA 3CUSA 3D2BA 3NWBA 3DAHA 4JMPA 2QENA 2OAQ1 3UFDA 3NKVA 3DR3A 4UBNA 3VH3A 2IHTA 1RC0A 4PYIA 3R1FA 2ONZA 5HA5A 3UHJA 5FTLA 1VBKA 4X7BA 3I1YA 5H80A 2C2HA 4JHXA 3EGWA 2QBYB 2VQ3A 4WADA 2O57A 1EUZA 2CJWB 2O14A 4D4GA 2P1RA 5D3MB 3ICCA 4C3OB 4ZI2A 1XTQA 2NU8A 1M1YA 4BL5A 3I0ZA 1LPSA 2BH9A 3A9RA 3MWFA 4CTKA 2BTEA 5LKAA 2GRMA 1SOUA 2L19A 1QHEA 3F4BA 1CR6A 1ZH4A 2ZTUA 3MCAA 2JI4A 3REQA 4JN6B 1IONA 3QF3A 5FR1A 1UQUA 2FK7A 3GLHE 3L93A 1XZQA 1OPRA 5FUYA 3GLHB 4WGGA 1I30A 5EWJB 1W4LA 3PIIA 4Q4CA 5HGJA 1BN7A 4BVGA 1ZGJA 5JS6A 3ADKA 4FLFA 1PL0A 1TJ5A 4NBVA 4U8HA 3WL6A 4CLDA 4A3SA 2K2WA 2IUOA 4XJSA 2BHLA 3NYWA 4DM4A 1E4EB 3FOZA 4DBLC 2EWVA 1IK4A 2J7KA 2VK2A 3UQZA 4EH1A 3K71B 3N59A 5I7VA 3ZGXA 1C3OB 2FWBA 3A1NA 2J48A 1XCMA 1JLRA 2WTMA 1SURA 4CIXA 3QXHA 1IRXA 1XTVA 5HTOA 1GVHA 4ODIA 4QDUA 3LLCA 5EY5B 4MEAA 4RZIA 1JI0A 4RTMA 3GUVA 4PGMA 3MAAC 3T1NA 1MW8X 2W48A 3OLYA 4HQ0A 3H7AA 1WMAA 1GNVA 2BHNA 1VMAA 3FVQA 3FYCA 3OJWA 1EEHA 2IPOA 3N2GA 5F51A 1S2GA 1U8EA 2Y1GA 3E9YA 2YWDA 4NZOA 2BFAA 5MFZA 4FD3A 1KQFA 3WGIA 3C3BA 2WM3A 1IY2A 2FEMA 2X0KA 3IAS6 3PPXA 2R63A 2A58A 4H60A 3UBMA 1M83A 3IJ5A 1V9CA 4BJ5A 2WV7A 2O06A 1XZCA 1R63A 4ZCIA 1C0KA 3QI7A 1SZJG 4S35A 3UCFA 3WJ1A 3AUUA 4B34A 4DDTA 2BP7B 2ZZNA 3ROMA 2JFXA 1LRJA 1ZDMA 2IW1A 2IEDA 2Q3JA 2UUOA 4RFSA 5DGXA 3NEYA 5CFQA 1YMVA 1KARA 4IW3B 1X80B 2C5LA 2G0NA 1DVRA 3HBNA 1ZSVA 3ZZTA 4ML3A 1Z0IA 3GV0A 3TW8B 1E77A 1DNPA 3F96A 1RC1A 3PHBE 4Z9FA 2Z5LA 4CLXA 4F4FA 2G4VA 4QUKA 2PD6A 5ALTA 1OFTA 1I7NA 1KY2A 2CD9A 1JQKA 1XQ1A 2F6RA 4DA6A 1MX9A 2R6GA 1J9EA 1W2HA 1WPGA 1Y3HA 1KAGA 2HJGA 4FDUA 1NULA 1ZI6A 2O38A 2FV8A 2R4QA 3STTA 2VLBA 4AKTA 3WAKA 1XCJA 1Q12A 2BN4A 5DH9A 3VH2A 1W5FA 1JIKA 2FF7A 4LGVA 1II8B 1P81A 2GI4A 1GSIA 4J1QA 1T2DA 2JLZA 4EBBA 4R41A 4QVIA 1UJBA 4QOHA 2M6LA 5IYZA 3WMXA 3WGLA 4BNVA 2FWPA 5L3SA 2VPXA 4MP3A 5TS3A 1E3MA 1GCGA 1E2UA 2I03A 2DC1A 1FTNA 3OFVA 4J43A 4JWTA 1M6YA 1C3EA 1I3CA 4KQMA 2J6BA 4XVUA 2ID8A 6YASA 2CLMB 2EL9A 2E48A 4YS6A 3IVMA 5K3OA 2J41A 1RXWA 2O8DA 3AEQB 3HXOA 3G49A 4FDMA 2XUZA 3GH1A 4IGFA 1U2GC 2VQFB 1O08A 2IEZA 1Z6TA 3I6YA 1D2MA 1PR3A 2Q7OE 2BEKA 1AC5A 2GB4A 3JZFA 4MW2A 5FHQA 1U31A 4E7PA 4A0RA 3FWNA 3B6JA 4Q18A 4AX8A 4M38A 2ZWPA 5C8YB 1P2DA 2HUNA 1WHTB 1QIJA 2ODBA 1J9GA 1HTBA 2PT6A 4Q7JB 5E38A 2ZIUB 1OSLA 2DR0A 5FL7D 3GIDA 3IP9A 1QGAA 4KZPA 3VKWA 1UBLS 2X9LA 3RRBA 5BSGA 1F48A 1EM8A 1I2AA 4HYQA 1WW2A 3PC2A 4MPRA 3AFHA 3NOVA 1AHHA 3HYRA 4N3AA 5JNRA 4G1EB 1E2EA 1Z6XA 1H9BA 1YCDA 4N4AA 1E89A 1N8NA 2PSFA 2ZSBA 4R7ZA 4AJ4A 4CQNA 5U4XA 2IHYA 2QIPA 2XQIA 5K0ZA 5KX5B 3TGLA 3GUYA 3LQ2A 4IIBA 4DCGA 1PK7A 1PQUA 2PO7A 2QTRA 3QOYA 4PX5A 5FAXA 4YCBA 3CF2A 5PNTA 2PX4A 4C88A 1PL8A 2Y2UA 3EHDA 3GZJA 3HE3A 3ND9A 2Z43A 4F4IA 5B58C 3Q8MA 1C29B 1VZ2A 2E6KA 4XQCA 1LPMA 1J56A 1G6Q1 4J1WA 2ZBVA 1KRHA 1ORIA 4BVAA 5IKXA 1RRCA 1DRUA 4NDNE 2OMKA 3T7RA 5MN6A 3GPIA 1AN0A 1G2IA 5E3IA 5MGNA 4PO1A 1GTVA 2WIGA 4QRDA 2RHJA 5L7YA 2DB3A 5AIAA 3KKOA 4CM9D 1Z74A 1GDDA 3W2TA 3MRTA 4HVTA 2BGJA 3PL5A 2A57A 5EZQA 3ZVMA 3W5SA 2Y2VA 2MJLA 3KR0A 3OAAA 1QHXA 4C2BA 2AMVA 2BFEB 2ZAMA 3QY9A 4UUOA 4UUPA 3AR9A 1RD4A 2GYVA 1YJXA 1P33A 1EM8B 2OXFA 1O6FA 1YK1A 1NPYA 3ME5A 3A2LA 1RM4A 1KJIA 1HYGA 2R60A 2YASA 1KJWA 3AVPA 2B69A 3CT4A 3GJQA 3OPYI 4O4HB 5KYVA 5IF3A 3FYSA 4NICA 3C43A 3EVAA 2GPAA 1AQJA 5EUCA 3ASYA 2R4UA 1VQ1A 5K2MA 3DE3X 2EYUA 4TWAA 2I4TA 4N54A 4O29A 2QPTA 3GGGA 4ITUA 4P7BA 5K8TA 1JILA 4IIVA 2PE5A 2HEGA 2V6FA 4K9PA 5M34A 1QIKA 2PKQO 4EG8A 4MEJA 1UXCA 1SB8A 2AWNA 3EAFA 3TLKA 3UMSA 4ALIA 2WOJA 4FD2A 3P32A 3BZBA 3VUEA 2GKSA 5IT9A 1HE1C 4NONA 4WV3A 1QO0D 5C35A 1BYUA 1NN1A 2NU7B 3JQAA 3SQLA 1ZL0A 4ZT6A 1PFWA 1EXMA 1M6NA 1QAMA 3PDIA 4CKXA 4FEYA 4DSUA 4EA8A 1KC1A 3AF0A 4INJA 4YRIA 5IM5A 1XTZA 3LA8A 3LYLA 1JKMA 1NY6A 5DHQA 3UAOA 3VNQA 2LNDA 3WSTA 5BNFA 3A27A 3HNPA 1YHNA 2R68A 3KB6A 1W9HA 3N2YA 3HTXA 3LIIA 1AY0A 2RIRA 1LCCA 3AI3A 3L43A 1J2EA 4WLEA 5K0NA 4N48A 4JBLA 1IMJA 1J8MF 2XT0A 3HJCA 4QYXA 5C0OE 3CKMA 2YN0A 2ZJZA 4I9NA 4WKGA 1NV9A 3HYCA 1V35A 2R1TA 2C00A 1JSCA 3GFQA 2X5XA 3C14C 4CKWB 3VYUB 3ZIDA 4IJMA 3I42A 3EBOA 1NR1A 3VBEA 2E5FA 1JKJA 4UEWA 2EJTA 3AINA 2C95A 5ALEA 5CAEB 1RRGA 2UZ0A 3IMGA 2BF4A 3GJXC 4MI6A 2CLCX 3KZOA 4YH1A 2A94A 2P4UA 1H85A 3GZTB 1M2KA 3QWIA 2P2DA 6ADHA 2VJMB 3PGKA 4ZVVA 5AKHA 3S28A 2IE0A 2FGKA 3TEPA 1OYVA 1HG0A 2ZANA 4Z86A 1UBRS 3L92A 4CR6A 1JDPA 4AG3A 3VR6H 5T41A 3JQFA 1XNHA 4REQB 2XV1A 4ME6A 4LF5B 4YLGA 3ZV5A 4CL8A 1P3JA 3DCNA 1IRIA 3MFYA 1VSUA 3EUAA 2FQXA 1OVMA 1BMDA 2NPIA 2YFKA 3INYA 3CLKA 5DLYA 3I9V6 1EJ0A 2XNCA 4G0ZA 2XYQA 3RUFA 3T38A 1E1CB 1M6EX 2QT9A 3DOUA 3JD4A 3FF4A 3RHFA 3RRJA 3AR8A 1Q6YA 2Y93A 1Y9EA 2G7ZA 3FWKA 4AZVA 3OMXA 2E4YA 2B5AA 3OX3A 1P31A 1C80A 2XOKA 4MCJA 1IHXA 1UINA 3WNQA 4EX6A 1YQDA 2BSAA 4QNNA 4RD6A 2VA8A 4AU1A 3DG9A 1LW7A 2HNKA 2WDZA 3F90A 1QB8A 4R3UC 3BAFA 4UJ5A 1XYVA 1PUJA 1VLLA 3RG2A 5FNZA 5K45A 5AJWA 1QH1B 1S96A 1XP5A 4KLCA 1YZYA 3W4IA 5JSFA 4F11A 1FNCA 5K7SA 3A1TA 1G5HA 4WDQA 3OZDA 5LBUA 1X6VA 3B1WA 3HO8A 2OZVA 1JFRA 4XWWA 4S1OA 4O3MA 1QGUB 1B0AA 5DHTA 2WT4A 3JVVA 4EA7A 4KNYA 3IOYA 2H9YA 2C9YA 1QVRA 2JCSA 4NBRA 5JE8A 5B64A 3PPYA 3REQB 2NXCA 2KBEA 1FDWA 2OVBA 3ADOA 3GJ5A 3N74A 4R1LA 5F23A 4L0DA 2OQ2A 1PUIA 2X8JB 3DLIA 4N7MA 2I29A 1LFAA 7ABPA 4KGVA 4PFSA 3K0SA 2C3OA 3BB4A 4LECA 1ISFA 2N1BA 4I9HA 2W6PA 1O3YA 4UQPA 3TRDA 4LI0A 3VU3A 4F4CA 4LXIA 1JQJC 2NTNA 2XWJI 3FYUA 3Q87B 3BOSA 4H0CA 4QA9A 2BFOA 5GMOA 1CQZA 3GRUA 1OBHA 3KS9A 3V1TC 2JKZA 2QVZX 2QVLA 4FOTA 1RWWA 2AHRA 1ONNA 3F8TA 2IXDA 3KHUA 4BMPB 1E69A 4KW7A 2G5TA 3IB3A 1JA9A 4FNOA 2MR6A 3BS4A 6Q21A 1HM5A 1ELOA 3PZBA 3W8NA 1ADYA 2RG7A 4C0XA 5MHTA 2XAUA 3S2UA 4F9EA 4Q12A 1KVRA 4MV6A 3FHTA 5KMGA 3EAQA 2EX4A 2YZGA 3WNBA 2GO1A 4UVDA 5EJ9A 2FU5C 2B5WA 1ZISA 4HEA1 5JFGA 4R2IA 4WL0A 1PJ2A 1A9YA 4Z4HA 4XPIA 1GYQA 3LF2A 5J58A 3RU9A 1UMKA 5CDHA 3U4HA 1TYCA 1YVEI 2DPLA 2I2AA 3GMSA 2QTAA 1KMCA 3LGSA 4EGCB 2H0AA 1MJHA 3QWHA 3T3PB 1QP8A 3P9IA 3ZWNA 1A5AB 2IZOA 3ZZUA 4B4OA 1T25A 4CHGA 1AN9A 3FSEA 3H0KA 3K6JA 3PDUA 4PLZA 3T4PA 3U26A 5LN1A 4L9SA 1II0A 4CLRB 1UWVA 5A9SA 1P3Y1 5J23A 1CYEA 1ZMXA 1GQOA 3HVIA 5IJAA 4FGSA 4RVDA 1SBZA 3TOZA 2WF7A 1G8HA 2ZIXB 4LHVA 1ADCA 4UUQA 4XYEA 1YZKA 5GM1A 1YJCA 2D4HA 2FQQA 3CN9A 1HQDA 1CVIA 1PEDA 2QTZA 4BMZA 2YHAA 5IAAA 1N75A 4ZQCB 4ZKEA 3H5OA 1I2CA 2B35A 4FP9A 5IZCC 3RZZA 1VFPA 3G2QA 3HG7A 3IPAA 3U17A 5F2NA 1CETA 2AF4C 4AQDA 1SPXA 2O3JA 4XCVA 4JOSA 1WH6A 1IPHA 1JTEA 2RH9B 4IJ6A 3IKTA 4M0LA 3HXQA 3DBRB 4I50A 1EB9A 5D2CA 4B6JA 2O3RA 3WKEA 1Y1TA 1LPNA 1ZVQA 3IQIX 3KPJA 4DIOA 5BN4A 4JB3A 3EVZA 2PJRA 3SOZA 3ABSB 4PNHA 3K0HA 2X2PA 3UK1A 4E2XA 4QYSA 4H59A 2XEXA 1Q0LA 1SRQA 1UJ6A 4L0MA 5KOJA 2Z56A 4CV2A 3ANXA 3COVA 1REQB 3DGFC 1AKQA 1TF7A 3QLTA 4M3NA 4QIHA 2VXBA 4PU7A 4PSVA 4WWHA 3TQCA 1EIWA 1LSJA 1XPUA 1BXZA 3OFSA 4WXYB 2GAOA 1UDXA 2F3UA 2QLJA 3TSZA 3VDQA 4QBTA 4ARIA 2HQ1A 1WABA 2E4UA 5DVZA 4PU3C 3K0EA 4CF6A 4JEIA 4ROTA 1UUFA 1QZ3A 4RJJA 2PYIA 1OGYA 3DFUA 1PZNA 1EE2A 3LT4A 3STHA 3TI7A 3WIBA 4CMIA 1L5YA 1ESMA 2WA2A 2WMNB 1X1AA 1M54A 2OV3A 1PEAA 3BPSA 3QVMA 4Q82A 2EWTA 5F3RA 3PHGA 4PS0A 1R0ZA 5EUBA 2JAOA 1UDBA 3MMSA 5JJ5A 5G0SA 3VHRA 3DMFA 3PPWA 1UDRA 4HGNA 4J3FA 3NTQA 4C2UA 1H65A 2FN9A 4I5GA 1KI4A 1QRAA 4TWBA 3A37A 5ALOA 3IP6A 5CLIA 2X40A 4AJEA 1Y9DA 3P0IA 5THQA 2ONKA 5FR2A 2Q6VA 2YUIA 1WCIA 2FSGA 2XSZD 1NW3A 1QIHA 2O52A 3FGOA 5EMNA 3ZEIA 3ZGYA 4B6GA 5CA1F 1LDEA 3VO8A 2DLCX 3BH0A 3PDWA 1S2MA 3NZEA 4M1YA 3BD7A 1MOZA 2OHGA 1SIUA 1WU7A 4WDRA 3GA5A 3N8DA 1XMVA 2C97A 2CB9A 5CPBA 3A2KA 2YWCA 2I7TA 3IFSA 1ZCJA 3DONA 2P79A 4H31A 3RS9A 2ZROA 5JH7B 5FOVA 4HDSB 1B6TA 4ZHQF 1E5VA 2XUKA 3RFTA 5JNLA 1AJEA 1WETA 1VYVA 1QIEA 2EF1A 2Q1UA 4E46A 1MLDA 3B89A 5LLSA 3EIUA 1F2TA 2J9ZB 1GZ7A 3EXHB 3PGJA 2VAMA 3TEMA 3BDNA 1X7GA 1CE8B 2B34A 2EZTA 4DHWA 1OWPA 2GRLA 5B3JA 4FHDA 1ZMBA 4JV5B 4DBZA 2Q6OA 3UJ9A 1R6UA 1HDCA 4L8YA 2P9TA 3T5TA 1EFPA 3CBGA 4KLZA 3SYTA 1K92A 3ELBA 1QKIA 4JI7B 3K6SA 1SCIA 4QOFA 1U99A 2OCAA 2Y6VA 3O9VA 5ALDA 3VPGA 4E5KA 3ER8A 1B73A 1R0CA 3FOBA 4A6XA 3UJNA 1BTOA 4QFCA 1WDMA 1U5BA 3SD7A 1XVVA 1XNQB 1G20A 3NQ41 1QQAA 4BX0A 3CUKA 2HF7A 4PZZA 5CAEA 3IS3A 8ATCA 1XVLA 1K0FA 1AU7A 1MFZA 3CZ9A 3M4XA 4MB2A 4MIOA 4QPCA 3P9PA 4UZEA 1M2NA 1L5OA 5COQA 2O7VA 3RI3A 1GPLA 1KVUA 3D2CA 1C41A 1G21E 2X8AA 3WIEA 1OMOA 2ORWA 4C4SA 5J43A 4DDKA 1K8RA 1JPVA 5KYXA 3ER9A 3AVUA 2TMGA 3HP1A 4J07A 4RGVA 1XO1A 4IDNA 1EFKA 1PK8A 1VKZA 2PS9A 2PCJA 4QYTA 4R40A 4JI2B 4QM6A 1MD9A 1SD2A 3PC4A 1F3OA 4QHSA 4X1YA 4HF7A 4D0NA 4NAVA 3L8YA 3JQGA 2DWPA 2EEZA 1T5TA 3DZJA 3QXJA 1F9EA 4G25A 3SXUA 4Q01A 2VP2A 4IGAA 2ZIGA 1EVEA 3HA5A 4ER7A 2HJHA 3GW8A 3K6RA 3PDIB 3QIAA 4OQEA 5F33A 5IJZA 2IVGA 2PUFA 2FN8A 1YA8A 1Z2DA 3DF9A 3DXYA 4PBTA 4Z4CA 4YG7B 1C4XA 2OHHA 5CA0A 1Y1LA 3C41J 3GN2A 4CV3A 1C3LA 5BSMA 3UWPA 2HDNB 3RFXA 4CLOB 4PPGA 1FFYA 4TSFD 5CPFA 5ERYA 1A71A 1J0EA 4GPBA 1Y1RA 4MJ7A 2PKQP 2FMXA 2EJVA 4FYVA 3ABOB 1NMXA 2PL3A 3HZOA 4QPNA 4X8OA 3HL4A 3QVXA 4XVCA 2NU6B 4M1SA 2PU5A 3J81A 2QM8A 1G20E 3B9BA 1LCDA 3WLIA 5IK2A 1RPNA 2YDYA 3H99A 1WH8A 1XR3A 3MELA 4GXQA 5IBPA 1P2GA 4ZMSA 1ZQ1A 2O6HA 4XSGA 2FPSA 1VGQA 2E5LB 4E30A 4JELA 1Q1EA 3DQQA 4H7FA 1VSQA 2C3UA 2QQEA 1U7ZA 2C77A 2SICE 2V96A 3TW4A 2VXCA 4I9UA 5FTKA 3UJBA 2O2GA 4WK0B 3V1YA 1KP3A 1ZJ4A 2GM4A 3E22B 1ZMRA 2GCEA 1GT91 2IPLA 3UUFA 4BIIA 2V4MA 3FWYA 2DBVO 2WUFA 2C59A 3GLVA 4NDWA 4HDOB 2IV3A 2JHAA 5EI5A 2X4LA 5FPHA 1Y7LA 4OHVA 5B4VA 3S55A 3KSMA 4F5EA 3RTCA 3T3HA 4RPHA 1TZCA 3R6TA 5DSZA 2ZUBA 2V03A 4DWVA 3F4KA 3KTDA 1PJAA 4FZ5A 2VHCA 4OFXA 4DXDA 1YDWA 5DOVA 4EF4A 1C8BA 1AUVA 3OCXA 5CIQA 1ZJYA 3TRHA 1PEYA 1TCVA 3AETA 1B42A 2BFEA 4NK5A 3BK1A 1ES9A 2A0YA 4RANA 3SYMA 3WGZA 4CLEA 4DM3A 1VBNA 3GPDG 1IEXA 4ON9A 1DARA 1JP7A 2GPNA 3DB2A 4KX3A 4Z58A 4OLFA 1JLLA 4FE3A 3DVRX 5DNCA 3PR3A 4RVCA 4X4BA 2D06A 3N5KA 4Q66C 3MOGA 3I83A 3QPAA 4EG4A 4BXOB 1XRQA 2WHPB 1GA4A 1HA3A 1FMCA 2GPJA 3FFXA 4R1PA 4JI5B 3WL5A 3SKVA 2J7WA 4Z5HA 3DLHA 3DMNA 4MUEA 2JFYA 1T3SA 4TROA 4J1XA 2G1KA 1UFVA 2BY4A 1PEKE 4O2BA 3MGCA 5GZ6A 1UK7A 2VBFA 3TGPA 2QX4A 1YIOA 3T5BA 2WW8A 4KTTE 1U3DA 2MINA 4X95A 3NONA 3H8WA 3CRMA 3ZPXA 1TA0A 4RTJA 1K8ZB 1N6NA 1WEHA 2ZI4A 2C99A 2HHJA 3QMPA 4K40A 3K0KA 3HCFA 4BWFB 4PQEA 1CRLA 3EW7A 4ZPXA 2WWIA 1K6JA 4DTIA 1LY1A 4K2AA 4KSBA 5FD8A 2W4MA 5DIFA 1R0KA 2OHFA 3RK0A 3S27A 3GDFA 4QUGA 1IE3A 1ATZA 2FFQA 4U7PB 2AKAB 3GUUA 3C3KA 1U0EA 2CLOB 3AV3A 4AJOA 5I8PA 1FSZA 4I2VA 4U2FA 5ALXA 3D8NA 4E70A 2HRRA 4PBSA 1RWPA 1ZH8A 5DYTA 2XTZA 3BXZA 1H93A 3INTA 5I5EA 4RWZA 3H05A 3OIFA 1LRLA 4X54A 1L9XA 1ZZ8A 2FWAA 2ZB8A 5AKYA 5KHAA 2Y27A 4OB7A 1MB3A 3TTWA 1PJ8A 1Y4DE 4B47A 1JLSA 1CEEA 3UO8B 4ZOAA 1LDYA 5F2EA 3U4MA 4QRIA 2HYIC 3C4VA 1NJ8A 2WLTA 2AK3A 3NNNA 4XOUA 3X1ZA 3VC2A 4JMLA 3VDRA 1I13A 2I80A 3P96A 1P2VA 4FMPA 4UNQA 5K20A 1SCJA 4X62B 4B3TB 1D2EA 1L5RA 2ZS7A 1XC7A 4EGSA 4BKMA 4NRDA 1VPLA 1JDZA 3ICPA 2FSVC 1LJLA 1DG9A 4PN3A 4TM7A 4Z4EA 1VP9A 1DBSA 1E9AA 2VDPB 2GCPA 3HUTA 1E1YA 2LYLA 1FVOA 5BMVB 3QSYA 3BD6A 1C7IA 3DYBA 3DE0X 4N0MA 4ZRMA 1SBYA 4LQDA 4OU5A 3RC9A 3L9WA 4X41A 3OE7A 3L4BC 4E51A 4Z6KA 4QJBA 4WBSA 4B35A 2PQ2A 5ALUA 2YQZA 3KX2A 1P2BA 1TCBA 2F90A 3EYAA 3LW7A 1VDMA 4JR1A 3IEPA 4YROA 3UANA 4L2IA 5LA6B 5B3KA 1Z4PX 2NQTA 1TU4A 5ECWA 5KU7A 3BDIA 4W7HA 3NHLA 1U0OC 1OWNA 1ZGAA 5A4MS 4RVHA 1PR6A 3K09C 4G9BA 3LHKA 4IIDA 3K4PA 5A2GA 1J42A 3LTNC 5BUCA 4GOMD 3B8HA 4GM0A 4Q4HA 3TLCA 5BSFA 4H27A 2IA5A 4IIFA 1F6WA 4ND4A 1COZA 2E7ZA 3FZYA 5DSXA 2FR8C 3GLSA 3EXHC 1T2VA 2IOFA 4GVPA 1H4QA 2O54A 4B5LA 4HADA 3BWXA 4BO8A 2CFSA 3NGLA 5TR9A 5DW3A 1CKEA 3GPBA 2PKYX 5TGZA 2X1VA 5K4GA 2V3VA 5SYMA 3HCPA 3EVBA 1RQPA 3V3KA 1EK2A 2YVKA 4PLVA 5C4MA 6PFKA 4OI0A 4TX1A 1RYMA 4ZCRA 5JRJA 3KTAA 4ETNA 3BXOA 4MDEA 1Y8AA 3AX6A 4Z2AA 4TTVA 1D2NA 1UM9B 4UNPA 2V5AA 3REGA 5KNCD 1SKMA 1W1WA 3QYXA 4HEQA 1CU1A 4HUJA 1C1DB 4G0YA 2ZYRA 9ATCA 1HDZA 2CMKA 1Q7GA 1DKPA 1C3OA 4HXYA 1QO7A 3IDFA 1K88A 2QGNA 1JXAA 2PYDA 1P19A 1PX2A 4QG3A 3K9FC 2ROQA 4ZAXA 1ADGA 1G0OA 4AJLA 1S7CA 2ETXA 3K16A 3H9UA 4MYUA 4Z5XA 4B3RB 3KJFA 3M33A 2QTTA 1ZP6A 5FBHA 4GC5A 5IJXA 4DPLA 2X5KO 3ZJUA 1P8JA 3T5MA 2QTGA 5EFZA 1W59A 1JMKC 4YT5A 3WMEA 4BLRA 3LX6A 1Y5MA 1YZQA 5TT0A 3QWGA 4HHEA 3E3OA 3MF4A 1EG7A 3ZNOA 2ACKA 3LJKA 3RVQA 4YJGB 3QVJA 2Y1WA 2XODA 2BZ1A 3PCTA 4M53A 1SHUX 1E6WA 1UOQA 3FDZA 3OQ6A 4G0UA 3CPEA 1VHQA 2VEDA 1IZ8A 1N9ZA 3H5LA 4WN3A 4NZMA 3L8GA 3V00A 2XYVA 2J9YB 3LD9A 1KE1A 5H4GA 4BMOB 4NV3A 2JGMA 1H4TA 3ND5A 4DLAA 2OUIA 3FNBA 3IMFA 2IPXA 5ARDA 4M6WA 4ZRDA 3N2GB 3RUPA 2WWHA 4ABYA 4UBKA 3CEHA 1I7DA 3DE6X 1LVHA 2MYPA 4G5GA 1OBCA 1QVAA 5BNZA 2IF0A 1O9BA 1Y3DE 2AQKA 2GS9A 4PNPA 1GJRA 1SC1A 1TUEA 1J8DA 2XZPA 3PC8C 3K0AB 3G23A 3P0EA 4EL5A 3TLJA 3AK4A 3T0IA 4LFCB 3ORRA 2EGGA 1IG3A 3EPRA 3G1TA 2HSJA 2IZ6A 5EJ5A 3IEXA 5JBNA 2GGSA 1SY7A 3AVTA 1PG5A 1MKYA 3D1VA 5SICE 1GKKA 3U3WA 1C81A 4I8