2VEOA

X-ray structure of candida antarctica lipase a in its closed state.
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
430
structure length
430
Chain Sequence
b'AALPNPYDDPFYTTPSNIGTFAKGQVIQSRKVPTDIGNANNAASFQLQYRTTNTQNEAVADVATVWIPAKPASPPKIFSYQVYEDATALDCAPSYSYLTGLDQPNKVTAVLDTPIIIGWALQQGYYVVSSDHEGFKAAFIAGYEEGMAILDGIRALKNYQNLPSDSKVALEGYSGGAHATVWATSLADSYAPELNIVGASHGGTPVSAKDTFTFLNGGPFAGFALAGVSGLSLAHPDMESFIEARLNAKGQQTLKQIRGRGFCLPQVVLTYPFLNVFSLVNDTNLLNEAPIAGILKQETVVQAEASYTVSVPKFPRFIWHAIPDEIVPYQPAATYVKEQCAKGANINFSPYPIAEHLTAEIFGLVPSLWFIKQAFDGTTPKVICGTPIPAIAGITTPSADQVLGSDLANQLRSLNGKQSAFGKPFGPITP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIPASE A
publication title X-Ray Structure of Candida Antarctica Lipase a Shows a Novel Lid Structure and a Likely Mode of Interfacial Activation.
pubmed doi rcsb
source organism Pseudozyma antarctica
molecule tags Hydrolase
total genus 157
structure length 430
sequence length 430
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03583 LIP Secretory lipase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.130 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2veoA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2veoA01
4P08A 3VKFA 1B6GA 3CN7A 4ZGBA 5HKAA 1N1MA 4Y2VA 2ACKA 4Y2UA 4WFJA 5C8XA 1XRNA 5CT5A 4Y2SA 3WKEA 1YS1X 1PFQA 5HK9A 4YPVA 2WILA 4ETWA 2XLBA 5CXUA 1EINA 4LXHA 1GKLA 3WJ1A 2OCIA 4HTAA 3LCRA 2HA5A 1W75A 2C0QA 4N8DA 2RAUA 4EB0A 4Q1VA 2Y2VA 1X70A 2XUPA 5C8ZA 2JBWA 5ALDA 1QTIA 1HDEA 4X6UA 3FWHA 4MQMA 4W1QA 2VAXA 3K6KA 1E66A 1ZIYA 5I9IA 4X00A 1ZJ4A 2CKMA 4UHHA 1XRMA 4DTCA 5T4FA 3EQ8A 4J0CA 3WYDA 4I3FA 1NX9A 3T52A 3S8YA 5EIAA 3I2FA 2XT0A 4NVRA 2GYVA 1IUNA 1QONA 2DSNA 2BKLA 1BS9A 3DLTA 1M33A 1CUBA 1MNAA 2H7XA 3IUMA 3FOBA 1O6FA 5JAOA 3HSSA 4E46A 1HKHA 2HA3A 4OB8A 4F60A 4PSCA 1EDEA 3KWJA 2WIKA 3W04A 1KEZA 4BVJA 4Z49A 1VKHA 5JANA 1Z68A 3G0CA 4OB7A 4KRYA 5HFNA 1MNQA 3FVRA 4BTLA 5LZ9A 3QYJA 3IULA 4YX9A 5EHXA 2JGJA 2RHTA 1ETHA 3C5VA 3A6ZA 3D5EA 4C89A 3B3QA 3UUFA 3O4JA 4BZZA 1EK1A 1K8QA 1X2BA 1XZCA 4BTVA 3WL8A 1W52X 1QIKA 4I19A 4JNCA 5AI6A 1AX9A 2R11A 1N5RA 4EHBA 3QITA 5K3FA 4EY4A 5ALLA 2PUJA 3W9BA 4GBGA 1CUWA 5EIHA 4FFWA 2XUQA 5DLPA 2PSHA 3R3ZA 4KE8A 3H2KA 3H04A 3IVMA 5E4JA 5LZ7A 5ALZA 2C58A 3KWFA 5LKRA 1A8SA 3PUIA 4P9NA 5CH3A 4EY8A 4C4YA 4N5IX 1YR2A 2XB6A 1FJ2A 4LYEA 4XWGA 3GUUA 1C7IA 4BBZA 3DOIA 4X93A 5CT9A 5JIBA 5KREA 2ZJFA 3G7NA 4HZGA 1S8OA 3NGMA 3AIMA 3WWDA 1L7QA 1ODTC 3ZLUA 1GKKA 1WHTA 1WB5A 2Y6VA 1AQLA 4TVKA 2QOEA 4DYHA 2JGKA 1H2YA 2QUBA 2QXUA 2RHWA 4HAIA 5AK6A 3CCCA 3HI4A 5AK3A 3IB3A 4MJ3A 4GWLA 2FJ0A 5LZ5A 2B20A 1ZGCA 4K5QA 4OYYA 1YAJA 4ZV7A 1XROA 1WB4A 2AJCA 1IUOA 1A8UA 3BWXA 3VJLA 1UXOA 3W05A 1DQYA 1ZD2P 2BGRA 3GZJA 3R3XA 3H1AA 3MGAA 1CV2A 2DHDA 3C6YA 4XJVA 5LP1A 2XDWA 1MAHA 4G8BA 3PFBA 4W1PA 1BCRA 3ZPXA 4B9AA 1XZKA 1AKNA 2HA0A 1IMJA 3O95A 3D59A 4KJXA 2G5TA 1AGYA 1JKMA 1XZJA 3FCXA 3ESCA 3BXPA 4ZRDA 1YCDA 4BCCA 4DGQA 2DQZA 4Y2TA 4G8CA 1CUHA 3WWEA 3B12A 5ALGA 4GLBA 2QXTA 5AIAA 2CJPA 1GQSA 4C4ZA 2J4FA 1CFJA 4GECA 4MXDA 4K2AA 2CUTA 4ARAA 3I28A 5AHXA 4H35A 1C7JA 1FFDA 5CTAA 3STWA 5IVKA 4Y7DA 1J06A 2JIDA 2JGFA 3RKSA 2G5PA 1BN6A 5JAUA 1NU8A 2C5FA 4E11A 2XQFA 4OSEA 1F0NA 4BAZA 2X8BA 1JJBA 3I1YA 2I03A 2YH2A 3C45A 1KU0A 1ODCA 4FTWA 1GPKA 4WCVA 1SC9A 2JGMA 4OYLA 4W9RA 2D5LA 3YASA 1ZOIA 3JWEA 1OXMA 2EDAA 3FSGD 2PM8A 4M0EA 2Z3WA 1XZEA 3L1JA 2QJRA 1VZ2A 4HRYA 3U0VA 3PI6A 4X71A 1JU3A 1MO2A 1H22A 2JGLA 5JZBA 2X76A 4J0JA 4G4GA 5LZ2A 5ALKA 4NMWA 2NW6A 2V98A 1MT3A 1TCAA 3K9BA 5ALHA 5CT4A 4U2FA 3WZMA 1CUEA 3FNBA 3AZQA 1J07A 4X85A 4UBMA 3EQ7A 4H7IA 4X92A 3I2HA 2VEOA 1CQWA 4BDSA 4BDTA 1LLFA 3E4DA 1ODSA 4LXIA 3QM1A 4B85A 2C7BA 3PF9A 4PF1A 3C87A 2VQ6A 3BJRA 3G0IA 5ALSA 1TCCA 5YASA 1HL7A 3BIXA 3F97A 5AI4A 4MQLA 5AKJA 5A71A 4P92A 1JMYA 4H0CA 3ZLTA 3C6ZA 2Z8XA 3O9VA 2O7RA 3ESAA 1CUAA 2XMBA 1XRQA 5ALUA 4W63A 5ALXA 5JARA 4Y9SA 4PW0A 4QDUA 1GXSA 4AZ3A 3A2LA 2HU8A 3TGLA 4EY7A 1UOPA 4B83A 3GA7A 2QKYA 1A88A 1BEEA 1QIFA 3DJYA 1CQZA 4C6HA 5HF6A 5ALVA 1RP1A 3MVEA 3AINA 4FLEA 5FPPA 5IVIA 3G9UA 2PL5A 4J0HA 4H18A 4V2IA 4UBKA 1CUVA 4HXEB 1UKBA 2XUDA 3L1HA 2XI4A 2WG0A 5HZGA 1E5TA 2J3QA 2ECFA 3IUQA 2QVBA 1YSCA 4KE9A 2HRQA 5LZ8A 1SFRA 1SCIA 3C5WP 3M3DA 3U1TA 5EIEA 3RK4A 5AOBA 1MX9A 5IVDA 4OU4A 1R9MA 2WTNA 4DNQA 1MX1A 1BCSA 2XMZA 1LPBB 4RNCA 5K3CA 2XMQA 1AUOA 2WLSA 3VJKA 2GBFA 2VJDA 2JGIA 1UZAA 5AKZA 3DQZA 1U4NA 2DQYA 1LBTA 2BJHA 1OCEA 5SYMA 3OOSA 5T4HA 5CURA 3VISA 1QIDA 2XUFA 3ZLVA 4JUIA 3W9UA 2GYUA 4CIAA 3PICA 2I78A 2J4CA 4UHCA 3WL7A 2H7YA 3K2IA 3IUNA 5AI0A 1JI3A 1AC5A 4UFNA 2QMQA 2V9ZA 2WJ6A 3C8DA 4BB0A 5AK5A 3QMWA 2ZSHA 2EDCA 3H2IA 2JEYA 3I6YA 5EI5A 2VJCA 2D0DA 3EBLA 5AJHA 5FUMA 1E8MA 1Q0RA 4HXFB 1DINA 1XRRA 4X91A 4QLOA 1W1IA 2ES4A 4J0KA 2H7CA 3QH4A 2RONA 4X97A 4B84A 4TPKA 3T4UA 4BZWA 4DM7A 1BU8A 1JMKC 1A8QA 3WWOA 2DCMA 3O9MA 3AIOA 4A5SA 4U2CA 2PPLA 1F0PA 1VE7A 5JZ9A 1IUPA 1MX5A 4UPDA 2OPHA 5A7HA 1XZAA 2PVSA 4OU5A 5HQ3A 4F0JA 4PSUA 3WA6A 4FWBA 4C01A 4DSZA 5KBYA 3HJUA 2ORYA 1UOQA 1CEXA 2VSQA 4N5HX 1YA8A 3EIOA 2FX5A 3VJMA 2BAGA 5A2GA 2HFKA 1USWA 5CBKA 2WSLA 4CG3A 1LNSA 3SX4A 2PSDA 5DNUA 4KE6A 1H2ZA 1I6WA 1UK9A 5JD5A 3F98A 5HK8A 1ACLA 4QDXA 1Q83A 5D3ZA 1H2WA 4X6YA 3GFFA 5IKXA 4YK7A 4DLNA 1DU4A 4B81A 3IURA 1SOMA 1O6GA 1XZFA 2XUIA 4Y2PA 2AJLI 2BUBA 3AFIA 4QDOA 4B0PA 4F21A 5LLSA 3FYUA 4B9EA 4UBOA 4QDZA 3G9ZA 3RARA 1K5PA 2CMFA 3KSRA 3DYIA 5ALYA 1WPRA 4LXGA 5HF9A 5DNWA 2CBGA 1D07A 4BYMA 2YYSA 1CUXA 1XLUA 1F6WA 2OGSA 2BFNA 2YASA 2ZSIA 4HVTA 1EXWA 1DWPA 5AP9A 2XE4A 3MUOA 2H9YA 2WUDA 3WQHA 4XIIA 4J0DA 4IH9A 4G1FA 5K5EA 3EF3A 4FDMA 3VVLA 1CUGA 1QIJA 4Q05A 3H17A 5FRDA 1XFDA 3KXPA 5I7UA 1XQYA 4DMFA 5KWIA 2XUOA 3AILA 1R4ZA 3DD5A 3HLKA 3PFCA 2JGEA 3KOOA 5IVHA 2O2HA 4Q3KA 1W76A 2PUHA 1DT3A 2HHAA 4BC0A 4B7ZA 3DS8A 4B80A 1CR6A 4XX1A 4GEGA 4BP8A 4B0OA 4DNOA 1THTA 2Y1KA 1E8DA 5AI5A 1XZMA 3RLIA 2DR0A 2BGNA 3CCBA 4UBLA 1WHSA 1H2XA 1CUIA 4J03A 2OCKA 2WIFA 1GT6A 2EEPA 5LKAA 3WMRA 3VVMA 3WWCA 2UZ0A 1J1IA 1SCKA 1ORVA 3DKRA 1JT2A 2K2QB 1QIIA 3D0KA 4C87A 5T4EA 4AB1A 3FLBA 3I6MA 3H19A 4FOLA 3OURA 5DTJA 2JF0A 4WFKA 4KEAA 1GGVA 1XZGA 3WK6A 1XLVA 4YASA 4EA6A 4UHDA 4ZWNA 4GXNA 3WLAA 1IZ8A 3STVA 3V1LA 4KAAA 4QDTA 3FLEA 4H7JA 1HLGA 4QZVA 3EQ9A 5C7YA 3KDAA 4Q82A 1DTEA 3WL5A 4BE4A 3GELA 1UOOA 5FPQA 4UBIA 4PV7A 5ALEA 4CCWA 2PBLA 2WUGA 2XQIA 5LYYA 3JW8A 2H1IA 3LLCA 5AM4A 4Q3LA 3FSGA 5AIBA 3H2HA 4D9JA 2PX6A 4JYMA 2QS9A 3STYA 2C4HA 1QIMA 2O2IA 5AI9A 1ZGBA 4ZXFA 2WUEA 4K6GA 2PSJA 1EDDA 3WA7A 1THGA 4S0XA 1GZ7A 1QE3A 5JAPA 4RE6A 1RWQA 2WM2A 1TIBA 3G9TA 1P0PA 3R3VA 1CUCA 3PDCA 4Y2JA 3G02A 1BEZA 1EH5A 1CVLA 2B9VA 4E15A 3O4HA 3RM3A 3STUA 1GPNA 2V96A 4WDQA 4X6XA 5C81A 4DMCA 3CN9A 4M0MA 5AM5A 2AJBA 5E2IA 2ZVDA 3BL8A 1TQHA 5AKKA 4BRSA 2W6CX 2AJDA 1DT5A 4QEKA 1XZLA 2OXEA 5A62A 6YASA 2HL6A 3PUHA 3FBWA 3WK5A 5K3FB 1LPOA 4MEBA 2WHQA 5AM0A 3FVTA 1E89A 3CXUA 3BJMA 2O7VA 2ZJ7A 5K3DA 1EB9A 1QJ4A 3W06A 4HS9A 3E1GA 5BWBA 1VJ5A 3D7RA 1R50A 3ICVA 5BOVA 1VZ3A 4J0GA 3KD2A 3AJAA 5DTIA 3GBSA 4PNZA 4J3JA 3FAKA 2B4KA 2DHEA 1AURA 1G5FA 4U2DA 3STTA 1UK7A 5DWDA 4ZI5A 1EX9A 5JATA 2XQKA 4AMZA 4QWMA 3H1BA 3FYTA 4DSAA 5ALNA 2QUAA 2OCGA 1EVEA 3V1NA 2I3DA 2OAEA 3D2AA 4ARBA 1OILA 4A23A 4FNMA 3HZOA 1UK8A 2Z3ZA 1Y7HA 2IIVA 4J7AA 4FMPA 3G0DA 1E8NA 5J3JA 3ZV7A 1G4HA 2W22A 4QNNA 1UWCA 4OB6A 4KAJA 3HEAA 1FFBA 4C88A 2WKWA 5EHNA 5AM2A 1SCQA 4L72A 4K6KA 4WFIA 3ZI7A 1MTZA 2GZRA 5HCUA 1QLWA 4X95A 1EVQA 1ZICA 5EGNA 3F67A 5JZSA 3A2MA 4LHEA 1EI9A 2VJBA 4W1SA 4AMYA 2RIPA 1CUSA 5D3KA 2WHPA 4AX4A 2OLEA 2ZJ6A 1U8EA 2P8SA 3PF8A 3PE6A 3SK0A 1ZI9A 1VLQA 5FXMA 2G63A 2ZYIA 1YASA 1XZBA 4G5XA 3QPAA 4NS4A 3X3HA 1FSSA 1VXRA 3UUEA 3C8HA 1HBJA 3R3UA 1CUYA 1H23A 1QOZA 3C70A 2VT7A 4Y2XA 5DYTA 1N8SA 1FFAA 5A7GA 2HA4A 3DDUA 1WOMA 2WTMA 4IQ4A 1BE0A 2FJPA 1TCBA 4F5ZA 5CRIA 1KU6A 1K4YA 1MJ5A 5I8PA 1N5MA 2ZYRA 4LYDA 3DOHA 2QT9A 1TKRA 2PSFA 3H18A 5K3BA 2ROQA 1YB7A 3LS2A 3LIPA 3WKDA 2C0PA 4KE7A 2GBIA 4AXBA 4X3CA 2HM7A 5AM1A 4BP9A 4GW3A 4IH4A 1YAHA 2G4LA 3LP5A 4DMKA 2WQZA 4RPCA 2CB9A 1LBSA 4A16A 2DFPA 3WWPA 3AZPA 3VXKA 2GBCA 3N0TA 2WJ3A 2WG1A 3WK8A 4AZ0A 2XUKA 1CUUA 1TAHA 4BRZA 3QMVA 4MWTA 1XLWA 4B6GA 2OGTA 2X5XA 4Q3OA 1WM1A 1ZD3A 1UKCA 2YXPX 2FUKA 1CUJA 5ALOA 3TEJA 3ESBA 5JADA 1NU6A 4AO7A 4W1RA 3WK7A 3DL4A 1U65A 3WIOA 4KACA 4DMHA 2GBGA 2QM0A 4GI1A 2I3ZA 4N8SA 1JFRA 3HABA 1QZ3A 2XUGA 4X7BA 4EY6A 5ALTA 1B41A 4H7FA 4QWWA 1XKTA 1TRHA 3G8YA 4UFPA 4LIPD 1HQDA 2ONCA 2WFMA 4I4CA 3SC2A 3WK9A 1VA5A 4WY5A 3I6ZA 4QA9A 3SWWA 5AK4A 3IUJA 3ZWQA 1K63A 4CFSA 2PKYX 4Y2RA 5BWCA 5DYYA 3HC7A 5FOQA 2IITA 3BF7A 5ALJA 4DNPA 7YASA 1CRLA 1XQVA 3D3NA 2XMGA 4Q34A 3C43A 4UHBA 5ALRA 1CUFA 4EY5A 4O08A 4H7HA 3G0GA 2WU3A 3HXKA 5A7FA 3R0VA 4U2GA 1U2EA 5CXXA 1EK2A 1CLEA 1ACJA 3E3AA 1LZLA 2XUAA 2BUCA 3DNMA 4K6HA 5D6OA 3F9CA 4INZA 5HF8A 5LZ4A 3IBTA 1GPLA 1R9NA 5ALMA 4H77A 3IA2A 3OC0A 2WHPB 4FLFA 3OM8A 1MN6A 2VF2A 1PJAA 3QPDA 3BDVA 3QBJA 3E0XA 3C6BA 4UUQA 5FKJA 3UMJA 3DEAA 5AI8A 3I2KA 4CIBA 1C4XA 3I2GA 5EFZA 4N8EA 1J2EA 1YS2X 1LZKA 1LPNA 4G9EA 3D4LA 3WL6A 2AXEA 5AKLA 4Y2QA 4AQDA 3V1MA 4PQEA 3FLAA 1ZD5A 2R8BA 1ZI6A 4FHZA 3O4IA 5ALIA 1HPLA 4OUKX 1VA4A 2HIHA 2WHRA 2Y2UA 1BN7A 1FFEA 4P93A 1G42A 3VDXA 1AZWA 3B5EA 4G9GA 4IHAA 1CUZA 4JEIA 2HA6A 1XRPA 3OPMA 1R3DA 2OQVA 1ZIXA 2HADA 1ORWA 4L0CA 3QZUA 5DNVA 3W2TA 4ROTA 4PSDA 1DWOA 2GZSA 5DJ5A 2XLCA 4E14A 1IVYA 3WKBA 5AKGA 2XMSA 3G9XA 4KYVA 2J3DA 1K6EA 1PV1A 1E3QA 4CG1A 1R88A 2PU5A 2RGUA 4H7DA 3D2CA 3ICWA 5CW2A 3O4GA 2WFLA 2HRRA 4BAUA 4BCBA 5CH5A 4KAFA 1ZJ5A 1MAAA 3WZLA 2JEZA 3A2NA 5AKHA 5BV7A 3ESDA 5E4TA 3BF8A 5EHZA 1JJIA 1LPAB 5JASA 2XMRA 2CZQA 2HA7A 4OD0A 1AMNA 3M82A 1T2NA 3D2BA 1JU4A 2XMDA 1QFMA 1QIGA 5JALA 4WY8A 3N2ZB 4CG2A 4KR0A 5CT6A 2DHCA 3C6XA 4C4XA 4CCYA 4U2BA 2WUFA 5HQ3B 3V1KA 2WFZA 2OAGA 5ESRA 5JAHA 1Y7IA 2XQJA 5ISMA 1XZHA 5LIPA 5F4ZA 2WG2A 3TJMA 5HFAA 4G4JA 4WJLA 4AO6A 3M83A 2HA2A 5FV4A 5AO9A 3DL7A 5ALQA 1QFSA 4ZV9A 1XQXA 1ISPA 1XZDA 5AICA 5JYCA 5IH7A 4BVKA 5ALWA 5SYNA 4MWSA 1DWQA 1G66A 4BVLA 3FYUB 4X90A 3V48A 1QTRA 3TRDA 3LIIA 2XUJA 3IIIA 4H7EA 3S2ZA 4CI9A 1DQZA 4FLMA 3AUKA 3P2MA 3STXA 2WIJA 4UFOA 5KWJA 1L7AA 3AIKA 1LPPA 3HRHA 2C5GA 1CIJA 1R1DA 3HACA 1UK6A 1LGYA 5A6VA 2VJAA 2WIDA 3BE8A 1VE6A 2WIGA 2V97A 2PU7A 4BAGA 3QVMA 2OQIA 4UHFA 4FBLA 4UHEA 4OPMA 2HU7A 2WJ4A 2HDWA 4IO0A 3WKAA 1FFCA 5JD6A 5K3AA 4AO8A 1JJFA 2CEKA 3I1IA 1Q84A 2GYWA 3WK4A 1CUDA 3ANSA 3QMMA 2ZYSA 5C8VA 3H2GA 5AOAA 2VTVA 2QR5A 2HFJA 1F8UA 3M81A 5HF5A 2Q0XA 1DX4A 1QIEA 1LPMA 2O2GA 1BRTA 1QGED 5H3HA 4B82A 3WJ2A 3Q0TA 4DNFA 4UBNA 4EBBA 1UFOA 1LPSA 5FLKA 1EB8A 3HYSA 4FKBA 2VATA 1DX6A 1WPXA 5E4YA 5D7BA 3O0DA 3A70A 1QO9A 1CPYA 2WFLB 4AN1A 1P0IA 5AM3A 1QIHA 2E3JA 5FDFA 5AKEA 5AOCA 5ALFA 1XZIA 4TGLA 4BE9A 2RI6A 1XRLA 2VAVA 5CMLA 4UBJA 3WI7A 3OTQA 4FFVA 5AKIA 1BROA 1XQWA 2BUAA 3R41A 3ILSA 3I2JA 2QRUA 4J0IA 4BC1A 3L1IA 4Y2YA 4L9AA 4QLAA 3Q8WA 2XQGA 5K3EA 3BDIA 4CCYB 1P0MA 1Q0ZA 2QZPA 3R40A 4IH1A 3NUZA 1XKLA 3I2IA 4RE5A 5AKXA 2PSEA 3MUNA 1YA4A 4AN0A 4U2EA 1VXOA 4ITVA 4GHWA 4QE3A 1EA5A 1A7UA 3F96A 3FCYA 3WIBA 2OGZA 4EZIA 3H2JA 3ANTA 4DIUA 2OCLA 4BATA 2Z8ZA 4MYDA 2WU4A 3G0BA 2QTBA 4XVCA 1Y37A 5HKBA 4FBMA 2B61A 3R3WA 5CT8A 1ZD4A 3GROA 3WKCA 4JYPA 1MU0A 3NOXA 2XMCA 2ACEA 2BCEA 5DYWA 1EDBA 3DCNA 1MPXA 4MEAA 4KRXA 1T4MA 3IDAA 3DKKA 4LKOA 2ZYHA 4FNGA 1QO7A 5EHQA 3FYUC 1GQRA 3H0CA 1EHYA 4G4IA 4BCDA 5T4BA 4HXGA 2QJWA 4JH0A 5JD4A 4G8DA 3OG9A 1YB6A 1WB6A 4MYSA 2VA9A 4OCZA 4L3WA 1X2EA 1UT6A 5FP0A 4M0FA 1L7RA 2VT6A 4NZZA 1RYYA 5ALPA 4PO3X 1W6RA 1IZ7A 4X94A 3NWOA 2Y6UA 1VOTA 2AJ8A 4ZREA 1TK3A 2Z5GA 5AKYA 3QPCA 3R3YA 1P0QA 2LIPA 2IX9A 3F8SA 3WYNA 4RGYA 3JYHA 3V9AA 2XUHA 3ED1A 2HU5A 3DYVA 4HRXA 3AZOA 4EUSA 1UKAA 3BIWA 4GDMA 5AH0A 4WDRA 1WCYA 1W4LA 2OG1A 1ZI8A 5CH8A 4H7KA
chains in the Genus database with same CATH superfamily
2BFDB 4P08A 1TQ4A 4UQPA 3VKFA 2E0IA 5JHGB 1H0SA 4ZEVA 9LDBA 3PQ4A 5ES4B 4YRSA 4HR7A 3NP9A 1UFKA 3LX4A 1SWVA 4YMUA 3EVGA 5C8XA 2WP8J 4ARSA 2FPGA 1M34B 1NVKA 2Q5CA 3JRXA 3K2EA 1DKNA 4Y2SA 2XPCA 3EARA 3L6OO 4I2NA 1PFQA 2D6FA 1N6NA 4RTPA 3NNNA 4I5DA 1PJLA 2RJNA 2BE9A 2WILA 4ETWA 3BRQA 3RHFA 4O0MA 5CJPA 3GVPA 4EUFA 1MHPA 3DLPX 3OZSA 5KHAA 4HUQB 3T94A 1ENZA 4LXHA 4N3GA 2F1KA 1KQNA 3PR2B 2C2BA 1GKLA 1Y4ZA 3AONB 4EABA 1R0KA 3EJ6A 3DE5X 1GZ4A 3T5PA 1EGHA 2JS7A 5J1SB 4LFAB 1HOTA 2V7PA 1IB6A 1TUBB 3BIOA 3CO0S 4QUIA 3MELA 3BRWD 4JI0B 4HKTA 1C29B 2HA5A 1KKLA 3GCXA 4UARA 4FS8A 4DBLE 9GPBA 1W75A 1ZGZA 2CLKB 4GSKA 1HI9A 1XDUA 1O9BA 1X1RA 5JSKA 5T8KC 1O95C 1RWOA 2WU1A 4OY3A 3U49A 2JLUA 2JBWA 3BRCA 4F4FA 3GK3A 4R1OA 1XWWA 1MLDA 5ALDA 1ZM7A 3U4DA 5DW0A 1SD1A 1WD5A 2PFSA 1ATIA 3U44A 5F1OA 3V8EA 4X66B 1RM3A 3FWHA 2PRZA 3GPCA 4ND7A 2Q8PA 4B3IA 1MG5A 2MIIA 5FBZA 4R7ZA 1CEQA 3L9XA 4DNXA 1TTHA 4MW6A 5I9IA 2W8BA 1JILA 1ZJ4A 2CEAA 3MCZA 3N39C 4UOEA 5JQGF 3DP7A 3JAMA 3N8DA 4BVAA 1PFUA 3M89A 2J30A 3AWIA 4DTCA 2GPAA 2ZANA 4F04A 3ONVA 4JJIA 5IC4A 4I5FA 2MINA 5EWJB 5KVSA 2GEJA 2DWOA 2YVUA 2FZGA 4KO3S 3HMKA 5AJVB 3AJDA 3HBNA 3LQKA 1GUFA 4JROA 4KDCA 3ZJYA 4OSPA 1K5GA 2QAGB 4BWFB 1G8YA 3QJGA 3T52A 2SKDA 4QNMA 3MWJA 3L77A 3ASVA 4NVRA 4FYMA 2QYSA 2BKLA 3HO6A 1HYHA 3CF6R 4ML3A 1SKAA 2JLZA 1OH6A 1BGXT 3CUWA 3S5UA 1CUBA 1MNAA 4DY6A 3IUMA 4YUVA 2H52A 3RBVA 3HSSA 3LDUA 5JAOA 3FNFA 2O4CA 1P1BA 3MPUA 3OIUA 2CFRA 1GL7A 1X7WB 4AW9A 4CQMD 3ZNPA 5JH7A 2ODQA 1JNYA 2WM9B 1N7HA 1DRUA 2FVXA 5K7SA 2GO1A 2WIKA 2K6GA 5D85A 4DC0A 2GM4A 4P4TA 4EIWA 4BVJA 2BFBB 2WTBA 2WF9A 3IQWA 4WOCA 4D82A 2GJ8A 1Z68A 3BH6A 2J9ZB 2VDNB 2JK0A 3G0CA 3LX6A 4KRYA 1XCPA 4LOIA 2V74B 3TTWA 1ZIPA 3C3KA 5DU2A 5BNFA 1CZKA 4A0SA 3A05A 4MVJF 4PU0A 1R0YA 2IUUA 3GIDA 1KO1A 3LQQA 3IT2A 3PZRA 4ODIA 5IC5A 5LZ9A 5EXSA 1SUBA 1Y8AA 1GDDA 3FKSA 3IULA 4MR8B 4ZCPA 5JC8A 3EEOA 3MLBA 1S2IA 4FYIA 3LBIA 4D3ZA 1OLSA 5EKUA 2B5OA 3BCUA 2XWPA 3C5VA 4RHEA 1K9VF 3K2BA 4N7BA 3B3QA 2L2QA 1I3CA 4POAA 2HSZA 2VJKA 1TAQA 4OBEA 4PFSA 3GLTA 2F59A 2CV0A 1A9XA 2PT9A 1JA9A 4COKA 3GYBA 3BJZA 3O7MA 2ZCVA 4QRHA 1FMCA 5FEMA 3WL8A 1OH5A 1EHCA 3ROZA 3JXBC 2A67A 3V00A 1DFGA 4PO9A 1ZWKA 3KVNA 1SVLA 1CFZA 2PNFA 3R5SA 1LQCA 4MVJH 1AX9A 4WIAA 1N5RA 3A3KA 3ZWWA 4DWWA 2O2DA 1INLA 1L0BA 5DCWA 4TOIA 3ZY3A 2Q7DA 1GFIA 1FLVA 1IZ0A 1I7NA 1RI2A 1NA5A 1XKXA 1EMDA 1Z22A 2NAFA 3HL0A 3IQFA 4G5HA 2Q9UA 4GBGA 1YVRA 4KSYA 1HFKA 3CKKA 5CB4A 2XUQA 4WMLA 3I2YX 3OQIA 3TR6A 4YUYA 1GARA 1YFLA 1AU9A 4FD2A 1Q50A 1DKUA 3COPA 4QFDA 3RE1A 3KKEA 1RZSA 3KK0A 3EGDB 1NASA 3PHIA 1QV7A 1CNEA 3AHIA 2GHIA 2ATCA 4JJ4A 1X9GA 2ISCA 2XWBF 5C5IA 4I9NA 3H04A 1S89A 1FX0A 2Q4TA 4FXOA 3U4GA 3DTTA 1JR2A 5LZ7A 1JDSA 3SR3A 4D9MA 6NULA 2A58A 5C8YA 4MRAA 4E5MA 4COOA 1AUPA 4HDMB 2P4QA 3CRNA 2Q5LA 3PK0A 1W6UA 2I6TA 3OFND 2IVZA 2N9UA 1YR2A 4NK5A 4XVUA 2I1LA 2IY8A 1OWOA 2FEMA 3WYAA 2AVNA 4XWGA 4HS4A 1TVEA 3V7YA 4OM8A 4OQEA 1KOLA 4UUAA 5A0FA 1HFJA 1P1RA 4OBMA 4K2HA 3PR1A 1D6NA 1YBMA 4X93A 1B8UA 5K0SA 2DJ5A 5KREA 3G7NA 1T5BA 1S8OA 3C3PA 3K73O 2VDRB 4MUGA 2TSYB 2J3KA 2VP2A 3NGMA 2GLUA 4MTCA 3BSWA 2AS0A 3UOAB 2GFHA 3ET5A 4HADA 2JH3A 3WWDA 2YWGA 3B51X 4Z4CA 1ODTC 5B3LA 2FMXA 3GUVA 3CG4A 5BN4B 1LJUA 2C8JA 2VP4A 3TLYA 2NZWA 1JLLA 1OTYA 1IOLA 2Y6VA 3L1UA 5L4LA 2JC3A 3TG8A 2ZTLA 4TT3A 1QDUA 1AQLA 2L49A 3JQQA 3TM5A 1ULHA 1HE3A 2QOEA 3S7ZA 1ZR2A 1D2RA 1L8AA 3E3OA 1AH2A 2EW2A 2ZUSA 2R1TA 3PFFA 1DTSA 3PQCA 1HE1C 3QNUA 2F9MA 3B2NA 1DGQA 5DGDA 1N5IA 2QMZA 2RHWA 2VJMB 1CE8B 2RI0A 5AK3A 3RT7A 5JJLA 4MJ3A 2J7PD 1KP2A 3DFUA 1OUMA 3STHA 2OO5C 1AE1A 3RUIA 1NDQA 2GVDC 3C3XA 4J4TA 2B20A 4RTQA 3ZK8A 3E23A 3V5NA 1VSTA 1HDCA 2UZ1A 4J75A 4MO9A 3CGWA 1MP0A 1LBHA 4LNHA 3QLEA 5KOYA 4MRSA 4LF6B 1IUOA 4RKRA 1RMYA 3TUZC 4JXXA 3VM6A 5LMCA 3URMA 1X7XB 3ENKA 3ZZMA 1P77A 3BWXA 1DULA 1JEDA 5EWMB 4MUYA 2FVYA 1DFIA 4YLEA 3VJLA 5B3JA 1WD7A 3FPHA 3H13A 3W05A 3K70C 2DUWA 1Z0ZA 3FETA 3M5DA 4IQFA 2FRDA 1Y4UA 4FWTA 2GBLA 3LL4A 1NBEA 3HHEA 3R3XA 4NG5A 3A6KA 1OPXA 2P9TA 4D5GA 4EJSB 1NW8A 1G19A 1KYIA 1FNBA 3O8DA 4HNHA 3WP0A 1LLUA 3OEHA 1W4AA 3OQVA 3H1AA 4S1NA 1WY7A 1YL7A 4OMCA 3U4HA 2X1LA 3MGAA 3Q3JB 3WLNA 2NZXA 2AX3A 5DXFA 2F1OA 2RIRA 1ZDMA 4XJVA 3GQBB 2JAXA 1WXXA 3LA6A 3HR7A 3TNJA 5EQDA 1ESZA 4UNNA 3WRXA 2HV8A 4AMBA 4QU9A 2HSWA 2QPAA 1C8VB 1JHZA 4FI3C 2C1EA 4M87A 3EZ9A 1NC3A 2FN8A 3ZPXA 2A9KA 3P5SA 1RYNA 1L3CA 3DONA 2WJZB 2NZJA 4N0PA 1A98A 1IMJA 1ZXXA 2C4NA 2ZBUA 5EMMA 4AG3A 1W7AA 4LNUA 4JAVC 2HHJA 1MT0A 2GNOA 2ZRNA 3JCZA 4FIDA 3TZKA 4TLBA 5CB0A 2PH1A 2X2OA 4JIGA 2B30A 3EIUA 1JHVA 2R87A 3FCXA 4K28A 3FPSA 5E1BA 1KY2A 3BXPA 1ZZ9A 4GLOA 3AVWA 5K4AA 1DTWB 4OLJA 1O1YA 4WJKB 4BCCA 1HEIA 4DGQA 1I9GA 7MDHA 5DX0A 5FBRB 1CUHA 1I6LA 3F6EX 4I14A 1TT5A 2Q1SA 1RCFA 1XHEA 3WWEA 2PXLA 4OG2A 1ZWLA 3QU4A 4B3XA 2PX2A 3QUAA 3RTDA 4DMMA 3EIFA 1D9ZA 4YQFA 4ZQGA 2CJPA 3UB4A 3FJOA 4P4GA 4Q03A 1YWGO 3BGIA 3MHPA 3KD3A 4NENB 4EUKA 3EDMA 3FHCB 1HTWA 2I2AA 4HLUC 1VPTA 4KVGA 4PWZA 4C4ZA 1OU0A 5J2TF 2P3QA 2J4FA 3SYLA 2WJGA 1UDCA 4O4LF 3ZGXA 2CL5A 4CMKA 1CFJA 4IWRA 2E4AA 3IBFA 4HNSA 5HJ7A 1RD4A 4PLPA 4CMEA 4KBFA 1SZJG 4UHKA 4R41A 3TRIA 4P3XA 5C18A 1UMCB 2PUVA 1J25A 2MDTA 2H11A 2NSHA 4K2AA 4EAQA 5KX5A 4URUR 1YT5A 3H9UA 2QN9A 5L3ZA 3GDHA 1NUAA 2PIAA 2XNDD 2X2FA 4G5OA 2PMEA 4DA7A 4LTNA 5TQ2A 5HJ5A 1QG4A 1E9FA 2H63A 3FGPA 1XXHA 3G5UA 1QPZA 1U9ZA 4G09A 4RKWA 4F3CA 5KTTA 2DHRA 1KJWA 2CVFA 2FP4A 3MRSA 4KNWA 1A7KA 1P3Y1 3MGGA 2VNJA 4F7DA 5IG2A 5ECYA 2XX3A 3RG8A 1XTPA 3PQ3A 2FJUA 4X1OA 3FUVA 1V48A 4F8JA 3Q1LA 4ERXA 3TVTA 2BFFB 4U7JA 2CKDA 1IHDA 2GCOB 1QPGA 2HPVA 4N65A 4H6XA 2C5FA 4PX3A 2C2ZA 1PJQA 3NC4A 1A69A 4OSEA 2PZFA 3KHUA 5TX7A 4U7DA 3HXMA 3NXSA 3L4KA 3UAYA 4XEHA 5HRAA 4UOQA 4IF6A 2YH2A 5IBCA 4MV0A 4PRYA 4FTWA 1N7JA 2JIZD 2LWIA 2HWKA 5CXSA 1EM6A 1Y4SA 2GNPA 4OYLA 1IC8A 1KFJB 4FWIB 2I4TA 4I99A 4R9NA 4W9RA 5EIOA 4TTPA 1L9KA 3Q7SA 1QYRA 4MVXA 4XLTA 4GI7A 1E69A 4Z86A 3V4RA 4JP1A 4DDUA 1KOJA 3RIHA 1WF3A 4JQOA 2ODPA 3RR2A 3FPLA 3LPLA 2WIBA 1MKYA 2BEWA 1EFTA 3CINA 1AT1A 2HK6A 4HGOA 4QQRA 4X20A 3VDMA 2Q1YA 1Z8DA 1ISIA 1RW4A 2QP4A 2QJRA 3DDCA 1WXQA 3LD9A 3N2KA 4LJRA 3QNMA 2IIBA 2ZPTX 5EAIA 3WYFA 4HRYA 3CROL 2VHWA 2FWAA 1B42A 4ZIRB 2ONZA 3JASB 5K8VA 3LT4A 4X71A 1JU3A 4QTZA 2OXTA 4C6TA 2JGLA 4CMBA 4BEBA 1UMDA 2QLLA 5GAHi 3RSZA 3OE7A 4R4JA 4Y2HA 1AMOA 4NMWA 5KNCD 1WWKA 1CEYA 1V47A 2KEKA 2RKOA 3G5TA 5IFLA 1N1GA 2YWCA 1B2LA 4D43A 1I10A 4TUYB 1TCAA 2XWJI 5ALHA 4KMOA 3OT4A 3VO8A 5GADl 5EJ4A 3JD2A 1MIOB 1DI0A 1BA2A 1Z45A 1S8AA 4D7AA 2GSWA 3EA4A 1BX1A 1HO3A 3UYKA 1FQOA 4GPTA 1EJ2A 4GKVA 4X92A 1FYFA 1CQTA 1OY1A 3DZIA 2Q45A 3AM5A 4MUMA 3GLGB 3OQMA 2ATVA 2J85A 3I2HA 3CY6A 4V0SA 4BVGA 3AVQA 3DE7X 1AOXA 2HHCA 3E4DA 5FOUA 1N9GA 5MF6A 3S55A 2IEGA 3CLRC 3KYCB 5BUQA 3RKUA 1ODSA 1G21A 2L0XA 1G9SA 1VCMA 3TEPA 5KQMA 5K0FA 3UT6A 2CZGA 3W5SA 1D7OA 5KSOA 2PXDA 3OVMA 2VZ9A 4KIWA 2VQ6A 1NZFA 3IP1A 5EYPA 3TE6A 2RGRA 3V8BA 1NEQA 3P9YA 3T54A 2XH8A 3DV9A 4GU5A 4Q3DA 1J99A 4LHVA 5FD8A 2DRIA 4MQLA 5BMVA 4RHXA 5AKJA 1OC2A 3AY7A 1VIVA 4J0QA 4OQMA 1JMYA 2GH1A 3D7KA 3OT5A 1NAHA 4EQZA 2FWMX 2WR8A 3UFDA 2X0KA 1HRKA 3A1SA 3NONA 2NTYC 4XOUA 1CK4A 3C6ZA 1BAPA 1YC2A 2HSJA 3FPJA 5DLQC 2P90A 1XMXA 2HCSA 1MABA 3LPDA 3V8RA 2HNAA 4B8YA 4YYEA 4BFWA 1ZJZA 2P7HA 1UXCA 2OFOA 4RSHA 5ALXA 2FW7A 4B87A 1UL1X 2F9LA 1VB3A 4JQCA 1QDLB 1W94A 2GJKA 5G40A 4MWOA 4EA9A 4QDUA 1GXSA 5FH9A 3NVDA 3TL2A 5CVJA 4DTIA 1RRPA 3W8EA 2DCUA 3AHCA 3VPXA 1NSTA 3UAXA 2XXAB 1LFAA 4PZEA 3A10A 1G8SA 1O57A 3GA7A 4I50B 4XLLA 4MUJA 1ST3A 1A88A 4WKGA 2CBZA 5FBWB 2P65A 3MMPA 4XD7A 3TQCA 1CQZA 5KNDH 3VDNB 3N5CA 4RVGA 4E51A 1K06A 2JCXA 5JQGB 1SG9A 4ZD6A 4QBFA 4L8FA 4Q37A 2RHGB 2WTAA 1KI6B 4GPZA 5D1NA 3DMRA 4D8UA 3AINA 5FPPA 5JJ5A 2AXUA 2IZ5A 1GA1A 4ZAWA 4YY3B 5ELXA 4N5MA 5HS6A 4F1WA 3OIDA 3BICA 1L1EA 3VO1A 5JNUA 1H6BA 3HB7A 4NCHA 4UBKA 4D6YA 3EF0A 2XUDA 4PX2A 1AGPA 1A9RA 2WG0A 3HKEB 3JQFA 4ZKEA 2AKYA 3JQGA 5THQA 1RIFA 2D62A 2EWWA 1CZUA 3U17A 1E5TA 4NARA 3D3WB 5A0VA 4FBIA 2ECFA 3EOAI 3JQBA 2C8LA 1U28A 1SCDA 4OHZA 5DYGA 2F3PA 3QVUA 4CN9A 1RRCA 1T5DX 1M2WA 3DLHA 1T43A 3II6X 4A1FA 4AZSA 4G9BA 5GIOE 1XWFA 4K9KA 3OC6A 3C5WP 3A6HA 1S0UA 4ZMRA 3U1TA 3O82A 3UFXA 3RK4A 3QLUC 1OAAA 4ZAYA 5CEEA 4M6WB 1XP5A 4GDFA 2NVWA 2QR3A 1MVOA 1MX9A 5IVDA 2Q2VA 3QXXA 4OU4A 4QAQA 4FOOA 4DNQA 5SZIA 4QSMA 1X0VA 3T7IA 1YS7A 5J2UB 1ECCA 4MKZA 1QXSA 4JODA 4E5YA 4X4DA 1LPBB 4TSKA 3OWXA 2YVAA 1DJMA 1PRYA 1PWZA 3FWZA 4JUAA 4KXMA 3FCSB 4O0LA 2WKRA 3G6KA 5K3CA 4QREA 2XMQA 1E3MA 1AUOA 2ZUCA 4RQAA 1RQLA 3P2IA 3VJKA 5JISA 1W46A 1EP1B 2GBFA 3WQQA 1R4MB 1Z2EA 5ITWA 1UZAA 2H1HA 4LYAA 4OXYA 4AKSA 1R0CA 4Q0MA 5DEIA 2ZWOA 5AKZA 2ZRPA 5DM1A 1A72A 1H6CA 3OFVA 4HB3A 3WS7A 5ICGA 3EBPA 1PK8A 1SQGA 1N2GA 1U4NA 2OC9A 2FZ4A 3HUUA 3QG5A 4RVOA 4K1LA 2HD4A 3D4NA 5EJEA 3EA0A 3HADA 1NW6A 2TMDA 3QEMB 1HETA 4IX9A 1ADJA 1LBTA 4X44A 4C7OA 2BJHA 2PTHA 4RSMA 3L02A 4NEGA 4UM5A 1KBQA 4UXHA 3V6LA 4WLVA 5JPIA 4PPQA 5T4HA 3THRA 4DY4A 4GFDA 1KZ6A 4OHKA 5B55A 3NQ41 2J5RA 4IS3A 1W2WB 5EXDA 3DCJA 2EWTA 2BIFA 2JVKA 1QNLA 4UTZA 2IYVA 3QPVA 2C54A 4OYRA 3F5MA 3MSCA 3IJ5A 1C1HA 3HDQA 3CJTA 4K46A 1NVXQ 2WSYB 4NNJA 4AUNA 3O4VA 2RI1A 3OX2A 3GDWA 1QH8A 5JBNA 2NU6B 3KUXA 3MQFA 4GKBA 2B92A 4JQYA 3WL7A 4AP6A 4LFBB 3QXSA 1F7UA 4INOA 5C31A 1V2GA 3PX7A 1LTHR 1IZYA 1Z7BA 3PHHA 2DP4E 1B76A 1PSZA 2H4XA 1T1IA 3B1FA 4FC7A 1PVDA 2O2EA 4MMZB 4NEQA 1ODLA 2P2ZA 3R4VA 1FPQA 4NG4A 3B3AA 3U3ZA 5KQLA 3GLFB 1A97A 3SMVA 4F45A 3UWKA 2O1EA 4ZYZA 3OEYA 4AUMA 4FILA 2I99A 5I7FA 1NZDA 5BQFA 4B74A 1RHQA 3IHKA 2XAAA 3HR4A 2GD1O 2ZSHA 3O31A 2EDCA 4DAOA 3HVRA 3RAEC 5JMPA 1VKNA 5GZ1A 4GC5A 2JLCA 3HFGA 1IWPB 1F2TB 1FSPA 1ENPA 2PLFA 3D1LA 4QPDA 4D3YA 2F8SA 4Z58A 3EBLA 2BSQA 5FUMA 2HNKA 4A4DA 1UBLS 1JHUA 1C7QA 2C5LA 2RFLA 2AOTA 3FOCA 3PJFA 4H59A 3U6KA 4YAJA 4R1TA 3EUFA 4FXPA 3SDBA 4MS4B 1J09A 3WHPA 4X91A 3KYDA 4QLOA 1UXHA 3C6MA 5HW0A 5ITSA 2ES4A 3LSYA 4I1RA 1Q0SA 1TECE 3JZDA 2YYZA 4J0KA 4YN3A 1W0KD 2CB0A 3GLIA 1YB1A 2WIUB 3MWFA 1SIWA 3QH4A 4IJ6A 5EWLB 3MYRA 2RONA 2YWJA 4PRLA 4GH5A 1PZHA 4X97A 3ROEA 1G16A 3DHEA 2P30A 2VQDA 2IZ7A 1M2FA 4PPGA 4WHMA 5IANA 1EQAA 2WWXA 3ZVLA 4BZWA 1MF7A 4F2DA 2ZQ5A 4D0RA 4DEXA 4U00A 1WZCA 5E1OA 1QC5A 4G56A 4FGLA 3LWDA 3W77A 2HHLA 5KC9A 2O8BB 1IXYA 3FAZA 3SLKA 3ZNQA 5H4HA 3QOYA 4G25A 3VZSA 3ORSA 2UUBB 1W19A 1CJUC 1LSOA 4NX2A 1N9KA 4G84A 4I6GA 3AR5A 5IAEA 4UM9D 4WUTA 5JG7A 3T06B 1Z9BA 3UK6A 1PZNA 5JRDS 3KV1A 3NBKA 1ZUNB 2YV2A 3I8OA 2BFCA 3ONNA 3PPYA 521PA 4B43A 5JZ9A 4WUVA 3UXHA 1RZRA 2KSQA 2I7CA 1SEVA 4MKXA 3BTSA 5BSTA 4YUZA 5HJEA 1WPGA 2V0CA 1B74A 2C2GA 2XZDA 4TV8B 4WN9A 4DLZA 1X7DA 3K30A 4PLZA 1CHDA 2R6GA 5CYFA 2QZ4A 1XZAA 1PFYA 5LL6P 4BNLA 1E0SA 2X40A 3HVHA 2H1OA 5BNZA 3HXOA 2FEWB 1UP4A 1XCOA 2EX0A 2G80A 3LLMA 1RJWA 2QM7A 3CX4A 3R5KA 4OU5A 3TK1A 5HQ3A 5LYJF 3WA6A 1TJNA 3BKWA 4BBJA 3VPHA 3OJLA 4C01A 4DSZA 2Y76A 1SH7A 1FSZA 4DQKA 1CEXA 4N5HX 2NVBA 2FX5A 3RU2A 3VJMA 2BV3A 1L5RA 2CJWA 2FR8C 2Q5OA 2QIPA 3SVLA 4ZEMA 5CVDA 4S0ZA 2L8NA 1W8IA 1J0XO 2OKCA 2WPDD 2WSLA 3FUUA 2QAJA 5AUNB 2JGRA 1B6SA 1M72A 2WUWE 4D96A 3LUCA 1PP4A 1E64A 1ZCAA 3S3TA 3SF8B 5JAIA 1LK7A 1E1RD 1N33B 5IJ9A 3KFXA 5CCXA 5DNUA 2NWQA 1U0NA 3PPVA 3PWKA 4RJJA 3QFHA 1K1EA 3ND5A 3NBXX 2QRMA 4A0FA 5KSYA 3W2EA 1ACLA 3UW1A 4EATA 1TOAA 4JB8A 2OECA 4DABA 4O2BA 1CBUA 4X6YA 1L2TA 1NBWB 2OHFA 1G2QA 4CM7A 5JJKA 3LAWA 2XIUA 3LUFA 3R0QA 4NE2A 3WWYA 3KJIA 1XDSA 3QVLA 3BB4A 2OAP1 3PC8C 2P5YA 4I3GA 4CM9D 4CR8A 4NULA 3KB2A 1EJ6A 2CD7A 1R8XA 4LYFA 2XOXA 3CQ9A 4Q48A 4DXDA 2AJLI 1XEWX 2OHXA 2ILTA 4Z9FA 3QI7A 4QDOA 5EE0A 2OA0A 3JWGA 4ZTUB 1L6RA 3ONFA 1XC7A 3K0HA 2YVQA 3HN7A 3KKMA 4M7WA 3T95A 2Y0CA 1BIFA 1RWKA 4KQ2A 2WSSD 3C8UA 3KKNA 4TV9A 1E2UA 2WMOB 3EIQA 1BHO1 5B4UA 1F38A 1BX3A 3IKMB 2W11A 4HD8A 3TCXB 2VTKA 2W2KB 2ZREA 5HMMA 4FHEA 2EJCA 2P35A 4QDZA 2IUEA 3RSGA 3T0IA 2D4AA 3UA3A 3ORRA 1T4GA 1H5UA 2WYHA 3E3NA 4TWIA 3GEIA 3U3WA 4UEWA 1JZQA 4MX8A 1XNQB 1U7PA 4MI9A 1JNXX 4QOSA 4LXGA 3ZDXB 4RHCA 2HJHA 1HURA 3C4JA 3O4FA 5DNWA 2Z2IA 3QTBA 5JWHA 3GDOA 3TWOA 1PUIA 2WSBA 3OM0A 4AY2A 3UV7A 4GZ3A 3GT7A 1XJCA 3QVVA 2ADMA 3RTGA 1XLUA 1MTOA 3PEWA 4QTTB 1NR1A 4L8GA 2BE7A 1DUSA 3K05A 2CHFA 2PL9A 3BSYA 3V4VB 4QUGA 3SC6A 3GA0A 5FA6A 5AP9A 2ZDQA 1BXGA 2GEUA 2QM3A 3IJPA 4ND1A 4UMFA 2XCOA 3V2IA 3O3NB 4BY9E 1YI8A 1IY2A 4KQEA 5CDYA 2H9YA 1KDYA 1QHXA 3AP2A 1Q11A 3PGJA 4O2RA 4OO3A 5AOVA 2CCKA 2HDOA 4RXTA 3ZX4A 3KZNA 4W7SA 4J0DA 2ZUWA 2V3VA 2WTEA 2AR7A 3EF3A 3NUQA 3SJ7A 4FDMA 5CYGA 3FZEA 3NIDB 1Y9DA 3NTLA 1U2PA 3PQ8A 3KEOA 5DGCA 5MN4A 4BMNA 2FAXA 2M6RA 1PJ2A 3D3QA 4L1KA 1DPFA 3HK2A 3ANYB 2H5JA 4BV2A 1FXSA 2OORC 1NF3A 2O20A 3KZVA 2WMYA 4UAGA 5BN3A 1SCUA 3A4MA 4ZXPA 4LE1A 4QGAA 1MB9A 5FRDA 1J22A 2FZ5A 1YONA 2W0MA 5BQ5A 3UUWA 1RXUA 1JMVA 2VP6A 2VWHA 3KXPA 4IO1A 3D8UA 3W5IA 3U4QB 4GM0A 1XQYA 2ZRAA 3GJ3A 4GYJA 2ET6A 1LV7A 1Y33E 4RJLA 5KQSA 1GNSA 2XUOA 4TMKA 2A9JA 1AXEA 3M0EA 3L8EA 1IQUA 1IPEA 3AILA 3RSLA 1MH9A 4PQYA 1Y6JA 3P7MA 3JU3A 1W1WA 1FFXA 2QE7A 1Y0BA 2HF7A 2ZJYA 3REQA 4DR1B 2H5IA 3B1ZA 5JCJA 3AI2A 1QYDA 4C76A 1F1BA 4HWSA 4I4TA 3SFZA 2GB4A 4EA8A 1FRZA 1ZRNA 4C06A 5FPTA 1WSWA 1DT3A 1GOTA 2R8ZA 1FVOA 5CW1A 1XR3A 5B4TA 3GUCA 3DZJA 3OJWA 4HH4A 5D3QA 4JI8B 2ZBGA 3QX7A 4L5AA 1Y9JA 2FZWA 5A9SA 3LH5A 4MKRA 1K2WA 1THTA 2I62A 2JFOA 2WZCA 2Y1KA 1KYTA 3C98A 3H9EO 4W5RA 3KLPX 3AEXA 2HMYB 4LDAA 1XZMA 1CTQA 3DYBA 3TQIA 2Y05A 1JKJB 1B8VA 2NTNA 3RLIA 5KU7A 1PR4A 1RWMA 5ITZB 1OBVA 4ZARA 4PWYA 4LJLA 1FE8A 4UBLA 1CNMA 4Q4AA 4C7JA 4DMUB 5FL7D 4JLWA 4BLTA 3FMPB 3O3OB 2WIFA 1RLUA 2HX1A 2PXBA 3FTFA 3S7TA 2GR9A 1EKXA 2EZ4A 4R9SA 2HCBA 3IOMA 2NSJA 1COWA 2IU0A 4P7JA 1H9BA 3U61B 4KU4A 4LGCA 3RT9A 3WWCA 4AF8A 2V8OA 1UC5B 3SIPA 1WETA 1ZH4A 4MI1A 3DKRA 2A0FA 3T9DA 1MENA 4RK6A 1U3GA 4NBWA 3AXSA 4G23A 1U6KA 3CUSA 1GZHB 1UJMA 3I58A 3PPIA 4C87A 4P98A 2Q62A 2BSXA 1X92A 2EW8A 1USKA 4Q1BA 1VKRA 4EP1A 4I6EA 2Y1OA 5F77A 4M1SA 4PN3A 5FHQA 4F93B 2ODWA 3N6RA 3TW8B 1H2AS 3EGWA 4WKPA 1KHTA 1Z35A 3OPQA 4B4VA 2VA8A 1KVTA 1SHLA 3ETHA 4D25A 3EFEA 1CY4A 4AJHA 3BA6A 3QWBA 3U7QA 1SPXA 3H4IA 4WFKA 3IUPA 3WOHA 2OBNA 1XZGA 3DNVB 2O1XA 4IDBA 1JT9A 1W4BA 4IOMA 1NNI1 1XLVA 3BHJA 3NVAA 3E2IA 4RACA 4TLDA 4EA6A 4UQLA 4D45A 3UC5A 2V7QA 3VK0A 4Q66C 5IULC 2JAUA 4X3PA 5LUBA 4Z3KA 3NDBB 4D6XA 5JBIA 1XNJA 1ZOLA 3VPSA 4QDTA 1ZH8A 2VLIA 4ZTZB 1D8TA 1HLGA 1D0VA 1CJKC 4WNYA 2E55A 2Q50A 5DX8A 5TPWA 5IYZB 1QH1B 2HPHA 4PSKA 2N3ZA 2PX8A 2AW5A 1AUQA 3KOUA 5B58T 4QFBA 1IY0A 4KLNA 3EJWA 5ESDA 3WL5A 4YPOA 1XDBA 1E6UA 3GELA 3U3RA 4PFQA 1QRUA 4Y1RB 4YRAA 4ZVRA 3IVPA 2LIVA 3HB5X 3KB8A 4M36A 4UBIA 4AX8A 4BNTA 2DLCX 3UJ8A 2Y92A 3TTUA 4CCWA 3ZDAA 1B14A 2BM8A 1J70A 1ZU5A 2D2VA 2I2DA 3DWFA 3CISA 3JQAA 1ZM3A 3Q9NA 4TYNA 3L7BA 1K7EB 1UXDA 4X1IB 1JLKA 4LOLA 3AGQA 3S40A 1FDOA 2GUGA 1HFWA 3AY6A 4RF5A 5KNBD 1SKYE 5AIBA 3F5DA 6GPBA 4ESVA 2H9AA 4MKHA 4RIEA 1TJPB 4ZQIA 5EP4A 1VQ1A 2IYPA 5BUZA 1YQEA 2G83A 2RBGA 1DZIA 4KR3A 1TZKA 4QRIA 1GADO 3GUHA 2FZEA 1ZGBA 3OMXA 4GXTA 4ZVQA 4K6GA 4UZEA 3TXYA 4UKDA 1NVFA 1Y3AA 2O8CA 4KQ9A 1EDDA 1E5VA 3WA7A 3H8VA 1THGA 1GQFA 5AYVA 5JAPA 2IQ5A 4NE9A 4DN6A 3NT2A 1HYQA 4RE6A 4YUAA 2F17A 4FFOA 2GPWA 1CYEA 2VNAA 3ZVMA 4X62B 3T61A 1M8GA 1NQXA 1P2VA 2FPLA 3GJ4A 3M33A 3PU6A 3PDCA 1I1HA 2NO5A 2J7UA 2OR3A 3RAJA 1BQ3A 1JA1A 3PGLA 2GYYA 2UYOA 3RVKA 3VU9A 2C9OA 3F3SA 5AVUA 3JD1A 5ALLA 3GBFA 3OKCA 4KXVA 3HP1A 2CNWA 2O0LA 2MSDB 1F0YA 1VMAA 2IEIA 4REQB 2H59A 1SHZA 1XPRA 2CNLA 2G9RA 3ZUPA 4NBUA 2YHIA 3O4HA 2XTNA 5TJ9A 4Q9DA 3V2UA 1Z29A 4MMYB 4NQRA 1S8NA 4R1QA 5CG1A 3FDZA 3TIIA 5C81A 3LPNA 1ZX1A 3TVYA 4DMCA 4NU8X 1MO4A 3HCBA 5E9QA 4ENQA 3VZPA 2AFIB 1BGWA 2BFEA 3O8NA 5D01A 2SCUA 4C05A 3ZWBA 5JZVA 3B7WA 4FHFA 4L4SA 3SEQA 2AEMA 2OHVA 3R3JA 4DKXA 2I2XB 3A4LA 4GQAA 1M6VB 3ZVRA 1PDVA 1RYHA 3RADC 1YS4A 4WPGA 1CQIB 3EVEA 4DV0B 5FEUA 2LLVA 4KWCA 5CM2Z 1BHQ1 1JUDA 1WSBA 2HL6A 4Z8YA 5G02A 4DBLC 4JJ8A 1POWA 3WMEA 4LC1A 2E6KA 2JANA 3OY2A 3FBWA 4QELA 4PS1A 4V3CA 3NP7A 1SKYB 5H0IA 3WK5A 1BE8A 3CZ9A 1U7ZA 4QJBA 1CB0A 1YB4A 3FVTA 3DBVO 4FMCB 2AG0A 2W2QA 2AYZA 1WZ2A 4QRDA 5H83A 2QJFA 3HCEA 3BJMA 1YTLA 2O7VA 3PUVA 2YVKA 3VAZA 4UNIA 1NLZA 3OLVA 3DAGA 1PO7A 1NQ5A 1OIWA 1N2BA 4KQJA 5PNTA 1RRMA 3D7RA 1R50A 3U3JA 1XN4A 3I9OA 3WBFA 3LLSA 3KD2A 4Q4HB 1WQ1R 3PE3A 1E1CA 3A14A 3D8RA 3LX5A 4I9HA 4DRXA 4X4GA 1A1SA 1DBIA 1G55A 2VJQA 3AF1A 3GBSA 4HMQA 1FDSA 1J5PA 3VU8A 2L17A 3OHMA 5BVGB 2BR5A 2ZS7A 3D1VA 3QFSA 5F73A 4J3JA 2C7VA 1ZVQA 2JFHA 4FT4A 5K0LA 4DCPA 1P17A 1LK5A 3EVBA 3TLKA 1BVUA 1G5FA 3QE0A 4TLEA 4TKUB 4G86A 5DWDA 1RJDA 4G2NA 4MS1B 4AG6A 4DWVA 2X5KO 4MDFA 1EX9A 4J9VA 2JAQA 4MRMA 4FQ7A 4B3MB 5LN1A 2BNNA 2G1KA 3MSXA 1HKUA 3TUJC 1OI2A 1V4BA 1WU8A 1KA9H 2UVPA 3PCRB 4FVTA 2KJQA 1Y1QA 2BFDA 5FUWA 4DSAA 3CNNA 4F85A 1RQXA 2IYQA 1VLHA 1Z4LA 4UHJA 3ZU4A 2J07A 4LRSB 3T99A 3VAYA 1EVEA 2BBSA 2I6GA 1I5RA 3PE5A 2IS1A 4WOBA 3OZDA 1H6AA 3EIEA 4XPIB 4OGWA 3H5AA 2Z6QA 2B0JA 1M34A 3F7NA 1H8EA 1I4TD 2OAEA 4B8ZA 3G0HA 2CVPA 1PEAA 2HFZA 1KDPA 2EWMA 2O07A 1WHSB 3GN2A 4FNMA 2I4LA 1OSLA 4MWZA 3WGIA 2WB2A 5DN9A 1UK8A 4EI8A 1O6ZA 1NN3A 3K2QA 1MO5A 2YFYA 2IIVA 2YJ5A 3PNPA 1GGHA 4FMPA 4J7AA 2GK3A 4YDSA 4B3SB 3HN6A 1SGWA 4MW0A 1CJTC 2D4HA 5C5EA 1VGRA 4MV3A 3LDFA 3Q87B 3IPAA 1A8HA 2F2TA 5TMDA 1C4OA 2LCQA 4BP3A 4QM6A 1P9NA 2AN5A 2HMAA 4MOWA 2KLBA 5FTWA 5LXTA 1V1MB 1TUBA 4JLUA 4DR2B 1E2PA 4HNAB 5M04A 1EFRD 1U0FA 3BBPA 3QTLA 4B31A 1JEQA 2G04A 2OV8A 4BZXA 1NR7A 3FCEA 2FPPB 3N5KA 4KAJA 3I1JA 4E5DA 4EHNA 5KWVA 3WAJA 1SKMA 2WKWA 3L82B 5T57A 3C3BA 5AM2A 1KEVA 3RVLA 2Z9BA 4XFJA 1U8CB 1MJHA 1TD1A 1EUDB 4WFIA 2G7ZA 1G3QA 4N5NA 1AS3A 3CIOA 1V8FA 1MTZA 3WLIA 4PHHA 2JASA 1T4DA 2GD6A 1CY0A 4N18A 1QQ6A 4J16C 2PD6A 1QLWA 2H07A 4X95A 4KOEC 1UFRA 2W00A 1QSGA 3KHSA 3ONDA 1B0PA 3LGAA 1EFAA 1K89A 4PS0A 1F2VA 1DHTA 5T67A 1QGYA 1EI9A 1U94A 1USVA 1GCAA 2ODEA 2Y93A 3AVVA 3NT4A 5E1DA 1RMQA 3NWPA 3PXPA 5EWJA 2FW9A 2CSUA 1T2DA 4LNAA 2WHPA 1ZCJA 2QAGA 3FNRA 4ZK6A 5JNWA 1KWKA 5L6LB 1U8EA 2XTZA 4JV5B 5K0ZA 3LU1A 5DI9A 5JVDF 2M6KA 1VC2A 1NX6A 3MWYW 4N0DA 2R4QA 4JOQA 5AT1A 4ZAVA 2YY7A 2FPIB 3PE6A 1YMQA 2G76A 2UUAB 1XTQA 2IYSA 4MA5A 1VLQA 4XUDA 1F6DA 1K6JA 2V9CA 3ETEA 4N47A 3ZGYA 1AKYA 1ECFA 4DSUA 2VHUA 2GUWA 3B9RA 2ZB8A 1OIVA 1XZBA 4Y67A 4EMBA 1ZNZA 4XB1A 3CZ4A 2BFBA 5EMNA 1PJ8A 1K6IA 3QOFA 3QRWA 2Q29A 2ZROA 3QPAA 4LBWA 4NS4A 3U1BA 1ZK2A 5I9MA 8GPBA 4B3JA 4J76A 4R01A 3SJBA 4F8YA 2HQBA 4XYGA 5CK4A 3INGA 3UKDA 5D00A 1XTIA 2OK8A 4B4WA 2VTBA 3CRW1 2FDCA 1CUYA 3GZDC 3EHDA 1N0HA 2YNMD 3CONA 1QOZA 3NDPA 1UOEA 2VT7A 3AI7A 1Z0AA 4CL8A 4DARA 4DV3B 4TTJA 4QYSA 1JR4A 4XRGA 1S9HA 1Z2OX 3NV9A 3LUPA 4Z4IA 3JQ8B 4QUKA 1Z4NA 2ZQYA 2PYDA 2VLBA 3NRJA 1SA0B 5EJFA 3KG2A 4BKRA 2KHZA 2YMPA 1QUFA 2EVWX 4PBRA 4TXMA 1NXWA 2Z56A 3ZS9A 2IHYA 4M89A 4QEZA 1JBQA 1QANA 4LPSA 3GD7A 3FDJA 3I5MA 4F5ZA 4UTVA 3L8DA 4N7MA 3V46A 3PNVA 1K4YA 4JLMA 3AH8A 3ZU5A 5I8PA 2ZYRA 1E4YA 3M7IA 2QY6A 5JUWA 2VBCA 3OX3A 3L7JA 1Z4JA 3IAXA 2FMUA 3BQMB 1N2CE 2XYRA 1VIDA 1HYEA 1ZN2A 2JIPA 4MYRA 4WEQA 3TQSA 5CBPA 5JMTA 3VZBA 2D13A 3EEYA 1B4DA 3KEQA 3WIDA 3BWBA 4KL8S 4IIFA 2JQEA 1LS1A 1QFXA 5K0GA 4BV8A 1HWYA 1N5JA 2GBIA 1IOVA 2ZE6A 3BOSA 3L7MA 4Z0HO 2J1LA 2D0OB 2DTXA 4YYZA 4GWKA 5AM1A 3CECA 3QFRA 2IDZA 4N0QA 4GW3A 1YJQA 4LDNA 3DOJA 1IONA 3UJ6A 4BFZA 2BR4A 4AJ9A 2VDMB 1CDDA 3FDIA 1ISSA 1T26A 2GCNA 4LDZA 4RPCA 2CB9A 2VXCA 3DV0B 4LZPA 4WGGA 5FR2A 3W1VA 4B33A 3X1YA 4TTQA 1ZD8A 5KHOC 4DR7B 2K7ZA 4IDGA 3DTVD 1DC7A 3W78A 5F7ZA 2GBCA 2IZ6A 3CSDA 3W8NA 3LVRE 3FH0A 4MS3B 4RPGA 1D2GA 4I1OA 4JVSB 4BEWA 1NULA 4CLOA 2O3QA 1X80B 3PIDA 1WIWA 3N28A 3KAJA 3FYSA 3SU8A 1IM2A 1JKFA 1BS2A 3H5IA 5AW6A 3QUBA 4GYYA 3UK1A 1OLUB 2OGTA 3OX4A 5LU9A 2K4MA 3VPCA 5F3WB 3MINB 4Q3OA 1ZD3A 3OPNA 4TM8A 4ZI7A 3EXHC 4OYHA 3TEJA 2LP4Y 2HRDA 2JLVA 3BFVA 4QBTA 2OMEA 3FB4A 4RCVA 4I3HA 4C22A 2HY7A 3U7RA 1NE7A 4MV6A 1U65A 5K51A 1JF8A 1DJPA 3BDAA 3C2QA 4ZQHA 4KACA 3JYQA 3R09A 4F56A 1FLAA 3H9CA 4KPEC 1L7EA 2BJWA 2PE5A 1YCHA 4LS3A 4YREA 4DCGA 1C4WA 4MIKA 1G59A 2GBGA 1A9TA 5EXEA 2PRKA 2XTMA 3NU1A 2QPOA 2CVOA 2NP7A 2QM0A 5K0NA 5BN4A 5CD9A 4FMDB 1M0WA 4H3SA 4XYBA 5ECDA 1YSEA 1KMQA 4H4DA 4N8SA 3RSQA 5KKCA 3QW2A 3LI2A 4OMUA 4KDFA 2Z9CA 1V8DA 3MTIA 4QU5A 3UA4A 1VJRA 2IGBA 4ESHA 3E1SA 3LQ4A 2IV2X 5HDBB 4LZOA 2ECKA 4HGPA 4YCNA 3ZVNA 2Q3DA 1DARA 1FNSA 1EJ0A 1N2CB 4O6VA 1B41A 2P2LA 1N57A 2YRXA 5BSMA 1FLNA 3RANA 4DVGA 5KYVA 2XB2A 2ZB7A 4WKCA 5B58C 3KQYA 1BNCA 2NYVA 1PV2A 2HINA 1IIRA 3G8YA 3PIIA 2ZLBA 4LIPD 1YZTA 2GAIA 2HMUA 3IVAA 4LOHA 3SC2A 4CR6A 4FIZA 5DTRA 2VK2A 3WK9A 1BMDA 4MIEA 4WY5A 4W8GA 1T0HB 3SZOA 3I6ZA 2EU8A 2O7NA 3IXQA 1DAPA 2ZRLA 4P2BA 4KLZA 2R5WA 5FOWA 3SX2A 3ZWQA 4CFSA 1JLMA 5DYYA 3T5GA 1RP7A 2AC7A 1OJ7A 5FOQA 1R74A 4IJ5A 3JVVA 1SD5A 1H9AA 4IIEA 4MYUA 4DOMA 4EHIA 4YRMA 4IDCA 4B2PA 5D3MB 4BNIA 5JY6A 2QX9A 4EPYA 1P3JA 3VPAA 3TNYA 5E7MA 3D3NA 3KCNA 3TD9A 1XTTA 3CW9A 4LJ4A 4EJSA 3W5CA 2VQSA 4A6XA 1L4MA 2PBFA 1GJRA 3C43A 2FOIA 1TKAA 2I0FA 2V4UA 2G8NA 4PAWA 4PG6A 4U9HS 3TE7A 1KTVA 4OFWA 5ALRA 1QHNA 1LFDB 1TFUA 1XQ9A 2CLHB 2ZRJA 1JSLA 1C30B 1NMYA 1N6OA 1T91A 2WNHA 3G5AA 3PQFA 3W7BA 2W4MA 4AECA 2GWRA 1AVTA 4UCWA 4UNRA 4LZAA 1JHDA 3LQRA 4Y6LA 5FI5A 3PQ6A 4H7HA 5CVCA 2ZSEA 3G0GA 1ISMA 3E18A 3I8XA 4AZ3B 3IAS6 2C07A 1UJ5A 2Z1NA 5BT9A 1IEVA 1PTJA 4C9BA 1B8NA 4PYJA 1LC3A 1VKJA 3H9JA 4NV0A 1J8QA 1QHYA 1U7WA 2B94A 3R6LA 4WW0A 1EK2A 1JH9A 1KAMA 4H9GA 1PQWA 4P7GA 4KK4A 1LDEA 1TTTA 1JDTA 1Z0JA 2CFIA 3RSSA 3W5UA 2LVBA 3DBRA 1MVLA 3NKLA 1KDZA 1BFKA 3UK7A 2W2PA 3PQ5A 4WX2B 3KEGA 3WRWA 2BUCA 5LQRA 1KMCA 3LDAA 4JC0A 4ZO6A 4Z9XA 1VLMA 5D6OA 3GLHA 2DPYA 1I5OA 3VR6D 2D5CA 3NZEA 2YL2A 4INZA 3EW9A 3MT8A 3PA8A 4AZVA 1VYUA 1PGPA 2C9YA 4LCEA 2E6UX 1X9IA 4P4LA 1GPLA 1R9NA 1Z8HA 2NAPA 4PLFA 4RSGA 4ZMSA 1YU6A 1BDBA 2NZUG 1ADBA 2PXCA 3KU1A 3OC0A 3OZBA 4H77A 1MC8A 3HJTA 3LBNA 4FLFA 1JAYA 1AKQA 4FGUA 3VYVA 2EYQA 3U39A 1JR3D 1UPTA 2YS6A 4W1PA 1O5TA 1T3ZA 4L08A 1YQTA 3ABQB 3NASA 2QJTA 3AHDA 5I5GA 2NM0A 3RS2A 1VLVA 2I87A 3GD5A 4DLUA 1GKUB 3GRYA 3GJXC 4K0RA 4KQHA 1QZTA 5AJUA 3MD9A 5GV7A 5C46F 1N5OX 2WA1A 3BH0A 3QBJA 3P20A 4KKXB 2X8WA 4NL4H 1MQ9A 1UMCA 4K9LA 4X65B 2IUYA 4UTOA 4MI6A 1ZNQO 3DMTA 2WJWA 5FKJA 4KR9A 3C3AA 3WGNA 3VRHA 5AI8A 4AJKA 5KTKA 1H69A 2NO4A 5K8JB 1M1UA 3F9IA 3P0EA 5KSZA 1BCSB 2J9FB 4D6PA 1E3SA 1KC3A 2H2IA 3FZYA 1A4IA 3DA8A 1JG4A 1BD3A 1JSCA 1P2DA 4N8EA 4O1HA 3I62A 1LZKA 1N0VC 2ZIXA 3KZ1E 4YJGB 2C96A 1BXKA 1LPNA 3QKUA 1JQJC 3HDTA 3D3EA 4P53A 4C6RA 4HQFA 4DLWA 5CFMA 1EVLA 3MCAA 5EUBA 2FLKA 4PE5B 1BJRE 3SIXA 1H2EA 2AN3A 5AKLA 4Q15A 1WMSA 2Q49A 2BFFA 1GLNA 4GXRA 3AKEA 1IVNA 3UV3A 3V1MA 3FLAA 1E62A 2GCOA 1ZD5A 5M34A 1ML3A 1NQOA 1NVUQ 2HWUA 3PTAA 1PKXA 3OMLA 2XOKA 1MC1A 3R7AA 1RKUA 3TN7A 4PLVA 4Q21A 2FRXA 1ZI6A 3K9WA 3O4IA 5KNCH 3S1AB 3W5DA 4OUKX 3GX1A 4GE0A 5ER9A 5DMHA 1RM4A 2Y2UA 4FN5A 1BN7A 5CJ2A 3F5QA 2EJUA 3BFKA 3PP8A 4TYQA 3ZQUA 3TBKA 3BK2A 1QMPA 4E31A 3U7HB 1O77A 2EBFX 1FFEA 1MXFA 3B5EA 1UIMA 3D4BA 4TWJA 1PW7A 2HA6A 1EVZA 2OQVA 1DHRA 2QL5A 4EENA 3PXDA 2XCIA 5IARA 4MVJP 1NQAO 2A4MA 3CVJA 3MMXA 2ZB3A 1Z82A 2ERYA 4GE3A 4NYMR 4XCXA 1A2BA 5ICEA 3AUYA 3HJGA 1VDMA 2GWHA 1OASA 1EEHA 3BIFA 2SHKA 3MS2A 4ROTA 3JASA 1F0KA 3W2TA 1VCIA 2XYGA 4NOKA 5I4IA 2TYSB 2CYBA 3BG5A 1HF0A 4D56A 2QDXA 4HEHA 5FA5A 2OL4A 1U9IC 3KFVA 1VRVA 5HKOA 3TZQA 5CFRA 1FFGA 3VO2A 4YRIA 1ADFA 4P0PB 1FMLA 4TUYA 1O94D 5CGQB 4JI6B 4IAOA 2DHQA 2H0AA 3TTTA 3CUEF 1TLTA 5DWVA 1MIOA 3PI7A 3F52A 4KYVA 4QG7A 4BQQA 4UMEA 1GN8A 3GDGA 1OB5A 4O8ZA 3FVQA 3UWSA 2QLMA 3T3HA 3TZBA 1V1JA 1N2JA 2C1XA 3FNIA 4II3A 5BUSA 3GLGA 1U2SA 2YBEA 2CLSA 5DCLA 4JLPA 3SHVA 2V0GA 2GZ3A 3F73A 1JTEA 5C5DA 2IYZA 2A59A 1RLTA 1SBYA 2RGEA 1JGTA 3PENA 4GL4A 3VMMA 4YS6A 5ICFA 2CE2X 4TMWA 3TLCA 3P8ZA 3HM9A 3C74A 2AN4A 1WIZA 2R00A 4G26A 3VVBA 1AKRA 4Z1MD 4OHUA 4CTMA 3G2HA 5CH5A 4BVBA 1R10A 1OYVA 3MMSA 2E4VA 2LGJA 3LYHA 4K9NA 2HCNA 2NUPB 3WZLA 4AULA 5LOVA 3R7DA 1R5NA 2JEZA 3A2NA 4R81A 5CCEA 1OT5A 4WXYB 1JHOA 4KQMA 2ZR0A 4JXJA 4M1MA 2A9VA 1SG0A 1F7VA 4PICA 2P9EA 2QPTA 3A3YA 4NWIA 4BEVA 4R7TA 5E4TA 2BKVA 1T0JB 3LXXA 4G5RA 5I9BA 2ZUEA 4M1WA 3B20A 3A9UA 3HG7A 1NXVA 1Y6RA 1EE1A 2O4UX 2V5AA 2H4HA 1E0AA 1QVVA 3BD7A 4FDAA 1OOEA 5CM9C 2FYTA 3WSTA 3Q12A 5JEEA 2FSGA 2HA7A 3EAGA 5T3YA 2X1VA 3GW8A 2AD1A 3P9XA 3M82A 1T2NA 2DUMA 4X4IA 3QV1A 1QFMA 4GRIA 3REGA 4YAGA 1TW3A 1YFJA 3ROMA 4BX2A 2OXIA 3R8CA 1SVKA 3TKAA 1CF9A 1EFLA 2LUOA 5A4MS 2C5BA 3N2ZB 2VC2B 4CG2A 1ZEMA 1U8ZA 1TB4A 3G1WA 1UT5A 1E3LA 2R2GA 2PQMA 4P58A 2M98A 3MA0A 2UYYA 1KJJA 3T4EA 4MA4A 5CFZA 3V1KA 3WG9A 4AMUA 3SAJA 4DQLA 4UU7A 3T7EA 2XXAA 5KYXB 2HZ7A 2WFZA 3N7AA 4FGJA 3CF4G 4Z0NA 1O96B 2A1TS 3AB7A 3D2LA 4I50A 4MQ5A 1Y7IA 2YMMA 1ZVVA 2WYVA 4FJ2A 4U5QA 3WLMA 2VDJA 2XQJA 5JQGA 3Q9UA 2CCJA 3PC4A 5ISMA 3UZUA 5AW2A 5IF3A 3DLIA 5EPEA 3JQ9C 1KI6A 3LFUA 1P33A 3Q98A 4F84A 2DQSA 4M0CA 1GL9B 2WG2A 3DMPA 2IUSA 5HFAA 1GVNB 1AXRA 4NATA 1H8HD 3TPFA 3OT1A 4B3FX 1MAUA 4YV1A 2RE8A 4QU8A 1ZAYA 3TSCA 2HA2A 2QF7A 1U0BB 2YV1A 1EBBA 2OHIA 3P2OA 3DL7A 1T4CB 2ZBEA 3DT6A 2A4KA 3I23A 2X3YA 1W5BA 2P8JA 2A0UA 4RMHA 1QO0A 2PYIA 4WZBB 1ISPA 1ZMBA 5CJJA 5GWXA 1D5WA 1RYDA 1LCIA 1ZMTA 2FN9A 3CRVA 3FMIA 3PKIA 2W2OA 3KPUA 1E59A 1Q20A 2B4QA 3TW0A 4OAPA 1TMOA 1FDUA 3A9XA 1J2UA 4R2XA 5AICA 4W5JA 1R4AA 5E38A 2YJNA 3PXAA 3QU2A 4Q16A 4EHJA 2BN4A 2JJ2D 1A9PA 3M1YA 1ORRA 1OJLA 5IH7A 3ILHA 3V9PA 2GJAA 4WBXC 1ZJ6A 2MYUA 1EP9A 4DZZA 1VI5A 4M6WA 1XWRA 1QZZA 2DR3A 3AFGA 4DPKA 3MBIA 1A4RA 1XP8A 1R6BX 1Z12A 1PEKE 3D8TA 2AHRA 3DMDA 4GI2A 3JATB 2OD9A 4JS0A 1QVAA 3HU3A 5EJ7A 2IY7A 3VMFA 3CVYA 1AN9A 3FYUB 2VNIA 5J2UA 2PGLA 2XYQA 4PZ0A 4V2UA 2OAQ1 2YDYA 1VHJA 3L0ZA 1QTRA 1AUXA 4X90A 5HIMA 1QQAA 1ZPDA 1J0DA 1FPMA 3LIIA 1TW2A 2GA8A 4WD3A 3WGYA 4A8JA 1YK0A 4OHXA 3UJAA 1R4MA 1XVAA 3S2ZA 5KJFA 2EZ9A 4WA7A 4CLRB 1XCMA 5THXA 3FOAA 3L5KA 2FPMA 4NJMB 3KJFA 2PDAA 2BONA 5J4HA 1ZJYA 3WBKA 5BV1A 2RCNA 3U6BA 4L16A 1UFQA 2PRYA 3KHTA 4IEIA 4NV1A 4QUHA 5C4GB 3UMBA 1R6XA 3AIKA 3MJFA 3SCFA 1RQ7A 2BVNA 3QEMA 4UEOA 5KTNA 3PKZA 4H3HB 4R8KA 1B8PA 3TS1A 2GQ0A 4KHPB 2Q2WA 1UK6A 3K8YA 3SR4A 5FTKA 1LGYA 4MLDA 2CW5A 3OMTA 3L8FA 4PX9A 2GF2A 1CYDA 3KTDA 1UM8A 1XA3A 1J1ZA 2WIDA 3GHYA 4WKNA 5AWFC 4Q2JA 1RYZA 1JFSA 3G1TA 3TTVA 3K0FB 3TDNA 3ZE9A 1H93A 1QDEA 1K27A 1PEYA 5HUHA 3HVIA 1HDZA 3H9BA 3ISJA 4D42A 5CYOA 2NU6A 1X3LA 3ZHTA 2PU7A 3AHGA 4DJDC 4TRMA 5B7GA 2OQIA 1G2OA 4PCLA 2ZIWB 3MK31 4UHFA 5D5QA 1BQ4A 1DLJA 1EBFA 2F7SA 2CYAA 4OPMA 4D9FA 3R76A 1CR0A 3I04M 4O4JF 5HUJA 3VR0A 1DEHA 4CM8B 3ONEA 1S7CA 3ZBUA 4YJ2B 1ZUHA 1E96A 4MW4A 3GLFA 4ZYLA 5BV7A 2EWVA 5JD6A 4QJIA 2YKGA 1GAEO 2IHVA 4TROA 3JTEA 4GVLA 2WAYA 3H75A 1ZQ1A 3KVOA 3N7TA 1UBSB 3M3PA 1NJSA 4GX5A 1YQ9A 5EZYF 3GRAA 2PH3A 1Z39A 3OKFA 4QO8A 3AETB 1N8NA 3GUZA 2QTRA 4FEAA 1F2TA 3LDHA 4L9RA 5AUQA 1IJEA 4MMXB 5DO9A 1FTYA 4R9RA 1U3UA 3S2FA 1T0UA 1U0SY 2XCRB 2ZVPX 1XD9A 3BD6A 3E0QA 4JJFA 4CMHA 621PA 2OO5A 3RS3A 4CL2A 1CUDA 1C0KA 1OI7A 4PG5A 2RH9B 3EXEA 3RVQA 5C8VA 4F7WA 2C5SA 3MG9A 5EKTA 3OOEA 3RYCB 2DVMA 1NLMA 5ERYA 1IBMB 2QTVA 2AD5A 3PXGA 3ZLJA 2HFJA 3LTEA 4NDNE 1E9DA 2L1PA 1WXFA 2CYCA 5B7NA 4K6CA 5CDUA 3J81k 5HF5A 1DG3A 2OD2A 3CBQA 1DX4A 4B4DA 2IS6A 2O2GA 2GJ4A 4MR9B 1BRTA 3T9BA 4L22A 4C7MA 5H3HA 3TUIC 3RZZA 2D54A 3K0EA 1DRJA 3X1MA 1WDTA 4E5VA 5FLXA 1XMPA 3IFSA 2HLHA 3VZQA 3M6VA 3CKYA 3O84A 4HXYA 4AD8A 2JJ1A 2VJYA 4DCMA 1CIVA 2NVOA 3OIWA 5JYBA 1AS0A 1LPSA 1PR5A 2NYRA 4N49A 3TB4A 2O8BA 3EBOA 2Y0PA 3HYSA 5FLKA 3L84A 2ST1A 2DR2A 1MFPA 4EG1A 2WWYA 3ANXA 2VATA 2ZU0C 3FTEA 1UDXA 1MD9A 1A7JA 4LOJA 1WPXA 5D7BA 1IHOA 3TOVA 3W6UA 2O1SA 3CUTA 1C3XA 1TVKB 2AQKA 2MMCA 2O5CA 2A7XA 4XVQA 1CPYA 2PLRA 2WFLB 3IKLA 2Q2NA 3M5PA 3VR5A 4JUCA 1PZFA 1P0IA 4RJTA 2Y67A 5AM3A 3ETJA 5JS6A 1YV9A 2E3JA 2ALJA 4TV8A 3GRPA 3VR2A 1YL6A 4PZYA 1XV5A 3ZJVA 2HSDA 5ALFA 4TGLA 3LFTA 3O1LA 4XH9B 1FFYA 2BGMA 5K20A 4EHAA 2SKCA 4ZOLB 1GG8A 3H1EA 3AESB 2G08A 1Q7RA 2NADA 3LUJA 4QHSA 4EJ0A 3PJDA 2ZYGA 3KR9A 4FKZA 4D9BA 4LZZA 4C3VA 2B4TO 5C2JB 2CJXA 3F1KA 3K5IA 1U0HC 4U9UA 1KC1A 3OM9A 3E5HA 3HCRA 4CCSA 4WBNA 3ZCUA 4F9FA 3TIVA 5ABPA 1U98A 1BC5A 2VUUA 3AF5A 3LBAA 4J0IA 2R25B 1P5HA 2XADA 4WN3A 4Y2GA 3EIXA 5JJBA 1V3UA 3H5LA 3WICA 4EX6A 3L1IA 2QY9A 3RODA 4KQ6A 5TEVA 5TNXA 3S2IA 3SF8A 1T3HA 1IAVA 2FSHA 4QLAA 2SICE 3Q8WA 4I1UA 1J2JA 1GGJA 2Y1FA 3WBJA 1NNSA 2CFOA 2P4EA 3I1FA 4FJ0A 1VMDA 3K53A 4W6ZA 3GVCA 3HFJA 2FZVA 2QZPA 1OBOA 2FKNA 4YJHA 4IMPA 1PJCA 9ATCA 4LHXA 2TECE 4CIDA 1WH8A 4R8SA 3VR4H 4RE5A 2QRJA 4CT0A 4ZU6X 1VDZA 4A2CA 2P2NA 1DFHA 3PEVA 3WXBA 4AN0A 1VI2A 4U2EA 1ZL2A 3CVWA 3AY0A 4RM3A 3FR7A 5JD3A 3TIFA 3OUZA 1EA5A 2YWDA 1DEAA 3Q9SA 2BHLA 4RTRA 1PTKA 1ANKA 5EQTA 1JTFA 4LWQA 4PNHA 1KFCB 4DEVA 4EZIA 4GPAA 5NULA 1FU7A 1R9JA 1U7OA 3T7RA 1F48A 2FQ1A 2DBQA 4RVNA 1DG9A 1CEEA 4YHBA 3H2JA 4F12A 3MJHA 2GXUA 2VWGA 4JBYA 4M8IA 1GPAA 2IPNA 1Z4PX 1NW9B 1UM9B 3B52X 1WEKA 4LE0A 3DOEA 4BLWA 4ALMA 2RSLA 4HVCA 3RVRA 4DQUA 3NXHA 1ZM9A 2EFYA 2ZYAA 3B6EA 5IAKA 2WU4A 1MJFA 1QAOA 2EBYA 2NPIA 3AV3A 4GMDA 5FTNA 5CNMA 1M8KA 1WCWA 3INTA 2FFAA 1M2HA 3RRMA 1ZN8A 2R62A 4IVZA 1D8AA 2AFHE 3CJRA 3R3WA 5DT2A 3P9KA 3HBAA 2AWIA 2WSMA 5ETJA 4K81B 2P5TB 4CNQA 1PERL 1KZ4A 1S4QA 1P1CA 1U3CA 2B1RA 4JYPA 1QTQA 5M2QA 3VDRA 4KH1A 1L1FA 1IE3A 2XMCA 1J8MF 3L7DA 3UWMA 2XAUA 1T6BY 4YBZA 4KXLA 4NZYA 3ZIAD 3AR6A 3FFBA 3WR5A 1L5HB 2PH7A 4R51A 2Q1XA 5F98A 4JDUA 1N2OA 3EC1A 1WMBA 1XZNA 2W2LD 2NXCA 4RZXA 1NBMA 5I6DA 3IDAA 4LECA 4LV5B 4LKOA 5B1HA 2C94A 4FNGA 1PG2A 2JCGA 2G9ZA 2J3IA 3CF4A 5E7JA 5EHQA 5TGZA 3VTZA 3H0CA 1G38A 7ABPA 1WBJB 1P7CA 4W99A 4XSHA 1SUAA 4WK6A 5FF9A 3ST7A 4NCJA 1YNOA 2O3JA 4MUIA 2VH5R 4PXSA 3PWTA 4G4IA 2R8XA 4E3WA 3GCWA 5T4BA 4LQ4A 5KTYA 2QJWA 1W36D 2W0SA 1CS0B 2PTGA 4UCXA 3QWHA 1FW8A 3JYOA 1PFKA 1C9DB 3GVXA 1A71A 4Q1AA 1YB6A 4TM7A 1J9GA 4C21A 4PYMA 4GGPA 2Y9PB 1X2EA 3EX