2VEOA

X-ray structure of candida antarctica lipase a in its closed state.
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
430
structure length
430
Chain Sequence
AALPNPYDDPFYTTPSNIGTFAKGQVIQSRKVPTDIGNANNAASFQLQYRTTNTQNEAVADVATVWIPAKPASPPKIFSYQVYEDATALDCAPSYSYLTGLDQPNKVTAVLDTPIIIGWALQQGYYVVSSDHEGFKAAFIAGYEEGMAILDGIRALKNYQNLPSDSKVALEGYSGGAHATVWATSLADSYAPELNIVGASHGGTPVSAKDTFTFLNGGPFAGFALAGVSGLSLAHPDMESFIEARLNAKGQQTLKQIRGRGFCLPQVVLTYPFLNVFSLVNDTNLLNEAPIAGILKQETVVQAEASYTVSVPKFPRFIWHAIPDEIVPYQPAATYVKEQCAKGANINFSPYPIAEHLTAEIFGLVPSLWFIKQAFDGTTPKVICGTPIPAIAGITTPSADQVLGSDLANQLRSLNGKQSAFGKPFGPITP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIPASE A
publication title X-Ray Structure of Candida Antarctica Lipase a Shows a Novel Lid Structure and a Likely Mode of Interfacial Activation.
pubmed doi rcsb
source organism Pseudozyma antarctica
molecule tags Hydrolase
total genus 157
structure length 430
sequence length 430
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03583 LIP Secretory lipase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.130 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2veoA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2veoA01
1A7UA 1IVYA 4DMKA 2RI6A 4PNZA 5KWIA 1E3QA 2WG1A 1P0IA 2XQJA 3PI6A 1BN7A 3ZV7A 3KSRA 3JW8A 4XVCA 3WQHA 5CT4A 1X2EA 4KJXA 5CMLA 1HQDA 3DEAA 4JYPA 4UPDA 3OPMA 1LPMA 5AI5A 1AX9A 2XQKA 3O4JA 1BE0A 4DGQA 4UBNA 1DX6A 2P8SA 3EQ9A 5JARA 5AKYA 5LYYA 4X71A 1EHYA 4HXEB 4AXBA 5JADA 3IBTA 4IHAA 1CUJA 1JMKC 1XZFA 2HDWA 4AO6A 4E15A 1C7JA 2HA5A 1U4NA 5CH5A 1A8SA 3DNMA 4H77A 1K8QA 3D4LA 3A6ZA 3WWOA 1AURA 3BIXA 3LCRA 1GZ7A 3AFIA 2W6CX 1XZKA 1ZD4A 3B5EA 5FRDA 1U65A 4DTCA 1QIKA 3DOHA 1CVLA 3PDCA 2G5PA 2ONCA 3D3NA 4PV7A 5K5EA 5HK8A 4FWBA 5LZ7A 3VDXA 4Y2PA 2O2HA 4X94A 2WLSA 1YS2X 5DYYA 1QJ4A 4J0JA 2C5GA 1PV1A 1LPBB 1H2YA 4K2AA 4X90A 1XRMA 2HA4A 1CUFA 2GYUA 4AQDA 3F8SA 3VISA 1HL7A 4LXGA 5D3ZA 4WY5A 3KWJA 3VVLA 1LBSA 1VA4A 1X70A 3TRDA 3JYHA 2VJDA 2GYVA 4BRSA 1D07A 5ALOA 4MWTA 1ZD5A 4QNNA 4EB0A 2J3DA 5JAOA 2ACEA 1E5TA 1UT6A 4A5SA 1OCEA 4KEAA 3ICVA 4Y2VA 1K5PA 4S0XA 2HM7A 2OG1A 3WL7A 2VT7A 4CCWA 2NW6A 3ANSA 1E8MA 4JH0A 4CG2A 4KAAA 4X85A 2QXUA 5C7YA 4WJLA 1MJ5A 2GBFA 4KE7A 3W06A 1MTZA 2VAXA 2WHPA 3AUKA 4BVJA 4NVRA 1ZD2P 5CURA 1YCDA 3WI7A 2BGNA 3E0XA 4GW3A 2I3DA 1K4YA 1MO2A 1W76A 3FWHA 4LXIA 4U2DA 3HJUA 1UKAA 3WKDA 3D5EA 4GXNA 1AC5A 4B7ZA 1LPSA 4J7AA 5AKKA 4ZV9A 5AKEA 2QZPA 4ETWA 3HACA 5ALQA 3AZOA 5JD6A 2HU5A 4W1RA 5IVHA 3QPCA 5A7GA 4EY6A 1ISPA 2BUCA 2ROQA 4BYMA 4WCVA 1GQSA 3C45A 5FXMA 4Y2QA 2YASA 4AN0A 1BS9A 5ALGA 4KR0A 4M0MA 2HL6A 5DJ5A 2H7CA 3C8HA 5DLPA 1IUPA 4I19A 1BEZA 4P9NA 4G1FA 3TGLA 2PSHA 4QEKA 1QZ3A 5AI6A 5BWCA 3G0GA 2RHTA 4CCYB 1JJBA 4EY5A 4QWWA 3CCCA 2VTVA 4H35A 4UBMA 2ZJFA 1TQHA 4UHFA 1CR6A 4IH4A 4OB7A 1HLGA 3P2MA 5K3FB 3PF8A 4KYVA 4ZXFA 1CUDA 4BTLA 2PU7A 4ZRDA 2QR5A 4AX4A 1P0QA 3ED1A 4WFIA 1SCKA 2GBGA 3WZLA 1YAHA 2XMGA 4Y2XA 1LLFA 3O95A 1F0NA 3U1TA 2OCGA 5AK4A 2B4KA 5AK6A 3H1BA 4ZWNA 3I6ZA 1E66A 1WPXA 2PSDA 3GA7A 3I2HA 5LZ5A 2H7XA 4BAUA 4K6GA 5CT5A 2ZYSA 3FVRA 3I2GA 3OG9A 3C6YA 4UBIA 1R88A 2CB9A 2QS9A 5FUMA 3H04A 3I2IA 4GWLA 5CTAA 1E8DA 3QZUA 1R1DA 1DWQA 1VJ5A 4QLAA 4E11A 4P92A 3D0KA 1N1MA 1VOTA 2XLBA 4H7JA 2VATA 3VKFA 4WY8A 3L1IA 4JYMA 5IVKA 2DQZA 3M81A 4LHEA 2OCIA 1S8OA 1QFMA 3C6XA 1LPNA 1U2EA 4B85A 1DTEA 4K6KA 1XRLA 3STUA 1CLEA 3HRHA 2WIFA 3D59A 2J4CA 1JT2A 5DYTA 3CCBA 2HRQA 1ZJ5A 2Z8XA 2PX6A 4GECA 1HKHA 4OD0A 1E8NA 4KRXA 3D2BA 4YK7A 5ESRA 5AI4A 1IUOA 4I4CA 5E4YA 5FPQA 4DMCA 4YASA 4CG3A 4OB6A 3D7RA 3FLAA 1H2WA 1WB5A 4TVKA 2W22A 5FKJA 5LZ9A 1MT3A 3RARA 1WOMA 1YSCA 3ESCA 1CFJA 1QIEA 1FSSA 1XZDA 1MU0A 1GKLA 2QJRA 4ZI5A 4W1PA 2DHDA 2PSFA 3FNBA 3FYUA 1R50A 3BJRA 3WIOA 3BJMA 4H7FA 1RP1A 2JEYA 3FSGD 1MX5A 4P93A 5CRIA 1K63A 4IH1A 4X92A 4B82A 1PJAA 1XKLA 3DQZA 3DYIA 4H7KA 1JJFA 3DKKA 3H2GA 1A8QA 2AJCA 5A6VA 2HIHA 1RWQA 2QVBA 4HAIA 2XUPA 4X93A 4N8DA 4J0IA 3E3AA 1YB7A 4L9AA 4FKBA 1ZICA 5HK9A 3GZJA 3C5WP 1WHTA 1Y7IA 3G0DA 4BZZA 1LZLA 5EHXA 5AOBA 4EY7A 1ACLA 1QIIA 1P0PA 3IUMA 1WPRA 1XZBA 4G4JA 5D3KA 1VKHA 5JAHA 1J2EA 4X7BA 1PFQA 4G9EA 1CUEA 1TRHA 3BDIA 2OCKA 4Q1VA 5DTJA 1CV2A 5AOCA 4H18A 2ZYRA 1EI9A 2PSEA 4NS4A 2IX9A 3CXUA 4GLBA 2C7BA 3LIIA 3E4DA 5AI8A 4XIIA 1J07A 1LZKA 3PFBA 4OPMA 2XQFA 5EHZA 3QITA 1K6EA 1W1IA 3L1JA 3MUNA 2Y6VA 3PF9A 4F5ZA 1ORVA 3STVA 5HCUA 2HRRA 5EFZA 4YPVA 3UMJA 1UKCA 3ESBA 1ZJ4A 3WK5A 3BF7A 3WMRA 3C87A 4FNGA 3I2KA 2HA6A 5D7BA 2Y2UA 5K3FA 2B61A 4DNFA 3T4UA 1ORWA 4UBJA 5A71A 2X76A 4ZV7A 1LNSA 1ZI9A 1VE6A 2ORYA 1E89A 5HF5A 1EK2A 5HKAA 5HKBA 5FV4A 3GUUA 4B9AA 3NWOA 5AHXA 3PFCA 4AO8A 3HXKA 1FFBA 3B12A 2HA2A 1QIHA 2XUFA 1C4XA 1XQYA 4DMHA 5AI9A 4C4ZA 1JU4A 2WKWA 3BDVA 2FJ0A 4C87A 3G9UA 1H23A 4OU5A 4IO0A 4UUQA 1FFEA 2GZSA 3FVTA 2VAVA 3QM1A 3KWFA 5ALRA 5AIAA 3W2TA 3H2JA 4DIUA 4KACA 3W9UA 5EIHA 1XRPA 2YH2A 4MQMA 1Q0ZA 3FCXA 4MYDA 3H18A 4E14A 3ZLVA 2H7YA 1XRRA 2DSNA 5IH7A 1XZCA 3OTQA 1EDBA 3WK4A 1AUOA 2ECFA 3Q8WA 2PVSA 3SX4A 4KE9A 3DL7A 5HF6A 5HZGA 5EGNA 4FLFA 3KDAA 3DOIA 1EA5A 1L7QA 3IIIA 5A7HA 4KRYA 2JGMA 4KAJA 5JD4A 3G9XA 3LS2A 1CUIA 3X3HA 1GXSA 4EY8A 5AM3A 4H7IA 4BB0A 1IMJA 4BAZA 2XMBA 3WJ1A 4N8SA 2ZYHA 1H2ZA 5ALEA 2RGUA 1JI3A 1VE7A 3BXPA 4Y7DA 4EZIA 4GI1A 3RLIA 5HQ3B 2WG2A 3HLKA 2Q0XA 3M82A 2K2QB 3AIKA 5ALZA 1EB9A 1UK8A 5JYCA 1CUSA 4CI9A 1TIBA 3M3DA 3A2LA 3F9CA 3HABA 4KE8A 4DLNA 2OCLA 2BCEA 3WKBA 3C5VA 1MNAA 4Q82A 3VXKA 5ISMA 4X6UA 1UK6A 4B0OA 1TCBA 3D2AA 1UOQA 1XQXA 5EIAA 4MXDA 1XFDA 2WU3A 4UHCA 1CUYA 5JZBA 3FYUB 1KU6A 5AH0A 2G4LA 1CUAA 5ALPA 1EVEA 2D0DA 1JMYA 1HDEA 3O9MA 5JANA 5AKIA 3WKEA 2WILA 2VT6A 3ZLTA 5JATA 1ETHA 4W1SA 2JBWA 5KWJA 1B6GA 2RAUA 4OCZA 3FYUC 3I6YA 4ROTA 5SYNA 1OILA 3G7NA 3QH4A 4WDRA 4RGYA 4Y2UA 1TKRA 2GBCA 1Q0RA 2VJBA 2AJLI 4E46A 2WJ3A 3LLCA 4ITVA 4U2BA 2Y6UA 4X97A 1JJIA 4UFNA 5AK5A 5FLKA 1CUXA 4G4GA 1SC9A 4DMFA 3WZMA 4BCBA 3VVMA 4GDMA 5KBYA 2DR0A 3I2JA 1CUCA 3CN7A 1Q83A 5DYWA 1QIMA 5AO9A 4ARAA 4J0HA 3WWDA 4BTVA 4BC0A 4HRYA 3AZQA 2ZJ6A 4B0PA 2QTBA 4IQ4A 2DQYA 3KXPA 2VQ6A 4QDXA 1QIJA 3KD2A 2QUBA 2WU4A 4Y2YA 2WUDA 1LPOA 1DQYA 3VJLA 2I78A 1UXOA 5E2IA 2DHCA 4UFPA 3DD5A 2XT0A 1GT6A 2XMRA 3ANTA 1KU0A 2H1IA 1F0PA 5CW2A 4B81A 1T2NA 4JEIA 3S8YA 1UWCA 4EA6A 4P08A 2V97A 2HFJA 4GBGA 1CEXA 2HU7A 1BRTA 4B9EA 4AN1A 3G0CA 4BE9A 1X2BA 3A2MA 2YXPX 3V1NA 4RPCA 1AQLA 3EQ7A 4AMYA 4B6GA 1EVQA 4QDZA 5ALXA 4J03A 5AI0A 3G0BA 2GZRA 2XUJA 4PO3X 3N0TA 1ZGCA 1XLUA 4UBOA 3TJMA 5JZSA 2HA0A 4V2IA 3R40A 4OB8A 1Y7HA 1CUZA 2XMSA 4NMWA 4MWSA 4BCDA 3WL8A 3R3UA 4UHDA 5CT8A 1YR2A 4CIAA 1VLQA 2RIPA 4UBKA 5ALMA 4I3FA 3PUIA 4BRZA 4LKOA 3H2KA 2WSLA 2JGEA 3DDUA 5T4FA 2OGSA 4F60A 5HFAA 4TGLA 2XUDA 1JFRA 4L0CA 1W6RA 3DYVA 1SOMA 4LXHA 4DM7A 3OM8A 2QRUA 5SYMA 3F97A 3QPAA 4J0KA 3I2FA 5I7UA 5LKAA 5J3JA 2CJPA 3R3XA 3QVMA 2C0PA 5K3DA 3AINA 2QT9A 4BE4A 5D6OA 5JZ9A 3HEAA 3R3YA 1NU6A 4PSUA 5LZ4A 2CEKA 2Z3WA 2OQIA 5HQ3A 4QDOA 2OLEA 4BZWA 3D2CA 1SCQA 1N5RA 3OOSA 3K9BA 2HA3A 3C43A 4OU4A 3B3QA 5AKGA 1IUNA 4U2CA 1FFAA 4INZA 1XZMA 5ALDA 2DFPA 1DQZA 5ALVA 1G5FA 1ZOIA 4QZVA 3FCYA 4KE6A 2CBGA 2Y1KA 5AKZA 1YB6A 1IZ8A 5IVDA 4FTWA 1P0MA 3WYDA 2BFNA 2ES4A 2ZYIA 3ZI7A 2RONA 5DNUA 4YX9A 4G9GA 4C4XA 5FPPA 3MUOA 3ICWA 1BROA 1H22A 1BU8A 2BUAA 3IULA 3WJ2A 4AMZA 2AXEA 3WK8A 1QO7A 2ZJ7A 7YASA 4H0CA 3HSSA 4OUKX 2B9VA 4TPKA 1ACJA 1W75A 1QTRA 1LPPA 4G4IA 3NGMA 3N2ZB 3C8DA 2XQIA 4JUIA 4EHBA 2OPHA 5LKRA 3IB3A 1EXWA 2ZSIA 3IURA 4EBBA 5I8PA 4QLOA 3WL6A 2XLCA 2XUGA 2FX5A 4HZGA 2B20A 3STYA 4X6YA 4D9JA 3QBJA 4H7DA 3STTA 3WWEA 1YA4A 3O0DA 4BBZA 5AIBA 1Q84A 2VJCA 2PU5A 3WLAA 2CKMA 4FBLA 2JGJA 3R3ZA 3BF8A 3GROA 2WJ6A 2XQGA 3PE6A 2WJ4A 2XI4A 4C01A 5ALHA 5E4JA 1G4HA 1F8UA 4L3WA 2JEZA 5ALLA 2WTNA 2XMQA 4HS9A 2XDWA 2QXTA 3KOOA 1ZI8A 2BKLA 3OC0A 5K3CA 3DKRA 1UK7A 2XB6A 4AZ3A 3R0VA 1CUWA 3WKCA 5AKLA 1TK3A 1QLWA 1Y37A 2J4FA 4OYLA 1ZI6A 2WFZA 5DNVA 2OQVA 1WCYA 5EHQA 3HC7A 4HTAA 1XQVA 1YA8A 4ZREA 3AJAA 2D5LA 1GGVA 1HPLA 5ALIA 4FNMA 4XX1A 4H7HA 3SWWA 1DT3A 3C6BA 1CQZA 2AJBA 5DNWA 1THGA 4BP8A 4WFJA 1DWPA 5LZ8A 5C8VA 3F98A 4F21A 1FJ2A 3W9BA 4HXGA 5FDFA 2QJWA 1DX4A 5AM5A 1EX9A 1QOZA 2XUQA 5H3HA 1XZIA 1AZWA 4C4YA 5EHNA 1B41A 3G9ZA 1R3DA 2I03A 4DNOA 3R41A 5LZ2A 4K5QA 1TAHA 4PW0A 3BWXA 1XZGA 4X95A 2WFLB 4EY4A 2JGIA 2LIPA 1GPLA 3UUFA 1BCSA 5A62A 3IUJA 3TEJA 3V1MA 5HF9A 3G0IA 3FYTA 3ZWQA 4MEBA 1W52X 4MEAA 1NU8A 5AICA 4FMPA 4WDQA 4JNCA 4RE5A 4DYHA 1BCRA 3R3WA 4GEGA 5ALFA 4H7EA 4FHZA 1ODCA 4PSCA 4UHEA 3K6KA 4FLEA 3IVMA 1A8UA 4XJVA 3PUHA 3LIPA 4QDUA 3WK7A 4Y2SA 4U2GA 2OAGA 3FSGA 4Y2TA 2O7RA 3V1LA 2E3JA 2QMQA 3UUEA 4G8DA 2HFKA 5A2GA 2X8BA 5LLSA 4EUSA 2YYSA 1TCAA 2C4HA 5AK3A 4AO7A 4L72A 2WTMA 1QO9A 1NX9A 4C88A 3H1AA 4F0JA 3HYSA 1FFDA 4HVTA 2JGLA 3W05A 4X6XA 3BE8A 1CUHA 5IKXA 5C81A 1QONA 1N8SA 3RK4A 4G5XA 3CN9A 1AGYA 1XZLA 2RHWA 4FLMA 1SCIA 1MN6A 1CUBA 4DNQA 4Q34A 4N5IX 1GPKA 4Y9SA 2VEOA 1C7IA 5DWDA 1ODTC 1VZ2A 1XZHA 4WFKA 3ESDA 4O08A 1EH5A 4Y2RA 1CQWA 3L1HA 4QDTA 1EDEA 1XZAA 3A70A 2PL5A 1UFOA 3IA2A 2XUOA 5JASA 1CRLA 5KREA 2PBLA 2XUHA 3WA7A 3R3VA 2WQZA 3FAKA 2JF0A 1VZ3A 4X00A 1QIDA 4B84A 5E4TA 3FLBA 3GBSA 3IDAA 2OGTA 3M83A 3DS8A 4ZGBA 2GBIA 5LP1A 1J1IA 1QIGA 3GFFA 3AIOA 1UOOA 1GKKA 2WIGA 1XROA 4A16A 3E1GA 1JKMA 4J3JA 5HF8A 4FBMA 5CH3A 1QTIA 1ZD3A 2HHAA 3O4GA 5AKHA 1FFCA 1QIFA 5CT9A 1N5MA 2HU8A 4BVKA 2HADA 1ZIXA 3MGAA 2CUTA 1ZGBA 2CZQA 1G42A 2VA9A 2O2GA 2EDCA 2PUJA 4RE6A 2R11A 1WHSA 2BUBA 2ACKA 3ZLUA 2IIVA 3FBWA 1L7RA 3HZOA 3WL5A 4MYSA 5ALTA 3A2NA 4Q3OA 5EIEA 4BVLA 3JWEA 4CFSA 3WYNA 1YS1X 4U2EA 3ILSA 3QMWA 3OURA 4Q05A 1VXOA 5BV7A 1G66A 1EK1A 1LGYA 1UKBA 3DJYA 1LPAB 5ALWA 1IZ7A 3STXA 4Q3KA 4IH9A 2XMZA 2R8BA 1DU4A 4X3CA 5AP9A 2FJPA 1XRNA 3G8YA 5C8ZA 1A88A 1ODSA 2JIDA 2WFLA 3T52A 4BC1A 2VJAA 2HA7A 3WWCA 4LYDA 5ALNA 3DL4A 4Q3LA 2WUEA 4Z49A 3BL8A 4B83A 1DWOA 2G63A 1XZJA 1QFSA 5LIPA 1VXRA 3FLEA 5CT6A 3IUQA 4DSAA 3EQ8A 4LIPD 1TCCA 2XMDA 2DHEA 4AZ0A 1YAJA 1YASA 4BATA 1WB6A 1L7AA 2WUFA 1EINA 4HRXA 3RKSA 2VSQA 6YASA 2BGRA 2WIJA 4BDSA 1MX1A 4BDTA 3I6MA 1J06A 3EF3A 4W1QA 3YASA 5T4HA 5A7FA 1XQWA 4QWMA 4N5HX 4G8BA 2O7VA 2WHQA 2CMFA 3HI4A 2Y2VA 3H17A 4DSZA 5AM4A 3I1YA 3S2ZA 5T4BA 5C8XA 2Z3ZA 2WFMA 2WG0A 4HXFB 2EEPA 3QMMA 3G02A 1EDDA 4W63A 5AKJA 3I1IA 3WWPA 5HFNA 4PF1A 2QOEA 1O6GA 3WIBA 2PSJA 1MX9A 4UHHA 1T4MA 1H2XA 5JALA 3RM3A 2WM2A 3DLTA 2JGFA 1MAAA 5AM0A 1Z68A 1JU3A 3O9VA 1XZEA 1HBJA 4MJ3A 4J0DA 3C6ZA 3AZPA 2Z8ZA 1UOPA 2C58A 1DINA 4Y2JA 1SFRA 5AM1A 4FFVA 1DT5A 1CIJA 1QE3A 3C70A 1GQRA 4OSEA 4W9RA 2WIDA 2QUAA 4M0EA 4BP9A 2OAEA 2WIKA 5AM2A 2C0QA 2H9YA 4CG1A 1BN6A 4K6HA 5CXUA 2PM8A 5YASA 1MNQA 2XUIA 2V96A 1F6WA 1R4ZA 1WB4A 4PQEA 4UBLA 4J0CA 3V48A 4UFOA 1AKNA 5I9IA 4N8EA 4GHWA 3H0CA 1AMNA 3V1KA 3F96A 1XLVA 3GELA 5CH8A 3WK9A 1VA5A 5ALKA 3AILA 1CUVA 5AOAA 1U8EA 2PPLA 3EIOA 5IVIA 3QPDA 5BOVA 2X5XA 3QYJA 3W04A 3STWA 5JAUA 1XLWA 3VJMA 1M33A 5FP0A 2XE4A 2WUGA 2J3QA 3O4IA 2WHRA 2JGKA 1THTA 5JIBA 2QKYA 4M0FA 4BCCA 2I3ZA 4QE3A 4CIBA 3SC2A 4UHBA 5BWBA 3EBLA 1CUUA 5AJHA 3Q0TA 3K2IA 1QGED 5EI5A 2C5FA 3NUZA 2BAGA 2ZVDA 4NZZA 5F4ZA 3U0VA 1W4LA 2V98A 3H2IA 1MPXA 2VF2A 4U2FA 1WM1A 2O2IA 5K3BA 4A23A 5K3EA 1XKTA 2EDAA 4MQLA 4XWGA 2G5TA 2OXEA 1UZAA 5ALYA 4BAGA 2WHPB 2AJDA 3G9TA 3MVEA 5CBKA 2XUAA 4J0GA 1CPYA 5ALSA 2V9ZA 4C89A 2ZSHA 3LP5A 4AB1A 4FFWA 4QA9A 4KAFA 3ZPXA 2XUKA 2PUHA 1KEZA 5T4EA 2FUKA 3DCNA 5FOQA 1MAHA 3I28A 3H19A 5AKXA 4CCYA 3O4HA 2OGZA 4ARBA 3H2HA 5JD5A 3WK6A 5CXXA 1CUGA 3IUNA 4OYYA 4B80A 3VJKA 1LBTA 2Z5GA 1BEEA 1R9MA 4DNPA 3PICA 3SK0A 2PKYX 4FDMA 3V9AA 3NOXA 4LYEA 3AIMA 4X91A 2IITA 1I6WA 1EB8A 5JAPA 4FOLA 3ESAA 3QMVA 2UZ0A 5K3AA 1R9NA 3FOBA 2QM0A 5ALUA 2AJ8A 1RYYA 3F67A 3BIWA 1USWA 3WKAA 3WA6A 4G8CA 1UK9A 2BJHA 4RNCA 2XMCA 5DTIA 4PSDA 5ALJA 1GPNA 2GYWA 1XRQA 4C6HA 1OXMA 1ZIYA 1O6FA 2DCMA
chains in the Genus database with same CATH superfamily
1CJSA 5E9JA 1LKZA 2HSZA 4TZ0A 4KK4A 3H3XA 1II0A 5IXJA 2WB2A 2RI6A 3W5CA 2DGDA 4MWZA 4XEUA 2WG1A 2XQJA 5KWIA 3OPYA 2GGSA 1BN7A 4C29A 3FNRA 4EPXA 3PPVA 3KSRA 4YB8A 3ZHZA 1HQYE 2E87A 4P6VF 3RJMA 2H08A 4M6WA 1V41E 5JQWA 2KJQA 3JW8A 4B48A 6Q21A 5LSAA 2GCNA 4OK3A 3RFTA 2ZSJA 3TB6A 1W5BA 3O5AA 1T34A 3WQHA 5DN6D 3IIJA 2LYJA 4QOHA 3I9LA 2OFXA 1E5LA 3MMPA 3T5DA 3CVWA 1AQYA 4KJXA 4XGQA 3H11A 1ODJA 4KXMA 1PT6A 4PQFA 1R8SA 2OTCA 4FFDA 3L06A 2RJNA 4UPDA 3Q98A 4F9EA 2EWVA 3E3MA 4CLOA 2HPVA 1E2DA 4BMSA 2Y1EA 1P62B 2XQKA 4KVFA 4B33A 3KQUA 4RZQA 2VUSA 1BE0A 2FLVA 2JFNA 1FXUA 4GP9A 2ZSEA 2EKQA 2QENA 4DGQA 1BXGA 4DS3A 2P8SA 5HKKA 3KQHA 3JQAB 1KFEB 3K1AA 1Y4SA 3EQ9A 4J3FA 1UPUA 5IM4F 1U0OC 3ZLVA 3BM5A 1OBFO 4GZLA 4X71A 2ZKIA 3HWWA 4AM8A 2UDPA 1E6CA 1V6CA 4OI1A 1FLAA 4ZHQB 1PG2A 3PR2B 4AXBA 4B75A 5JADA 1L3BA 5JNUA 3IEPA 2OT3B 3WHKA 1W4RA 1P1BA 3K8ZA 3U3MA 4ZMSA 4QREA 4U3JA 4MV8A 1RQNA 4LDPA 3ZXSA 5BORA 1ZY2A 1WH8A 2B78A 3LTEA 4LGMA 1P80A 1D4OA 1MOZA 1W1UA 3E81A 5AXAA 4BNMA 1TF2A 2QUKA 4EI8A 2JH3A 2QGFA 5ITSA 4RY2A 1H05A 1K8QA 3D4LA 4HEJA 1KZ1A 4B87A 5JPDA 3QKUA 2WUSR 3LRXA 2P4UA 2RGGA 3FGNA 3F52A 1CNEA 1FRNA 1I5RA 1U0EA 3L0YA 3R23A 5DHRA 1VB3A 5DSTA 4B40A 1A2QA 2W6PA 3AR3A 4MR8A 4DCCA 1QK5A 4P38A 2PWYA 2UKDA 3TUZC 1UFRA 1LD3A 2CF5A 2ZDHA 5G02A 3UWMA 4DTCA 4I5DA 4KQ9A 1QIKA 1I4WA 2I1LA 3B6EA 3PDCA 2RH8A 3R0JA 3TZBA 5KUTA 2I6QA 1MIOB 3DTVB 1MC8A 3RBZA 1B93A 2VDQB 1JDZA 1Q5PA 1MXHA 2MR6A 2NO9A 2G5PA 1ESMA 2PA3A 3UV3A 3V7FA 5KNCH 5L53A 1TW3A 2QL6A 3TSZA 1KMIY 4YRIA 3CSSA 1AQIA 3MGCA 3CLRD 1WUJS 4HR7A 5D3MB 5ANRB 2YYZA 5G0WA 1ISJA 2ZI3A 2X5JO 1U2PA 1DJQA 1PR4A 4I46A 2X9NA 4Y2PA 5AVQA 4N65A 1NE2A 1SK9A 1Q0TA 5IBPA 4ONEA 4M0LA 1NY5A 3I5UA 2YN4A 2PXCA 2O2ZA 3LGSA 2C5GA 2GZUA 1PV1A 3D1VA 1WXDA 2JZOA 1H2YA 3G2NA 3KB2A 4GX0A 2HA4A 2J3EA 2XVZA 1Q6YA 4LVCA 3WGVA 1WZ2A 1FVOA 3BREA 3KAPA 4IQFA 3HDVA 5E95A 4KFCA 3HU5A 4URHA 3O4VA 1GPBA 1NUTA 2FP4A 1OTXA 1DEOA 1V2GA 2ZULA 3NPMA 1IN4A 1RR6A 3VOAA 3HY3A 4FDUA 1R6AA 5TLSA 1L4EA 4F04A 4TTAA 3ZUPA 1ZM7A 1LRLA 3A3KA 2ZTMA 3JYQA 1SCBA 1HL7A 4EFLA 2N75A 2VHVA 1UCFA 3AEKA 3DMYA 1BHSA 3HZZA 4LBWA 2JJ8A 3KWJA 1TB4A 4RMJA 4WY5A 5D3ZA 5DHQA 1CNFA 3DAYA 4JUAA 2Q5FA 4HFMA 5I9SA 4YT2A 3JASA 5J2TB 3TRJA 1TVKB 3FE2A 2QX6A 3LM8A 4MV4A 1T8RA 2WU0A 1Y1QA 3SIPA 1D07A 2EGHA 2QZ9A 3FOWA 5ALOA 4MWTA 1DXHA 1J8YF 1K9SA 2ST1A 2ZWOA 4QNNA 4XGNA 4D3ZA 2V55B 5GQSA 3PS9A 3L41A 4ZI3A 3ZXUB 3KSAC 3F7MA 1UT5A 1YU9A 1KFCB 2WWHA 5DMXA 2UUPA 5GZ6A 1OR8A 5FBKA 4A5SA 1T3GA 4WZBA 1N4DA 2JGDB 3ICVA 3KG2A 3R0ZA 3R24A 4PBSA 3CF2A 3NU1A 3RLFA 1X1QA 1DO2A 3BB1A 3CJRA 3H42B 4IJQA 4IHJA 2VP6A 3BCHA 4ND2A 5DLEA 5FNVA 4RKWA 3RODA 1A96A 2VYCA 4QD3A 4ZOCA 1TMYA 2GN4A 2HM7A 2VDVE 2NZJA 4FVTA 5AWFC 4DCTA 5CCBA 1WKCA 3WL7A 2O0JA 2WF8A 1YR8A 1QKJA 1AF4A 3JU3A 4CCWA 3ANSA 3LK7A 5DOVA 5BOSA 4OQMA 4Z4QA 1O94C 1P1CA 2YJ4A 3NHJA 4IRXA 4JH0A 4CF6A 4CG2A 4V0RA 1P4JA 3F6WA 1LSSA 3IAAA 3GBFA 5EUCA 4YYEA 2KEJA 3MQ2A 4MTLA 5KYGA 4KCGA 2DX7A 4Q1DA 3VR4D 3OLCX 3ELYA 2O0KA 4BTEA 3DWIA 1C81A 3WFIA 4LHYA 4Z0NA 1MTZA 1YO6A 3I0ZA 3AUKA 1GL3A 3QVGA 5DCLA 3SHQA 1WSAA 3BWYA 3CG4A 2R44A 1ZD2P 5CURA 3LK6A 3T7IA 4CKCA 1P77A 1Z37A 5TB5A 1NLYA 4MP8A 1XELA 2IHBA 5IAJA 5I7EA 2ZI4A 4F84A 3NIWA 1PJSA 4H1UA 4ZEWA 3ZX5A 3FF4A 2G9VA 1M34E 2X19A 4GW3A 4RPHA 4YNBA 1SIBE 2OD9A 4FYYA 4R31A 5HMLA 1W76A 4L4UA 3FWHA 3OFJA 4GOJA 3GXBA 1R0ZA 2CCKA 4LXIA 2SECE 1ESCA 1DCKA 1U7DA 5LXTF 3HJUA 1AQ6A 1KL7A 1UKAA 3LZ6A 4JWTA 1M75A 3R5TA 4L7VA 2WUWE 5C1PA 1JR3E 4FI3F 5JQGB 2PLWA 4P7BA 1FFXB 1O94D 5CEFA 2ID8A 5AKEA 3V8MA 2R5WA 1C41A 3NTUA 1F1BA 5I48A 5K2MA 3MXTA 4ETWA 3HACA 5DWQA 2C96A 4UU0A 3PDJA 3V1YA 2GEBA 4DCGA 4ITRC 3C7KA 1ZH0A 3Q8LA 1NDHA 5DISB 4D9BA 4BFXA 4JQSA 4MWDA 2CJWA 3L0BA 4AJEA 5F23A 3OLQA 3KSMA 4P1ZA 3VYSB 4HS4A 4EGAA 1W93A 1ISPA 3Q72A 2AD1A 1W5TA 4AKIA 4DV6B 1G1MA 5KNLA 1RZ3A 4WCVA 1AN0A 2FSVA 3OJOA 4JLVA 3RO7A 3ROFA 4D99A 5BQXA 3C45A 4Y2QA 1U2GA 2YASA 4NOMA 5B1YA 5EA2A 5JLAA 5LCXA 3UAWA 3AUXA 4HATA 4ZO8A 5EPUA 2Q2VA 5DJ5A 1XN1A 2EJVA 2F1IA 2JJQA 2XHZA 2M1XA 2CYBA 1WXXA 2O3SA 1V1MB 4KNYA 1YV9A 1BEZA 3FGPA 3O3CA 1Q7EA 1VB5A 4FE7A 1NLUA 4G0ZA 3BK7A 5TS2A 1JHMA 2GMWA 3BXGA 4EPTA 5JJ5A 4GS5A 1XL0A 1YZTA 3KU1A 5JQGA 1EFVA 3OFSA 3G5LA 4O2RA 5JZOA 3C5EA 5CX1A 2XZLA 4CR7A 3NDJA 4GO1A 5I5EA 3H5RA 1A8HA 1NPDA 4A8HA 3INYA 2J32A 3CNQS 1I2ZA 1QYCA 2FY8A 4EB3A 1Q2XA 4DYDA 1K92A 3GP8A 1P2GA 3GLHE 4EFMA 4B44A 2W2XA 4QEDA 3ELDA 4AROA 4LHWA 2AOUB 4IS3A 2OLJA 2J0UA 3SXUB 4D74A 1NQ5A 3QLVA 4F1WA 1QGYA 4PIVA 3V3KA 1A7JA 1TQHA 2V3WA 1QWOA 1I9GA 3NVAA 1IY1A 4UHFA 4JB3A 3VV3A 4YUZA 2J3JA 3PUXA 5HRAA 2HKIA 4HMOA 2OY0A 4IMPA 1U0BB 3EDCA 1GITA 1MB9A 3WXBA 1HLGA 3P2MA 4YRRA 5K3FB 1H3EA 5DX0A 3PF8A 1ACMA 4L02A 3KSZO 3HBAA 2HRBA 1POUA 4NWIA 4ZXFA 1OJ7A 1ZK4A 5EMHA 4BJ5A 4V0KA 4DDWA 4CT0A 4WPGA 2JASA 3HB7A 4AX4A 1RYHA 1P0CA 1USKA 3L79A 1Z34A 2WNHA 3ED1A 1C1YA 4PYNA 1GAQA 2YJ6A 4KSYA 4OGWA 2VZ8A 1EUDB 3HBMA 1K8RA 1JA1A 2PXHA 2WW8A 3JQ7B 1MW9X 4Y0AA 5TEVA 3WX0A 1K6IA 2O8DA 5EQJB 5JSHA 2Q2NA 4MRNA 3KFXA 5BT8A 2DH5A 3KPVA 4Y2XA 5AVJA 2VDMB 2ZCVA 4AK9A 1U8CB 2OYRA 2ONJA 4D9EA 1T29A 2Y0CA 4PO1A 4W6QA 3U1TA 2E2WA 4IDCA 4DE9A 3IS3A 4XQ9A 2X0IA 3VPCA 5JSQA 4OX9Y 4GZMA 1G63A 3P96A 4D9HA 3HHEA 3WRYA 4JLOA 1S2IA 5A4FS 3RYCB 3WGHA 4H27A 1G6Q1 2XWBF 3DCIA 1L7PA 4ZWNA 1E66A 3GA7A 4OEHA 4F72A 4V1CA 1JEQB 3DM5A 3LL7A 3RF7A 2E82A 3PNLA 3ZOZA 1KVUA 5LZ5A 2AQHA 2YY6A 2A59A 3OF2A 4QDKA 2YV3A 3TF5A 3JATB 1PV4A 4XYMA 2W4MA 1T13A 1IOLA 3KC2A 2ZYSA 5ECYA 1GARA 3FVRA 2FEXA 1G6HA 4ZMBA 2J41A 4YV0A 5EJMA 3O94A 4WXRA 1LXCA 1IPFA 1L9KA 4YHHB 1P1KA 1YK0A 1AUVA 4L8GA 4MZDA 4RL6A 2NXEA 3KYDA 1QBGA 4D79A 1ZUD1 5HRCA 1TQ4A 2CB9A 4R54A 1PJZA 1II9A 1V26A 5LQJA 2W6ID 4ZOLA 1DVRA 4WBNB 3FG9A 5K0TA 4RC9A 1FP4B 1JRLA 4G1EB 1PFYA 2NO5A 2W93A 3Q3IA 4C4SA 1AGXA 3UGTA 4GE3A 2JI7A 3OIGA 1RZVA 3RYFB 3E8MA 1X7GA 2V7QD 1IZZA 3TSAA 4ZKDA 1T9CA 1K5DA 1VJ5A 1FP6A 1J9ZA 1AKMA 1Z7BA 3QA3E 4LC0A 5M04A 3K16A 2JFYA 3LOPA 4G5RA 1UTXA 4P92A 1NNUA 1ZJYA 4WUTA 2ALJA 2CHVA 3B6KA 1N1MA 1VOTA 4Q48A 4YRFA 1NC1A 3RS4A 4CMEA 1X19A 3DUFB 4TYMA 2VATA 3A04A 3VKGA 1IQPA 1BXKA 4QGSA 4ZTZB 3L7NA 3RRFA 3TDMA 1Z5ZA 2DY0A 2O3UA 2VHTA 5FQOA 2Z4RA 3WB0A 4GMGA 4Z86A 1CETA 3ZE1B 4LF9B 5LPNA 2GN0A 1C9YA 3ENKA 3VSAA 5IM4A 1T9BA 4DUPA 1U1DA 3ONFA 1TA9A 3JQ6A 5CBPB 4C0LA 1MX3A 2QRVB 3A2KA 3QTLA 2CJFA 3F7NA 2OWDA 3WNZA 4OHXA 4MYHA 5H7XA 4QGFA 4R7ZA 3RU2A 4IV0A 1XRLA 4CEIB 2HXSA 2WIFA 1DHRA 4CFZA 4PINA 4DWOA 1TE2A 4S1NA 4MDEA 5JO0A 1GGJA 2KPOA 1IFXA 3RU3A 2M9MA 2A1TR 2J3LA 4YUXA 5KKCA 2ZRKA 3GDGA 4EENA 3FPSA 3WJAA 2Z8XA 4XCVA 4BMPB 4YMGA 2PX6A 2H4ZA 2BHRA 1ICEA 3BMCA 4GECA 4RF4A 1DEXA 4UM9D 2JLRA 5GIOE 2FNAA 2LCQA 3GJ0A 5KPDA 2Y0BA 4WX2B 4RY0A 2EW2A 4PHCA 1KY4A 5E4YA 2ECQA 2BONA 4BO8A 3P8ZA 1NQUA 1XA0A 4IXWA 4DMCA 2FPPB 3B6JA 4YASA 6REQA 2ZBRA 4ID3A 1IXYA 3DVLA 2I2BA 5C32A 2OV1A 2NYAA 2AXVA 1WCIA 1W44A 3CO5A 3FETA 3T3MB 2FW6A 2YJGA 1UIMA 5LJIA 1PUIA 1WB5A 4LJ5A 3MWKA 1GYRA 1ZNQO 3G2JA 2VBGA 3HV0A 3QG1A 5G4KB 1BG6A 1Z39A 5KJ6A 4EGCB 2GAOA 3RUPA 5LLDA 4LSMA 2FV8A 3HNRA 1YSCA 3O93A 3ZH9B 3ESCA 3Q85A 3ZNQA 3IVCA 4RFLA 4CTOA 4GM0A 4EI9A 1DAPA 1NGSA 1XMJA 4CM4B 4ZI5A 1XVUA 2XJ3A 3RYIA 3PSHA 1WLYA 3GJ4A 2DHDA 2QTLA 2WJIA 4FIDA 3S5UA 3QPUA 2VXCA 1AGPA 3FNBA 2BEUB 2BEJA 3FYUA 3BJRA 3WIOA 1NZJA 4IG4A 3VNQA 5E7MA 1RP1A 3GN1A 1ZA1A 4M9XA 3UWKA 1MX5A 4QOJA 4BX8A 2F1OA 3IXQA 2IZ5A 5JCJD 1IHUA 3OOJA 4GBMA 3G88A 4IF6A 1K63A 2R84A 4K3UA 3U37A 3HYNA 3GRPA 2I33A 4LE1A 3JSAA 5H0IA 1DP4A 1SQGA 3RIHA 1PL6A 5JH7B 1OTHA 3ZV5A 3LWBA 5HKKD 4YWJA 3OSZA 2JLCA 4C78A 1JJFA 5E9WA 1UF9A 3UAXA 1DDGA 3LP6A 5C3MA 1JG6A 3E15A 1LFDB 3H9EO 4L51A 3RVJA 1TUGA 4E94A 5K8IA 3EGIA 2X6QA 5E1BA 4ER5A 1KOJA 4HNHA 1G21E 3PXCX 4I9UA 3JTMA 5C18A 4DR2B 3BXOA 2VN8A 4LX8A 3I8XA 5BURA 2XUPA 4R8RA 2P6UA 3LUCA 1US8B 1YBAA 1ONNA 4OK6A 5I9MA 2PMWB 4X93A 4N8DA 3KQSA 3ZNOA 3EUAA 2A0UA 2MYUA 1NF9A 4YP7A 1X3SA 2XCOA 1GUBA 4UVEA 1OAKA 3OEEA 1LTHR 4NCJA 4KMSA 3RSZA 3GZJA 4JQDA 3EHEA 3BDNA 1JSRA 2HO4A 3C74A 3LT1A 1WHTA 1BS1A 1C3OA 1V6AA 3G0DA 3D6AA 4H9GA 4MPJA 1PRAA 1V3TA 2PBFA 3MOSA 1XU4A 2HMVA 3MJCA 3U3JA 2QJFA 4EKYA 1ACLA 4OBWA 1VIVA 3U7RA 1SKYB 4N9QA 4R9RA 2OENG 2AXUA 2M4HA 3NP9A 4DIOA 4RXUA 5MGBA 4DLXA 3FTNA 3WGQA 4R6WA 4AZVA 4XJSA 3RFVA 4F4IA 4FKZA 1XDUA 1JFTA 1OX4A 1VIAA 2FP3A 2MSNA 2MWMA 2AR9A 4G9EA 3QQ5A 3LC0A 4G84A 4Y1EA 3KR0A 4I99A 4ND8A 1YFLA 3D8UA 5BSHA 5AOCA 3CONA 3DD1A 4B8WA 5IP5A 5L3RA 4BLOA 2WPDD 4L15A 1EI9A 5B57C 1HMYA 3I12A 2NQ8A 4MA4A 2IX9A 3IIEA 2L82A 4Q12A 4CPDA 1EWTA 4INJA 2ZJAA 3HCDA 4X4CA 3Q9LA 3ASUA 3QEMA 1ISSA 4WXHA 4DQVA 3NASA 5JAMA 1Z5PA 3LPMA 1R0BA 1II8B 4MCTA 3BULA 3PXUA 5EJ4A 5LXTA 3RRZA 3SR0A 2OD7A 4EVIA 5I51A 1AKUA 2QUZA 1LZKA 2EP5A 2V45A 1ZAKA 4OPMA 4HPJB 1UEJA 5EHZA 5IANA 2EX1A 1SCNE 4GYYA 2QY9A 4U8HA 2OILA 1Y9ZA 2XSZD 1JS1X 3Q0EA 3CB2A 5DGDA 5TQJA 2JIZD 2KM1A 4UCFA 3UC9A 1SZCA 1X3LA 4OHUA 2MYNA 4LC9A 4UUMA 2XRFA 2FRVA 2E1PA 2AN9A 3GR6A 5D84A 2AXZA 4FGUA 1J5PA 1GFWA 3PF9A 1SEVA 2BMDA 1B6SA 4A2WA 1ZGJA 1Z2PX 2PT9A 3EOBI 3LW7A 3I04M 3VNSA 2VTEA 2IOQA 5EFZA 2CLCX 1TZKA 4FEAA 4OREX 3VZCA 4CEJA 1LLCA 1XZPA 4MR9B 2C83A 1TAUA 3IEIA 3WVNA 3L8HA 5ESXA 4F5YA 5G1PA 4X8MA 1ISRA 3HBFA 2HA6A 2HCSA 1O08A 4X20A 3JQ8A 4G0WA 2Z2IA 3GVIA 2C5HA 3Q5DA 4YACA 3W8RA 2EBUA 4LAFA 2PXXA 2QIOA 4OQPA 4HC4A 2GX6A 3ZWCA 1B1AA 3CKLA 3AL0C 2A5LA 3SYNA 4BBJA 1ZI9A 1FFYA 2GCIA 3ET4A 3KKKA 3FUXA 4D4GA 4YXWA 2L1PA 2X6TA 3EFBA 2ORYA 4I50A 4BVFA 4LPKA 3SBDA 3S40A 3GX1A 1JFVA 5HKBA 5HKAA 2P2CA 2JVLA 4TS3A 3PDIA 2J3MA 3LECA 3D7NA 2QDKA 1GPH1 4CN8A 3KUKA 2Q1UA 4NNOA 3T7RA 4MWGA 3FFXA 4L07A 1LVGA 2QTVA 1QK3A 4KWHA 3HXKA 3EY4A 3CGGA 4KGDA 2PFKA 4QGAA 3RPEA 1X87A 4ASUA 1FFBA 5IEBA 2EXXA 5SZHB 1D6MA 4NP6A 9MHTA 3MTAA 1U2GC 1GZ6A 2WJVA 3WMEA 1Z7EA 4I4TF 2QL9A 4XCQA 2XUFA 1NFRA 2BLNA 4L7QA 1N0VC 1BKDR 1C4XA 1GV0A 1CYDA 1AVTA 4WADA 4NDWA 4DMHA 4C7MA 3UM9A 2BGKA 3LLVA 4MR7A 4CL3A 3NR2A 4X1KB 3K09A 4LXYA 5EJIA 1JVNA 2ZPAA 3LUAA 3ZU3A 1PHPA 4C87A 4FJ0A 3HCPA 3SVLA 5B7NA 3G9UA 3G5UA 5C8DA 4UDOA 4J4HA 1ZDMA 3EYWA 1Y6RA 4N3NA 4Y6SA 5BSRA 2AUMA 3GK3A 3EHDA 3IBSA 4JLNA 4W8OA 3OTIA 4FFOA 5FNZA 3U7QA 3L6EA 1FFEA 4R2LA 2GZSA 2BH9A 2VAVA 1V3UA 3FVTA 1MT0A 3KWFA 2OFPA 3N2GA 1VHLA 4V38A 1MGOA 3D6HA 3CH6A 3OLZA 3AHFA 5FBZA 5TPWB 1T9GR 5ALRA 4O4HF 1DIHA 5AIAA 1VRWA 4HHEA 1IE3A 1Y33E 3U61B 4IDNA 5JY6A 3D9QX 1P44A 5JHHB 5DB4A 4EX7A 1NE7A 1T9KA 4F9GA 1TGVA 1ZU4A 1QANA 3INNA 5AVVA 4FPXA 1JLLA 1IK6A 2YH2A 2RAVA 1Q0ZA 4MUGA 4RH0A 3T5BA 4Z1MD 2MDTA 2PKCA 1XVVA 1W5AA 2RHDA 4H59A 2BI7A 1VHDA 3C5HA 4Z9BA 4C7VA 4QTUB 5AXBA 4ZKEA 4BEBA 3NLLA 1UMCA 2DSNA 2LDBA 3DOCA 3IP7A 3ZVLA 1DG3A 4PYRA 2VJLA 3UB3A 4R1QA 1BWQA 3OTQA 3C85A 3UO8B 1A9XA 3QIVA 2YWEA 4FFNA 5IT5A 4N0EA 5KI6A 3CX8A 1BIFA 2D1TA 1MB4A 4RHEA 4A0GA 2FPIA 2RKBA 1EDBA 3WK4A 5JI2E 1UAAA 3AHEA 1Q1GA 3EVAA 4MWOA 1Q92A 2BMVA 2X15A 1G1AA 1M8GA 2PUEA 1F38A 1W0CA 2O6LA 3Q5GA 5ELLA 1PK9A 4AURA 2A86A 4IJ5A 5LP6C 1OWOA 1KJ8A 2HCBA 4WLOA 5LD2C 3JZMA 3KDAA 4S2UA 1BFKA 3DOIA 4H4CA 4MRRA 1PKXA 1XE3A 4EUEA 1EA5A 2IUTA 4EUHA 1B2LA 1L7QA 1V9SA 2B6HA 2CVQA 2DLNA 4ZT3A 2VBIA 2OOKA 3L5OA 3WRYC 4A6DA 4UUAA 5A7HA 2XCQA 4FOTA 3U3RA 2M6KA 1XG5A 3UJ8A 4C2BA 3VKWA 3CPHA 1DIGA 1VC2A 3LS2A 1AY0A 1U3VA 4B79A 5LQKA 5AJVB 1RLJA 4M0KA 1XJWA 3DZHA 1BH6A 1WCWA 5I01A 1THZA 4K46A 4AY6A 4WXYB 4C3ZA 2A6CA 3BTSA 2WZBA 4J1TA 5EL0A 2EATA 5CR9A 2VT2A 4RLQA 3THRA 3GYBA 3H8VA 1U9JA 1N2ZA 1Q1QA 2CSFA 2A0XA 4YVFA 3TMYA 4K8RB 4E5YA 3I72A 3IQEA 2AE2A 4RTKA 1UIRA 3FFBA 1BMQA 3GVCA 2ZRGA 4BAZA 2PGAA 4X4HA 1OHHA 2NUBA 2R68A 2P6MA 1A9SA 2AR7A 2VDNB 1H2BA 3GRYA 3Q9SA 1D7OA 2X0FA 2P41A 5CFRA 4U9HS 1RC8A 3BXPA 2GAIA 2PLFA 4YRJA 1VKNA 2PZFA 2E6KA 2UVDA 4PG8A 1W2WB 3K0FB 4GOXA 2YOHA 4IEFB 1DDIA 1EE9A 1T2VA 1S6YA 3FTQA 2IV2X 1W48A 2JCBA 1G16A 2HYDA 4LW8A 2JCSA 3F46A 3KEMA 3RUCA 3GLQA 4ZJZA 3T5AA 5BUSA 3Q8MA 4ARIA 1Q1NA 3KKEA 2F8SA 4KR6A 3LHSA 4GX5A 4FMBB 1GDDA 5CK4A 2YV4A 3AIKA 3LRTA 4CMEC 2EFGA 1EB9A 1VCHA 2A3NA 3H8JA 2XOEA 4IZ6A 1T5SA 3KUXA 1T5DX 2WRZA 4H6WA 3GJSA 3LBNA 1EFPB 2OHJA 2YRWA 3T3IA 3Q6MA 1VE1A 4KGVA 2KI5A 2NZUG 3AF0A 3NCTA 4O4LB 5BMOA 3W5BA 3THXB 1NUPA 2PVCA 1PGOA 3QFHA 1TYCA 2C2XA 1Y4ZA 2JIOA 3F9CA 4CQMA 5FTLA 2G17A 2XD4A 4DLNA 5MN5A 2ZQ5A 2OCLA 2BCEA 3I01A 4N6NA 4YJ3A 1CX9B 2R87A 4HFNA 3MCAA 3NB0A 4E5KA 3D4BA 1FRFS 2Q3FA 3OIDA 2VJYA 4BIIA 3KXAA 2HJWA 3BD6A 4XX0A 2UXDB 5ISMA 4LG1A 1B0ZA 4ND5A 1Z5WA 1JEAA 2FEKA 2W2NA 3AI3A 4GZ5A 4JJ8A 2FJRA 1UBGA 4B0OA 1TCBA 4HT3B 4RTSA 2LYLA 4K3VA 2BFOA 1K6XA 1UOQA 3DULA 3HCOA 4A6XA 2DF8A 3BMQA 2EBWA 3HFGA 5I9NA 4J1NA 1RLOA 1QS0B 4UHCA 2VR1A 4D0LB 1CUYA 3F4LA 4KUGA 1TW2A 2YJZA 1OWLA 1KVSA 3KJGA 3KVNA 2IHYA 3BKXA 3NM6B 4PSAA 1RWWA 4QUBA 4RUKA 4B2YA 4DLZA 1IONA 1OVGA 1VCIA 1CJMA 2OBYA 3CZRA 1VIYA 5KJCA 2XNDA 4CM9A 3OC6A 2NU6A 1NUAA 3IPXA 2BTQB 2MYPA 2Y92A 2PX0A 4XPIA 3RVOA 3UH0A 3UJHA 5AH0A 4CU2A 2CUNA 5BUZA 5A3JA 4FMDF 5L4SA 1ZS4A 4FZVA 4FM9A 1NX6A 2ZSFA 1GL9B 1MQSA 1QRDA 3O9MA 4H3KB 1UDXA 3C3JA 4IICA 5I9TA 5JANA 3ROTA 2ZI9A 3ZJTA 5CDGA 4BL5A 1QHHA 4ZU1X 2VXOA 2PS1A 1NI3A 3QXCA 4J94A 3W3AH 3LWDA 3BCSA 2XJ4A 2JLBA 1XTRA 2I67A 5KWJA 4MQEB 2NQTA 5EPOA 1ZCBA 3WO1A 3UBTA 1MRZA 1ZMOA 2AG0A 2VNHA 3Q10A 1ZUIA 3L4BA 4KQIA 5BSGA 3CV3A 5LQDA 1IJBA 3W4KA 4F93B 1DBIA 3FYUC 2VKQA 4PPGA 3O4FA 4ROTA 4ZYZA 4WDRA 3A36A 3WFJA 1JW9B 5B58T 5IJAA 4BNFA 4RGYA 3A37A 4ZTUB 3GLUA 3E9QA 3JQGA 5JJKA 4FHCA 4C04A 1O89A 2Q6TA 2VYNA 4NR0A 4P3YA 2VJBA 3B78A 1LCIA 2ATEA 3WOHA 2WJ3A 1NVVQ 1E9RA 1QGUA 1YR3A 1VJ0A 1O6BA 1VLVA 3HB4X 1DO0A 5JROA 4WESB 4R9SA 4X97A 1XWIA 1JJIA 4PZYA 5AK5A 3DSRA 4OXRA 3DB1A 3E27A 4D96A 4BMZA 4G4GA 1Y7YA 2AF3C 2ETXA 1J00A 2BKVA 2XXBA 4OI2A 3UWPA 3W1WA 1RCTE 3G8AA 4K9QA 2E9SA 4P3OA 4DR5B 4G5FA 4IOLA 4GDMA 3VVMA 2LXNA 4JC0A 1VE9A 4EG7A 4IY1A 4JLUA 4LFBB 1CUCA 2CNOA 3HWSA 1XMVA 1UPCA 1ITZA 4TKLA 3WGTA 2ZJZA 1WBDA 1M2EA 4I3HA 1XPJA 4OGLA 5GTDA 1Q2UA 3VHLB 1P3DA 3F5MA 4KZKA 4PC3A 3TW8B 1J21A 3WLSA 1VMAA 4OI4A 4LJSA 4BC0A 3AZQA 2VF7A 1G291 2ZJ6A 4YT8A 5DV9A 3RAFC 3F0TA 4B0PA 2JDID 1QH8A 1QC5A 5LMCA 2PV0A 3FDIA 5HE8A 4EUKA 1PQWA 4YRPA 1KBZA 4ZT7A 1ZRMA 3MIIA 4GGOA 2G1JA 3MS2A 2AXQA 2DC1A 1EK6A 1PT7A 1QIJA 5A0FA 5JRJA 5EZ6B 2GUWA 2I2AA 1E4VA 2BJVA 2IPAB 3NNNA 5K01A 4QASA 2VP2A 2YFKA 4WD3A 5CCEA 3JQ9C 1BA2A 3CFYA 4Y2YA 2Q9CA 1RHRA 2P4SA 3DMHA 1ZPDA 1TQ6A 1R9GA 1YQXA 2H7VA 2YDXA 3O8DA 3BE5A 3VJLA 3O82A 1J90A 3ZLJA 1UXOA 3ZVKA 4UAJA 4E0BA 2H4YA 1KKUA 3DD5A 3HKBA 3OD1A 2W0MA 1P1HA 3PIRA 1F12A 1KU0A 4IOJA 4A91A 3THYB 1G18A 5FYQA 2DT8A 3ZZMA 5A9RA 2H1IA 4KFTA 2O07A 1F0PA 1YDGA 4EHAA 1PR6A 5CW2A 3FPBA 4ZZ1A 2SKEA 1PDOA 2V6JA 2X2PA 1UWCA 2O5RA 3M6WA 4P08A 2V97A 4U9IS 2HFJA 3WLTA 5TT1A 3EMKA 4QYIB 1IOVA 1NJSA 3A1DA 3BL5A 3LF1A 2R8PA 4R68A 5I6DA 4NJEA 4WA7A 5I7FA 5A7LA 4U6QA 4MYTA 3DXZA 1PE0A 3RREA 3BWVA 5L3ZA 3TFLA 2PXEA 4CMIA 4N3CA 5JSYA 4OXIA 4G24A 5DE3A 3H1GA 4FI3C 2C07A 3A2MA 2P9JA 1JHQA 3N2YA 4D6XA 4RPCA 1N2CA 2DSTA 1Y98A 2R79A 3QNWA 4ERXA 4L16A 1P29A 3IV6A 4XIFA 4AMYA 4I6RA 1T5HX 1QF6A 3ROZA 1ZGAA 5JPIA 3AVPA 2JLUA 1Y5LA 3CR8A 3GYGA 4Y1RB 4RA9A 5AI0A 3G0BA 3PX3A 4ND7A 4ZC1A 3DO8A 4XM1A 3UMVA 2LKCA 4V03A 2IH2A 2H51A 2IEGA 4DUGA 4A6PA 4J1WA 5LQCA 3A4VA 3MCWA 2OEPA 4FN4A 3TJMA 4I5IA 2BZGA 2HA0A 3CJQA 4OK5A 4V2IA 1K7CA 1S3GA 4XWOA 4PYIA 1OZ0A 4PCUA 4ETNA 1VRVA 4I4TA 2WB4A 1VPDA 4YO7A 3MLFA 2H11A 3R40A 4GSYA 4OB8A 3UGKA 1UBMS 4K8OA 3ZZ1A 4C6TA 2Y3IA 4YALA 4HDQB 5IN4A 4DRXA 4YCLA 4MWSA 3NJ4A 1J25A 3EZ7A 2Y1DA 3R3UA 1CS0A 1T8WA 1K3FA 4LS3A 2XCRB 2YC2C 3L7JA 4JDUA 1TZBA 2BHLA 4RKEA 1R5BA 1DIRA 2RIPA 4FFMA 4OXKA 1T5OA 3PNSA 1FA9A 1M2HA 3GBVA 1IHDA 3BA1A 4PSKA 2BEVB 4YFYA 1NTRA 3OH8A 1QGAA 3ZV6A 4YGXB 2CJXA 2GZ1A 5T4FA 3CVVA 3GEBA 1ZFNA 1OGIA 4O4HA 4TGLA 4OHWA 4RIGA 3I9V1 1EA7A 1JYSA 1MJFA 2X13A 3NYWA 4HX9A 4RQBA 4M86A 4ZI2A 1A7KA 4L0CA 5THQA 3PD1A 3AEXA 3QA9A 1BCSB 1C2YA 3G89A 1QR6A 1V9CA 3H0KA 4LUCA 4UZSA 3TNLA 3HTXA 5HIJA 4LWZA 4XFKA 5FBVB 2JD0A 3CRRA 3TOVA 3I9OA 1NXXA 2A0KA 3HKDB 1Z07A 2ESRA 3CX4A 4X61A 1ULSA 1UBJS 5SYMA 4CL0A 2R2AA 2X1HA 3ZKCA 3O47A 1KJYA 4CMGA 2PO7A 4M1TA 5EXDA 3R3XA 2NUPA 1STOA 1E1KA 1A4RA 4K28A 1ONPA 2AFIA 5CLLA 1D0VA 3K09C 2RGEA 3D1LA 3AK4A 1YVRA 5K3DA 4C07A 3QVSA 5C35A 1EFCA 2FAXA 3FBTA 1RJ9A 5DN9A 2XBMA 1YNSA 3QENA 1PTKA 5KYUA 3U3KA 3T1TA 4RTPA 1Q1BA 5EYPB 3ESQA 3BCUA 1BCRB 3C3MA 4L74A 1TYEB 4Q9JA 5DF1A 5FORA 4BE4A 1CY2A 1E1RA 3VZSA 3GDFA 2XOKA 2QBYA 1XNQB 2LV8A 5FUWA 2ZDGA 1NBMA 2C7RA 1K86A 1QDEA 3AL3A 1PR9A 1QFXA 2DKFA 3HHPA 5LZ4A 4P3NA 2Z3WA 2RH4A 2W71A 1KSFX 3QXHA 5J5AA 4OHYA 1JEDA 1CHDA 4MCIA 2OLEA 3GC6A 3F90A 2VTBA 3K9CA 2WVAA 3D2CA 1NNSA 3JY6A 1JEJA 2IPNA 3ZIAA 4DLKA 2YS7A 3U40A 5KQSA 1HEYA 2HA3A 1EX6A 4OU4A 4WCFB 1SM4A 2Q2QA 3OOWA 3GEGA 1T24A 1ENYA 1IUNA 3B3QA 2IKQA 1E1LA 2J0VA 2OXRA 4INZA 5TR9A 1PZEA 3AVUA 4HTFB 4KMRA 2ZJOA 3PJRA 2IS6A 3C14C 3PYXA 1GXSB 1T1GA 3X43A 5DDIP 3S1AB 3ZDYB 3HM2A 3A9RA 3HP4A 3SXPA 2RSLA 1G60A 1JQDA 5FTWA 4D92A 3RS9A 4X4FA 1EFHA 1ZOIA 2R6AA 3GA0A 4ZEVA 4UXJA 2ZYGA 1KTVA 4X4EA 1H5NA 2NAPA 2EGUA 3KXLA 1FBTA 1SZPA 3HB5X 5K6RA 4UM7A 2UUCB 4MVJI 4FE4A 1TAGA 1YZGA 4QIHA 1HSOA 2VQDA 2JFXA 2ZTHA 5BVHA 3PITA 2CDRA 3DCJA 3IUYA 3JAWB 2DPYA 2D2VA 4QTZA 1SXJE 1YDHA 3TTUA 5A4IS 4QGHA 4XA8A 5ER6A 5T57A 3W5HA 4DJDC 3CE9A 3HCNA 2RONA 2VSNA 4OA8A 4QUGA 3AYXB 5KNBA 1T9AA 1VL2A 2ZWIA 3MWFA 4BFCA 1I14A 3D8SA 1M2JA 4RCVA 2AGVA 3N2KB 1IK4A 2I6TA 1WPGA 3QKTA 2HHJA 4J1TC 1E0SA 1S2DA 3DDCA 3G5AA 3N70A 4PBTA 1BROA 1H22A 2I3GA 1BU8A 1TVMA 2OPBA 3U0BA 5I3CA 1RRPA 2QLTA 1JR2A 1U0LA 4N3GA 1L1FA 2R62A 4DILA 2ZTLA 2WFAA 4TS4A 3W1VA 1PS8A 1L5NA 1FPQA 2CL7X 4DLPA 1IOZA 2B8JA 3JYPA 2ZR0A 3IPCA 5B6IA 2QPLA 4NYMQ 1DULA 4ENSA 1MHTA 2IX3A 1KI6B 5FADA 2DHRA 4AMZA 4DIBA 3C4QA 2B9EA 3QELA 1WSWA 3FYHA 4LRUA 4MV3A 1CQTA 5JCZA 1QO7A 3HGMA 3WADA 7YASA 2YDYA 3TW0A 2CFRA 2QN6A 1VBMA 3SKYA 1RACA 4B6RA 3HSSA 1NBWB 1KJWA 5C1BA 1P7PA 3CGWA 2B9VA 1V16A 2H2GA 1ACJA 1XLTA 2PRJA 3CH4B 3KYCA 4KQEA 4PEVA 5AHOA 4EX6A 1LPPA 4L5YA 2Y0EA 2YMPA 1DKNA 3N2ZB 3TWOA 2QAGB 3IBGA 3DFFA 1BMFA 3I0MA 2CY0A 5A5EA 4EF4A 1P2BA 4BGIA 3K0AB 3CTPA 1MD9A 1SA0A 2FDCA 1L5FA 4UMEA 1EXWA 2ZSIA 1N5DA 5EWJA 3IURA 3PL5A 4PCLA 2AV6A 1TAQA 1MJNA 2QZJA 3OZIA 3UBMA 3P4UA 4M83A 2FX5A 1I3KA 4JB8A 4JK3A 2VQEB 2EBYA 3L8ZA 3ECCA 3U4QB 2E0IA 4HBGA 2XITA 5GOZA 3EXHB 3BPSA 4X6YA 4C6RA 5J4YA 5LQUA 3K7EA 3RVMA 3OZAA 2QLLA 3CXRA 3MMSA 2DM6A 3REGA 5AVYA 3TQHA 2NMVA 4ND3A 3GT7A 3TLGB 4CIXA 4YCJA 1LQ2A 4BNIA 1QQ5A 1R4MA 3WWEA 2LYPA 3AIIA 3T1NA 1CNMA 1TO2E 4OJQA 3AI1A 3O0DA 1Z4PX 4MCXA 1TECE 5CJJA 3A14A 2IEZA 2B7CA 4HUJA 1TJNA 4BB5A 1P73A 1KAEA 3GP5A 3WRXC 3NAMA 4GSLA 2AHRA 4N40A 4D4KA 1UM9A 3UATA 2CKMA 4GRAA 4X24A 3RABA 3TTSA 5HM6A 3R3ZA 1TYAE 3BF8A 1IATA 2HMAA 1TTQB 1YHNA 1Y1LA 3LUGA 5IU6A 1C30A 4INAA 4XSGA 1TC1A 5CB4B 2ILVA 1I2CA 3PRYA 2M6LA 3U56A 2OZKA 2WT4A 1YRLA 4O3FA 1CK4A 5K45A 2J07A 4D97A 1B15A 4RVSA 2HJHA 2CYCA 2NVOA 3IDQA 3MTIA 4NCHA 5CDUA 1XR3A 4JMLA 2Q7DA 3BS3A 3ENNA 4CQMD 2XMQA 4HS9A 3UMRA 3IODA 4C05A 4QO7A 4MKHA 4D9FA 1Q12A 2HK7A 1A72A 3A1WA 2ILTA 4Z2AA 4UAUA 3EVEA 5EZYF 5CXQA 4EFNA 1T0UA 1ZIOA 1MORA 2WSSD 2BKLA 3PRKE 1FVXA 1MIHA 1K6JA 2HX1A 4G89A 1WHSB 4BZXA 3ORFA 5KU7A 3D3EA 3ZV3A 1D03A 2ANCA 5B30A 3I9JA 1ULTA 4IP0A 5IYZF 3U4DA 3O91A 3R0VA 5KYNA 1G8YA 2JHFA 2DUJA 4GRIA 4B09A 1HNXB 1TMGE 3E9NA 1MFZA 3IERA 4TTJA 1IH8A 4RLFA 3REOA 3WLEA 5JWOA 5AKLA 1DKUA 4HBZA 5TJHA 4CDMA 4O2AA 5KYKA 4NPAA 1KQPA 3I58A 3HY6A 3PRJA 4URYR 3WBBA 2QN3A 2JARA 1XJQA 3HMQA 3K0SA 4E6PA 3FHJA 2XNDD 4C0XA 4CM9D 2GESA 3GVXA 3K8QA 1BDJA 2YWGA 1W94A 2CC2A 4ZICA 1XQVA 1OIXA 2YXDA 3FPGA 1J7KA 4XGRA 5JSUA 3K8YA 3P4XA 1GG5A 5G0TA 5T5QA 3SJ7A 4AJJA 1GGVA 2BEWB 2YZ2A 3EXG2 4FCCA 1JG2A 1WG8A 3QLEA 1HPLA 4KLAA 3LYUA 4FNMA 4QFDA 5ALIA 4XX1A 3CX3A 4GUDA 4YJGB 3KRTA 3HXMA 1ZJZA 1QF9A 2AJBA 5IJ9A 3FMIA 1N3BA 2HGSA 4BLQA 5ICSA 2PRIA 1F17A 2PD4A 1OXTA 1CRZA 1BYIA 3FWPA 4WFJA 4X84A 5DLDA 4E51A 2ZRAA 3G7DA 1GIAA 4BXOA 4FMCB 4B4WA 1AM4D 1IJFA 2Q41A 5LZ8A 4BO9A 3F98A 3VPSA 4F21A 1KI2A 3T3GA 2LGJA 1JL3A 4DKXA 4PHTA 5GAGi 5CLQA 3ZWAA 5L51A 1M34A 1L4BA 2ZXUA 1V96A 1Y81A 5TMPA 4HLUA 3GJYA 1QV7A 3DVAB 4HXYA 5EJ6A 4HXGA 2P5SA 4PG4A 4ARUA 2O8FA 3HBJA 2QJWA 2JI9A 2BGJA 2DPMA 1IUKA 1DX4A 5AUOB 5AM5A 2VYQA 3ZHQA 3HDTA 1QOZA 2KSQA 3WBFA 1XZIA 4C4YA 3OKPA 2X77A 4FYMA 1B41A 3MCTA 3PNVA 2WYOA 1FNBA 3H4IA 2YWRA 1V47A 5FO0A 2I03A 2UXBB 2QLNA 3V80A 1A1VA 3R41A 5LZ2A 3E7PA 3F3KA 3FRIA 4HWSA 4DQDA 2O05A 5C9ZA 1Z4QA 3LY9A 3O31A 3UHJA 3BWXA 2ADMA 2BKUA 3BCRA 2WTAA 2WFLB 1EDOA 1AKVA 3VNAA 2D8MA 3I8OA 4IFIA 1IMOA 2BFBB 4KR2A 1GPLA 3BGOS 2GM9A 2EWWA 3UUFA 3ZBTA 2I22A 2H4JA 1IC6A 1RXVA 4TQGA 5EMNA 3T4EA 4HRAA 2EHJA 3A10A 3G8DA 3BWCA 4MAFA 1G8MA 2O8BB 3OETA 3CLHA 4HNRA 5EE5B 3EGXB 1B3BA 4TV9F 2YNMA 3C24A 3G0IA 4WK6A 3FYTA 3U3DA 3WIDA 5JNWA 1JTEA 3DW1X 4GPD1 1G19A 1E4YA 4MEBA 4OQFA 2VDPB 4PX2A 4ALJA 3B38A 1BVUA 3ACDA 1NU8A 5GY7A 1U3TA 1KY2A 1P9LA 5AICA 4ES6A 3TCXB 3NWBA 3GUCA 4RVUA 4W5HA 2ZJ3A 4BUCA 1BFDA 2IYRA 5IT4A 4ARZB 1GDHA 1H4VB 2GHTA 4EW6A 5KKNB 5P8WA 2AH5A 3C0KA 1S8AA 1NW3A 4JNCA 1JG7A 4I8XA 4PYKA 4X1YA 4DYHA 1MQ9A 4TYQA 2DQSA 3K6SB 1N5IA 3SY8A 2ODBA 2C7GA 5BW6B 1G5IA 1C7ZA 2PJDA 1Z4MA 3GLHA 4DDTA 2UUAB 1DWUA 3B3FA 4QPJC 5ALFA 2B30A 4O25A 3FDFA 3L7YA 2MR5A 1KMHA 1M7HA 2W2KB 1W9MA 1QDLB 5D2CA 1XIVA 5KJFA 5H68A 1SHKA 3WWZA 5IW8A 4PYOA 4BWFB 4UHEA 4LZZA 2L17A 4LECA 4OHZA 4AJKA 2ZE7A 4EUFA 3IVMA 4JJKA 4XJVA 3PUHA 1JIQA 3SQOA 1U2DA 3EDMA 3CR3C 3WK7A 4Y2SA 1D1SA 3SQXA 3KT6A 2PBZA 3A6FA 3FSGA 3FGZA 4PO8A 2CDCA 3SSAA 1K06A 1ADFA 3H9JA 4EDFA 4ZJPA 5JSZA 1AOXA 1XRJA 4BRUA 3ABOB 3FY4A 3ELUA 5C4GB 3DBLA 3SC4A 3F4KA 3AF4A 4WBSA 2PKXA 1SCDA 1U0FA 2DPHA 1RIIA 1JKXA 1L5QA 3OZDA 4G8DA 1J99A 4JUCA 3Q3GE 2QTTA 4MV1A 2I91A 3VZRA 4NPHA 2X8BA 2YHSA 5LLSA 5K4HA 3ORSA 4NRDA 3K70C 5A0TA 1TCAA 4DUGD 3WR5A 2C1XA 2FX2A 2YJ3A 5AK3A 3B9RA 4AO7A 2LNMA 1QO9A 1J2YA 1P2TA 3VNRA 3WQSB 1T25A 5IMBA 3ENVA 4LBZA 1FFDA 4ACAA 3T1HB 2D1SA 1X7HA 5KTKA 4OMFG 4M1MA 3VAYA 2VAWA 1VPTA 2ZRHA 3E23A 1OREA 5F1YA 2B5VA 3MSCA 4NFSA 1X7XA 3OQPA 3WNBA 5KYWB 1VYTA 5L3QA 4X1IB 2XXQA 1YFKA 5CYFA 5HJ2A 1SU8A 4GMFA 3GCZA 4M1YA 1PQPA 4TSRA 1HOXA 1W8DA 3OKAA 3QKSB 1VJCA 5FAXA 5MGNA 3RRYA 3MLBA 1N8SA 1HETA 4PC6A 2EIXA 1WCXA 4BVBA 4WK4B 1N7HA 4EJ6A 1PZHA 1CQIB 1XZLA 1YDWA 2NQ2C 2V9CA 1SCAA 2PH7A 1MN6A 3QW2A 4FLMA 1AKWA 3RS0A 4ESHA 4AJLA 3GLFB 4Q9DA 1Z26A 1AUPA 4QKQA 5GONA 3ZWKA 4Y1GA 1QMGA 2VDUE 3D8TA 3PQ5A 2HBQA 2ZM6B 1G98A 3M1LA 3P32A 4QU9A 2VEOA 4BUJA 3P9CA 1WDLA 1YI1A 1XZHA 1Q19A 2RHJA 3VSBA 2O3TA 4LWOA 3UAZA 4O08A 1JDJA 1EH5A 3WYBA 1M10A 4MS3B 5CVJA 3AFHA 4FZ5A 4Y6GB 4KR3A 3R3JA 4Y2RA 2ZFUA 2BT4A 1RMYA 2PQMA 1LBEA 3K9FC 1QNFA 1KXJA 3OWHA 4N0MA 4FB5A 1CQWA 1HTTA 1WV0A 4P7GA 4TV8B 4G0XA 3NRBA 1PNRA 2VUHB 3RS2A 2HJVA 3DLCA 1UBNA 3SYKA 1SBTA 5JG7A 2FE4A 2Q5HA 1A9TA 4RA6B 1XZAA 3LC2O 2P62A 2PL5A 3DV0B 3P9KA 4DPMA 3TS1A 4N03A 3C4JA 4M0CA 3FRJA 2FQYA 3IA2A 4J4BA 4M1KA 1UPBA 3ZH2A 4DV3B 3DAHA 4OQXA 3OKZA 1N1GA 1UJ6A 3A9TA 3OHSX 4RF5A 3SQNA 3QP9A 3NT5A 1EXDA 4RD6A 2XUHA 1V11A 4Z0PA 3WA7A 4Z4FA 1OAOA 4Q4AB 3CWQA 2JF0A 3JSXA 1ZVQA 1DAHA 2ID7A 4M8LA 1VZ3A 5E4TA 3FLBA 1KJ9A 3LLMA 3DZBA 3SICE 3IDAA 4YAGA 1UMBA 3ABSB 1ZGHA 1E1RD 2QYOA 4JLKA 1CG6A 4BS9A 2DR2A 3OCYA 1KEEB 2XOKD 3KCNA 4JQZA 4NULA 4CTKA 2REQA 4WRRA 2XKKA 1QIGA 3SXJA 1M1UA 3NBMA 2PE5A 1KO7A 4M53A 3HKEA 2CV0A 4ACBA 3VPDA 1RXIA 3UK1A 1GKKA 1QPBA 3PFKA 1FJHA 4A16A 3EZXA 3MHPA 1R8XA 4ND4A 4MO2A 2C57A 2F6RA 4J3JA 1JKMA 4QRHA 1KSHA 4CVNA 1UJ5A 3CBQA 4LY6A 2R0QC 1KTIA 1T0PA 5K7SA 1DBSA 4V0LA 3PC7A 4BGVA 2L8NA 1WLSA 1F4LA 2FU5C 5KYYB 2OK8A 3JWJA 2X1LA 1ZD3A 1YJXA 2IE8A 2WSBA 1DRJA 4ZCTA 3CX7A 1C29B 3ACBA 2FEWB 2QTCA 1NVUQ 2CNWA 2I29A 5C7OO 3SHOA 4F7WA 2EX4A 3DLIA 1KBOA 3QI2A 5D6NA 4IDFA 3N2LA 4I0WB 5CT9A 2JIBA 5B64A 5EP4A 4LYJA 4BVKA 4FEYA 4NBLA 2DTEA 5EWLA 1Z17A 3NWPA 4TSKA 1KS2A 1ZIXA 1RHMA 1BQ4A 1W0JA 2J30A 1ZW1A 2CUTA 2VBFA 1W5EA 1ZGBA 2GLTA 4QL3A 4B6FA 4E7OA 4BWVA 5LFAA 1G42A 1JHXA 2VA9A 3OJEA 4IMRA 4C06A 2O2GA 4RD3A 4ZV4A 3ZGVA 3NHRA 2PUJA 3MT8A 3FHOA 1C4OA 4K0RA 4P83A 2IVGA 2Q62A 4RM2A 4TWZA 4KP7A 3Q2KA 3T38A 4NZMA 5JVDA 1D6NA 5B3AA 5KNBD 1XHLA 1T2UA 1QQTA 1TPZA 3FBWA 2D1FA 2B21A 3E8SA 4F9TA 2WJHA 2B1QA 2R751 3HZOA 4DLSA 2Q5LA 4JYBA 4M89A 1U8FO 4JP1A 1A1SA 3EUWA 2GYYA 2W8ZA 4FGZA 4P34A 4EJFA 1OLUB 2XDYA 2C9BA 5EIEA 3IEXA 2GWHA 2XR1A 1U0GA 4MYRA 5DK6A 2K5UA 3CTMA 1CEQA 5EERA 3BIFA 1CB0A 4QM6A 5BV0A 3HXOA 5FFNA 1E32A 4JJ6A 4OP2A 2F55A 3LY5A 1L7BA 3WYNA 3SDZA 5BR1A 1H9CA 1MVLA 2VLIA 1OBHA 3QMWA 4KXFB 5BWNA 1LJ8A 3PHHA 3AEQB 2VHZA 1XO1A 3LHFA 1WAMA 3K5WA 3KR9A 3KQOA 4TUYB 2PZEA 3FUWA 2O2YA 3P5BA 4Y9RA 4G1CA 4LBYA 4LTDA 4C0JA 1JB9A 2FPXA 5CLHA 3F73A 2I4TA 3L77A 1O5TA 4D98A 2A9OA 2LBPA 1NVAA 1OWNA 3KXKA 2B37A 4UASA 3AJRA 5BV7A 1HQCA 1BKSB 3D2LA 5FOXA 1G66A 2C2OA 3SQWA 5KOJA 4L22A 1K8XB 3C3DA 1W85A 4RAQA 1IEQA 1V1RB 1JFFB 4UVGA 1UKBA 1VG9B 4DDUA 2EX0A 3AR6A 2QGNA 3EVGA 2BHNA 1PYOA 4YQZA 1LPAB 6ADHA 3ONNA 4CTMA 1N6RA 2BFCB 2QTZA 4UM8B 5EQDA 5BSMA 3V8RA 3STXA 2GM5A 4PYJA 2CWDA 3A58B 4LGCA 4TKUA 1HE8B 4XASA 1SC1A 1X7ZB 3L6DA 3PVSA 4YROA 3RCBA 4RCYA 4GI5A 3X1XA 3REQB 1E1NA 4MSUA 4RPLA 3L07A 2XMZA 3TZLA 1F8XA 2R8BA 4BKOA 4BQOA 4CLDA 2VRCA 1PVVA 4GM4A 4PC1A 5C53B 2QVCA 1VSUA 3AJEA 3E18A 3UZUA 3T5MA 4O4JB 4NOJA 1SD1A 4F7DA 1KPIA 3VTAA 1DB3A 3ZVMA 4NJMB 3G0HA 2GARA 5C8ZA 1VP3A 3RWMB 2QG6A 4HWGA 4UD2A 2H5IA 5FOWA 3AB3A 4P3PA 3TQTA 4M1ZA 1Y3CE 1Y6FA 2HMUA 1EUCB 1FPMA 1O3YA 1SB8A 2HA7A 2Q29A 2VJAA 3GN2A 1POWA 3NAGA 1HYEA 1NZDA 4FFBB 4MX8A 3TAUA 1RHJA 1JSZA 2A33A 3DL4A 3I2JA 4JY7A 1G3UA 3TRHA 3BL8A 1FS4A 4O2LA 2DERA 3RTAA 2G63A 2V1XA 1Q20A 1RYMA 4K6CA 5LIPA 1YE3A 3LISA 2F1KA 4A82A 3X1YA 3UUGA 3D3QA 4WZ6A 2PDAA 4YMWA 4I5FA 4NARA 4D0RA 3GVPA 3IUQA 1KPGA 3ZY4A 1BQ3A 3BWBA 4DSAA 1RLUA 2KBFA 3EQ8A 4R4JA 1D1TA 3VSCA 1AHIA 2RIRA 3QLTA 3OZGA 1XTBA 1JHRA 1GRNA 2DHEA 2Z8YM 3T15A 1O0BA 1YRWA 2OL4A 1EINA 4HRXA 4TKZA 5IXSA 3FPKA 5FOTA 3VMFA 4JT8A 3IO5A 2QEQA 1DTWB 4FS3A 4FN5A 4RO0A 2IUFA 4WCDA 3BGDA 4RJJA 1LSOA 4HQFA 2VTDA 5BSUA 3I6MA 2ZJ4A 4XVHA 3KJHA 1NJ8A 4GP6A 2I6UA 1J06A 4OP3A 1OKKA 5ECGC 1JKIA 3NCHA 2GCOA 4MIEA 4P2BA 4KC0A 3V4PB 3VPBA 3Q11A 4M7WA 1J0EA 2Z6QA 4QWMA 4BBAA 3PE4A 3ZHUA 4CT4B 4IMJB 2ICTA 1AK2A 3HA5A 4MVCA 3PVCA 4Y98A 4MB2A 4AU1A 1SBCA 2CMFA 3B3AA 4HLUC 4KQ1A 5IAEA 3VO2A 1AS2A 2AKAB 4G41A 1RSZA 1W35A 4PHFA 1HLFA 1IG0A 4M0UA 2AN3A 3A32A 3PPIA 3O9XA 3JYOA 3I52A 4D8YA 4DXHA 2WIBA 1BFUA 5AM4A 4I4NA 3FWYA 4HG2A 3GFGA 4YJ2F 4B31A 2OLKA 2G88A 3CNOA 1U8XX 7MHTA 8ABPA 1QF7A 1T5TA 2WNSA 1T6ZA 3KTAB 4S2EA 3UC5A 4AJPA 1K5HA 4HXFB 2EEPA 1MEJA 1K7SN 2C00A 1TLTA 1VLMA 2Q6LA 2BFMA 3CNHA 3QMMA 2OQRA 2OCBA 4HO1X 2NSYA 2IU4A 5M3BA 3I3SR 3VYWA 3BXEA 2X0DA 3I8SA 1G5PA 4RKQA 5KVQA 5G0VA 4D82A 1RXCA 1TZ2A 4ZVMA 2QOEA 4LEIA 4CQLA 4YRZA 4I55B 2ATVA 3HRKA 4XWAA 4ZZ2A 1YMUA 3B1ZA 4HX2A 2CVPA 2PSJA 1MX9A 1F3OA 1YRAA 2AG8A 4TROA 4F92B 2C7QA 5JALA 3SIWA 3RM3A 4OLBA 2R7KA 2WUVA 1XB2A 4BNUA 4YRCA 2FSIA 1LS6A 2O3QA 3TR6A 3NT2A 1D2RA 4A26A 5BMVB 1NXOA 4DZZA 1KHTA 1FYXA 2PAFA 3MQ4A 1UBFA 3EWSA 5FBHA 3RFFA 1RFLA 1HBJA 1M54A 1SQSA 4HNSA 5KIAA 3H65A 4FKMA 1WB9A 1W0KA 4LJAA 1JR3D 2AOTA 4CJXA 4QPNA 1UOPA 2C58A 3AI2A 4YEDA 4WXPA 3S3TA 3EXIA 3C6QA 1QB8A 3ZCTA 3Q2OA 4MGIR 3KVOA 3WSWA 1Y7TA 1KZ6A 3N28A 1EZZA 3QY0A 4GC5A 2TRSB 1NQXA 2BBOA 1GQRA 1GVNB 1E92A 2VDWA 4OSEA 4W9RA 5AJTA 3RUIA 1OU4A 3S0JA 4D57A 4DC1A 2QUAA 2IHTA 1JTFA 3MWEB 4EKEA 5AM2A 2WIKA 1JJAA 5KX5A 2H9YA 1SKYE 1OASA 1BN6A 5AOVA 2E4ZA 4K6HA 2XZTA 1FQWA 1NM5A 4MW7A 4R6XA 3VOSA 3GPIA 2OB2A 2W2VA 4FR0A 1DCMA 1UJNA 1Z22A 2XUIA 3FWKA 4ZDKA 1F6WA 4C22A 2YNMD 1ABEA 3G2LA 3B3GA 4ERNA 4I1OA 2FPSA 1PCXA 4MVJD 4B8YA 4J49A 1RI4A 4UBLA 3ST7A 4L73A 3MQFA 1U2DC 3GRAA 4G4SO 4MUFA 4U2KA 3ZTWA 3TSCA 1E96A 1O4XA 3IPRA 5K8VA 5H8WA 2PGXA 5HMMA 1S2GA 2IODA 4N3BA 3PJEA 4TL8A 4H3SA 4KXVA 821PA 3FPAA 4C0AC 3IMGA 5I9IA 3DZJA 3KKPA 4N8EA 4Z6KA 1Z6QA 4GHWA 4MI6A 1JE0A 3H0CA 4FYXA 5CIQA 4YRBA 5JI3E 1AMNA 1GG2A 2HLNA 3MRSA 1P9RA 1H66A 1TA4A 1NXTA 2NO7A 3O74A 1NUSA 3KKOA 5CH8A 2CDNA 4FNOA 4DCNA 2YFQA 1Q15A 3BWEA 4PU8A 5ALKA 3MWYW 5SY9A 1EWYA 2AS0A 5MDHA 3EA4A 3EIOA 2AWOA 1UKEA 5IVIA 1WZUA 3CKYA 5LMNB 4BFSA 1W4ZA 1QRRA 2B34A 1PRYA 1QRAA 4LGVA 4TTVA 5LM3A 1LH0A 4L1KA 10MHA 2NSDA 4NLLA 4LOAA 5T67A 1XU9A 5AHWA 3FOAA 1WQ3A 2X8JB 3ETEA 3GHYA 3KZOA 2VF5X 1QLHA 4EG6A 1XEFA 2X0JA 3TX2A 3WDKA 4ZI7A 3OQNA 1TM1E 2ZIXB 1X1RA 3WS7A 1GAWA 3DBRB 2QAIA 2O06A 4N01A 4KQXA 4JBHA 3IP5A 4RMIA 1DJOA 1JKJA 1THTA 3GJXC 3PWKA 3NI2A 4RU1A 3RHFA 2UUBB 3PLNA 3SIRA 2QHXA 2DFTA 4MV7A 5TF4A 3ZY6A 4OGKA 1Q0QA 3S7TA 2RGNA 2QKYA 5K9ZA 1P33A 1VMKA 4TKMA 1RPJA 3PEFA 1OFGA 2LYSA 2C2ZA 3R7FA 1EKXA 1ZXBA 1IIRA 1E4EB 4IZHA 4QE3A 4B3CA 3NVKI 3ORYA 4ATNA 2I2DA 1NI4B 3KZVA 3O83A 4UNSA 4ZXPA 5CU7A 3FNIA 2XWJI 3TIXB 2CBXA 2GK4A 3QU9A 4BHTA 1O9BA 1ZZ7A 2KB0A 3FD8A 2HRDA 3U3WA 3IC5A 3TZKA 3F71A 4BJ6A 3O75A 3W5IA 4GOMD 1O97D 5EZ5A 5F3RA 4F45A 3PQCA 3CNEA 2Y1CA 4GXRA 2H1SA 1E3MA 3MMXA 4C0BA 4ETMA 2VOEA 2BAGA 3B6ZA 5K0NA 3ZNPA 2ZVDA 3VR3A 4YAIA 3IAUA 1ES9A 5F4ZA 2PD6A 3JTEA 4BQEA 4EG5A 2ZE6A 1OCTC 3NTRA 5JDCC 1Y6QA 4RXMA 4UTPA 2BZSA 3TSOA 5A9TA 1ZWLA 4Y6PA 4G4SP 4IINA 3ET5A 1A9OA 3B70A 3H3JA 1NJ5A 1HT0A 2QNBA 5IT9A 1TEHA 4EMSA 2OB1A 3EGOA 1IEVA 4WNAB 4YCNA 5K3EA 5F3DA 2VS1A 2OZLA 2C95A 2RBGA 1N6NA 2EDAA 1SGWA 4PFJA 5AFSA 2EFEB 1P1IA 3IKVA 4TWJA 2FRXA 4X3PA 2JAXA 1GSAA 1J42A 5FULA 1PNQA 4RK4A 3T12A 1TF7A 1Y9JA 4CT5A 2YV5A 5KJEA 2F3TA 1O6CA 3QFSA 3H6KA 3M4JA 4IWYA 4R83A 4BAGA 2ZJ5A 2WHPB 1L6RA 5EKDA 8AT1A 1NVDA 4AD8A 4GL4A 3UANA 1QCCA 3VZQA 4YRGA 5TE9A 2NV2B 3V8NA 5JZVA 1HR0B 4GHJA 5J43A 1ZZ6A 4GI3A 2FN9A 5KVCA 2C5LA 3ZXYA 4D9GA 1SXQA 4C7BA 3IXLA 4KR9A</