2VERN

Structural model for the complex between the dr adhesins and carcinoembryonic antigen (cea)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERCDGNCQIIGYVIGTQCATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFIMBRIAL ADHESIN AFA-III
publication title Binding of Dr Adhesins of Escherichia Coli to Carcinoembryonic Antigen Triggers Receptor Dissociation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 23
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2verN00
3ZE1E 4K8RH 4LVHB 4P0DA 3TWCH 4NT6A 4C57C 1T7ZA 1X5YA 2R4SL 3KPLB 1II4E 2VXSL 4FQQB 2AXFB 2BHZA 1LO2L 4L5FH 4P5MB 1SYVA 3H42H 3MRIA 5IVXA 1CDYA 3QAZB 4ODSL 4OM1H 4J8RA 1XCTB 1AD9B 3ZE1F 5J6GB 2NZIA 5KVEL 1DVFC 3UDWA 4JQIH 4NQVB 4YEEA 1V5JA 4IEFB 4JN1L 4P3DA 1P84K 3KJ4C 1W72L 1WCBA 3BPNB 4OLWH 2EDHA 4PJIB 1KNOB 5DD6B 1C16B 4XBGA 5DI8A 3FZUC 4KDWA 1BOGA 5SX4H 2JB6A 4WFGE 4ODXB 4HHAA 4DKEL 3MBXL 2X9XA 3QFDB 5ICZA 2MTPA 3EO9L 4HULB 2A6DB 4OAWB 4OLZL 1AI1H 1T7WA 5ESQB 5HVWA 1U8KA 1QEWB 3FFDB 4ZO6A 5HY9A 1LNUB 1ZT1B 4NQDE 1O5DT 4Q0XH 2RFXA 5T1LD 3BIBX 4E5XA 4GRLA 1UCBL 5F89B 2E7MA 3WE6B 1FL6A 2EYSA 3MV7B 1NMBH 5TF0A 1F90L 1MRCH 1UWXK 2G2RA 3ZYZA 2GY5A 4TVSa 4UBDC 4XCCL 2AEQH 1NAMB 4NJAH 5GXBB 1RZIA 4ETQA 4C4KO 4PJFB 5I1EL 2W65A 2F53A 5F9AC 5C9KA 5MI0C 1MRFL 1NDGB 2UWEA 3MLZL 3IDUA 4JRWA 4J3WA 4NQUA 4WV1A 1BQSA 3SE4C 4HEPG 1MLBA 3L3DA 3WXVL 1OWRM 4ZS7L 1N6UA 1CD0A 5FGBC 3X3GH 3WIHH 1T0NA 3HZYB 4ZFOB 2V5RA 1DVFA 4WUUE 5EU6E 1DBAH 3SKUD 1J8HD 1G7HB 3BYTA 4Z78A 3WV0A 2PTVA 2YMXH 1AQDB 2LVCA 4YDIL 1NCUA 2CUMA 4UIKL 1NANH 2BHYA 1YEFL 4MHHG 1S78C 1OL0A 5E0QA 1FZKB 5E7BA 2D0HA 4FQCL 4LOUC 1HOCB 1Q9OA 2DQUH 1E4JA 4WTXA 1PAMA 2F54D 3EOAB 5IHZB 1CLYL 5FYKU 4D0BB 4QLRA 4PJEB 5DJAA 5IB5B 2CIKB 3D1MC 4PJ7B 4OLEA 3VFGL 1HH9A 1N5AA 3LKOA 3L3KB 1EFXB 4JO1H 4H1LA 2I9TA 4JGMA 4PUBH 4YQXL 1JGDA 3QPXH 2V6HA 3MRLA 3PGCA 3RIFF 3T0XA 3DV4A 5A43C 3RTQB 1ZVSB 2X4RB 3VXOB 1VB9A 4WU7A 4PJ9D 2AERT 4LDEB 4PJ9C 2CR3A 2ZSWA 3K1KC 1A4JB 4G6JH 3FAXA 3S37X 2PYED 1CF8L 2AJSH 4NOFA 1FFOA 5FF6A 2VUOA 3MQIA 4KMQA 5FGBA 1DFBH 1IARB 4WTZG 1CK0L 4KQ3H 1WBXA 2A74B 2BDNH 4TNWF 4G7VH 3MYZA 3U9PH 1CGUA 2EC9U 3SDAB 1B4JL 1XR9B 3QDMA 1MIML 4GKNA 1YNKH 1TJGH 1NC2D 4WWKD 1IAII 1RJZA 4JFQB 4WNQB 3EOYG 4WWKC 4Z9KB 4KJYB 5BS0A 3O6MH 4Y16C 3CX5J 4NQXA 1QFWI 4L3AA 2YWZA 4P2QB 3MLWH 2EDEA 3QI9B 3RJDA 1GHFL 4FFVD 3UTZB 4R97C 2N7BA 4P57A 2WAHA 4PJCB 3RVUC 1JZ7A 3HR5A 1U91B 4HGMA 3ULUD 3P0VL 43C9A 2B4CC 4LEOA 5D7LB 4GOSA 4Z7VE 4S1DD 1JGEA 5KG9A 4MA1B 3O3BA 2PR4L 1D5MA 2BFVH 1RSFA 4Y1AB 1YQVL 5F7WC 1Q0YH 2Y5TB 5CGYD 2VISA 5BXFB 5CGYC 2FH8A 4Z7VF 1Q94A 1UJTA 1JN6B 3G5YA 3S3JA 5FKPB 3QDHA 3O11A 1FPTH 4FQ2H 4XAWH 3TO2B 3ZDXF 1I8LC 5EU4A 3DVNB 5C07B 4YPGB 3FFCA 3TPUB 3IXAA 1FCCA 1T7YA 1G7PB 2ILLA 1C5CH 3FT4A 5JLZA 4ZUVA 3AB0C 3LKSA 3WJJA 3GSOB 5ILTL 4ZTOL 4P99A 1A7OL 1DBKL 4OZ4A 2ZCHL 5IB1A 2M2DA 2B8OT 1CDIA 4LGPB 4MJ5A 1A7QH 1RULH 5EWIH 1KOAA 1B6DA 4I3GA 1U8LA 4U1HB 1ZT7B 4LAJH 3WLBB 1WFTA 4LL9A 4IHOB 4KPHL 3D3VD 1QLFB 3QUZB 3X12A 1AKJD 3OV6A 4Y16A 3MRKA 2CKBH 3MNVA 2XY2A 5C0BD 4YHML 2W0LA 1TETH 1G9EA 1V05A 1WWWX 4BELD 4UOJA 5LCVL 5SV4A 4P46A 5MEPA 5CIPB 4V1DD 1U92A 4U3CA 3OX8B 4F7TB 2FSEA 3DWTA 4NWTL 3X17A 1YPZE 4OZIB 1I7RB 5E8DL 5TDPB 3RGVB 4X5WB 4H5SA 4LLDA 1NCWH 1I3GH 2AJZA 4N0UE 1TQBB 3IYLW 1YPZF 5GZND 5GZNC 2FZ3A 5DUMH 3E6FA 1R0AH 1GVIA 2FB4L 3MV01 4NQED 5T33L 1I8LA 1KTLA 3QDGD 1UZ8A 5MHSE 3CK0H 2GTZB 1DQQB 5L2KD 5KSBB 4QRUA 1H9VA 3MLSL 2D31B 5GSRA 1LD9A 3T4AB 3AS3A 4OV5A 1KEGH 3UTQB 1UKQA 4FZEH 1QNZH 4BH7B 5KOMC 4QXGL 1Q9LA 3N0PB 2B5IB 2MSPA 1VEPA 2ITDB 3L6FA 4NZDA 3QUMA 4QTIH 3VFTB 3RWFA 4HSQA 3V4PL 1ZLUK 1JWUA 1ZVHA 1OB1A 5DR5H 3TIDB 1R24B 1NGZB 4XHJD 1EO7A 2R1YA 4XPGL 3MRDB 3PWJA 1F6AB 4M4RA 2A6IA 3RKDD 1SJXA 2D4DA 3QEGL 3AVEA 4WENB 4KRPC 3P4LA 2X70B 2BCKB 3BH8B 2XG4A 1LMKA 4OT1L 5HYJD 1UM4H 1ZHBA 1Y6MR 3NAAH 2Z31B 4GRWE 5I1KL 4LLYB 5IF0A 3O2DA 5J1TC 2H6PA 4R8WL 1JZ4A 4RGMC 3QT2A 1LP9B 2Z91B 2ADGB 1P6FA 4FQXC 5ADPH 1R5VB 1ZLSL 4GRWF 3VXUD 5I1IH 4R7NB 4KVNL 3MSPA 2K7QA 3QBTB 3JWDL 4P23D 1OGAE 1BQHG 1YN6B 5JDJA 3THMH 1MRDL 1PKQA 2P5WE 1A9EB 3CVHL 2XWTA 2BSSA 2GJJA 3BJ91 3ZKMC 5ID0A 1MI5E 4PRPA 5H37G 1QBML 5HHMB 1OARL 3MXVL 3K46A 3C08H 4FA8A 1FGVL 5DD5H 1U6AH 5J56B 5D6DC 4UT9H 2BNQE 4J1UA 2IFFH 1RZGA 3GJFK 3QDAA 4JHBA 5GRVL 3JWOH 3QFJD 5CGTA 3PL6B 1T3FA 1KBGL 3VGFA 4LDOB 4N0CD 1HKFA 4N0CC 4RIRB 3TV3L 5E2JA 2C7UA 5L8JB 1A3QA 1GJIA 2PXYB 4JO4L 1GZPA 3BSZH 5KTEL 4QRTB 4LU5L 5GGTH 3NFSL 1Z5LA 1CICB 3NCMA 5DK3A 3D48R 3HMWH 3HS0B 3KDMB 1IC7H 3OXSA 3MFFB 4PJDF 4CN6A 5EH1A 4BA8A 2F58H 4RISH 2BK8A 4UT6L 3QUML 4PJBB 3BOVA 3T65B 3MNWB 1MELA 3EHBD 3EHBC 3E6HA 5E08H 4DFHA 4HWZA 1WICA 2NY1D 2CR6A 1A1NA 2N4IA 5CILL 4K94L 2W60A 4HK0A 4ZXBD 4YX2H 4TUKH 1JHTA 1RZFL 2H9GB 3MBEB 4HLJA 4JY5L 3BDYL 4M6OH 3GB7B 2HWZL 2Q7YB 1NC4B 4G9FA 5E9DD 5C0CD 3S5LA 25C8L 2AXGA 4HZAA 3T1WA 1E27A 1MFBH 4U49A 4FQLL 1PYWB 3TF7C 4HPYL 4RQQB 4NRZA 4Y2DC 2O5YL 1NCDL 5JHDB 3O2DL 4PBWD 1KCUH 1WBYA 1B88A 4KK9C 3IKCB 3G9AB 5IBTH 4ZFFA 4DCQB 3QJHA 1I1FA 2G60L 4KJQD 4YZFF 2EKSB 4KJQC 5DJ6A 3RUGA 3MLYL 1CYGA 1N26A 1BD2B 4I2XA 1DZBA 2X89A 1MH5A 2ERJB 1MEXH 2EXYC 1QO3B 3QCTH 4OGXL 1NGXB 1ZWIA 3QAZC 1JK8A 1OF2A 3SEPA 4XH2B 4DK3A 3D39B 5GS1B 3MZTA 1QQDB 3VFWB 4JFYB 4LCWB 3V8CA 2VXQL 1QRNA 5EORL 1TTGA 1FNGB 4RFOL 3BPNC 2VLKA 4GKOA 1ZLWH 4XNUH 3QDJE 3CFEA 4LHUA 3DGCR 3RY6A 3DXAB 4NO2B 3O3AA 1LO5A 4U1SB 1A1OA 3HE7A 4M93C 1FJ1B 4LSUL 3ARVA 4Z18A 5T3XL 2YN3A 1DBMH 4TPRL 1Y18B 1JHLH 2XPGB 4PGBB 1PW3A 4K7PL 4HAFA 1S5HB 3RL2B 5F7KC 5DMKA 3ZE2E 2VLMD 1J05A 2WV3A 4PTUB 4MWFB 4MNGB 1P9MC 4EDXB 2R1WA 4FFYH 2EEAA 3MV7D 1NGYB 1UACH 2B1AL 1S7QB 4GQ9H 1B4RA 3R0MA 2EE6A 4Y2DA 5D72H 4PRBB 3V7AG 3ZKXC 5T1DL 1UWGL 3ZE2F 5D7IA 1UM6L 1A7NL 2VTFA 5I73C 5TFSH 5GGSY 1JYVA 1J1XL 4Y5XC 1LEIA 3MJGX 2C1OA 3L1OH 3GSQA 4JFXA 2OL3H 2IPTH 2XTJE 2W91A 4OKVA 3HRZB 4JQXC 2EKJA 3GMLA 3G08A 1N7MH 4X5XA 3FQRB 2H32B 3ZKNC 3HE6C 4TOYL 3GFUA 4LLAA 2VLJE 3EYQD 3U4BH 3VI3E 5DD3H 1SJHA 5ICXA 1RAMA 2GCYB 4PR5A 2R4SH 4JN2A 1LO2H 4X0KA 1D5BB 2CGRL 4ODSH 3VI3F 2C4XA 1XGUA 2SEBB 3UBXI 1CDHA 3O3EB 5KVEH 2BSTB 3BIKA 2B7DT 1I8MB 4F80A 4HUWA 3LN5A 4X6DA 1DSFL 4JN1H 4HKZB 1JPGA 4LFHD 4NQSB 1W72H 5GRUL 4NFCA 3V6OA 4NCDA 5I8KL 2BSED 1ZS8B 5DJ2B 4DUWA 3DJ9A 4G6AD 4H26B 4G6AC 2HT4C 3IU3A 2JJTC 5BCAA 1CFBA 4PLJD 4DKEH 3MBXH 4PLJC 3F65A 3QO1B 2P48B 3EO9H 4XB7A 4OLZH 3L7FB 1B0GA 3FOLB 4OCYL 1CU4L 4D9RD 4HXBL 1BX2B 2J1KA 1EFXD 4FQ1L 2R69L 4NQCA 4YBQD 5SX4I 4HGWA 4JFFB 2YA0A 1UCBH 4HEME 4ORZC 3LKQA 4PY8I 3KYMB 4M7ZB 1N8ZA 1F90H 1L9MA 3RVTC 3RTQD 1HH6A 5ABDE 3O6FA 1Z2KA 4XCCH 2X4PA 5IESL 4YFLI 2AW2A 2YA1A 5D9SA 4WHTA 3WUWA 5I1EH 4M43L 1X5AA 5FM4A 2YKLL 1KT2B 3HE6A 3BKYL 5B22A 1MRFH 4G7YL 5HGAB 5JPMA 3MLZH 4PD4K 5FO8B 3NA9L 1VGEL 4U0RB 3WXVH 1L9NA 3C09B 4ZS7H 4PTTA 4O58L 4NM4L 4I5BB 1M4KA 2F74B 1KIRB 3SDAD 1DUZA 1I3UA 3UTSE 3BVNA 3CVIL 3JV6A 4X9HA 1NGQL 1QOKA 4MJIA 5CGMA 1YMHB 2EDKA 1ZA3A 4BFIB 4QXWA 3SE8L 4YDIH 4P2QD 4UIKH 1QSEB 1EEZB 3O4LB 3PP3H 3QI9D 1YEFH 1RJYA 4HJ0D 3QI9C 4J3OC 4IS6B 2JJTA 3S4SB 5FYLL 5FOBB 3C8DA 5DS8B 4FQCH 1MNUL 5C0DB 2E8ZA 1U8NA 4WVRA 1JUFA 5D7LD 1PSKL 1YEHL 5C0JB 4RDQF 3EOBA 3KHOA 3PWVB 1NANI 1CLYH 3M17A 3ULUF 3CMOL 4NQDA 1CD8A 4Y1AD 4WO4B 1FVCB 1P7HL 2FJGB 2ZUUA 4PYHA 5AYUL 3ZHKA 4RNRB 4DFIA 3S37L 4AH2A 5DFVC 4N0YH 3KAAA 3W9EA 4XXDA 4RX4A 1QPPA 3SY0A 1I7TB 4YQXH 1EIBA 2XN9B 5C07D 3KPOA 4RFNB 1GGCL 5GGVL 4S10A 2PW2A 1VPOL 5FKAB 2C4FT 3T1FB 5J1AB 4M4PA 1K8DA 4C56E 3RAJL 5BW7C 1KEML 3QIUC 1RZJL 4OIBA 1MCOL 3MJ8B 5I76A 2HT3D 2HT3C 2EH7H 1FNEA 3W0WE 1CK0H 3AY4A 2QQKL 1JFQH 4MCYB 4JPKL 3TT3H 3QUZD 3KLDA 1F3RB 3FRPG 4XCNB 4WUUA 5EU6A 1OTSD 2O5XL 1B4JH 1OTSC 2K7PA 1MIMH 2DAVA 1RU9L 3IETA 4DTGL 3ARYA 5DTFB 4JHWL 3LIZL 2OXGA 5FYJD 1G7MB 2DKSA 1J86A 4B50A 3D0LA 4BFBD 1BLNB 9CGTA 3PJSB 1PFCA 1GHFH 3RGVD 1X5GA 3NVQA 4LSVL 2LU4A 3W11C 4EQ3A 5E56A 2Y25A 5EOCJ 1UB6A 3OF6D 4JZNA 2FR4A 3P0VH 3K2UL 3UPRA 4BFEA 1TQBC 2ADIB 3B8YA 1RURL 1YECL 3RKPA 3FQXB 4R96B 2PR4H 3TBTB 3SO3B 2R2EA 4S2SB 1YQVH 3VG0L 4KWUA 4M1CD 3PDOA 2EE3A 4M1CC 5I15L 1N59A 3ARUA 3IJYA 3WFHA 1INDL 3HPJA 3WFBL 3KPTA 5LGHH 4QHMB 2GI7A 1MWAB 2EYTB 5CEYA 4WFHD 5F7EL 5F96L 3BPCB 1KLGA 4OGZA 1MUJB 1HILA 4XVUD 4XVUC 4UTBL 1ADQA 2B5IC 5ILTH 5I1CL 4ZTOH 3LSOA 1A7OH 4PV9A 1DBKH 2ZCHH 1A47A 4GKSB 2VDQL 4H1LH 4OBRA 5F1IB 2I07A 4NIKB 2HTLD 5ISZE 5HYFA 4MAUL 2VDML 3MV8E 2LU7A 4KPHH 5FM5M 2K9UA 4YHYB 4XI5D 4XI5C 2FNBA 2ADJA 4PREA 4YHMH 4D0DA 4H0IA 2HFFA 4R3SB 5LCVH 4KHXL 4HDIA 1FO0B 1TQCC 5LWYL 3AXLA 2Z31D 2P4AB 4NWTH 2DM2A 4LPYA 2A1WL 5E8DH 1M7IB 4QY8B 2E7LA 5L8KB 5KVDL 3FHQA 4DWHA 3T3PF 4FFWC 1PX4A 4Z7VA 3V6ZB 3QXTA 4H88L 3BQUA 4KU1A 4PP2B 4QRQB 5DJ8A 1CD9B 4WJ5A 4NNYB 1WWBX 2EZ0D 2DLHA 3IFPA 1M05A 2FB4H 1I1YA 3S9DB 3RWDA 5T33H 3B83A 4ZSOE 3P4MA 3UTPD 4HKJB 1OSPL 1XF5B 1YY9D 5HHMD 3RL1B 2VNCA 4GW5B 5ICYA 2NX5A 4NKMB 2WLYA 4TVPD 1DBBL 3MLSH 5CBEA 4M7LT 1NUFA 3QEUA 5FECA 1R3IL 2GJ6B 3L3OB 3PL6D 3FTGB 5H35B 4QXGH 5JO5A 2M26A 2L0DA 2YPLB 3TBSB 3V4PH 5DK2B 2PXYD 1FNSL 1T22B 2C3VB 2FECI 3IDIA 4U7KA 4UOW1 2YN5A 2KDGA 4HUUA 5DK0B 4UNVA 5JA8B 4Z5RA 4P5KB 4XPGH 4PPTA 1CICD 4WHCA 4QYOB 1CICC 4OZGE 3NBNA 2CLZA 4KZDL 3WLWD 3HCVB 4OFYD 1X9QA 2EDXA 1CE6A 3PABA 1J1PL 2DIBA 4OD1L 4P9ML 1ADQL 1NCBL 3KPQA 4WCYL 1B0WA 3LQAC 4HWEL 1MF2L 4F15B 3HAEG 3QEGH 4YNYA 4OZGF 4M3KB 4L3EE 2FJHA 4YFDB 3MLXL 1YPZA 3MCKB 1CI5A 1QR4A 5DJDA 3GMRB 5I1KH 2BVOA 5DQ9B 4R8WH 4X4YB 1YEJL 4N0UA 3Q6FA 3BKCL 3MBED 1U8JA 1UJ3C 2F5BL 3CH1A 3MBEC 3VWJB 1NC4D 1ZLWK 1ZLSH 3S98A 1H5BB 1OT2A 4KVNH 4WDIA 1GAFL 3FQUA 4P5TA 3H9HB 3JWDH 3K8KA 4MD4A 4U6XA 2J8UB 2R39A 1U8MA 3CFBA 1BOYA 2VSCA 1MRDH 2E7HA 3QPQD 4YE4L 3VFRA 5JHDD 4L8CA 1URLA 4NP4L 1QBMH 3STZA 1OARH 3MXVH 4H0HB 3IB4A 1FGVH 4G9DB 3QXAB 2AKRB 2JCCE 3BD5A 5L88L 5D1QC 1KBGH 1BD2D 4S11A 3CZFB 1HYSC 1PBYA 3KPRB 2GK2A 3QJFA 5DYOB 3S96A 3TV3H 5BZWA 1WEJL 2YD5A 2Z35B 3B2UC 4JO4H 4BKLA 4I0PB 3P3YA 3D39D 3OAZH 2NW2B 4L4VB 1QVOB 4LLQB 4LU5H 2MHAB 3NFSH 1R3JB 4LCWD 3BP5A 3QEQB 5I8EB 4YO0A 1KPUB 3HB3D 3P0YH 4LVOB 4ODTL 3MRMB 5H94A 3H3PL 1E0OB 3ZLQC 2VN4A 5D1ZB 4UT6H 3DXAD 3QUMH 4JY4B 3NN8B 2OQJB 2IPUK 3F7QA 2IALA 3DSNA 4X6CB 4CMMB 5JA9A 1UJ3A 1TJIL 2VRAA 4IM8A 5CILH 3PQYE 2GT9B 4K94H 4K23L 4PJ8B 4RA0C 1RZFH 1FL5B 3MV7E 2VDKL 5ACLA 3P9MA 1EZVX 1T1ZA 4QF1A 3BDYH 2HWZH 2WWKO 2CK0L 3SGJC 1CL7L 5I1HL 1DLHA 25C8H 2EDOA 1OGAA 4Y5YB 5ERWA 4ZOEA 3L5HA 4RWYL 2P5WA 3C87A 4FQLH 4GT7A 5F3BB 1HK6A 4EI5B 2VL4A 1MI5A 3FN9A 4HPYH 4U1JB 2O5YH 1NCDH 3O2DH 4YXLL 5D1QA 3BXNB 2BNQA 3O41B 4HIXL 4RBPH 2R1XA 3IFLL 2X9WA 3UJIL 2G60H 3MO1A 3SHSA 2CDFB 1NEZB 3I6KB 2QR0B 2ENYA 5DJYA 3L3HA 1TJHH 3MLYH 5DJ0A 3BH9B 3SDXB 4OM0L 2Q87A 3TA3B 3B2VL 4PJDA 3DROB 4LPTA 4NNXB 1KGCD 5FGRA 4OGXH 1FBIL 3KPNA 4MD0A 4R4FL 3SBWA 5EOTA 4XGZA 5GGQL 4G80B 3H7LA 3QULA 2VXQH 5EORH 2DMKA 3R4DA 4RFOH 4NUJB 1YMMB 3ABZA 3EFFB 2HG5B 2X7LA 5HYQB 3HI5L 5DD0L 3SJVE 1N2RB 4UV7L 4XT1C 4Y8AA 1K2DB 4ZUSA 3T0EE 4DN3L 1UXSA 3AU1A 1X7QA 4D9RE 2AP2A 3HC4L 4LSUH 3OZ9L 5T3XH 5EC1B 3SGJA 4TPRH 3QUYA 4GUPA 4WU5B 4K7PH 3PP3K 4ZUUB 5F72S 4NYLA 4ZUWA 1MJ7L 1HZHL 4JFFD 2AABL 5C7XL 1KJ2A 4I0KA 3NFNA 4PJXB 3IVKB 3F62A 2B1AH 4ISVB 2KQNA 4LSSL 5C0EB 5T1DH 1UWGH 4JANA 4JFZL 5C9JA 2VERN 1A7NH 4NRYB 1J1XH 3C6SA 5LQBL 2OTWA 3I9GL 1Z3GL 4DK6A 3LEYL 2XTJC 3N1MC 1PX3A 5HJ3B 1S9VB 4TOYH 3FRUB 3W39B 3LHPL 4QT5B 5IMLA 5GQBA 5LAXA 2BY1A 1U93B 1VDGA 1W0VA 3EO0A 5EO0A 4L8SA 2CGRH 1QYGL 1ZE3C 3FQNB 4X6EA 5FUOL 3LPFA 1QSED 1ZV5A 3O4LD 5HHOE 4K7FB 3X13B 4BH8A 3BZ4A 1CD1A 4KC3B 5GRUH 2P43B 3BWAA 3X3FL 4LCYB 5BJTB 4KH2A 5I8KH 1XAUA 1NBYB 3B9VA 5DDHA 2QQQA 5JW4R 4GAYA 5LBSL 5T1LA 1XF3B 5FA3A 1AD0B 3GI8L 5K33A 3IJSA 3ARFB 4WO4D 4OCYH 5EBWA 3BUYA 1CU4H 4HXBH 1GIGL 4FQ1H 1M7DB 1NQBA 2R69H 5IOPA 4PJ5E 3F7PC 4NC1E 2ICWJ 4WI8A 3E0GA 2R23B 2GUOA 4UV4L 2X6MA 3FOMB 1BZ9A 2XN9D 1GL4B 2BOCA 4A6YA 4KRLB 1DQTA 1MCPL 2D7NA 4MJ6A 1CG9B 4DZ8A 4Y19B 5IESH 4FRWA 3I6LE 4LASL 2P7TB 3LEXA 4M43H 4ONOA 5GSVB 2HVKB 4E0RB 2Q7NA 2YKLH 3CCHB 3BKYH 2NW3B 4QWWD 2D0FA 4G7YH 5B3JE 4LCUA 5I1DA 3NA9H 1KJ2L 1VGEH 2VLJA 3MODL 3T3ME 4O58H 4NM4H 5I17A 3GBML 5B3JF 1KTDA 1MY5A 4RFEA 5DRXA 4F7CB 3MLVL 3CVIH 1NGQH 2CXGA 3T3MF 5DJZB 3WNMA 2AQ2A 3SE8H 3WO4B 3GJEB 3HG1B 3DYOA 3ROLA 1MJUL 2D7MA 1MCJA 5JTWA 4GMSL 5FYLH 2UYLA 4AY0A 1MNUH 4XP5L 3MRRB 3C5ZB 4OZIF 3QWRD 1CDCA 4MX7A 4G8FB 2MCG1 1ONQB 3MRFB 1GSMA 3BRDA 1PSKH 1YEHH 2IJ0C 5IG7A 5HHQA 2WBJB 4IIQA 1NJ9A 1T1WB 1NPUA 5F3HA 3CMOH 1EEYB 1IAKA 5F6HJ 3TH3T 5AYUH 3LS5L 2GSIA 5AG8A 3S37H 2J7LA 4LLUB 4LVNC 1XF4B 4PGEB 1HNFA 2BMKA 1OHQA 2CMRL 4RRPA 5HYEA 4JFHE 3VJ6B 1GGCH 1P7KB 5GGVH 2VITB 3ARTA 4X5LA 1VPOH 4GAGL 1F11A 5D2NB 4P4KC 2HFEA 4CU8A 4IRJB 5IUSA 4UQ3B 1ZSDA 3OGCA 3RAJH 5I1LB 3S88L 1KEMH 3QUXB 3IXTB 1AY1L 3K8MA 1RZJH 3SOBL 4HIJA 4J3UA 1MCOH 3MRGB 5K9KB 1G6RL 1KG0B 4MNQB 4YC2B 4ZPTB 3RWHA 2J5LC 4X4XB 2QQKH 1SM3L 3KNBB 1K4DA 2EXWD 4JPKH 1HINL 4W70A 4A6YL 1F4XL 2EXWC 4LDLB 2YD7A 4YHYC 3UTSA 1YEIL 4DAGL 2O5XH 2WBWB 5D6CA 3UO1L 4D8PA 1RU9H 3FB8A 1IGFL 4NKQB 1FGNL 4JHWH 3LIZH 4TSBL 2WUBL 3VG9C 4NN6B 1JI2A 3Q5YA 4W4OA 1YY8B 4WEMB 3B6SB 3MMEB 4L1DA 1FYHB 1KB5B 1S9KC 5ID1A 3G04A 4LSVH 2F19L 4MMZC 3PGFL 3KXFB 4LPXA 1BMGA 4WIQA 2I25N 3HPLB 1DN0A 3NH7L 4KXZH 2GJZB 1EFQA 3K2UH 4IOSD 5SWSB 3EBAA 5T1MB 3FO2A 4U7MA 1UKSA 5CSZB 1QKZL 1RURH 2EYRA 1YECH 4OCXH 4M62L 3UTPE 5GGSB 2FYYA 1Y6KR 3KYNB 4OLVL 5J13C 4JRXE 4B7IA 1A22B 3VG0H 2CRMA 3HI1B 2RCSL 1OD7A 5I15H 3C2AL 3VD5A 1JL8A 2VDOL 2X1WL 1INDH 4XP1L 4P4KA 3V7AE 1IEBB 3WFBH 3EKCA 1HI6B 3NZ8A 5BZDB 1IFHL 4UDTB 5F7EH 1HHJA 5F96H 5IHLB 4C56A 2XKUA 3IDMB 1FC1A 2GJ6D 3F7VB 3AMLA 3QXWA 2VZ1A 4QO1A 4UTBH 1JZ5A 2Y7QB 3G5XB 2YPLD 1S9YA 5I1CH 4NDMA 1F58L 3D3VA 3W0WA 2VDQH 2VWEE 1AKJA 3IDGA 3PHQB 4U05A 4J3TA 4MAUH 2VIRA 1OSZB 2VDMH 2YC1A 3Q1SL 4QCIA 1Q38A 4OZHE 3VFVA 5F8QC 2BNRE 4ELKA 3WIFA 3MRBB 5TQ0L 4NGHL 5GRVK 1UA6L 3NCEB 2DQEL 5FAAA 1UYWL 3IDXH 2GW5A 4OZHF 3GJFB 2UZYB 4KHXH 2NY0B 2OP4L 4BSVB 3E1F1 4EIZC 5IHUL 5LWYH 4WI2A 1FLTX 4NC0B 1BBJA 2DN7A 3OAZK 2A1WH 5DEGB 4RSVA 2D03L 5KVDH 3UROR 3VWJD 2IQ9L 3MOAL 4LLMB 4H88H 2RR3A 4GQPH 1G0XA 2EIZA 4XX1G 1H5BC 4JY6A 1RY7B 2W9EL 5EO9B 4Z0XA 1RUQL 1NSNL 3UBXB 5L2KA 1HQ4B 1HXMA 4HX1B 4TUJB 2PO6C 5JHDE 5C0AE 4OD3L 3ULSA 4CNIA 3FN3A 3BZDA 4JAMB 1ORSB 1KF9B 5TJWK 1EEUA 4YDJB 3ULUL 1LO0L 1OSPH 3JVGC 2DQFA 2NXYC 3U82B 3ESUF 4XNXL 3TYFB 4HFUL 1S9WA 1ZT4A 4AT6B 2QSQA 3VGAC 5FYKE 1DBBH 1FL3A 3ALWA 1FSKB 3HC0B 1IVLA 3BN3B 2H8PA 4FXGB 4JM2B 3ULVE 2Q8AL 2WIIB 1A2YB 2OJEB 2A83A 3MUGB 2RJMA 5KW9L 4HS3B 1JPFB 5DRNA 1ZGLA 3KPRD 3FB6B 4LMQE 2QKIA 1T80A 2OS7A 3U83A 3V8OA 4EZMA 5ISZA 4DZBA 5IV2A 3ULVF 1FNSH 4I0PD 3WSQL 3MV8A 1UB5A 4JHAL 2QEJA 4L4VD 2FBJL 4XZUA 1RIUL 1T6WA 2GK0B 4RBPK 3FONB 3QEQD 4L1HA 3GZKA 4KZDH 1W0WB 5GIRB 1H8SA 5D1ZD 4PJHB 3VA6A 1J1PH 4OD1H 4P9MH 2AV1A 1ADQH 1NCBH 4WCYH 2P8LB 4HWEH 1WFOA 1MF2H 3U0WL 4CAGA 1IL1B 5HGDB 2OJZL 4TUOB 4KKLD 4ZNEE 3MLXH 4KKLC 5FUCE 5DJXA 1KULA 3JBG7 4JGUA 2ZNXA 4G43A 3EDDA 5DHVA 2CO7B 3O3DA 4PJ8D 1ED3A 1YEJH 3VXQA 4PJ8C 1IRAY 3BKCH 3U6RB 3CUPB 1WVZA 2F5BH 3P9LB 2O93L 2PO6A 2GTWA 2M1KA 1QSFE 3BPOB 4OZFB 4ZSOA 1GAFH 4Y5YC 3BJLA 1PEWA 5E8EA 2P24B 3KPMA 4OGYL 5F88B 5JIIA 4DJMA 4EI5D 5HSFA 5FCSH 1JZ6A 4R7DB 4YE4H 3NACL 3V2AR 3DX6A 1YEEL 5C09B 4NP4H 1EVUA 4AIZB 4AM0B 5A2IH 4Q2ZB 1YN7A 4FTVB 3V0VB 5C0GA 3OR6A 4RGOL 1C5DA 5AUMA 5L88H 3RNKB 3GUTA 4RGNE 2X4UA 5DMGD 3TA3D 4U6YA 1YNTB 3TA3C 4X7SL 5DRZA 4F7MA 4MA7L 4CVUA 1G9MC 1TENA 2XOTA 4KTEL 1WEJH 1NGWB 2XKNA 4WY7L 1T04B 1KCVL 1KJ3L 2B1HL 4ONFL 2PF6A 1CN4A 2XWBA 3CAFA 3GSWA 3DUSA 2D3VA 3BI9X 3B9DA 1YMMD 4IBLT 4ODTH 2AJXL 3H3PH 3BW9B 4BK4A 3VFPB 3VW3L 3H9SB 5L0QC 4L3EA 4NKDA 4ZXBA 4BQ9A 1WQVT 5J3HD 2W0FA 3DTXB 4BZ2L 4MAYC 2R2BA 1INQA 1TJIH 3ZDYE 1BIIA 5C0CA 4K23H 1BZQK 4QOKE 5E5MA 2VDKH 3VXPA 3BP4A 1AO7E 1X5ZA 2CK0H 3QG7L 3ZDYF 1CL7H 5I1HH 4I77H 5EU7C 4X7TB 5ANMA 2X4OB 2AJYL 2A6KB 2X1PA 4K3EL 2FWOB 3EYFB 4RWYH 3PP4L 1TTFA 1DEEB 3BGMA 4Y4FA 5D7JB 4KUCD 2LE9A 1M7XA 2VR4A 5EB9A 4Q9CA 5D5MB 5SWZE 4E41E 4YXLH 3VD4A 4N8VG 1YDPB 4Z7UB 4X98B 2AGJH 4NO3A 4FXKB 1U3HC 4HIXH 3IFLH 2EE2A 3UJIH 1PG7X 2C26A 4YGVB 3MR9A 1XR8A 3P4NA 4P5MA 3VXRB 1FH5L 4MDIB 5CMAB 4OM0H 3KYOB 5EN2A 2XI9A 5HDOA 3GSXB 2EDFA 2DL2A 4N5ED 4N5EC 4WW2B 3TN0C 5J6HB 1FBIH 3J7HA 1P7QA 5M95B 5DD6A 1IGJB 4G6KL 4R4FH 1T0MB 5GGQH 2ARJB 3LAFA 4PFEA 1RIHL 1S7VA 4LKCA 5T1KB 4TRPL 3F12A 3V6FA 3HI5H 2XQYG 3MGOA 2A6DA 5DD0H 1PY4A 5B38B 4UV7H 5IMKB 4MAYA 5ESQA 5EZOL 1XZ0B 5TPWL 1QEWA 3FFDA 3P4OA 4DN3H 5IBUB 3GSNA 5CWSB 1DQML 1EDQA 1BVKB 5D2LB 3PQYA 4P3CL 4HCRA 3HC4H 3ARFD 3OZ9H 2NLJA 5DURB 4DGYL 1JYNA 3U46B 5FO9B 3MV7A 4JDVA 5E70A 3CXDL 1TVHA 4N9GB 2HVJB 4KKAC 1MJ7H 1HZHH 1VA9A 2AABH 5C7XH 5HD8D 5EUKA 4RMTA 4ZO9A 1TLKA 1NAMA 4HUVA 1MJ8L 2FO4A 12E8L 4HIEA 2QQLL 2ATPB 4JVWA 4LSSH 2OTPA 1NDGA 4GRWH 4JFZH 4Y19D 4KK8D 5DO2C 1U3HA 3CSGA 2WWMC 5AAMA 5LQBH 5KS9E 3IFOB 4QRSB 3I9GH 1Z3GH 3QZWB 2FLRT 3LEYH 4FS0A 1UZ6E 1J9CT 2GY7B 5B39B 4XPBL 1MQKL 1MAML 4NBYB 5KS9F 1YYMH 3QEHB 3PIQB 5ENWB 3RQ3A 2VQ1A 3BD4A 3OHXA 3TN0A 2AI0L 2BJML 3LHPH 4G6ML 4F2MA 3SPVA 1AQDA 1UZ6F 4U2ZA 1MCKA 1M71B 2PCPB 3WFEL 1IGTB 1EUUA 1D9KB 1QYGH 1BFVL 5HVFB 5FUOH 2A77L 3SO5A 1BP3B 1ND0B 2VLRB 1L7TL 3WO4C 3HG1D 1FFNB 1BVZA 2FD6L 1FAKT 2YPKB 3SJVA 2VQUA 4MS8C 3X3FH 3T0EA 2IAMB 2L7UA 2YBRB 4D0BA 3GSRA 4MQ7B 3C5ZD 3C5ZC 5IB5A 5KSUA 1UQSB 4PRIB 5GRZA 4K7PY 3PF2A 1GXEA 5LBSH 2WBJD 4J4PA 3L3KA 1EFXA 3VDBA 2FEDD 3GI8H 2PTTB 1G0YR 4V2CB 2DQTL 2H45A 3KR3L 5E6IA 1T03L 4ZPVB 1GIGH 1KJMA 4YFEA 1WBZB 4QXTB 2YEZB 4LF3B 3Q2CA 3CDGB 4WHYH 1AE6L 3DYPA 5JUEL 3I02A 3DX8A 3I3EA 1S7WB 2C1PB 4M61B 1HHKB 3GSNL 3HZMA 1MCPH 3QB7C 1JV5B 2DWEA 4HCRL 4IRJD 2CDGB 2I26N 5T3ZE 1ZGLM 4LASH 5KANG 5T5NG 3QUXD 3PWPB 1DBJL 3QUXC 4XMPL 1P6AB 3QH3B 1AGBA 1W0YT 5BQ7B 4R4NC 3VH8G 4MNQD 1KJ2H 4MD5B 4UOW0 4O2CB 1NAML 3L95B 4YC2C 3FHAA 5EO1A 1T1YA 3AS0A 3MODH 1JZ3A 1X5HA 4EUPG 4AZ8A 3HUJE 3VRJB 3TCLB 3LV3A 3JWNC 4JEGB 4JFQA 3C5JB 1C08B 3MLVH 1XGPA 3U9UA 4AJ0A 3HUJF 2BXZA 1DLFL 3CFDA 3WCYA 3UTZA 5JOPD 5HHOA 5IMOA 1R3HB 4D9QD 4Y7MA 5E2VL 1U91A 1MJUH 1FIGH 3UZEA 1JWMA 3M1BB 4GMSH 2Z92A 2XZAL 5DJCA 3KPSB 2I5YL 3KXFD 2J12B 1S7XA 2VJXA 1Z6JT 4MSWB 4XP5H 3QWOA 1MY7A 5SWSD 2BOBA 5DMJB 2VXUL 1JN6A 3FKUS 5FKPA 3VFOA 5LGJB 3QQ3A 3DVNA 4PJ5A 5CJBA 3LS5H 1OAUL 1LVEA 5I16B 3KPPA 4KUZL 1BQHA 1G7PA 5FO7A 2YSSB 2E6JA 2IPKA 5BVJB 2CMRH 5CUSH 4BM7A 4JFEE 4U1GB 3VXSB 1IQDB 3WNNA 3DBXB 1QR1A 4OIIL 3QNYB 4OSUL 5HPMA 3SE9L 3S88H 5DUPL 3WLBA 5IB4A 1U95A 5DEFA 3FN0L 1AY1H 2B20A 4WI4A 2WBKA 1NEUA 1NL0L 3SOBH 1I1AB 2NY3B 2QADB 3ZSSA 4MZ2A 2LTQB 3V52H 2ZWLT 5IEHA 2EEDA 1AGDB 1A8JH 1SM3H 1HINH 1EVTC 4PY7B 4A6YH 1F4XH 3C6LC 4DVBB 5IIEB 3N1QC 1HQRB 1WJ3A 1YEIH 4DAGH 5C6WH 4OCLC 3UO1H 1JPTL 2V2WB 1JMZA 1CVSC 3UTTE 1IGFH 4PRHB 4F7TA 4P59L 1G7QA 3RIFK 1FGNH 3OKLB 4OZIA 4JJ5A 4R26H 2ZSVA 4HZLB 5TDPA 4TSBH 1HHGA 2J2ZA 5MENB 2NY0D 2WUBH 4QRPE 3LDBB 5EZIL 3IRZA 5DZLA 2HJLA 1MAJA 3ZT6A 1A0QL 3DLQR 2Q86B 2F19H 1IEAB 4JKWA 3PGFH 2BHUA 2WINB 3P30L 3REVB 3NH7H 4TNWK 5EZJB 4XNMB 1HHHB 4FG6D 1LEKB 3N1PC 4FG6C 1VFUA 3AM8C 3X14B 3EO1B 1QKZH 2A2QT 4LBEA 5B8CA 1DQQA 4M62H 4U3XA 1HKLL 4OLVH 4HV8B 4YHKL 4K8RD 5TE6L 4K8RC 4YHOL 3V79C 3RWCA 2RCSH 3C2AH 2Z93B 1IBGL 1C7TA 2VDOH 4KXZI 1LE9A 1LGVA 4MXQD 4R0LA 4XP1H 4MXQC 5BVPL 1XGQA 4QHNB 3G6JE 5HHNA 4PYGA 1IFHH 4O02L 4JM2D 4PJGB 4MB5A 3DRTB 1QSVA 3VFMA 1OVZA 3CX2A 1S7TB 3G6JF 3WHXB 5F1NB 4KAQL 4ZYKB 1F58H 1SJEA 4YGAB 4EKXA 3ROOB 3FCTB 3P0GB 3TVMB 1WUNT 3C6LA 3WL9A 3MXWL 3B9AA 3G9VA 3DO3A 1ROWA 2VWEC 3Q1SH 3TO4B 1MCEA 2XA3A 3D6GA 1T5WA 2X70A 1JHKL 3SDCB 1XCQB 3UC0H 5TQ0H 1JE6A 2LV4A 4IMLA 4NGHH 3OBAA 1UA6H 2DQEH 2Z31A 1UYWH 1I9EA 2VE6B 4ELMB 4JFPA 1PEZA 3JTTB 1Z0MA 2OP4H 4HKXB 4M8QB 5CJ5A 5IHUH 4RWHA 5SWQA 5IWLC 3BN9D 3BN9C 5IKCB 1YEDB 1S5IL 4OD2A 3OJMB 3WDJA 3RZCB 2D03H 3ARDA 3VXTB 4PV8A 3EDJA 2IQ9H 3BGFB 1OGTB 2DS4A 1Y6NR 3C9NB 2I24N 1CLZL 4R4BB 3BPOC 4JCLA 2W9EH 3FT3B 3SE3C 1RUQH 1NSNH 1DE4A 5JW3H 1TFHA 1R3KB 4HUKB 4O2EB 5E5RB 1A7PL 4OD3H 2I60L 2X9YA 3ULUH 3MTRA 1LO0H 1UADC 3NABL 5C09D 4XNXH 5BRZB 4LGRB 1KPVB 1T66D 4FTVD 4KJPD 2NY5C 4RIRA 2MQ0A 5F7DA 4HH9A 4KJPC 1WZMA 4ZOBA 2Q8AH 2VMFA 2XICA 5KW9H 1YEGH 3JV5A 1W72B 3ULVC 2NYYC 4QRTA 3SKNA 3CFKB 3LKPA 5JW4Q 2P45B 4MXVE 4N90E 5KVFH 4YHPB 1G9NL 3N1FC 3WSQH 4JHAH 4OZHA 2BNRA 2MMXA 2FBJH 4WW1B 1G7IB 1RIUH 4Y5VA 1GCFA 5ECJE 4TTDC 4F8TA 3NCYP 4MXVF 3JUZA 1N64L 5DWUL 3JXAA 3H9SD 4G8GB 1AGEA 5JPNA 5E24E 1IM9A 2AQ1A 2E9JA 3U0WH 4OBSA 5MERA 2OJZH 2VH5L 2IQAA 1BQLL 4MQXD 5GGRA 5IVZA 3OXRA 4ZQKB 3V6BR 3GRWA 4KJWD 3GB7A 4O51B 4GS7B 3MV9B 3QXDA 2DOCA 1JPSL 4HH8A 4L9LA 4L29B 4KTDL 1P4LB 1PYWA 1DUYB 2PETA 2VL5B 4RQQA 5E8NA 4DN4L 4DOHE 2V9RA 3VMPA 5JHDA 5TGBB 5LG1A 3BP6B 5A16A 4XNZC 4OGYH 1D6VL 5D7JD 1H15B 5D8JL 3NACH 1RUKL 5F70A 1YEEH 3UAJD 2R2HB 5I0ZA 2UWEE 5FDWB 1AHWA 4YLQT 2R4RL 5CLWA 3WFCL 1U8HA 2IEPA 5CP7B 4RGOH 1MCCA 4JQVC 2YD3A 2IAND 4M5YL 4NO0B 3VXRD 2BNUB 2EH8H 4M6AA 5KN5B 5GS1A 3HMXA 4Z7WE 4RGNC 4X7SH 5E4EB 2ESVE 2V17L 1S7UA 4MA7H 5TDOA 1AGCB 4KTEH 5JZ7D 4NT6B 4WY7H 4PP1D 1KCVH 2B1HH 1RK1B 4ONFH 1SYVB 5KZCB 3MRIB 4Z7WF 5IVXB 3F7YA 1EBPA 1F5WA 4NO2A 1FIEA 1B2WL 5T1KD 1NBVL 4ZUTA 2AJXH 1ZTXL 4F58L 4P3DB 3UYRL 1WCBB 4PGDA 1GC1C 3VW3H 1C12A 1D3CA 1NUNB 1K4CA 1T5XA 4ZNEA 5GJSL 4XBGB 5DI8B 2CRIA 4PGBA 1BOGB 3WD5H 2JB6B 2O5ZL 4BZ2H 2P8MB 4APQA 1PGRB 1WZKA 5DURD 4G42A 4EI6A 4UQ2A 5HYSG 1U8KB 2QTEA 4PRBA 5HY9B 3Q48A 1QSFA 1T7XA 2ZUQB 2RFXB 1KCKA 4ENEC 1PG7L 3RP1A 2R8SL 1TXKA 3QG7H 1S7SA 4GRLB 5CJXC 1E4WL 1FL6B 1MVFA 2AJYH 2EYSB 2H2SD 2H2SC 5ALCL 4ZG1A 4TQEL 3CXHJ 3PP4H 3HRZA 3GRWL 5TDNB 1JRHL 1A5FL 2P5EE 1GGTA 2H32A 1KB9K 5DHVH 3WN5A 4ETQB 5JXED 4CADA 2W65B 1CL7I 1EJOH 4Z7NE 5KSVA 5EFIB 4WWID 4GBXB 2F53B 3PWLB 3T04D 1RJCA 2GCYA 4WV1B 4XNQA 1R5WB 1VFBA 1MLBB 1R6VA 3L3DB 3DHMA 1FH5H 1P69B 5LJYH 4Z7NF 3QDME 2BSTA 1J0KA 4MLIA 1WAAE 4ZAKA 3FRPA 2NY5L 2HT2C 1IZKA 3OR7B 4GJTB 1DVFB 3ISWA 5GGUA 5FYKL 1D9KD 1C5BL 5EG6C 4G6KH 1L7IL 2VLRD 4Z78B 3KJ4B 1ZA6A 4P2RE 3ULVL 4IOFD 4DW2L 1WAAF 1RIHH 2UV3A 4IDLA 4KI1A 2DKMA 4TRPH 2IAMD 1F2QA 5GZOC 2IAMC 2H41A 3E2HC 5ETUA 1MJJB 5EZOH 4P2OC 3HMXL 4PRID 5TPWH 2A73A 5E95B 1KN4L 1Q9OB 1BJMA 1DQMH 4P3CH 4JFFA 2AJUL 2XQBL 4QOKA 1EA9C 4PLKC 5F1KC 4DGYH 5KSAA 3CXDH 2BVEA 5DJAB 1X5LA 4XX1E 1AO7A 1HH9B 2OR8A 1N5AB 5E94A 3LKOB 3DURA 5HPOA 4H1LB 1MJ8H 4BUGA 2I9TB 12E8H 5IW6A 5D2NE 4ONHB 1T6VN 2QQLH 2Q3AA 1JGDB 5CFHA 5HGBA 1T2XA 3MRLB 3PGCB 3BRFA 3DV4B 5SWZA 4WU7B 4E41A 5MEOB 1R5IA 3CPLA 3DECA 4U1MB 1H3TA 2ZSWB 4JJHA 5FIEA 4LCIH 4XPBH 1MQKH 1MAMH 2VXTL 5FF6B 3P77B 1FLRL 4P2CG 1WBXB 4TNVF 2AI0H 5E7FA 1GGUA 2BJMH 3HNSL 4NZUL 4G6MH 1CLOL 3DI3B 4JO2L 1Q0XL 3O4LA 4WTWA 1ES0A 3WFEH 2E7CA 4GKNB 4NKOA 3S3PA 1JBJA 2BY0A 4KI5E 1BFVH 2A77H 1RJZB 1L7TH 5BS0B 3MGAA 4P2OA 1F00I 3KXFE 1Z0NA 2FD6H 1W2KT 4ZS6D 1LO3L 3IAPA 3KPSD 5DF0A 3PG2A 3I75B 3FO0L 4E42A 1FVCA 2PNDA 5EU5A 3BEVA 3HR5B 5ELIA 5KAQG 4EBQL 43C9B 4LEOB 2G9HA 4I9WE 1SEQL 2FH6A 1JGEB 4CU6A 3KR3H 1GC1L 4FQIL 1F4HA 3D69A 1T03H 3O3BB 4WI7A 4DGIL 4A2MA 2QBWA 1D5MB 5F44A 3U36A 1M1SA 3A6OA 5FKAA 5AAWA 1AE6H 3U2SB 5JUEH 1ACYL 1Q94B 1A6PA 3O11B 3VXSD 1QFHA 4U1GC 2Y36L 3GSNH 1RFDL 4IMKC 5EU4B 4QXUL 3FFCB 5KS9A 4HCRH 3IXAB 4NZRL 4N5UA 5E5UB 4XCEB 2Q6WA 1DBJH 3FT4B 4XMPH 5JLZB 4ZUVB 3LKSB 1YNLL 4D9LH 1I1AD 4WFFD 2NY3D 1I1AC 1PZ5A 2QADD 1SVZA 2NY3C 2XG5A 4HIHB 2QADC 4WUKL 1INEL 1NAMH 5IB1B 2AK1L 3VXMB 1U8LB 2H3NA 3F6LA 2DBJA 3QRFM 1G7MA 3OKDB 5D96C 4PRHD 5IBLD 3O4OB 3PJSA 4Y16B 4JRYE 3BPLB 5FDYA 1DLFH 1B3JA 4F9PC 5MEND 4JPVL 3WXWL 2X4QA 3HAEA 5E2VH 4R97B 5CD3A 4P46B 5MEPB 3VGBA 4YHNA 3TNNA 2ADIA 1TCRA 2IH3A 4KK6D 4LP4A 2XZAH 2FHCA 2FSEB 2I5YH 2EDBA 4R96A 1X6LA 1FVEA 1FFPA 3O2WL 4H5SB 4LLDB 4LEXH 2VXUH 3K74B 3NPZB 2HMIC 2COQA 4MA3A 1TIUA 3QIBC 4QHMA 4XMLL 3E6FB 3PV7A 1I4FB 2YRLA 4G3YL 4OQTA 1OAUH 3KYKL 1GZQB 4KUZH 1C7SA 4G8IB 4LP5A 3TT1L 3T0BA 1UZ8B 4G5ZL 1CDJA 3T0AA 2CLVB 4XHQA 2IGFL 4ZO7A 3PHOB 4QRUB 4LCCC 2AQ3A 2P8PA 5GSRB 4NKIH 3MROA 4OIIH 5F1IA 4OSUH 3EW3B 5EBLA 2RHEA 4OV5B 3SE9H 3ILQD 3ILQC 5DUPH 1IT9L 3FN0H 1Q9LB 1TNNA 3EJZC 3TVMD 1NUGA 3L6FB 1NL0H 3GGWA 3QUMB 3ARGA 3R06A 3RWFB 2NY2C 3HUJA 1JWUB 1A4KA 5F6IC 3PXHA 4IJ3B 1NCAL 3TO4D 1U8PA 4YUEL 2FX9L 3RVWC 4PJAE 1SJVA 3SDCD 2R1YB 1EO5A 5DLML 4C54A 3PWJB 4KGJA 1JPTH 1AR2A 1XT5A 8CGTA 1LK3L 5CZVL 4J3XA 2A6IB 3QXUA 5IJKC 2JJSA 4P59H 1U58B 1A6WL 4QHLA 1I9IL 4PJAF 4QY8A 3VFSA 3UTOA 4FFZL 2A9ML 5DSCA 4HJGA 5EZIH 1A3LL 4P2YA 5D7KE 2V9TA 1IGYA 1A0QH 1ZHBB 5DFWH 3OB0H 3RZCD 5IF0B 4H8WL 3P30H 2H6PB 3BGFC 2HTKD 3F7RA 2HTKC 3AS1A 4G9FE 4HKJA 2FIKA 5E1HB 3RWEA 3CH8A 3GBNL 1XF5A 2CPCA 3WEXA 3LOWA 4KTYA 1HKLH 3HNTL 4YHKH 5TE6H 1I1CA 5FGCB 1CFNB 3QNZA 4GW1A 1IBGH 4FTVE 1PKQB 2AXJA 2R9HD 5BRZD 4JFEA 2R9HC 5BVPH 2HJKA 2XWTB 2BSSB 5ID0B 4PRPB 5C08E 2Z8VC 4JKPL 4CW1A 5JW4M 4OTXL 3IU4H 4O02H 1AR1D 1A6AA 1AR1C 1A6ZA 4X4ZA 2C3VA 5DXWA 4J1UB 1RZGB 1ORQA 4M48L 1HEZA 4MJ2A 2P42B 4I2XE 1T3FB 4OQTL 4P5KA 4KAQH 4P3WA 1QPXA 4EIGB 4QYOA 3SKJL 1OAKL 3WS3A 2W07A 3T8XA 5FV1L 4Z76B 2C7UB 3HCVA 1NFDE 2HYMA 3MXWH 5GRXG 1GZPB 3QR2A 3C8KB 3JTSB 1HXYA 4U1IA 1QRNE 5H37H 4RAHA 1NCCL 5T3ZL 1JHKH 3UTTA 1Z5LB 2VOTA 1NFDF 3K0WA 4KRPB 4DUVA 4G8GD 1WWAX 4QRPA 2LABA 4X80L 3RDTC 3FQWB 5D1XC 4BQ8A 3AUVA 3VWKA 2WSKA 1BF2A 3VWJA 1O0VA 3E6HB 3DETC 4N1CA 3MV9D 4HWZB 1E6JL 4O00A 1A1NB 1S5IH 3ARPA 4FQXB 3ZYJA 1MFCL 1S8DA 1V3JA 2W60B 4HK0B 4PG9A 2JJUA 1N6QL 5F9JA 1GOGA 5FM5O 4FABL 1JHTB 4KK5D 2NCMA 3KVQA 4RMQA 3T0WA 4KK5C 1DN2A 2F9BT 4ZTPL 1CLZH 3KLSA 4GXUM 3KLHC 4HK3J 2DQDL 4CN4A 1OAYL 1SBSL 3S5LB 2AXGB 2XWJB 1A7PH 1E27B 2I60H 1A7RL 1S9XA 5F7UA 1NFIA 4QRRE 3G6JA 5FYJU 3NABH 3QIWA 4NRZB 1LO4L 1CWVA 1IC5L 1TPXC 4GO6B 2DI8A 3CZFA 1WBYB 4X9BA 2IANE 5DYOA 2HLFD 2WMPA 3DVGA 3QJHB 5FYLE 3RGHA 1I1FB 4GLRH 4NO0D 3VCLA 5DJ6B 2APXA 2VDNH 3MRCA 1KELL 3RUGB 4XXCC 5F7NC 5C2UB 1YUHA 4U6HA 3C60C 2C9AA 1KC5L 5CZKA 1G9NH 1QD0A 3RU8L 1MH5B 1Q72L 5E8OA 5D1ZA 3MOBL 5CKAA 2JIXB 5KZCD 2UZIL 1CXEA 1ZWIB 1RJLA 3LPGA 1JK8B 1OF2B 4NBXB 1S7RA 3RDTA 5GRJL 3UDWC 5D1XA 3QQ4A 3S6CA 3V6OE 1N64H 2YUVA 1CGXA 4WGVB 4CMMA 1WC7A 5DWUH 2F8VA 2EIBA 4Z0BL 2VLKB 1JF1B 1KCLA 1CXHA 2VH5H 3CFEB 1BQLH 4LHUB 2VZUA 3O45A 3LKRA 2O61B 5FM8A 1IKFL 1VCAA 1LO5B 3ZT7A 4MGXA 3AAZA 5H8DA 1A1OB 5IMMA 3HE7B 1FVDA 5KVGL 1FNAA 5I1GL 1D5IL 1HDMB 1JPSH 2FRGP 4KTDH 5DMKB 3VGHA 4EI5A 1J05B 4IRSA 4GRLD 4CJ0A 4DN4H 5IGXL 5C3TA 4JZOA 4Y2DB 1WFNA 1D6VH 5D8JH 3PGDB 1RUKH 3TH4T 1J5OL 2CH8A 3B9KA 1OTTD 4CVXA 2C1OB 3ZO0A 1G84A 1OTTC 4MQTB 4GBXD 2F53D 3GSQB 2IADA 3WFCH 2CKNA 4OKVB 1CGSL 3GMLB 4WV1C 5E8PA 2NNAA 3G08B 3C60A 4M5YH 1MCWW 2Z8RA 1DJSA 4JO3L 3L5JA 2YD9A 1TNMA 2AXHA 2DWDA 2BP3A 2V17H 3QNXA 5GS2H 2QLVB 1SJHB 1BVLA 2K3TA 5ICXB 1DVFD 4NUJA 1Q9KA 4PR5B 2AEIT 2HG5A 4JN2B 2EDQA 4MJIE 4X0KB 2YWYA 1XGUB 4PS4L 1B2WH 3FZUD 1GOHA 1HCFX 1NBVH 4HUWB 1ZTXH 3LN5B 4X6DB 3V4UL 4F58H 4Q9RL 1JPGB 3UYRH 1CXLA 5EC1A 3T2NL 5C8JB 5GJSH 4M93B 3CGTA 4WU5A 4ZUUA 5AWNL 3FB5A 2O5ZH 1TTUA 2QSCL 5B4MC 2FO1A 4Y89A 4ISVA 4PBVC 1A1MB 3TLRA 1RMFL 4N8PA 4ERSL 4NQCB 3BISA 1PG7H 2R8SH 4HGWB 2MJWA 4LSPL 7FABL 4IOIA 4BFGA 3ZKXB 4PG2C 4UBDD 5JQHC 3KJ6L 1F3DJ 4ODVL 1E4WH 5I73B 5ALCH 2BERA 3LKQB 4Y5XB 4TQEH 3TESA 1N8ZB 4S1RL 2MQ3A 3GRWH 4ESKA 2A9NL 5IEKB 5EIIA 1JRHH 1A5FH 3O6FB 1AH1A 2NTFA 2X4PB 1A3RL 4HS6A 5D9SB 4WHTB 3WUWB 3ZSTA 3OG4B 5CCKL 3HE6B 4XMKL 2ZZUT 5JPMB 1BJ1J 2IWGA 1IILE 2R15A 2X2YA 4WEBL 4Z7WA 2ESVA 3WS6A 4JDTL 1MFDL 2APVA 4PTTB 3EIFA 2NY5H 1BWWA 4FXLA 1EZVY 5FYKH 3ES6B 3UJJL 1C5BH 3BVNB 3JV6B 2VKXA 2VSDA 1S78D 1L7IH 4M3JA 3ULVH 5BS0D 4LHJB 4DW2H 3BHBA 4UU9B 1ZA3B 4HUMB 4LOUD 5J1SC 4FMFA 3T0VA 2X4SA 1RJYB 4FNLL 5I18L 2GITA 1Q9WA 3HMXH 1EXUA 1KN4H 4LPCA 1U8NB 3INUL 1JUFB 2R23A 3EOBB 2AJUH 2XQBH 3OMZA 4KVCL 3JV4A 3U79A 3MRHB 3M17B 2DBLL 4NQDB 4PG2A 1NDMA 1FV1A 3BEWA 4AH2B 4Y19A 4OGAC 1SEBA 4XXDB 3IF1A 2AV7A 4Q7DA 4XCFL 5GSVA 3SY0B 2HVKA 3CCHA 1KIPA 4CVZA 3KPOB 3FFCD 2P5EA 2PW2B 4DKDC 5GS0L 1I1RA 4M03A 3O8XC 3S36L 3QG6A 1SQ2N 4I3RL 4LSRL 4MHHI 1K8DB 3ARBA 1RV6X 3WJJC 1UWEL 1FYTB 3IDNB 1KYOK 5IR1A 3LMJL 1OLZA 1ULVA 1KJVA 1OY3B 2DDQL 3VXMD 1FLRH 5DJZA 3HNSH 1WAAA 4NZUH 1CLOH 4JO2H 4WUUB 4M1DL 5EU6B 5MENE 2OX5A 1Q0XH 3HG1A 3O4OC 2H32H 4KFZC 3K4DA 4Y16D 1MCBA 3Q3GA 3BPLC 3IETB 4P2RA 3MLPA 4M5ZL 4S1SL 3HI6L 4JFDE 4Y4KC 4KI5C 4P46D 4KMLB 3MRFA 4P46C 3JWDC 3D0LB 3RVUD 4JHZA 5IFJB 1LO3H 2IF7A 1HSBB 1T1WA 2X09A 3FO0H 1BQUA 3BT2L 2WP3T 2YD1A 3M45A 4JZNB 2FR4B 3ZDXE 4LLUA 4EBQH 4OIAA 5K9OB 3L9RB 3UPRB 2E9IA 3LRSB 4PGEA 1C1EL 1MCSA 3ZTJG 2VAJA 1SEQH 1IZJA 5AD0B 1GC1H 4FQIH 3LN4B 4MB4A 5FFLA 2VO5A 4IDJL 4DGIH 5IB2A 3HZVA 4LAQL 3RIAF 3MZGB 3PDOB 4F37F 5D2NA 1VACA 2Y4SA 3OB0K 3IJYB 1ACYH 3WFHB 2HFTA 2NX5E 5I1LA 5J89A 3O8XA 3HPJB 4FP8L 4YAQB 2Y36H 1MHEA 3WO3B 1RFDH 4QXUH 4JZJA 5CEYB 2BY3A 4NZRH 2PW1A 2YA2A 3QIUB 2EIDA 3OKMB 1KLGB 4R2GB 3CNKA 5C0NC 1RHHA 3U4EA 5I19L 1YNLH 3DX9A 4I8DA 2ED9A 3NA4A 3LSOB 2EIEA 5EIVA 4WUKH 4ODUA 1INEH 4IJ3C 2BZDA 3GMQA 4JVPA 5DT1L 2I07B 1QBAA 2AK1H 2MNUA 3TJHC 3BMWA 4LFHG 4BSJA 1KLFA 3VRLF 4K94C 2OSLA 3QHZL 2VYRE 4NO5A 3R8BB 4JPIA 4Y4KA 3DO7A 2C3HA 5I75B 3MRQA 5EOCL 5DVKA 1KB5A 1CDGA 2ADJB 2DTSA 5FOJA 4D0DB 3KXFA 4JPVH 3WXWH 2HFFB 4K3HA 3CVHA 5MP6L 3CSYB 3MYJA 1P1ZA 3CSPA 2GJZA 4HDIB 4WI6A 2IMNA 5SWSA 3AXLB 1JJUA 5C71A 1K5NA 1EERB 3GI9L 2JJVA 3PUCA 4ZODA 1RQ5A 4OJFH 1QFWM 4I18C 3O2WH 3UZVB 3BWUC 5E6ZA 4U33A 3VRIA 2DIJA 4Z7VB 5IFAL 5IQ7L 5CZXC 4QGTA 5J06A 2X1QA 2V2XB 4L8BA 1YJDL 5DJ8B 4WJ5B 4X6FA 5HHPB 4G3YH 5BZDA 3IFNL 3IFPB 3KYKH 5C0RL 1OCWL 2CRZA 3P4MB 3IDMA 1V7ML 1VADA 4G5ZH 4MXWL 4POYA 5DD1L 1G7LA 4PRPD 1ZVYA 2E9WA 3VD3A 3LRHA 4OUOA 1IAOA 4PRDA 5CBEB 4ORGA 5FECB 2BSRA 1U8IB 4MLSA 2DMCA 3F6IA 3S3SA 1IT9H 4UILL 1MOEA 4HW6A 1QFPA 4C59B 2VZ3A 1NCAH 3C5SA 1TITA 3IDIB 4YUEH 4HUUB 2FX9H 3VXNA 1TVBA 5T3XD 4DGVL 1KIQB 3GJFA 4Z5RB 3D0VA 1N0LA 4JRYA 4KRPD 2NY6C 3MFGB 1LK3H 2CLZB 5CZVH 1A6WH 1CE6B 5I2IB 1I9IH 3OPZL 1TQCB 3KPQB 4MJ4A 5BV7L 1G7JA 4YNYB 3EZJB 5IK3B 4I18A 1A3LH 2FJHB 4L4TB 4TTGA 4I4WA 1YPZB 4OLUL 3OJDB 4ZFGL 1GPOL 4FQXD 5DJDB 1NFKA 1QA9B 5KJRH 2PTUA 4H8WH 4J3SA 5DZNA 1HQ4A 4JCMA 4EDWL 4N0UB 3Q6FB 1U8JB 1KB5L 3RWJA 3GBNH 3VGDA 2KL6A 5L6YL 3HAEH 3MA9L 1CR9L 3ZKMD 1GGIL 3FQUB 3TZVC 4MD4B 3ECBB 4U6XB 5CEZE 1U8MB 3CFBB 5J57B 4L8CB 4OF8A 5C0FA 4EN3A 3STZB 4JKPH 4OTXH 5FV2A 5DHYA 4N8VA 3GIZL 1M6OA 5MEQA 3DV6B 4Z95L 5E2WL 3MUJA 5DA4A 4M48H 1N3NB 1F02I 4PJDE 5ESVB 4OQTH 2WZPD 4NBZB 4OF3A 2OTUA 1O7VA 3SKJH 2ITCA 3FONA 2APFA 3QJFB 1GH7A 2X89D 4U1LA 1JF6A 3S96B 1MPAH 2QV2A 2JIXD 3PWUB 5BZWB 1JYXA 4PJAA 3ALXA 4BKLB 5HHXL 3QCVL 1CXKA 1OM3H 2ARJQ 2FJFA 1NCCH 3LN9A 5T3ZH 1CZ8H 3GO1L 5I8CA 4TUOA 2YK1L 3QUKA 5FUZL 2EO1A 3S35X 5JNYA 5H94B 2VLKD 5E4IA 4YBLC 4X80H 2OYPA 3ALPA 3RY6C 4AK1A 3NCCB 4GRMA 1FZOA 4Q97A 2IALB 4GRWB 3HE7D 1E6JH 3W9DA 3HKFA 3HE7C 1T89A 4YH6A 1UJ3B 1OTUC 2AK4E 1MFCH 3WIIL 2VB5A 1SYSA 1N6QH 2NY4B 4FABH 5EOQL 3IGAA 3MLTA 3P9MB 4ZTPH 1T1ZB 2HA1A 3PWNA 4QF1B 3TZVA 2DQDH 3TBYA 2BC4A 1FNHA 1OAYH 1SBSH 3BKML 1DLHB 4YZFE 1XIWC 4AM0A 5KAQF 4Y2DD 1OGAB 2W9LA 5ERWB 4FTVA 2QSVA 1A7RH 4KK9D 2P5WB 3AREA 4WFED 3CFJA 5H2BB 4BK5A 1MI5B 5C08A 3V5HB 3S7GA 1LO4H 1IC5H 1Z9LA 5TH2A 1YNTA 1V3MA 5J12B 5D1QB 1RUPL 2BNQB 3VFUA 2XXCB 3ME0A 4G8EA 2R1XB 2X4NA 2J6EA 3FO1A 4C4KT 1KELH 4U2YA 5DJYB 5A2KH 3L3HB 2EXYD 1XF2A 3H42L 5DJ0B 3Q0HA 1NFDA 1N6VA 2PKDA 1KC5H 4JQIL 4UNTA 3RU8H 1Q72H 3MX0A 4Q6IA 4RAUA 3MOBH 1YYLL 5JHLH 5I6XB 1HHIA 4GLRI 3H9SA 2UZIH 1VEOA 1T2QL 4XGZB 5GRJH 1K6QL 1WIUA 4HXAL 3QULB 2KZ1B 3F8UB 4F7PA 8FABB 4D3CL 4Z0BH 3V6OC 1AFVL 2X7LB 1XGTB 1VFAA 2Q76A 3CDCA 4ZUSB 4BQBA 1KUMA 4BZYA 1IKFH 1UXSB 1J11A 3AU1B 3TNMA 1X7QB 1RUAL 4X7TA 5KVGH 3NZHL 1QLRA 5I1GH 3STLA 1D5IH 2A6KA 3CJJA 1GGYA 1A6VL 3EYFA 3GMOA 1XIWA 1CFSA 2DQIL 4NQCD 1RZJC 2VZVA 4NYLB 3BZFA 4N8CL 4ETYA 4P9HC 1KJ2B 3RHWF 5IGXH 5HHVL 3C8HA 5CAYB 1HN1A 2MKLC 3DUHA 4X98A 3L3JA 3U7AA 4QRRA 1E4KC 1UC6A 4FXKA 3O6FD 1K3ZA 4JANB 3O6FC 3MRPA 4K3GA 1J5OH 2P1YA 3C6SB 2IANA 4N0FA 3GMNA 5INCB 3ZKND 2FX8H 3HE6D 1I85A 3KYOA 4E9LA 3D85A 3GSXA 1T2JA 1CGSH 3WIHL 1J8HE 4NN7C 4PGJA 1LDSA 3VH8A 1OP9A 1HNGA 3GMMB 4EUPA 1P84J 4JO3H 2VXSH 2MCPL 3T4YA 1T0MA 2ICWA 4NSKA 1RZ8A 3BRGC 2VDPL 5E2UL 2VAAA 5T1KA 5IMLB 1CFVL 3MUZ1 5LAXB 3ELAT 4GKZA 4HBCL 5EO0B 4L8SB 1XZ0A 4ZOCA 4MCZA 4X7CC 4X6EB 4PS4H 4X99A 4YK4C 1Z9OA 4P48A 3PV6A 5HGHA 5T5FL 2HT4D 3V4UH 2J6EL 3BX7C 3REWA 2F54E 2LQRA 4Q9RH 1JTTA 4BH8B 3BZ4B 1CD1B 4K71B 5GJTL 5JXAL 3QDJB 3BWAB 5L9DL 4WFGD 3SQBA 3T2NH 3U46A 3WFZA 1MCWM 5DDHB 5AWNH 1BM3L 4HMCA 4GAYB 5CJOL 2QSCH 3W82A 2GAZB 4NQDD 3IJSB 5EBWB 3RNQA 4Y2OA 5JR1L 1RMFH 4ERSH 3RVTD 1E4KA 2E7BA 3DX7A 4LSPH 4RX4D 3IAQA 7FABH 3RPIB 3U7YL 4W6WB 2GUOB 3KJ6H 4ODVH 1BZ9B 5JXEA 2PYEE 2BOCB 4Y4HA 5FEBA 4A6YB 4S1RH 4XRCB 2A9NH 4MJ6B 2H2PC 4DZ8B 1VFMA 1A3RH 3QEHA 4EQ2A 2XTJB 3LEXB 5IROC 3TBVA 5CCKH 1FYTD 3W81A 4X4ME 1FZJA 2NR6C 4DUXA 5DVMA 4XMKH 3LD8C 4LCUB 5I1DB 1I7ZA 1IGTA 4WEBH 2VLJB 1JRHI 3AY4C 2WANA 4JDTH 1MFDH 3SGEH 4LSQL 5I17B 2X40A 4B5EA 4WUUD 3B5GA 3HNVL 5EU6D 4NUGL 1KTDB 4RFEB 2YPKA 5DRXB 5ACZA 3UJJH 2ZG2A 1A6TA 4RMUA 4PRIA 4FN0A 3ULUE 5CEXA 1BIHA 1MCLA 3DMMC 3CX5K 3ROLB 5DZOA 3RVVC 4FNLH 2UYLB 5I18H 1N0XL 5DC0A 1TZGL 2UVFA 4LSDA 3TGXA 4ZPVA 4OQ1A 2X41A 1CTOA 3V5DA 4LIQL 4K3JL 4MX7B 4QXTA 2WUCL 3INUH 1WSST 3MLRL 3VFGH 4KVCH 5IG7B 5HHQB 4IIQB 4S0TD 5DFVD 1JTOA 1NJ9B 2AAVA 4LMQI 4HG4K 5F3HB 2DBLH 5GGRY 1HHKA 1PY9A 1IAKB 4D0CA 2AJ3A 4DKFL 1D5ZA 2HLAB 2WIMA 2DM4A 4DQOL 2CLRA 2GSIB 1JV5A 3OKOA 4MVBC 1ITBB 4KMTL 4XCFH 2BMKB 1F8TL 4UT7L 3UXFA 5IROA 1DDHA 3DARA 1P2CA 1I3RA 5GS0H 1KYOJ 4KDVA 4MD5A 3QIUD 3WNOA 1CF8H 1F11B 4R2GD 3S36H 2BVPB 4R2GC 4UB0L 3P9WB 3SKMB 4P9HL 5IM7A 4LSRH 4I3RH 1ZSDB 3D3VE 3OGCB 3RFZC 5C0IA 1UWEH 1XGRA 1DTUA 3MA7A 2DLFL 1J8KA 3LMJH 1CGYA 4R9HA 2XZZA 2DDQH 5C0BE 3TBWA 1RK0B 3RWHB 3ZHDA 1YA5A 1QP1A 1K3IA 1K4DB 2R29L 4XWGL 5I1JL 2CD0A 4V1DE 4M1DH 3UTSB 4GG6E 1JTPA 5D6CB 5I75C 2Y6SC 4UMGA 4D8PB 1MHPL 3DMMA 4M5ZH 4S1SH 3HI6H 1J87A 3B3IA 4RMSA 4LGSB 1I8IA 3L3IB 4LQ1A 4GG6F 4ACPA 3W11D 5HDQL 4OCSL 2D9QB 3UYOD 3ARQA 1ACZA 4RAVA 1BJ8A 5ID1B 3G04B 3OKEB 5LGJA 2E7LC 3BT2H 4NQEE 5DUML 3QYCA 1DN0B 3QDGE 3GSUB 1K8IA 3BQUC 1C1EH 2GSGB 3FO2B 5L2KE 2YSSA 2EYRB 4LPWA 2FYYB 4LVNB 2GHWB 4IDJH 4YXHL 4U6TA 1AXSA 4P4RA 3QNYA 2FECL 4POZC 4AEHL 2E6PA 1BBDL 1EMTL 4P4KB 1KSRA 4FP8H 4HWBA 3DRQA 1H8OA 2D7OA 5CHNA 1HHJB 3MRNA 5HI3C 3MNZB 1JWSA 4C56B 3CFCL 3H7BA 3L7EA 1E28B 4PY7A 4HUNB 5I19H 2J5LB 5B21A 1HQRA 1S9YB 1DEDA 4NDMB 1I8KA 3W0WB 3FO9A 4R90L 5DT1H 3V9FA 2HRPL 3S4SG 3IDGB 3S8WA 3FQTA 2YC1B 4QCIB 5MENA 1TZHA 2DIAA 3QHZH 3VFVB 3WHE1 5L8LB 4ELKB 1GGBL 3WIFB 5HYJE 1BZ7A 4QTHA 4JFDA 5EOCH 3VG9B 4UUJA 3T3PE 4JDZA 1JNHA 2Q86A 4HQQL 2A0LC 3LKNB 3GNML 5MP6H 2RQ8A 4L4TD 4XNMA 3VXUE 4ODHL 4FFWD 1BBJB 1P5VA 3GI9H 1AP2A 2OK0L 1D6EB 2OM5A 4HKBA 5IFAH 5J13B 2ED8A 5IQ7H 1T4KA 5DVNA 3THML 2EIZB 4OB5L 1YJDH 4JY6B 1NMCC 4Z0XB 5E00A 3IFNH 5MHSD 4XP9L 4P5TC 1HXMB 2NY7L 4CNIB 1L4IA 3ULSB 5C0RH 1OCWH 3JZ7A 4C55A 3IAGC 3HHRB 5I74B 2P47B 3QFJE 1V7MH 2N1KA 1FFQA 4MXWH 3SDDC 2DQFB 5DD1H 1NUDA 5F21B 4TSCL 5TE7L 3O0RL 1S9WB 3RI5F 3FCTA 1FL3B 1NLBL 3B43A 2H8PB 2YD2A 2G5BB 4DEPC 2FL5A 2W0KA 2A6JA 2A83B 7CGTA 5E99L 4UILH 5DRNB 2Y5EA 1ZGLB 2QKIB 1VKXA 5ISZB 5IV2B 1W8OA 1YQ2A 2F8OA 3U30B 3MV8B 1UB5B 5EU3A 2ZPKL 5JORA 4DGVH 4HWBL 4XZUB 4HKXA 2R0LL 4CGTA 3P73A 1MHHA 4XCYB 3NPSB 4X9FA 3OPZH 4OT1H 2AV1B 2LFGA 4HUXA 1FORL 3RZCA 5BV7H 1AGFA 5F7LB 2KPNA 1A14L 4BZ1L 4OLUH 4ZFGH 1GPOH 4NZTL 5E9DE 5C0CE 5DJXB 4YJZL 4M6OL 4JB9L 2Z4QA 4G43B 1O7SA 4YIQA 5DHVB 2NY4D 3QO0A 3O3DB 1ED3B 2NY4C 2YD4A 3FAWA 4EDWH 2WQ8A 3EYVA 5HYSA 2APTA 3NCJL 1KB5H 2PO6B 2GTWB 5ANME 5JQ6L 2X05A 1I9JL 1X44A 4X83A 5HYIA 1CGWA 5L6YH 1OGAD 3SDDA 3CVHH 2NXYB 4ZSOB 1CR9H 4DKAA 3WNKA 1GGIH 2P5WD 3KPMB 2IH1A 2XY1A 5DHXB 1DQJA 3LH2L 3VGAB 1MI5D 2RGSA 4GMTL 3P40A 5JDSA 3DX6B 5IVOA 5EC2A 5D1QD 1T20A 5J12C 4UDUA 2BNQD 3ZTNL 4H25A 3GIZH 3FB7A 1YN7B 1HYSD 43CAA 3G5ZA 2VZOA 4Z95H 5E2WH 5C0GB 1ZHLA 4JR9L 3OR6B 5DRWA 3S35L 5AUMB 3GUTB 3B2UD 2XFXA 1MVUB 4AENA 4U6YB 5KTEH 4F7MB 3D2UB 4PJIE 1F4AA 4FQHA 4G8GA 5I6XC 1V7NL 2V7NA 5HHXH 3QCVH 4OZGB 2XWBB 4HLZG 3SBWC 5AYQA 3GO1H 3GSWB 2YK1H 4GG8A 5JOFA 4PJIF 1SBBA 5FUZH 1D5XA 2DICA 4O51A 1CFTB 1LEGA 4XC1L 4HIIA 4L3EB 4NKDB 2VLME 3O9WA 5IVNA 2W0FB 1DL7L 1MCFA 2KH2B 3VU2A 2B2XL 2VR9A 3Q5OA 3I50L 2R2BB 1INQB 4M9OA 4YR6B 4JY5H 4PY8J 3GJFH 5TGBA 2R0WL 1CDBA 3WIIH 3QUYC 5E5MB 5EOQH 4F33A 1KLUA 1FAIL 3VXPB 3IT8D 4PJFE 3BP4B 1EHLL 4UINL 3BKMH 1EEQA 4U1KA 3BE1L 3D18A 4HWNA 1FG9C 4I0CC 2MWCA 4PJFF 4JVUA 3BGMB 4Y4FB 3QA3B 2V5YA 4NO0A 1U2CA 1T0PB 3FMGL 5KN5A 4F3FA 1L6XA 1RUPH 1AGCA 3ORJA 5DD3L 4NO3B 2JCCB 4HF5L 5GISL 4Z77A 4X8JA 1CFQA 5C70A 3MR9B 1H8NA 1RK1A 1XR8B 3P4NB 4XVTL 5EN2B 3TM6A 1YYLH 32C2A 4L8SC 1P7QB 2XRAL 1T2QH 5C6PB 1JYWA 5C3LD 1K6QH 4I48A 4HXAH 5L0QB 4LLVA 5L2JB 1S7VB 4KY1L 4LKCB 5EBGA 3P11L 5EZLA 2P8MA 3QDJD 4K71C 2ZUXA 4D3CH 1R3LA 3F12B 4PJEE 1AFVH 3V6FB 3MGOB 4PJ7E 4MAYB 3LZFL 3P4OB 1LILA 3GKZA 4JFOA 3GSNB 5AZEL 1GYAA 4HT1L 2AK4A 4ZNCD 3KWWA 4PJEF 3PQYB 3MGTA 2HJFA 5KVMC 4X6BA 1RUAH 4PJ7F 3NFPA 3NZHH 2NLJB 3EGSA 1XH3A 3L5WA 4JDVB 1A6VH 1TVHB 2DQIH 3UP1A 5TDNA 3SCMA 5I66A 3AC0A 4N8CH 3RVXD 3RVXC 4EXPX 5EUKB 2ADFL 5K9QG 4HUVB 4LNRA 2IFGA 1UM6H 2FO4B 5HHVH 4HIEB 5EFIA 4GBXA 3PWLA 3U4BL 3MCLL 2ZG1A 1FYTE 5EPMA 1U3HB 1R5WA 4OZFH 2XTJD 4KKCD 2I9LA 1BGXL 4KKCC 1DP0A 5EA0L 3TFKD 5J11B 3TFKC 1EX0A 1X4ZA 3OR7A 1HIML 2VLJD 2FGWL 3U4AA 2ICCA 2JK5A 2MCPH 2VQ1B 3L5XL 3OHXB 3TN0B 3SKOA 5CEZL 5EIQA 4P2QE 4OFVA 4F2MB 2VDPH 3SPVB 5E2UH 2HH0L 1VGKA 3BO8A 1I7UA 1CFVH 5ITFA 3LEVL 1ITCA 1DSFH 1MJJA 4HBCH 4PJCE 1X5IA 2V7HA 1OQOA 4FOMA 4BUHA 5D7LE 35C8L 5T5FH 2J6EH 4LPUA 3SJVB 3ILPB 5K9QI 5JXAH 5GJTH 1QRKA 4NHUA 5L9DH 3T0EB 4PJCF 4Y1AE 5LXGL 5IB3B 3GSRB 5KSUB 1CIUA 2HKFL 1PQZA 3RWGB 1BM3H 1KPRA 3O6KL 5CJOH 2LVEA 4N0YL 2X4TA 2ZCLL 4IIQC 4O4YL 3RWIA 4NCC1 1LK2A 4ONHA 3CC5A 5C07E 1G6RA 2OBGA 5CSBA 5E6IB 1H3XA 5JR1H 4RZCB 3V95A 1KJMB 3LB6D 3LB6C 1JNNL 4NOBA 3HLAA 5MEOA 1E4XL 4PD4J 1NEZG 1PJ9A 3U7YH 3I02B 3DX8B 4U1MA 3SE4A 2P49B 3HZMB 4LLWA 2DWEB 1RZKL 3ARXA 1Y0LA 3G6AA 1NCTA 3P77A 2EH7L 1JFQL 1REIA 2FHBA 5JW5A 2ZOLA 3I6GB 3TT3L 1J8HA 1AGBB 4MZ3A 3EJJX 4XP6L 4NRXA 4OKDA 3CD4A 3MV11 3NGBC 1XFPA 3DUUB 4K07A 5EO1B 5A2FA 1T1YB 2JKXA 4PRNA 4YDVB 5FYJE 3LV3B 4LSQH 4B7LA 1AXIB 3A6CL 3MJ7B 3UTSD 3HNVH 2APBA 4NUGH 4BSWA 3WNPA 4OZIE 3SDYL 2C5DC 1IM3B 1XGPB 3U9UB 3I75A 3E8UL 5GS3A 3CFDB 2Q1EA 4FFVC 3MCG1 5HHOB 3OKNA 5IMOB 3X11A 2F54A 4OI9A 3SGEI 4O5LL 5JW4N 1TDQA 4U31A 4W4OC 4JPWL 4I3SL 3T77A 3FT2A 1JWMB 3ULUC 4EUPH 2Z92B 4HG4J 5DJCB 1N0XH 1TZGH 3GHBL 4S1DC 1S7XB 3L5IA 4F7EA 3IDJB 4OI8A 1B0RA 5J7CC 3BP7A 5IJVA 4LIQH 4K3JH 2X42A 3QWOB 1UENA 2WUCH 1BFTA 4NQTA 5EBMB 3MLRH 3U2SA 2BOBB 3AMKA 4J3VA 3WKNA 5KSBE 3LVEA 3VFOB 1NKRA 5LGHL 5J9PA 4WFHE 3QQ3B 4DKFH 2J8HA 4PJ9A 3VFNA 4PJ5B 4DQOH 3U7WL 4NFDA 2X10A 3KPPB 1FP5A 5KSBF 2PYEA 4KMTH 1BQHB 4XCEA 5FHAL 4P4KD 5FO7B 4ZDHA 1IGML 2W38A 1F8TH 2IPKB 4X7EC 4XNYL 4UT7H 4HPOL 1Z9MA 5D71L 5FHBL 4EVNA 4HIHA 1J0ZA 4C56D 2G75A 1QR1B 2XNAA 4UB0H 3PHSA 4X4MA 3LY6A 4P9HH 5HPMB 3VXMA 3GIVB 2VLLA 4YEFA 5IB4B 1U95B 5DEFB 2DQHL 3W0WD 3OKDA 1NC2A 2DLFH 3B5HA 4LRNL 3EDFA 4WWKA 1QFOA 5ITBL 4GXUN 2V2TA 5IEHB 1A21A 4HGKC 4DTGH 4MA8L 3QSKB 2R29H 4XWGH 5I1JH 4N1EA 3T0DA 5C1MB 3B9EA 3WUZA 3DSFL 1MHPH 1RUML 3GK8L 4X9GA 4L4TE 1G7QB 3V0WL 1F4WL 4JJ5B 1LP9E 2ZSVB 2ICEA 1HHGB 1LHZA 1IGIL 2ZNWA 2XIDA 4YHLL 3F5WA 5HDQH 2FCBA 4OCSH 1I75A 2HJLB 1LP9F 3UYPA 1NBQA 4FMKA 3V7MA 3H0TA 1I4FA 3UJTL 4EJ1C 3MOQA 4TNVK 3QWQB 1GZQA 2QSTA 3K2MC 2DMBA 1IMHC 4G8IA 5HHME 4LBEB 5DUBA 5LGKA 2CLVA 5B8CB 4TVPE 3PHOA 2FGZA 2OR9L 4EXKA 4YXHH 5HVHB 3I85A 3Q6GL 2H26A 3RWCB 4JKMA 5I74C 4OF6A 4AEHH 1LE9B 2YS4A 4FHBD 1BBDH 4R0LB 1EMTH 2V5SA 1XGQB 4PGCA 5HHNB 4NN5C 4K3DL 1FZMA 1ZHKA 4GXVL 3MJ6A 4MNHA 3CFCH 3VFMB 3DIFA 5IW1A 4XHJC 1UVQB 4OUUB 1SJEB 3ZYOA 5FGSA 5EUOB 5C0BA 5ISZD 4R90H 3C6LB 3WL9B 3MV8D 1H3UA 1U58A 2HRPH 3RKDC 3U30C 4PJBE 4V1DA 2BRRL 4GG6A 4UIMB 4MDJA 3V5KA 1T5WB 1GGBH 2CXKA 4JLRA 4YHIB 1X5KA 3NPSC 4IMLB 2YUWA 4PJBF 4ODWA 4HQQH 4U4BA 4KQ4L 3GNMH 4W4NA 4JFPB 1MCHA 1MHCA 4L3CA 4ODHH 5SWQB 1FNLA 4UAOB 4NQEA 1F6LL 2OK0H 4OD2B 3QDGA 3OTTA 3ARDB 4PV8B 1BEYL 3PXJA 1CFNA 4OFKA 4U1NB 2PO6D 4P23C 2QQNL 5C86A 4OB5H 3OKKA 1J1OL 2B4CL 3OGOE 4JRXB 2NXYD 4L9DA 2BVUA 1DE4B 3ARSA 3IJHB 4XVJL 4XP9H 1T21A 3L3GA 2NY7H 1LE5A 1HWHB 3PNWA 1AIFA 2WWKT 4NPYA 5E1AA 1BD2E 1TZIB 3GSVA 4TSCH 1H3WM 1R3IH 2R0ZL 5TE7H 3O0RH 5ESAA 1CT8A 1NLBH 3IRPX 4HH9B 5F7DB 4Z76A 3VE0A 3BZEA 1BPVA 3D39E 1UXWA 3C8KA 3JTSA 4LCWE 1U8QA 5E99H 1HCVA 3DNKA 3SKNB 2FLBT 3MACL 3D2UD