2VEXA

Crystal strucutre of protein tyrosine phosphatase 1b in complex with an isothiazolidinone-containing inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
297
structure length
297
Chain Sequence
MEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isothiazolidinone Inhibitors of Ptp1B Containing Imidazoles and Imidazolines
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE 1
total genus 100
structure length 297
sequence length 297
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2vexA00
2VEYA 1SUGA 2HC1A 5K9VA 2BZLA 2JJDA 2NZ6A 5KA1A 3B7OA 1QXKA 2OOQA 3QCBA 2I4HA 2HNPA 3QKPA 1EEOA 2NV5A 2HY3A 3ZMPA 1YPTA 4HJQA 3O3LA 1ECVA 2BGDA 2P4DA 2PQ5A 1PTTA 2F71A 4NWGA 5KA0A 3CWEA 3I36A 4QAHA 5KA2A 1LARA 3EAXA 2A3KA 2I1YA 3U96A 4IKCA 4GRYA 3RGQA 3QCIA 2QDPA 4WOHA 1ONZA 1YGUA 2GJTA 1X24A 3I80A 2QBPA 3EMUA 4HRFA 3MMJA 5MMZB 2J17A 3I7ZA 4GE2A 2VEUA 1OEUA 3F9AA 1WRMA 3F99A 4DGPA 1PH0A 3O4SA 4I8NA 2HVLA 2BIJA 1Q6JA 2HNQA 1LQFA 2BV5A 1G1HA 1NWLA 3EU0A 3GXHA 1OEOX 2CMCA 2ESBA 4H34A 1GFYA 3F41A 1U25A 2B3OA 2F6YA 2I6IA 3V0DA 4GFVA 2Q05A 4RHGA 1ZC0A 2QBSA 3O4UA 3ZV2A 1I57A 1Q6TA 2F6VA 3CM3A 4R0SA 2YDUA 3RZ2A 3QCGA 1PTUA 2M3VA 3AWGA 1FPZA 2R0BA 4Y14A 3NMEA 2CNIA 1PYNA 2IMGA 2CMAA 1WAXA 2PSZA 4QAPA 4R30A 1C86A 1U26A 4BJOA 1XXPA 2P6XA 3PS5A 3EZZA 1NO6A 2HXPA 3D9CA 5I6VA 3M4UA 4RKKA 2I4GA 2B4PA 2NTAA 3V0EA 3A5KA 1YZ4A 3QCCA 2J16B 3D1HA 3ZM2A 2ZN7A 5K9WA 2HC2A 2CJZA 3ZMQA 1VHRA 3QCJA 1L8KA 2PA5A 1U24A 1YFOA 4OHHA 1XM2A 3A5JA 4GWFA 4H1OA 3V0JA 1G4US 4RI5A 2SHPA 1C84A 5K22A 2OZ5A 2F6WA 5IBSA 1PTYA 4BPCA 1XXVA 4PYHA 3BLTA 1C85A 1OETA 1Q6NA 2CM2A 2QDMA 1R6HA 4MBBA 2WGPA 4D3QA 4NWFA 1JLNA 2FH7A 1L8GA 2H04A 3S3HA 1JF7A 4JNBA 1Q6SA 1Q6PA 4JMJA 1OEMX 4YR8B 2CNGA 4OHEA 1YTWA 2QDCA 4YAAA 4NX8A 3ZM1A 1XBOA 3QCKA 5KADA 4RI4A 4R0TA 4GE5A 1OHEA 2CNHA 4GFUA 2F6ZA 1M3GA 4QBWA 2RF6A 1YTSA 2B07A 1YGRA 4OHIA 3QCDA 2NT7A 4J51A 3QCNA 2QEPA 3V0HA 3N0AA 3AWFA 2QCJA 4JMKA 3ZM3A 4OHDA 5K23A 4KI9A 3EB1A 5EHPA 2VEWA 2I5XA 4QUMA 2BGEA 2FJMA 2I4EA 1I9SA 2B4OA 3MOWA 1T49A 5BZXA 4ERCA 2H02A 1C88A 4WU3A 1V3AA 4KYQA 5EHRA 1I9TA 2NT2A 2B49A 2VEVA 1KAKA 2A8BA 1EENA 5KABA 1OEVA 1G1GA 1NWEA 1NZ7A 1YWFA 1OESA 1OHCA 2NLKA 1PTVA 4ZRTA 2C7SA 2Y2FA 5AWXA 3D1QA 5BUGA 2I3RA 2CFVA 5M43A 3QKQA 3D44A 2GP0A 3BLUA 3F9BA 1G7GA 5KA4A 2I42A 1XRIA 1ZCKA 2PI7A 2CM8A 4NYHA 3V0FA 2CNFA 3S4EA 1G7FA 3LJ8A 2I6JA 5KAAA 3QCLA 4DGXA 2QBQA 2I3UA 3SR9A 1GWZA 1T4JA 4RDDA 4QUNA 5KA7A 3BRHA 2F70A 4ZN5A 3OLRA 4GE6A 5IBMA 1YN9A 4JBCA 3D1OA 3S3EA 2AHSA 1QZ0A 1C87A 3S3KA 1C83A 2VEXA 4PVGA 2FJNA 2I75A 1RPMA 2C46A 1NNYA 3D42A 5BZZA 2H4GA 3V0GA 5KA3A 3S3FA 4QBEA 1Q1MA 2CM3A 3BM8A 3QCFA 1WCHA 1ZCLA 2GWOA 5BX1A 1D5RA 3ZM0A 2F6TA 4AZ1A 1MKPA 1FQ1A 2B4UA 3H2XA 1BZCA 4GS0A 5J8RA 2CM7A 2H4KA 1Q6MA 5GTJA 1PXHA 5LXQB 2HCMA 2B4SA 1G1FA 1RXDA 3V0IA 1BZHA 4NNDA 1FPRA 4GRZA 2QBRA 1YTNA 4WU2A 4ZI4A 5K24A 3MOZA 4D3PA 4TVVA 5KA8A 3QCMA 4Y2EA 3OMHA 2J16A 1NL9A 2CMBA 3S4OA 4S0GA 5HDEA 4D3RA 2Y96A 1OHDA 4RH9A 4RH5A 2OUDA 1KAVA 2DXPA 4HJPA 1AAXA 4Z6BA 2F46A 4WTYA 1J4XA 2MBCA 2H03A 1ONYA 3F81A 2AZRA 2G6ZA 2Q47A 1A5YA 2H4VA 1P15A 2PBNA 4KYRA 3RGOA 1T48A 2CNEA 2QCTA 3O4TA 4OHLA 3SMEA 4ICZA 2I6PA 3QCHA 2OC3A 2ZMMA 5K25A 2I6MA 5KACA 1ZZWA 2E0TA 1PA9A 1PA1A 3AWEA 2I6OA 3QCEA 3RO1A 2PT0A 2G59A 5KA9A 2HB1A 1LYVA 3GXGA 1BZJA 2F6FA 1G4WR 4B04A 3O5XA
chains in the Genus database with same CATH superfamily
2VEYA 1SUGA 2HC1A 5K9VA 2BZLA 2JJDA 2NZ6A 2UUOA 5KA1A 3B7OA 1QXKA 2OOQA 3QCBA 2JFGA 2I4HA 2HNPA 3QKPA 1EEOA 2NV5A 2HY3A 2VTEA 3ZMPA 1YPTA 4HJQA 1P3DA 3O3LA 1ECVA 2BGDA 2UAGA 2P4DA 2PQ5A 1PTTA 2F71A 2F00A 4NWGA 5KA0A 3N2AA 3QCZA 3CWEA 3I36A 4QAHA 5KA2A 1W78A 1LARA 3EAXA 2A3KA 2I1YA 3U96A 4IKCA 4GRYA 3RGQA 3QCIA 2QDPA 4WOHA 1ONZA 1YGUA 2GJTA 1X24A 3I80A 2QBPA 3EMUA 4HRFA 3MMJA 4BUCA 5MMZB 2J17A 3I7ZA 4GE2A 2VEUA 1P31A 1OEUA 3F9AA 1WRMA 3F99A 4DGPA 1PH0A 3MVNA 3O4SA 4I8NA 2HVLA 2BIJA 1Q6JA 2HNQA 1LQFA 2JFFA 2BV5A 1JBVA 1G1HA 2AM1A 1NWLA 3EU0A 3GXHA 1OEOX 2CMCA 2ESBA 4H34A 1GFYA 3F41A 1U25A 2B3OA 2F6YA 2I6IA 3V0DA 4GFVA 2Q05A 4RHGA 1ZC0A 2QBSA 3O4UA 3ZV2A 1I57A 1Q6TA 2F6VA 3CM3A 4R0SA 2YDUA 3RZ2A 3QCGA 3PYZA 1PTUA 2M3VA 3AWGA 3HN7A 1FPZA 2R0BA 4Y14A 3NMEA 2CNIA 1PYNA 2GCBA 2IMGA 2CMAA 1WAXA 2PSZA 4QAPA 4R30A 1C86A 1U26A 4BJOA 1XXPA 2P6XA 3PS5A 3EZZA 1NO6A 2HXPA 2Y66A 3D9CA 5I6VA 2XJAA 3M4UA 4RKKA 2VORA 2I4GA 2B4PA 2NTAA 3V0EA 3A5KA 1YZ4A 3QCCA 2J16B 3D1HA 3ZM2A 2ZN7A 5K9WA 2HC2A 1GG4A 4C13A 2CJZA 3ZMQA 1VHRA 3QCJA 1L8KA 2PA5A 1U24A 1YFOA 4OHHA 1XM2A 3A5JA 4GWFA 4H1OA 1FGSA 3V0JA 1G4US 4RI5A 2UUPA 2SHPA 1C84A 5K22A 2OZ5A 2GC6A 2F6WA 5IBSA 4CVKA 1PTYA 2JFHA 4BPCA 1XXVA 2XPCA 4PYHA 3BLTA 1C85A 1OETA 1Q6NA 2CM2A 2QDMA 1R6HA 4MBBA 2WGPA 4D3QA 2Y1OA 4NWFA 1JLNA 2FH7A 1JBWA 1L8GA 2H04A 3S3HA 1JF7A 4JNBA 1Q6SA 1Q6PA 4JMJA 1OEMX 2WJPA 4YR8B 2CNGA 1J6UA 4OHEA 1W7KA 1YTWA 2QDCA 2GC5A 4YAAA 4NX8A 3ZM1A 1XBOA 3QCKA 5KADA 3ZM5A 4RI4A 4R0TA 4GE5A 1UAGA 1OHEA 2CNHA 4GFUA 2F6ZA 1M3GA 4QBWA 2RF6A 1YTSA 2B07A 1YGRA 4OHIA 3QCDA 2NT7A 4J51A 3QCNA 2QEPA 3V0HA 3N0AA 3AWFA 2QCJA 4JMKA 3ZM3A 4OHDA 5K23A 2Y67A 4KI9A 3EB1A 5EHPA 2VEWA 2I5XA 1E0DA 4QUMA 2BGEA 2FJMA 2I4EA 1I9SA 2B4OA 3MOWA 1T49A 5BZXA 4ERCA 2H02A 1C88A 4WU3A 1V3AA 4QF5A 3ZM6A 4KYQA 5EHRA 1I9TA 2NT2A 2B49A 2VEVA 4ZIYA 1KAKA 2A8BA 1EENA 5KABA 1OEVA 1E8CA 1G1GA 1GQQA 1NWEA 1NZ7A 1YWFA 1OESA 1OHCA 2NLKA 1PTVA 4ZRTA 2C7SA 2Y2FA 5AWXA 3D1QA 5BUGA 2I3RA 2CFVA 5M43A 3QKQA 3D44A 2GP0A 3BLUA 3F9BA 1G7GA 5KA4A 2I42A 1XRIA 1ZCKA 2PI7A 2CM8A 4NYHA 3V0FA 2CNFA 3S4EA 1G7FA 3LJ8A 2I6JA 4CVMA 5KAAA 3QCLA 4DGXA 2QBQA 2I3UA 3SR9A 1GWZA 1T4JA 4RDDA 4QUNA 5KA7A 3BRHA 2F70A 4ZN5A 3UAGA 3OLRA 4GE6A 5IBMA 1YN9A 4JBCA 3D1OA 3S3EA 2AHSA 1QZ0A 1C87A 3S3KA 1C83A 2VEXA 4PVGA 2FJNA 3LK7A 2I75A 1RPMA 2C46A 1NNYA 3D42A 5BZZA 5A5EA 2H4GA 3V0GA 5KA3A 1O5ZA 4QBEA 3S3FA 1Q1MA 5A5FA 2CM3A 3BM8A 3QCFA 1WCHA 2WTZA 2VTDA 1ZCLA 2GWOA 2AM2A 5BX1A 1D5RA 3ZM0A 3NRSA 2F6TA 4AZ1A 1MKPA 1FQ1A 2B4UA 4HV4A 2GCAA 3H2XA 4C12A 3ZL8A 1BZCA 4GS0A 5J8RA 4QDIA 2CM7A 2H4KA 1Q6MA 1EEHA 5GTJA 1PXHA 5LXQB 2HCMA 2B4SA 1G1FA 1GQYA 1RXDA 3V0IA 1BZHA 2Y68A 4NNDA 1FPRA 4GRZA 2QBRA 1YTNA 4WU2A 4ZI4A 5K24A 3MOZA 4D3PA 4TVVA 5KA8A 3QCMA 4Y2EA 3OMHA 2J16A 1NL9A 2CMBA 3S4OA 4S0GA 5HDEA 4D3RA 2Y96A 1OHDA 4RH9A 4RH5A 2OUDA 1KAVA 2DXPA 4HJPA 1AAXA 4BUBA 4Z6BA 2F46A 4WTYA 1J4XA 2MBCA 2H03A 1ONYA 3F81A 2AZRA 2G6ZA 2Q47A 1A5YA 4CVLA 2H4VA 1P15A 2PBNA 4KYRA 3RGOA 1T48A 2CNEA 2QCTA 3O4TA 4OHLA 3SMEA 4ICZA 2VOSA 2I6PA 3QCHA 4UAGA 2OC3A 2ZMMA 5K25A 2I6MA 5KACA 1ZZWA 2E0TA 1PA9A 1PA1A 3AWEA 2X5OA 2I6OA 3QCEA 3RO1A 2PT0A 2G59A 5KA9A 2HB1A 1LYVA 3GXGA 1BZJA 2F6FA 1G4WR 4B04A 3O5XA
chains in the Genus database with same CATH topology
2VEYA 1SUGA 2HC1A 5K9VA 2BZLA 2JJDA 2NZ6A 5KA1A 3B7OA 1QXKA 2OOQA 3QCBA 2I4HA 2HNPA 3QKPA 1EEOA 2NV5A 2HY3A 3ZMPA 1YPTA 4HJQA 3O3LA 1ECVA 2BGDA 2P4DA 2PQ5A 1PTTA 2F71A 4NWGA 5KA0A 3CWEA 3I36A 4QAHA 5KA2A 1LARA 3EAXA 2A3KA 2I1YA 3U96A 4IKCA 4GRYA 3RGQA 3QCIA 2QDPA 4WOHA 1ONZA 1YGUA 2GJTA 1X24A 3I80A 2QBPA 3EMUA 4HRFA 3MMJA 5MMZB 2J17A 3I7ZA 4GE2A 2VEUA 1OEUA 3F9AA 1WRMA 3F99A 4DGPA 1PH0A 3O4SA 4I8NA 2HVLA 2BIJA 1Q6JA 2HNQA 1LQFA 2BV5A 1G1HA 1NWLA 3EU0A 3GXHA 1OEOX 2CMCA 2ESBA 4H34A 1GFYA 3F41A 1U25A 2B3OA 2F6YA 2I6IA 3V0DA 4GFVA 2Q05A 4RHGA 1ZC0A 2QBSA 3O4UA 3ZV2A 1I57A 1Q6TA 2F6VA 3CM3A 4R0SA 2YDUA 3RZ2A 3QCGA 1PTUA 2M3VA 3AWGA 1FPZA 2R0BA 4Y14A 3NMEA 2CNIA 1PYNA 2IMGA 2CMAA 1WAXA 2PSZA 4QAPA 4R30A 1C86A 1U26A 4BJOA 1XXPA 2P6XA 3PS5A 3EZZA 1NO6A 2HXPA 3D9CA 5I6VA 3M4UA 4RKKA 2I4GA 2B4PA 2NTAA 3V0EA 3A5KA 1YZ4A 3QCCA 2J16B 3D1HA 3ZM2A 2ZN7A 5K9WA 2HC2A 2CJZA 3ZMQA 1VHRA 3QCJA 1L8KA 2PA5A 1U24A 1YFOA 4OHHA 1XM2A 3A5JA 4GWFA 4H1OA 3V0JA 1G4US 4RI5A 2SHPA 1C84A 5K22A 2OZ5A 2F6WA 5IBSA 1PTYA 4BPCA 1XXVA 4PYHA 3BLTA 1C85A 1OETA 1Q6NA 2CM2A 2QDMA 1R6HA 4MBBA 2WGPA 4D3QA 4NWFA 1JLNA 2FH7A 1L8GA 2H04A 3S3HA 1JF7A 4JNBA 1Q6SA 1Q6PA 4JMJA 1OEMX 4YR8B 2CNGA 4OHEA 1YTWA 2QDCA 4YAAA 4NX8A 3ZM1A 1XBOA 3QCKA 5KADA 4RI4A 4R0TA 4GE5A 1OHEA 2CNHA 4GFUA 2F6ZA 1M3GA 4QBWA 2RF6A 1YTSA 2B07A 1YGRA 4OHIA 3QCDA 2NT7A 4J51A 3QCNA 2QEPA 3V0HA 3N0AA 3AWFA 2QCJA 4JMKA 3ZM3A 4OHDA 5K23A 4KI9A 3EB1A 5EHPA 2VEWA 2I5XA 4QUMA 2BGEA 2FJMA 2I4EA 1I9SA 2B4OA 3MOWA 1T49A 5BZXA 4ERCA 2H02A 1C88A 4WU3A 1V3AA 4KYQA 5EHRA 1I9TA 2NT2A 2B49A 2VEVA 1KAKA 2A8BA 1EENA 5KABA 1OEVA 1G1GA 1NWEA 1NZ7A 1YWFA 1OESA 1OHCA 2NLKA 1PTVA 4ZRTA 2C7SA 2Y2FA 5AWXA 3D1QA 5BUGA 2I3RA 2CFVA 5M43A 3QKQA 3D44A 2GP0A 3BLUA 3F9BA 1G7GA 5KA4A 2I42A 1XRIA 1ZCKA 2PI7A 2CM8A 4NYHA 3V0FA 2CNFA 3S4EA 1G7FA 3LJ8A 2I6JA 5KAAA 3QCLA 4DGXA 2QBQA 2I3UA 3SR9A 1GWZA 1T4JA 4RDDA 4QUNA 5KA7A 3BRHA 2F70A 4ZN5A 3OLRA 4GE6A 5IBMA 1YN9A 4JBCA 3D1OA 3S3EA 2AHSA 1QZ0A 1C87A 3S3KA 1C83A 2VEXA 4PVGA 2FJNA 2I75A 1RPMA 2C46A 1NNYA 3D42A 5BZZA 2H4GA 3V0GA 5KA3A 3S3FA 4QBEA 1Q1MA 2CM3A 3BM8A 3QCFA 1WCHA 1ZCLA 2GWOA 5BX1A 1D5RA 3ZM0A 2F6TA 4AZ1A 1MKPA 1FQ1A 2B4UA 3H2XA 1BZCA 4GS0A 5J8RA 2CM7A 2H4KA 1Q6MA 5GTJA 1PXHA 5LXQB 2HCMA 2B4SA 1G1FA 1RXDA 3V0IA 1BZHA 4NNDA 1FPRA 4GRZA 2QBRA 1YTNA 4WU2A 4ZI4A 5K24A 3MOZA 4D3PA 4TVVA 5KA8A 3QCMA 4Y2EA 3OMHA 2J16A 1NL9A 2CMBA 3S4OA 4S0GA 5HDEA 4D3RA 2Y96A 1OHDA 4RH9A 4RH5A 2OUDA 1KAVA 2DXPA 4HJPA 1AAXA 4Z6BA 2F46A 4WTYA 1J4XA 2MBCA 2H03A 1ONYA 3F81A 2AZRA 2G6ZA 2Q47A 1A5YA 2H4VA 1P15A 2PBNA 4KYRA 3RGOA 1T48A 2CNEA 2QCTA 3O4TA 4OHLA 3SMEA 4ICZA 2I6PA 3QCHA 2OC3A 2ZMMA 5K25A 2I6MA 5KACA 1ZZWA 2E0TA 1PA9A 1PA1A 3AWEA 2I6OA 3QCEA 3RO1A 2PT0A 2G59A 5KA9A 2HB1A 1LYVA 3GXGA 1BZJA 2F6FA 1G4WR 4B04A 3O5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VEY A;  1SUG A;  2HC1 A;  5K9V A;  2BZL A;  2JJD A;  2NZ6 A;  5KA1 A;  3B7O A;  1QXK A;  2OOQ A;  3QCB A;  2I4H A;  2HNP A;  3QKP A;  1EEO A;  2NV5 A;  2HY3 A;  3ZMP A;  1YPT A;  4HJQ A;  3O3L A;  1ECV A;  2BGD A;  2P4D A;  2PQ5 A;  1PTT A;  2F71 A;  4NWG A;  5KA0 A;  3CWE A;  3I36 A;  4QAH A;  5KA2 A;  1LAR A;  3EAX A;  2A3K A;  2I1Y A;  3U96 A;  4IKC A;  4GRY A;  3RGQ A;  3QCI A;  2QDP A;  4WOH A;  1ONZ A;  1YGU A;  2GJT A;  1X24 A;  3I80 A;  2QBP A;  3EMU A;  4HRF A;  3MMJ A;  5MMZ B;  2J17 A;  3I7Z A;  4GE2 A;  2VEU A;  1OEU A;  3F9A A;  1WRM A;  3F99 A;  4DGP A;  1PH0 A;  3O4S A;  4I8N A;  2HVL A;  2BIJ A;  1Q6J A;  2HNQ A;  1LQF A;  2BV5 A;  1G1H A;  1NWL A;  3EU0 A;  3GXH A;  1OEO X;  2CMC A;  2ESB A;  4H34 A;  1GFY A;  3F41 A;  1U25 A;  2B3O A;  2F6Y A;  2I6I A;  3V0D A;  4GFV A;  2Q05 A;  4RHG A;  1ZC0 A;  2QBS A;  3O4U A;  3ZV2 A;  1I57 A;  1Q6T A;  2F6V A;  3CM3 A;  4R0S A;  2YDU A;  3RZ2 A;  3QCG A;  1PTU A;  2M3V A;  3AWG A;  1FPZ A;  2R0B A;  4Y14 A;  3NME A;  2CNI A;  1PYN A;  2IMG A;  2CMA A;  1WAX A;  2PSZ A;  4QAP A;  4R30 A;  1C86 A;  1U26 A;  4BJO A;  1XXP A;  2P6X A;  3PS5 A;  3EZZ A;  1NO6 A;  2HXP A;  3D9C A;  5I6V A;  3M4U A;  4RKK A;  2I4G A;  2B4P A;  2NTA A;  3V0E A;  3A5K A;  1YZ4 A;  3QCC A;  2J16 B;  3D1H A;  3ZM2 A;  2ZN7 A;  5K9W A;  2HC2 A;  2CJZ A;  3ZMQ A;  1VHR A;  3QCJ A;  1L8K A;  2PA5 A;  1U24 A;  1YFO A;  4OHH A;  1XM2 A;  3A5J A;  4GWF A;  4H1O A;  3V0J A;  1G4U S;  4RI5 A;  2SHP A;  1C84 A;  5K22 A;  2OZ5 A;  2F6W A;  5IBS A;  1PTY A;  4BPC A;  1XXV A;  4PYH A;  3BLT A;  1C85 A;  1OET A;  1Q6N A;  2CM2 A;  2QDM A;  1R6H A;  4MBB A;  2WGP A;  4D3Q A;  4NWF A;  1JLN A;  2FH7 A;  1L8G A;  2H04 A;  3S3H A;  1JF7 A;  4JNB A;  1Q6S A;  1Q6P A;  4JMJ A;  1OEM X;  4YR8 B;  2CNG A;  4OHE A;  1YTW A;  2QDC A;  4YAA A;  4NX8 A;  3ZM1 A;  1XBO A;  3QCK A;  5KAD A;  4RI4 A;  4R0T A;  4GE5 A;  1OHE A;  2CNH A;  4GFU A;  2F6Z A;  1M3G A;  4QBW A;  2RF6 A;  1YTS A;  2B07 A;  1YGR A;  4OHI A;  3QCD A;  2NT7 A;  4J51 A;  3QCN A;  2QEP A;  3V0H A;  3N0A A;  3AWF A;  2QCJ A;  4JMK A;  3ZM3 A;  4OHD A;  5K23 A;  4KI9 A;  3EB1 A;  5EHP A;  2VEW A;  2I5X A;  4QUM A;  2BGE A;  2FJM A;  2I4E A;  1I9S A;  2B4O A;  3MOW A;  1T49 A;  5BZX A;  4ERC A;  2H02 A;  1C88 A;  4WU3 A;  1V3A A;  4KYQ A;  5EHR A;  1I9T A;  2NT2 A;  2B49 A;  2VEV A;  1KAK A;  2A8B A;  1EEN A;  5KAB A;  1OEV A;  1G1G A;  1NWE A;  1NZ7 A;  1YWF A;  1OES A;  1OHC A;  2NLK A;  1PTV A;  4ZRT A;  2C7S A;  2Y2F A;  5AWX A;  3D1Q A;  5BUG A;  2I3R A;  2CFV A;  5M43 A;  3QKQ A;  3D44 A;  2GP0 A;  3BLU A;  3F9B A;  1G7G A;  5KA4 A;  2I42 A;  1XRI A;  1ZCK A;  2PI7 A;  2CM8 A;  4NYH A;  3V0F A;  2CNF A;  3S4E A;  1G7F A;  3LJ8 A;  2I6J A;  5KAA A;  3QCL A;  4DGX A;  2QBQ A;  2I3U A;  3SR9 A;  1GWZ A;  1T4J A;  4RDD A;  4QUN A;  5KA7 A;  3BRH A;  2F70 A;  4ZN5 A;  3OLR A;  4GE6 A;  5IBM A;  1YN9 A;  4JBC A;  3D1O A;  3S3E A;  2AHS A;  1QZ0 A;  1C87 A;  3S3K A;  1C83 A;  2VEX A;  4PVG A;  2FJN A;  2I75 A;  1RPM A;  2C46 A;  1NNY A;  3D42 A;  5BZZ A;  2H4G A;  3V0G A;  5KA3 A;  3S3F A;  4QBE A;  1Q1M A;  2CM3 A;  3BM8 A;  3QCF A;  1WCH A;  1ZCL A;  2GWO A;  5BX1 A;  1D5R A;  3ZM0 A;  2F6T A;  4AZ1 A;  1MKP A;  1FQ1 A;  2B4U A;  3H2X A;  1BZC A;  4GS0 A;  5J8R A;  2CM7 A;  2H4K A;  1Q6M A;  5GTJ A;  1PXH A;  5LXQ B;  2HCM A;  2B4S A;  1G1F A;  1RXD A;  3V0I A;  1BZH A;  4NND A;  1FPR A;  4GRZ A;  2QBR A;  1YTN A;  4WU2 A;  4ZI4 A;  5K24 A;  3MOZ A;  4D3P A;  4TVV A;  5KA8 A;  3QCM A;  4Y2E A;  3OMH A;  2J16 A;  1NL9 A;  2CMB A;  3S4O A;  4S0G A;  5HDE A;  4D3R A;  2Y96 A;  1OHD A;  4RH9 A;  4RH5 A;  2OUD A;  1KAV A;  2DXP A;  4HJP A;  1AAX A;  4Z6B A;  2F46 A;  4WTY A;  1J4X A;  2MBC A;  2H03 A;  1ONY A;  3F81 A;  2AZR A;  2G6Z A;  2Q47 A;  1A5Y A;  2H4V A;  1P15 A;  2PBN A;  4KYR A;  3RGO A;  1T48 A;  2CNE A;  2QCT A;  3O4T A;  4OHL A;  3SME A;  4ICZ A;  2I6P A;  3QCH A;  2OC3 A;  2ZMM A;  5K25 A;  2I6M A;  5KAC A;  1ZZW A;  2E0T A;  1PA9 A;  1PA1 A;  3AWE A;  2I6O A;  3QCE A;  3RO1 A;  2PT0 A;  2G59 A;  5KA9 A;  2HB1 A;  1LYV A;  3GXG A;  1BZJ A;  2F6F A;  1G4W R;  4B04 A;  3O5X A; 
#chains in the Genus database with same CATH topology
 2VEY A;  1SUG A;  2HC1 A;  5K9V A;  2BZL A;  2JJD A;  2NZ6 A;  2UUO A;  5KA1 A;  3B7O A;  1QXK A;  2OOQ A;  3QCB A;  2JFG A;  2I4H A;  2HNP A;  3QKP A;  1EEO A;  2NV5 A;  2HY3 A;  2VTE A;  3ZMP A;  1YPT A;  4HJQ A;  1P3D A;  3O3L A;  1ECV A;  2BGD A;  2UAG A;  2P4D A;  2PQ5 A;  1PTT A;  2F71 A;  2F00 A;  4NWG A;  5KA0 A;  3N2A A;  3QCZ A;  3CWE A;  3I36 A;  4QAH A;  5KA2 A;  1W78 A;  1LAR A;  3EAX A;  2A3K A;  2I1Y A;  3U96 A;  4IKC A;  4GRY A;  3RGQ A;  3QCI A;  2QDP A;  4WOH A;  1ONZ A;  1YGU A;  2GJT A;  1X24 A;  3I80 A;  2QBP A;  3EMU A;  4HRF A;  3MMJ A;  4BUC A;  5MMZ B;  2J17 A;  3I7Z A;  4GE2 A;  2VEU A;  1P31 A;  1OEU A;  3F9A A;  1WRM A;  3F99 A;  4DGP A;  1PH0 A;  3MVN A;  3O4S A;  4I8N A;  2HVL A;  2BIJ A;  1Q6J A;  2HNQ A;  1LQF A;  2JFF A;  2BV5 A;  1JBV A;  1G1H A;  2AM1 A;  1NWL A;  3EU0 A;  3GXH A;  1OEO X;  2CMC A;  2ESB A;  4H34 A;  1GFY A;  3F41 A;  1U25 A;  2B3O A;  2F6Y A;  2I6I A;  3V0D A;  4GFV A;  2Q05 A;  4RHG A;  1ZC0 A;  2QBS A;  3O4U A;  3ZV2 A;  1I57 A;  1Q6T A;  2F6V A;  3CM3 A;  4R0S A;  2YDU A;  3RZ2 A;  3QCG A;  3PYZ A;  1PTU A;  2M3V A;  3AWG A;  3HN7 A;  1FPZ A;  2R0B A;  4Y14 A;  3NME A;  2CNI A;  1PYN A;  2GCB A;  2IMG A;  2CMA A;  1WAX A;  2PSZ A;  4QAP A;  4R30 A;  1C86 A;  1U26 A;  4BJO A;  1XXP A;  2P6X A;  3PS5 A;  3EZZ A;  1NO6 A;  2HXP A;  2Y66 A;  3D9C A;  5I6V A;  2XJA A;  3M4U A;  4RKK A;  2VOR A;  2I4G A;  2B4P A;  2NTA A;  3V0E A;  3A5K A;  1YZ4 A;  3QCC A;  2J16 B;  3D1H A;  3ZM2 A;  2ZN7 A;  5K9W A;  2HC2 A;  1GG4 A;  4C13 A;  2CJZ A;  3ZMQ A;  1VHR A;  3QCJ A;  1L8K A;  2PA5 A;  1U24 A;  1YFO A;  4OHH A;  1XM2 A;  3A5J A;  4GWF A;  4H1O A;  1FGS A;  3V0J A;  1G4U S;  4RI5 A;  2UUP A;  2SHP A;  1C84 A;  5K22 A;  2OZ5 A;  2GC6 A;  2F6W A;  5IBS A;  4CVK A;  1PTY A;  2JFH A;  4BPC A;  1XXV A;  2XPC A;  4PYH A;  3BLT A;  1C85 A;  1OET A;  1Q6N A;  2CM2 A;  2QDM A;  1R6H A;  4MBB A;  2WGP A;  4D3Q A;  2Y1O A;  4NWF A;  1JLN A;  2FH7 A;  1JBW A;  1L8G A;  2H04 A;  3S3H A;  1JF7 A;  4JNB A;  1Q6S A;  1Q6P A;  4JMJ A;  1OEM X;  2WJP A;  4YR8 B;  2CNG A;  1J6U A;  4OHE A;  1W7K A;  1YTW A;  2QDC A;  2GC5 A;  4YAA A;  4NX8 A;  3ZM1 A;  1XBO A;  3QCK A;  5KAD A;  3ZM5 A;  4RI4 A;  4R0T A;  4GE5 A;  1UAG A;  1OHE A;  2CNH A;  4GFU A;  2F6Z A;  1M3G A;  4QBW A;  2RF6 A;  1YTS A;  2B07 A;  1YGR A;  4OHI A;  3QCD A;  2NT7 A;  4J51 A;  3QCN A;  2QEP A;  3V0H A;  3N0A A;  3AWF A;  2QCJ A;  4JMK A;  3ZM3 A;  4OHD A;  5K23 A;  2Y67 A;  4KI9 A;  3EB1 A;  5EHP A;  2VEW A;  2I5X A;  1E0D A;  4QUM A;  2BGE A;  2FJM A;  2I4E A;  1I9S A;  2B4O A;  3MOW A;  1T49 A;  5BZX A;  4ERC A;  2H02 A;  1C88 A;  4WU3 A;  1V3A A;  4QF5 A;  3ZM6 A;  4KYQ A;  5EHR A;  1I9T A;  2NT2 A;  2B49 A;  2VEV A;  4ZIY A;  1KAK A;  2A8B A;  1EEN A;  5KAB A;  1OEV A;  1E8C A;  1G1G A;  1GQQ A;  1NWE A;  1NZ7 A;  1YWF A;  1OES A;  1OHC A;  2NLK A;  1PTV A;  4ZRT A;  2C7S A;  2Y2F A;  5AWX A;  3D1Q A;  5BUG A;  2I3R A;  2CFV A;  5M43 A;  3QKQ A;  3D44 A;  2GP0 A;  3BLU A;  3F9B A;  1G7G A;  5KA4 A;  2I42 A;  1XRI A;  1ZCK A;  2PI7 A;  2CM8 A;  4NYH A;  3V0F A;  2CNF A;  3S4E A;  1G7F A;  3LJ8 A;  2I6J A;  4CVM A;  5KAA A;  3QCL A;  4DGX A;  2QBQ A;  2I3U A;  3SR9 A;  1GWZ A;  1T4J A;  4RDD A;  4QUN A;  5KA7 A;  3BRH A;  2F70 A;  4ZN5 A;  3UAG A;  3OLR A;  4GE6 A;  5IBM A;  1YN9 A;  4JBC A;  3D1O A;  3S3E A;  2AHS A;  1QZ0 A;  1C87 A;  3S3K A;  1C83 A;  2VEX A;  4PVG A;  2FJN A;  3LK7 A;  2I75 A;  1RPM A;  2C46 A;  1NNY A;  3D42 A;  5BZZ A;  5A5E A;  2H4G A;  3V0G A;  5KA3 A;  1O5Z A;  4QBE A;  3S3F A;  1Q1M A;  5A5F A;  2CM3 A;  3BM8 A;  3QCF A;  1WCH A;  2WTZ A;  2VTD A;  1ZCL A;  2GWO A;  2AM2 A;  5BX1 A;  1D5R A;  3ZM0 A;  3NRS A;  2F6T A;  4AZ1 A;  1MKP A;  1FQ1 A;  2B4U A;  4HV4 A;  2GCA A;  3H2X A;  4C12 A;  3ZL8 A;  1BZC A;  4GS0 A;  5J8R A;  4QDI A;  2CM7 A;  2H4K A;  1Q6M A;  1EEH A;  5GTJ A;  1PXH A;  5LXQ B;  2HCM A;  2B4S A;  1G1F A;  1GQY A;  1RXD A;  3V0I A;  1BZH A;  2Y68 A;  4NND A;  1FPR A;  4GRZ A;  2QBR A;  1YTN A;  4WU2 A;  4ZI4 A;  5K24 A;  3MOZ A;  4D3P A;  4TVV A;  5KA8 A;  3QCM A;  4Y2E A;  3OMH A;  2J16 A;  1NL9 A;  2CMB A;  3S4O A;  4S0G A;  5HDE A;  4D3R A;  2Y96 A;  1OHD A;  4RH9 A;  4RH5 A;  2OUD A;  1KAV A;  2DXP A;  4HJP A;  1AAX A;  4BUB A;  4Z6B A;  2F46 A;  4WTY A;  1J4X A;  2MBC A;  2H03 A;  1ONY A;  3F81 A;  2AZR A;  2G6Z A;  2Q47 A;  1A5Y A;  4CVL A;  2H4V A;  1P15 A;  2PBN A;  4KYR A;  3RGO A;  1T48 A;  2CNE A;  2QCT A;  3O4T A;  4OHL A;  3SME A;  4ICZ A;  2VOS A;  2I6P A;  3QCH A;  4UAG A;  2OC3 A;  2ZMM A;  5K25 A;  2I6M A;  5KAC A;  1ZZW A;  2E0T A;  1PA9 A;  1PA1 A;  3AWE A;  2X5O A;  2I6O A;  3QCE A;  3RO1 A;  2PT0 A;  2G59 A;  5KA9 A;  2HB1 A;  1LYV A;  3GXG A;  1BZJ A;  2F6F A;  1G4W R;  4B04 A;  3O5X A; 
#chains in the Genus database with same CATH homology
 2VEY A;  1SUG A;  2HC1 A;  5K9V A;  2BZL A;  2JJD A;  2NZ6 A;  5KA1 A;  3B7O A;  1QXK A;  2OOQ A;  3QCB A;  2I4H A;  2HNP A;  3QKP A;  1EEO A;  2NV5 A;  2HY3 A;  3ZMP A;  1YPT A;  4HJQ A;  3O3L A;  1ECV A;  2BGD A;  2P4D A;  2PQ5 A;  1PTT A;  2F71 A;  4NWG A;  5KA0 A;  3CWE A;  3I36 A;  4QAH A;  5KA2 A;  1LAR A;  3EAX A;  2A3K A;  2I1Y A;  3U96 A;  4IKC A;  4GRY A;  3RGQ A;  3QCI A;  2QDP A;  4WOH A;  1ONZ A;  1YGU A;  2GJT A;  1X24 A;  3I80 A;  2QBP A;  3EMU A;  4HRF A;  3MMJ A;  5MMZ B;  2J17 A;  3I7Z A;  4GE2 A;  2VEU A;  1OEU A;  3F9A A;  1WRM A;  3F99 A;  4DGP A;  1PH0 A;  3O4S A;  4I8N A;  2HVL A;  2BIJ A;  1Q6J A;  2HNQ A;  1LQF A;  2BV5 A;  1G1H A;  1NWL A;  3EU0 A;  3GXH A;  1OEO X;  2CMC A;  2ESB A;  4H34 A;  1GFY A;  3F41 A;  1U25 A;  2B3O A;  2F6Y A;  2I6I A;  3V0D A;  4GFV A;  2Q05 A;  4RHG A;  1ZC0 A;  2QBS A;  3O4U A;  3ZV2 A;  1I57 A;  1Q6T A;  2F6V A;  3CM3 A;  4R0S A;  2YDU A;  3RZ2 A;  3QCG A;  1PTU A;  2M3V A;  3AWG A;  1FPZ A;  2R0B A;  4Y14 A;  3NME A;  2CNI A;  1PYN A;  2IMG A;  2CMA A;  1WAX A;  2PSZ A;  4QAP A;  4R30 A;  1C86 A;  1U26 A;  4BJO A;  1XXP A;  2P6X A;  3PS5 A;  3EZZ A;  1NO6 A;  2HXP A;  3D9C A;  5I6V A;  3M4U A;  4RKK A;  2I4G A;  2B4P A;  2NTA A;  3V0E A;  3A5K A;  1YZ4 A;  3QCC A;  2J16 B;  3D1H A;  3ZM2 A;  2ZN7 A;  5K9W A;  2HC2 A;  2CJZ A;  3ZMQ A;  1VHR A;  3QCJ A;  1L8K A;  2PA5 A;  1U24 A;  1YFO A;  4OHH A;  1XM2 A;  3A5J A;  4GWF A;  4H1O A;  3V0J A;  1G4U S;  4RI5 A;  2SHP A;  1C84 A;  5K22 A;  2OZ5 A;  2F6W A;  5IBS A;  1PTY A;  4BPC A;  1XXV A;  4PYH A;  3BLT A;  1C85 A;  1OET A;  1Q6N A;  2CM2 A;  2QDM A;  1R6H A;  4MBB A;  2WGP A;  4D3Q A;  4NWF A;  1JLN A;  2FH7 A;  1L8G A;  2H04 A;  3S3H A;  1JF7 A;  4JNB A;  1Q6S A;  1Q6P A;  4JMJ A;  1OEM X;  4YR8 B;  2CNG A;  4OHE A;  1YTW A;  2QDC A;  4YAA A;  4NX8 A;  3ZM1 A;  1XBO A;  3QCK A;  5KAD A;  4RI4 A;  4R0T A;  4GE5 A;  1OHE A;  2CNH A;  4GFU A;  2F6Z A;  1M3G A;  4QBW A;  2RF6 A;  1YTS A;  2B07 A;  1YGR A;  4OHI A;  3QCD A;  2NT7 A;  4J51 A;  3QCN A;  2QEP A;  3V0H A;  3N0A A;  3AWF A;  2QCJ A;  4JMK A;  3ZM3 A;  4OHD A;  5K23 A;  4KI9 A;  3EB1 A;  5EHP A;  2VEW A;  2I5X A;  4QUM A;  2BGE A;  2FJM A;  2I4E A;  1I9S A;  2B4O A;  3MOW A;  1T49 A;  5BZX A;  4ERC A;  2H02 A;  1C88 A;  4WU3 A;  1V3A A;  4KYQ A;  5EHR A;  1I9T A;  2NT2 A;  2B49 A;  2VEV A;  1KAK A;  2A8B A;  1EEN A;  5KAB A;  1OEV A;  1G1G A;  1NWE A;  1NZ7 A;  1YWF A;  1OES A;  1OHC A;  2NLK A;  1PTV A;  4ZRT A;  2C7S A;  2Y2F A;  5AWX A;  3D1Q A;  5BUG A;  2I3R A;  2CFV A;  5M43 A;  3QKQ A;  3D44 A;  2GP0 A;  3BLU A;  3F9B A;  1G7G A;  5KA4 A;  2I42 A;  1XRI A;  1ZCK A;  2PI7 A;  2CM8 A;  4NYH A;  3V0F A;  2CNF A;  3S4E A;  1G7F A;  3LJ8 A;  2I6J A;  5KAA A;  3QCL A;  4DGX A;  2QBQ A;  2I3U A;  3SR9 A;  1GWZ A;  1T4J A;  4RDD A;  4QUN A;  5KA7 A;  3BRH A;  2F70 A;  4ZN5 A;  3OLR A;  4GE6 A;  5IBM A;  1YN9 A;  4JBC A;  3D1O A;  3S3E A;  2AHS A;  1QZ0 A;  1C87 A;  3S3K A;  1C83 A;  2VEX A;  4PVG A;  2FJN A;  2I75 A;  1RPM A;  2C46 A;  1NNY A;  3D42 A;  5BZZ A;  2H4G A;  3V0G A;  5KA3 A;  3S3F A;  4QBE A;  1Q1M A;  2CM3 A;  3BM8 A;  3QCF A;  1WCH A;  1ZCL A;  2GWO A;  5BX1 A;  1D5R A;  3ZM0 A;  2F6T A;  4AZ1 A;  1MKP A;  1FQ1 A;  2B4U A;  3H2X A;  1BZC A;  4GS0 A;  5J8R A;  2CM7 A;  2H4K A;  1Q6M A;  5GTJ A;  1PXH A;  5LXQ B;  2HCM A;  2B4S A;  1G1F A;  1RXD A;  3V0I A;  1BZH A;  4NND A;  1FPR A;  4GRZ A;  2QBR A;  1YTN A;  4WU2 A;  4ZI4 A;  5K24 A;  3MOZ A;  4D3P A;  4TVV A;  5KA8 A;  3QCM A;  4Y2E A;  3OMH A;  2J16 A;  1NL9 A;  2CMB A;  3S4O A;  4S0G A;  5HDE A;  4D3R A;  2Y96 A;  1OHD A;  4RH9 A;  4RH5 A;  2OUD A;  1KAV A;  2DXP A;  4HJP A;  1AAX A;  4Z6B A;  2F46 A;  4WTY A;  1J4X A;  2MBC A;  2H03 A;  1ONY A;  3F81 A;  2AZR A;  2G6Z A;  2Q47 A;  1A5Y A;  2H4V A;  1P15 A;  2PBN A;  4KYR A;  3RGO A;  1T48 A;  2CNE A;  2QCT A;  3O4T A;  4OHL A;  3SME A;  4ICZ A;  2I6P A;  3QCH A;  2OC3 A;  2ZMM A;  5K25 A;  2I6M A;  5KAC A;  1ZZW A;  2E0T A;  1PA9 A;  1PA1 A;  3AWE A;  2I6O A;  3QCE A;  3RO1 A;  2PT0 A;  2G59 A;  5KA9 A;  2HB1 A;  1LYV A;  3GXG A;  1BZJ A;  2F6F A;  1G4W R;  4B04 A;  3O5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...