2VFAA

Crystal structure of a chimera of plasmodium falciparum and human hypoxanthine-guanine phosphoribosyl transferases
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
209
structure length
196
Chain Sequence
b'DPVFVKDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXANTHINE-GUANINE-XANTHINE PHOSPHORIBOSYLTRANSFERASE, HYP
publication title Crystal Structure of a Chimera of Human and Plasmodium Falciparum Hypoxanthine Guanine Phosphoribosyltransferases Provides Insights Into Oligomerization.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 56
structure length 196
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 2007-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vfaA00
4LYYA 1VSTA 5BRNA 1GPH1 4ZFNA 4RANA 3NAGA 4F8EA 3OHPA 3GGJA 4OHCA 1A97A 1GRVA 1FSGA 1TC1A 5K51A 5HKLA 3G6WA 4Z1OA 3S5JA 1VCHA 1Z7GA 1YFZA 1A95A 4P86A 4P83A 5BSKA 3ACBA 1ZN9A 4RABA 3MJDA 1TC2A 2IGBA 4FYMA 1XTVA 5HIAA 3KB8A 3OZGA 4M0PA 1J7JA 1QK3A 2AEEA 4RHTA 1D6NA 1U9ZA 2H06A 1DQNA 4RV4A 5ESXA 1XZ8A 4P80A 1QK5A 1XTTA 1XZNA 1O5OA 1O57A 1G2PA 5JSQA 1W30A 2HCRA 4M0UA 1OPRA 1WD5A 1R3UA 1P17A 1UFRA 2JKZA 4RACA 4RADA 2JBHA 4QYIA 1ZN8A 3QW4B 1JLSA 4QRIA 1G9SA 1DKRA 1I0LA 4IJQA 4RAQA 4RQBA 1IBSA 1QK4A 2PRYA 4P81A 5JV5A 1VDMA 4LZNA 4LYGA 4M0KA 3OZFA 1AO0A 1L1QA 4P84A 1I13A 1MZVA 4PAWA 4RHYA 1A4XA 5ESWA 1UPFA 4JITA 2H07A 2WNSA 4QYIB 5BQPA 1ECFA 5IPFA 2P1ZA 4LZAA 1ZN7A 2VFAA 1STOA 1LH0A 3HVUA 1BD3A 4WMLA 1UPUA 3MBIA 5KAPA 4MB6A 3GGCA 1A96A 1I0IA 1HGXA 4RHUA 5IAOA 3EFHA 1DBRA 2JI4A 2JKYA 4JLSA 3DEZA 1A3CA 1A98A 1CJBA 1ECGA 4KN6A 1L1RA 2E55A 4PFQA 5KAMA 1BZYA 1P19A 1G2QA 3DMPA 4X44A 3O7MA 2FXVA 1JLRA 1PZMA 2C4KA 3M3HA 5EUCA 1QB7A 4P3KA 1QCDA 2XBUA 1DQPA 2PS1A 4S2UA 2YZKA 3GEPA 3ACDA 1ECCA 3N2LA 4RQAA 3ACCA 4WN3A 3H83A 1HMPA 1QB8A 4RAOA 2H08A 4RHXA 1NULA 1OROA 2DY0A 1U9YA 2EHJA 5BQOA 2PRZA 4LZOA 3LRTA 1P4AA 1G9TA 3LPNA 4X45A 1NONA 1I5EA 1QCCA 1XTUA 1ECBA 1BD4A 3DAHA 2GEBA 4P82A 1ECJA 5E38A 1OREA 1Y0BA 1V9SA 1DKUA 1I14A 1P18A 4TWBA
chains in the Genus database with same CATH superfamily
1RHMA 3U2QA 1F3LA 1XD8A 3AKEA 3OZIA 4LNUA 2ZBRA 2BFNA 2GBLC 3NVDA 3GFFA 4ZCSA 2O4UX 1SXJE 1VZ3A 4JJ8A 4D3DA 2DJ5A 8ADHA 1N3BA 4NESA 3TSCA 2VTDA 7GPBA 1EXVA 2EW8A 3K71B 2YASA 2EATA 4RVNA 4Z54A 2V1UA 2E6UX 2FW0A 3K5IA 1D7OA 3F7MA 2JEYA 4PFJA 3H5AA 3CEMA 3G7SA 3KBOA 4KH0A 4TLAA 3L8MA 3N2ZB 4GLFA 1ICEA 4IJVA 1JBQA 3TMAA 4EJSC 2R11A 4M0PA 2CN1A 1U8FO 5HCNA 5L3SB 4JLJA 1BX3A 2QY9A 3B89A 4M8IA 4F91B 3LCRA 2XYRA 4X91A 3ONFA 2ST1A 4QU0A 5B6IA 3V4RA 3NIGB 4DCUA 1ZD5A 4Y1RB 2X42A 5A3SA 2EP5A 3JYNA 2MYTA 1AKVA 1KK1A 2I4TA 4OTZA 2SICE 5ALNA 5J43A 4B4VA 2QRNA 2D5BA 3SFTA 5B58C 5DMXA 4I50B 3U61B 2JKZA 4EJSB 3HDGA 5D8DA 2ZFUA 3QG5A 3DAOA 1T3TA 1IXKA 1E9BA 2GN6A 3MCVA 3D5TA 1U6JA 4L9AA 1Q6YA 3L6DA 2PUBA 3HCWA 1WUTA 4CKEB 3HCOA 5SV2A 3TW6A 5DBFA 1GZ4A 3TSOA 5AH0A 2EGUA 3E84A 2VP9A 3IVRA 1QZXA 1YZFA 3NOOA 4QU5A 4YR7A 1FXWA 5KHLB 3ZWOA 4FBMA 4WY2A 1ZX1A 5FV4A 1CB0A 1SOVA 4OGGA 3W2GA 5MGBA 1X38A 2I34A 4LVCA 4N5MA 1SUCA 1UJ6A 3GWGA 3HWWA 1AKNA 4OQMA 1THMA 2XUGA 3CWZA 5F1OA 5JC8A 3W34A 1XTZA 1CS0B 1FQWA 1YU6A 4OBWA 1MA0A 4TWZA 3V48A 1CY0A 3AKCA 3QM1A 2BFCB 2PCJA 4RHUA 3LXUX 3REQB 1Z6QA 4Q6WA 3TAHA 4O2BB 1KH1A 1CDOA 1TFUA 2EFGA 1ZEMA 1A98A 2I6FA 2P35A 1IM2A 4G1UC 3RSLA 4YRNA 1JAXA 1E0AA 4LE0A 3TW8A 1LLDA 4HDNA 1ECPA 4M55A 1D2RA 2JD1A 3VZBA 1E58A 1DVRA 2A1UB 2IY7A 3G02A 4NF2A 4DANA 5HQTA 4LVUA 3M3HA 2CUKA 2ENWA 3CJTA 4O8CA 4UNNA 3OZRA 3SJAA 3X1YA 4EF4A 1T36A 1QCDA 3F49S 3HVRA 4Y0AA 3V55A 4RXMA 2OD7A 2YIMA 3M9XA 4Y1FA 1ZEJA 2BBTA 4I1IA 4OKSA 4JI0B 3W3AA 1SOWA 3IE0A 1RWWA 1F48A 3FE2A 3UGQA 4N7RA 2I62A 4QO7A 1PT7A 1ZNXA 2WU4A 3F8WA 2X0JA 4D82A 2PE5A 1PGJA 4KAXA 4TS4A 1XRMA 1SCJA 1LTHR 2QBYB 3ORFA 4CYMA 3PDIB 5HR5A 1KERA 4MS3B 2NQ8A 3GX1A 1HSZA 4NBTA 5JY6A 3ENQA 4LJYA 5C8DA 1Z45A 4GEKA 5FR2A 3UHAA 3V7FA 3S5UA 3PDJA 1D4AA 9ABPA 5D3QA 1Y3HA 5J4LA 1UADA 4KE7A 4LBYA 4RLSA 4CDGA 4AJEA 2GTHA 4PZEA 1UXHA 2VBFA 4WKGA 1NLUA 2DT5A 1KQ3A 4J43A 5ERGB 3FRIA 1J00A 4INZA 4GLJA 1MXHA 5AJXA 1ADBA 3IIEA 1YR6A 4K6MA 1ZNYA 4DG5A 2F1JA 3PHHA 3T9DA 5MHTA 4X24A 2XCOA 1E6EA 2C7OA 4H18A 1KR2A 1XGKA 1U02A 1X42A 4O59O 3GLVA 4GR4A 4TL8A 5EKXA 2POCA 4RYDA 1DMRA 3NPMA 5IAGA 1PGPA 5A9RA 3QFFA 4LDPA 1P29A 2IPOA 3CW9A 3R2JA 1FVHA 1TM1E 3DD5A 4RVCA 5FPSA 4GMKA 3S40A 1R27A 4R1PA 1NUAA 5JU6A 1E5DA 3A1VA 5JFOA 1I33A 3OT1A 2D7JA 2O8FB 4HJXA 4ZEOA 2EX1A 3N75A 1KKLA 1VCIA 4GT1A 4KLAA 4O02B 3IPLA 1EFHA 4JA2A 2G7ZA 4POOA 1B6SA 3AW8A 6YASA 1Q0SA 2CMHA 3C3MA 2M6LA 2H1CA 1YOBA 4MYTA 3H8SA 3NANA 3RIHA 2ZBQA 4B3IA 3LA8A 1OT5A 3DLTA 3EZ2A 2RI6A 4UEKA 1KQFA 1CJTC 3WL8A 3PV0A 4L3VA 3EUEA 3FSGA 2QAGC 4YALA 1JYEA 5GZ1A 5JNUA 2A9JA 4WWHA 3PRYA 4IH4A 1ZJ4A 2QR3A 4BQOA 3F6RA 2ZJYA 2X1HA 4CL0A 4CQNA 1RXWA 1YTLA 3H5TA 1F8UA 1VJ0A 4KJXA 1XZBA 4CIXA 3WQSB 3VDRA 2ZI4A 4L3OA 3EB9A 1ZONA 3GUUA 2C0QA 2HU5A 5JSFA 1QQTA 2FWRA 5L7WA 3BHNA 4YCLA 1EESA 2NUAA 4Q3CA 3TR6A 5FL7A 1WSAA 3DHYA 3FNGA 2W93A 3I5MA 3L1IA 4LDRA 3KAQA 4TT8A 4AUNA 4F60A 5JCZA 4DR7B 2ZRGA 2IYLD 3LD9A 3WWEA 5F4ZA 2DF8A 1M8KA 4D0LB 3V4PB 5BWOA 1QTQA 1VMAA 1ZLXA 5A06A 3JQGA 4B3SB 3SZOA 3NXSA 2AGVA 3HCPA 4QWMA 2JD0A 3R7SA 1YRWA 2JKYA 1IEXA 1GL3A 2VI5A 4JLSA 2XE8A 1XR3A 1USKA 4KO8A 3C70A 2PMDA 3EVNA 3EDCA 4LXGA 1KJYA 3FPEA 4OOFA 4MYRA 1VIDA 4CM5A 4MVJE 2CHVA 3K8QA 1XPJA 2UZ0A 3I6QA 1Q2UA 4Q7QA 2P77A 3EA5A 4MYSA 3IPCA 1W29A 4HRVA 1Q0QA 5KJ1A 1NPTO 2VEOA 1NMXA 1XU9A 5DHTA 3AUFA 5C51B 2HSDA 4GSYA 2JK1A 4MW1A 4DR1B 4R2JA 3G13A 3KV3O 2LCFA 1ZJYA 4J0JA 4MYHA 1ZPDA 3ED1A 4RVUA 2OYRA 3P9KA 1IHUA 3CN9A 4E4YA 3PU6A 2HCFA 4PTZA 3S4YA 3PI6A 3M7IA 2HPZA 1JEAA 4EFMA 4UHDA 2GEUA 4OSPA 3FDIA 4PQYA 2W11A 2A58A 4NE9A 3FYUB 4ZCLA 1D8TA 3UUWA 1P2TA 2RSLA 2N42A 5IJ9A 3UANA 1L4YA 2EEZA 3KJQA 4DQLA 3DZBA 2C2KA 1DAMA 3KTAA 1TEHA 3EIWA 2VDWA 3RC9A 4QTXA 3M49A 3EGWA 1JBKA 1OBCA 3MJTA 2IU0A 3BWCA 1UEXC 5LMZA 2OSVA 3BAFA 4AT1A 1RPTA 3DE0X 4NG5A 2PX3A 4TMZA 5BMVA 4RHEA 4BZWA 4FSHA 4BFYA 1KYXA 3ZQ6A 1TJ5A 3OKFA 1Y98A 1O6FA 2DPGA 3WIVA 3AUXA 5CYOA 2WKWA 1F3OA 5G41A 3IXLA 2BZGA 3UMYA 2WIJA 5C5EA 3MHPA 3R8XA 3OX1A 2X7JA 4PGGA 1COWA 4K9OA 1QCZA 4DB2A 2WF7A 4XR4A 3BTSA 1A2QA 2H2FA 2I2DA 2WKPA 3HN6A 4MULA 4UDOA 4OM7A 3GRYA 2IV3A 2WHRA 2YN4A 5TQ2A 4DAEA 3BSFA 3V1TC 3TTTA 2FSPA 2ODBA 2R1TB 2YDYA 1GHTA 3DVAA 1E79A 3IO5A 4NMLA 4B0OA 4BNTA 4EUKA 4IKPA 1AKWA 2GPTA 3BTOA 4UVDA 2BFDB 1SC9A 2ZJFA 4HC4A 4UDNA 3SS8A 1XMVA 1EUCB 4L7VA 2SHKA 5CUQA 3FYTA 3FHJA 4M1ZA 1Q84A 5EMKA 2GASA 4CLDA 3A14A 3MD0A 4ZVKA 3BA1A 4UD2A 2Q1WA 1HORA 1Z0UA 4ZAGA 3W77A 5MF6A 3IOEA 5CDGA 1P7PA 1OLSA 3JWJA 1UMCB 1U28A 1YVDA 3B8HA 4B47A 4IEIA 1Y7PA 3PRKE 3QW4B 3EIOA 1P77A 4KRFA 5BR4A 4AWXA 1UKZA 2Q6IA 4E15A 2WOJA 2BGJA 4A8JC 1U2TA 5GIOE 1Z2NX 4GKKB 3UMGA 3C1AA 4EB6A 2GSDA 3FI0A 3GFTA 3NDJA 4XAQA 4EHBA 1BA3A 2P11A 1NBWB 4J0KA 1SWVA 1RRPA 3DE5X 2OCAA 4UMVA 1OKKD 1T91A 2LKCA 1G5FA 1PTJA 2RARA 1YNOA 2X0IA 1FJXA 3WG9A 1THZA 2HFKA 2G9NA 2YBDA 5AM1A 1JLLA 1EFRA 1G41A 1I51A 1QTIA 2ZIZA 3EVBA 4O33A 2JJMA 1P9NA 1QE0A 2QLBA 4HGRA 4JLVA 1MVNA 4KBFA 4X7RA 2WB4A 4Y2XA 4A0RA 5JZBA 1RZRD 1C7IA 2HAEA 2IEBA 2VUSA 2FV8A 3REOA 2C82A 1YDFA 3ITKA 4IVNA 4TLDA 4C06A 2Y1KA 4E2ZA 3QMMA 1IN1A 1NKVA 2DHDA 1Z15A 2X5OA 4OK3A 2D59A 4BVLA 3INYA 3KZKA 5JI2E 2E48A 4QTTB 4D9IA 3CU5A 5G40A 4EY4A 3U0VA 2CMDA 3BILA 5A1JA 2YYAA 2QJFA 1RYFA 5E1OA 1AXGA 1JIVA 3TL3A 3VHLB 1EHCA 2Z9DA 1E2HA 4EAQA 2BSQA 5CXQA 1MKYA 1I94B 1ZHOA 1I4DD 1J4AA 3CA8A 4GGPA 4ZZ2A 5JYDA 1AF4A 4E2YA 4D0RA 3KQNA 4AQ7A 3NVKI 2Q28A 3OZBA 5C7YA 5JD4A 1ZDMA 2JFVA 1W25A 2YWHA 4GGOA 1V8ZA 2GYVA 2QMOA 3KQLA 1RI4A 4YPFA 4B3DA 1S8OA 3GA0A 3PPXA 1L3IA 1F0YA 3T7RA 1KFBB 3LC0A 2F90A 3FCSB 1PUJA 3IP6A 5BURA 1T2DA 2J6BA 1L5WA 4LJLA 2G82A 2JGMA 3PUIA 2GZAA 5T8KC 2UU9B 1FRZA 2DWUA 1KY4A 4N5LA 2J08A 5DGTA 3ZK9A 4EVIA 5K8JB 3AVTA 4DT1A 3S55A 4BFTA 5B6JA 1N5OX 3AHGA 4D46A 3RT7A 3SSMA 2OY0A 3WJ1A 1C0EA 4AZSA 3EGIA 3E35A 1J9GA 3EZYA 4CKZA 5I6DA 4X3CA 4IIFA 4AYXA 3EEBA 4ER0A 2ZRHA 3KOOA 1FU7A 4KWIA 1FS4A 2OESA 2XQIA 3MD9A 2NT3A 3RD5A 4FJ1A 1G9XA 5JEDA 5H9VA 1BMFA 1WP9A 4GMGA 1PIWA 4V2UA 2PJUA 3OM9A 4OO3A 4IPTA 1S7CA 1R4MB 2LGJA 1WQ4A 3EFOA 3H3XA 2BMAA 4RABA 3NHMA 5KNCA 3E9CA 4AMYA 3EVCA 3GN1A 1IQ0A 1YZKA 1LCIA 3BGVA 5KNDD 3IMCA 2J4DA 4BS9A 2Q0XA 5I51A 2QQ5A 3AJ9A 4XWGA 1IMJA 1A9PA 3V7UA 2OZVA 5ENVA 5K4AA 1USUA 3CR8A 1GSHA 4MVJD 2C00A 3EG9A 4JUCA 4CNQA 3K0CA 1X7ZB 5BT8A 1S3FA 2QQFA 1QZZA 3PTLA 4FQ7A 2GK7A 4NE2A 4CIWA 5E8RA 3LDUA 4OHFA 1IWPB 3SQWA 4IGAA 4NYIQ 3OX2A 5EN4A 5D5QA 1G8GA 2M6RA 3EXHB 4GRIA 4RMNA 4UUNA 4EKGA 1GQQA 5CH3A 1ZL2A 4BNDA 2B69A 3E3AA 3L4JA 1M6HA 4UZEA 4JUAA 4LZNA 1EG2A 4G4GA 4Q7JB 4R1TA 3L6RA 3PSHA 4OBBA 4CLEA 4TZ6A 5IXJA 2QL6A 3A1EA 3DBHA 3H5NA 2ARKA 4IQ8A 1ZCAA 2P78A 2ZT8A 1WO8A 4NYJQ 4OUKX 4B48A 3D3EA 1YQQA 3GLFE 1KJJA 4FKBA 3R7NA 5A4JA 2J3LA 4PLWA 2HHCA 4O1MA 3FYHA 4NH0A 4RWZA 3WWDA 4CF4A 2PL3A 4NJOA 3MRVA 3DPSA 2QPAA 1SZDA 1TNDA 2Q9BA 3DEHA 5FPYA 3U5TA 2ICAA 4ZHQF 2NZ2A 1TF7A 3TVYA 4ZARA 3RVBA 2YOGA 1AB6A 2JGDB 2I1LA 2W2MA 3HXTA 4Y2SA 5B37A 4ND3A 4BMDA 1U81A 1LBEA 4ZVSA 1II8A 3ICEA 3P9NA 2J4CA 5AM3A 3F6PA 2HT1A 3SEZA 3KPJA 1VKZA 1IOWA 2CLOB 1W49A 4RIGA 1DQRA 2AUTA 2XNKA 1CZHA 3KCQA 4JIGA 4QELA 2GLUA 5E4FA 5EYPB 4F71A 2FXVA 1F2VA 2P9EA 4CMAA 4YYEA 1O6CA 4X66B 4MA5A 5LZ8A 3ZJVA 4XIIA 1OXBB 3U7RA 4LFAB 1JFSA 4H2DA 3A04A 3KKMA 4CCYB 1UKAA 3R0VA 2GEJA 1G5RA 1IN6A 3VTFA 5L4LA 3T6KA 2YY5A 4FLMA 1RNLA 1A50B 1FW8A 1M2VB 4Z3DA 1F2UB 3C87A 4WOBA 2C1ZA 2P6UA 3ZLJA 1L5MA 2EARA 1ZIXA 2PD6A 1W5TA 4P2BA 1PBTA 3BQ9A 1U8ZA 1TZMA 3HKEB 3KSUA 2J67A 1W9HA 1DOHA 3GEDA 3L8YA 4LTMA 3BAZA 2A94A 2J8ZA 3AVOA 2Y0CA 4KIFA 4W63A 1T6BY 4M7PA 4WRRA 1SVSA 3QY9A 1RZ3A 3FTQA 1V5EA 2OFPA 4M7RA 3V3TA 3FDFA 3BT7A 2NZVG 3MB5A 2RGCA 1TQHA 4E22A 4LGCA 4DY4A 3NVAA 1RJWA 3WRXA 2XUKA 1GCOA 2QTLA 3BWVA 4JBXA 3WZ2A 4TL7A 3HXOA 1W5EA 3F6SA 5HE9A 1WXXA 2NSDA 4JKYA 1L2TA 1JA0A 3R6WA 1E4EB 3MMXA 1K7SN 1AXRA 3O4JA 4L5IA 2AD1A 3EAGA 4DHWA 5HRUA 2XKBA 1HYHA 2ZIUB 3ABIA 3IUPA 4RX1A 2O3QA 5AKKA 1DBVO 4LXQA 4ALJA 5A3RA 4CKYA 4QT0A 4F8EA 3CG0A 1NVAA 1DWQA 1G21A 1Y5MA 4F9GA 2B5WA 4MWTA 4X63A 5EJ7A 4OHUA 2H11A 2BSXA 1RBYA 3WWPA 3H9UA 2YZNA 4N0MA 3HV0A 4F04A 5CFMA 1S02A 3KK0A 4N3GA 2JEOA 1NJ8A 2RGGA 2DEUA 3D0OA 1E64A 1ND5A 5FNZA 2Q4RA 3TQCA 2IRWA 1GD1O 1PJAA 1O96B 4OH1A 3WDKA 2VNKA 3KQUA 3AEUA 5JZSA 3JQFC 4LYHA 1U1EA 5EY5B 5FL3A 3TUIC 1P4HA 3LF1A 3M4YA 1ENZA 1QIKA 1YRLA 2FOXA 2XB8A 1TVMA 1H4SA 2VF4X 3JYQA 1E6KA 1K6IA 3KBBA 4KIGA 3EH1A 4WLFA 2PUHA 4UAGA 4KR9A 1AX9A 3UT5B 2R7AA 2MHCA 2VEDA 4KWTA 1IPEA 3T0IA 4F06A 3K30A 1E8DA 1OVGA 5B1IA 3L84A 4HN4B 1NC3A 2PTGA 3BMQB 3ENNA 3O47A 4FFVA 5F21A 3J7AC 3H5VA 2AQHA 4MQBA 5E8JA 5EHNA 3I5YA 1YOVB 1ISSA 3I2YX 5LZ7A 1G7RA 3LC7O 4GWLA 3SEFA 3NORA 2G06A 4XIYA 3CVVA 4PWYA 3WQHA 4Q00A 3Q6MA 4BLQA 2WAAA 2QN1A 4R01A 1I13A 1S89A 4IUBS 4ZVLA 2R8EA 3DO6A 2BZ1A 1PUIA 2V7PA 1NBIA 4FYVA 1QO0A 4JBGA 2C4TA 3PA8A 4FOLA 1HC7A 3TVDA 1ES9A 3D4BA 3DOHA 2G63A 1K06A 4UNRA 5KINB 5HJ2A 2ZRPA 2R6JA 1FTQA 1NI3A 1OHHD 2AS0A 3QELB 4MUAA 5HX7A 2MYPA 4HNHA 3VFDA 3N1UA 2QTHA 4MVWA 5D7BA 1M1NB 1RADA 2HXYA 4PG4A 1E1KA 1RMTA 2IYWA 1QANA 3MZ0A 4X7PA 3OQBA 4AD8A 1U0SY 4ANFA 5BYBA 3ROMA 1L1RA 1WSBA 2I78A 3PT5A 2HJGA 1VA5A 4HZIA 4D3XA 3QSGA 4J8PA 4QODA 2MCFA 1TJNA 2Z3VA 1R0SA 4WGGA 5C4MA 3HE3A 4KE8A 5EKUA 3V33A 4IHJB 4LE2A 5FWYA 2RAUA 2O0KA 1N33B 4KQHA 1TUIA 1GLGA 2QUAA 3O5AA 1UM9B 3BWBA 5TEWA 2A0XA 2ZYTX 5IFLA 3QG1A 4ZTZB 2ZJ4A 2C2GA 2F9FA 3VOAA 2DTXA 4BE9A 2WKQA 4JP8A 5T7BA 1WTCA 1N32B 3GLTA 1UC9A 5ESDA 3UTDA 3ED5A 1NM5A 3CF0A 4YUZA 4RCVA 4WZBE 4OX9B 2VDMB 4BNJA 4GXQA 5B1EA 1NUSA 1WPXA 3GLHA 1KH3A 2OGTA 2QV7A 2PAFA 1GN8A 2LDXA 5FT9A 4TKVB 4V0SA 2Y0DA 4ALKA 3OWHA 3G9ZA 1POWA 4EZEA 4UMDA 3OQPA 2I3DA 2OG1A 2HSEA 1BQ4A 1FE8A 1EVYA 1C80A 1M2FA 1TYBE 2ZEJA 5DISB 3HB0A 4CLRA 3OESA 2C78A 4Y6OA 3C7DB 1CE8A 1A72A 4PYNA 3ZNQA 5EE9A 2Y1CA 3HNOA 5GZ6A 4JKIA 3TKLA 1PQWA 5FNVB 2CSXA 2XT9A 3QIVA 2NVUB 2CNDA 1L7MA 1DMSA 2F6RA 3BM5A 2WKRA 4JL8A 4P86A 3ZKWB 2XCUA 4ZQEA 2ZRIA 3KRTA 1KZ6A 1NTOA 3ZQ4A 4BUJA 3ZWNA 4URXR 1BDIA 4HAIA 1OGYA 3UQZA 1K2WA 2QVBA 1QV6A 3C5EA 4Q4AA 1E1YA 5AVZA 2F62A 1E5QA 2X58A 3GUVA 3LYUA 2HWUA 1OD6A 3CB4A 4XQ9A 5KKCA 4QUAA 1Z47A 3IGFA 4PS1A 4IOMA 3G2MA 1C8LA 1ACLA 4WLUA 3AUAA 3C4VA 2ES4A 2HSGA 1KAEA 3P27A 2D2XA 3KKKA 5GV7A 1ZCZA 2GX6A 3TQRA 4OLJA 1BHO1 1JDJA 1I4LD 1WEKA 4D02A 3GDWA 1B1AA 3K92A 4HEA1 3WBJA 4FEEA 1YZTA 3ZI4A 4F97A 2IHNA 4JYZA 1U11A 1XLTC 2WJ3A 2XCQA 3L0OA 4U2KA 3EMDA 5GQSA 1NW9B 1GNTA 3WL3A 3M6FA 5ERXA 3G5LA 4LHEA 3CJRA 4MOWA 3UWDA 1TCBA 1U7OA 2JFOA 1RQPA 3DGEC 1ILWA 3FYDA 4MV9A 4WZAB 5DHPA 4D79A 1EM8A 2CY0A 1Y5LA 1ECLA 2ZG6A 4D0NA 3K09C 2ZTUA 5KC8A 2VA9A 3H87A 1AOXA 1T9HA 2R6AA 2OR3A 2P91A 4TYMA 3PD1A 5FI3A 5GADl 3I61A 1NJ5A 2BJHA 4ZO6A 5JWRA 4QX6A 1Z74A 4RK4A 1J09A 1D2NA 1FOEB 2PR7A 4PCLA 3GH3A 4QPZA 5KOIA 4LS3A 5KSPA 1Q3HA 3M8KA 4HFMA 2IYOA 4ZZ0A 1QHIA 2TMDA 1XG5A 5B1DA 4CQMA 2RHMA 4HTFA 3GJRA 1VP9A 3NIBA 4UARA 4UNPA 3K9CA 1NYQA 4V0RA 1QQAA 4UJ5A 2UAGA 4LRYA 5CNKA 5CNJA 3T7CA 3X3HA 1G0OA 1IZ9A 3OCVA 1ZWLA 4RFLA 5IVPA 2VNHA 1VHJA 3UK0A 4QJBA 1VRWA 1C9DB 4F93B 2GXQA 4E5MA 1KPIA 1V71A 4UZSA 3W8DA 3K9HA 2FQYA 5IJXA 1FP2A 3EBOA 5GY7A 1B8OA 2OOSA 4E0BA 3FNBA 4MW0A 4W6QA 1SA0A 3JQCA 4Z6KA 4LGMA 3RRNA 2H17A 2YW2A 3MTQA 4FGKA 3V8EA 5A7FA 4LZZA 5GTDA 2ILVA 1HA3A 1ZIYA 1U1DA 821PA 2PEZA 4LDQA 2P62A 4KJZA 2HXGA 1A1VA 1VYHA 4IVRA 3KOYA 1MUUA 4Z4HA 4X5OA 1O6BA 2R87A 3JD3A 2ZJ0A 2HW8A 3PHLA 4DPKA 2WSBA 1ANKA 3GVIA 1MVOA 2JATA 3JAKB 3PKZA 1OFTA 3D8BA 4JA0A 5FUXA 5IEBA 5FXMA 2W71A 4W7SA 2JCSA 1BMQA 2WWRA 5CFRA 1Z6GA 4M1YA 1NDUA 2HHAA 4NTZA 2QEQA 1WSDA 1LWOA 2YYYA 3IHTA 3MWDA 2CMKA 4PX2A 4R1SA 4E03A 4HX2A 5FBVB 2GH1A 1ISJA 5A2GA 3T3IA 1CQPA 4JT9A 1PFVA 1UDXA 1WCWA 1Z5OA 3CRVA 2CVQA 4KQCA 3URMA 4CM8A 2NXEA 1SVWA 1K1EA 4XIGS 2EV9A 2WNHA 2XDQB 2B1QA 5I45A 4AJ2A 5WRFA 1FSZA 1R0ZA 1QO9A 2VJQA 1VKHA 4CT0A 4D9HA 4KH1A 1U5BA 4NCXA 4EGSA 3UAYA 4M21A 4EUHA 1E1QA 2VOJA 2K2QB 2Q2WA 2UYYA 1ZUIA 1EAMA 4TSFA 1NJ1A 2CNBA 3P9ZA 4BKMA 1ZS9A 3CLHA 5ADWA 4JR1A 1Z0KA 3GGSA 1GGEA 4P08A 4ZPJA 4D7AA 4K03A 2I29A 3J80A 4J90A 2ZCUA 5D00A 5KWVA 2Z98A 3O1JC 1SCDA 1J0BA 2QSJA 1EWQA 3HCAA 1JWBB 1N6LA 3A10A 4M9UA 1CT9A 4JJKA 1QQ7A 2GD2A 1Z2EA 4K81B 4RY9A 2H9IA 4FDTA 3GLQA 2O4CA 1VRCA 2H0RA 2FPMA 1BW9A 2PMKA 4HDCA 1FU8A 3ZJ5A 4ETIA 2AJTA 1F20A 2W43A 2JIRA 5K8VA 3OZ7A 4TZTA 1OX4B 1XRPA 3TI9A 4UPDA 4WVFA 1X0VA 3VO9A 5JJKA 1IY1A 4W5RA 1DLIA 3B3GA 1TMGE 2A8YA 3VHQA 4V1CI 1USVA 4KG7A 4KQ2A 4UE2A 4YP6A 1LV8A 2QAIA 4HNGA 1JN0A 3TH5A 3WTBA 3P8ZA 5I8WA 4PU0A 3T34A 3D0QA 1GLNA 2QQGA 4RQUA 1TQ8A 5T57A 4D9MA 1OLUB 3R3VA 3ILVA 1KORA 3HKDB 4NCIA 1KEPA 1KDZA 4YQYA 1U0LA 2IITA 1RQNA 3DE3X 3JWEA 3MBIA 3V1UA 2ZZKA 1H4QA 4Y9UA 3CVOA 4NENA 3L6CA 4S0XA 1BQEA 4DSNA 2YQ4A 1OBVA 4H9GA 2BUBA 2CEKA 4YRPA 2H57A 4LCBA 3ROQA 4C6TB 2IDMA 2VQ6A 3NTLA 4EW2A 1C9MA 4LMPA 1E0SA 4RBNA 1CETA 3ZXXA 3ENWA 3KL4A 3NHYA 1DEKA 3GXOA 1RWKA 1VE9A 1GQOA 2BCJQ 3A7DA 1JSXA 3AJ8A 4HNQA 5CX4A 4FYPA 4IDDA 2BM1A 2F3UA 3OD1A 3PWKA 1YZVA 4HSEA 1I8TA 4OQXA 4OH7A 4K40A 3LE8A 3RBVA 3VV3A 3LZDA 3QGMA 3LX5A 4N8EA 1H2AS 3GMIA 3OIDA 3GVPA 3EXEA 4FFNA 4QSHA 3JSXA 4FFDA 1TX4B 1VJCA 3OZWA 3QLVA 1SURA 3NNDA 1DAPA 4FWBA 3CUEF 3NTXA 1JHXA 3A3KA 2YXNA 1L7OA 2AJLI 1M6NA 1EUDA 1DBQA 1UJNA 1Y81A 2CBGA 4W1QA 4CDRA 1R12A 1E2LA 3O94A 5IUJC 1UCFA 3KYJB 2A0YA 1P8AA 4M0CA 2DY0A 2W2KA 1A9SA 3C3EA 4GWKA 4CM3A 2ZTLA 5CCDA 2MINB 1VL2A 4EZBA 3VSBA 4AJPA 2DBZA 3F4KA 4XLZA 1KO5A 1VRVA 2PXAA 4B4UA 4OA5A 4KGXA 3S1AA 2ZUFA 3B48A 1PSZA 1IBKB 1P2SA 4B7XA 5CA1B 2V6BA 4HWPA 4LHZA 3WJ2A 2O3JA 1KF0A 4TS9A 4D99A 4ZMRA 2OENG 1BCRA 4U7JA 1LVHA 2CCKA 4INOA 1U4OA 3EQZA 3IB6A 2A1TR 3BMCA 4F9FA 2OZLB 1CLUA 3CLRD 4V2IA 3IODA 3UAOA 3BUSA 5JQWA 4BYGA 3HLKA 1TKCA 3CPHA 2F43A 3ZZNA 4AG6A 5SY6A 1BJTA 1LX7A 3OQIB 1CLEA 1X86B 1CUGA 4YCDA 4RETA 2IOYA 1NF8A 5KYUB 1T6YA 5THXA 3PHCA 5GP1A 3WWZA 3H1FA 3INGA 3ROTA 1GL9B 2QD3A 5G0SA 1KRHA 3B5EA 3KKOA 4P5PA 1E66A 1ULAA 3A9RA 3FI9A 1DQYA 3LRXA 4MLCA 1V16B 4A26A 2X76A 1FS5A 1UBTS 1VLLA 2PGAA 3TB6A 5I7FA 3C5HA 4OSEA 4A2QA 3T3NA 3B1XA 1TM3E 4GKAA 5JJIA 2Y92A 3PC8A 3H4TA 2PSEA 2NO0A 3OIGA 3ON5A 1J5XA 3UW1A 2FUCA 4ZEXA 4PWZA 3ZVRA 1R0RE 3CCFA 3B20A 4IFEA 4OQZA 4V02A 1HTTA 2V6MA 5J40A 4Y2HA 1REQA 4AL4A 1YI0A 4FGSA 1GLVA 4RD0A 3HFJA 4TTTS 4J3JA 5J63A 4ZJYA 1G63A 4IZHA 3V7YA 1Z5PA 3P9RA 1ZM7A 2OBYA 3NV9A 4X8HA 2B21A 1RI2A 2GCPA 3DG9A 1UPTA 1MMFB 1YL5A 2ATVA 1L1FA 1BDJA 1IBLB 5E9AA 3SF8A 1NBOA 3CBGA 3A4MA 1I2CA 3AJRA 3HFSA 2OGWA 1SUBA 1TPZA 3EASA 3OKPA 5CR9A 3GLIA 1V8OA 1YGPA 2F1HA 2XMQA 3AZPA 3GJQA 1MCZA 3OJ0A 4HNAA 4ZAYA 5BRAA 5JAQA 1NVFA 3IEIA 4E2WA 5EMMA 2J41A 4J9UE 4YR9A 2J07A 4O4JB 4DBLE 3I2HA 1RPJA 4LJ8A 3VZPA 1H9BA 4CMIA 3VKHA 3TIXB 1YJ5A 3O21A 3JQRA 2V0CA 4BX9A 1LZLA 1T1EA 2EEPA 4RHCA 2H1OA 3FAKA 4M4SA 1KDRA 1EZZA 5KYNA 3UOGA 4X1KB 3A6DA 1S2OA 2V03A 1T4MA 1LEHA 3COYA 1MRZA 2JIMA 5GGYA 2PSJA 2BM9A 2FMIA 1QYIA 5D3MB 2XCRB 1SUPA 3K1JA 2HA7A 1NP3A 2A0UA 4LYAA 4EK9A 3C1TA 3ZUPA 3I05A 4QEZA 2R2GA 4R83A 5E9QA 2ZS7A 4AJIA 2QUKA 1L7RA 3D4PA 1O95D 3NHKA 1TIKA 4OJNA 3NAQA 4YRMA 1YONA 2GF9A 1VLQA 4BQSA 1GDDA 1OYVA 4IF4A 3B2EA 4ENQA 2O2IA 3ZGZA 2V5AA 2OBLA 1BFDA 2V6FA 1HF3A 1PNVA 3U4AA 2QVYX 4QYXA 3M6MD 3ZVNA 2OLKA 2AR7A 4H16A 3OQVA 2VF2A 3IDAA 1W0KD 3TQHA 3A36A 4LF5B 1B3RA 4PGAA 3A6EA 3A37A 3ANLA 1GPJA 1EJ2A 3K73O 4ZIRA 3UN1A 3QX7A 1OCEA 4U9UA 2CXTA 1M1ZA 1ZICA 4G1MB 1GGFA 1W6RA 5HS4A 3EVZA 4MS4A 2HPHA 2ZBGA 2OYCA 4D8WA 3T38A 2WPDD 2WLTA 4GDMA 2DTDA 721PA 1EUZA 1N7IA 2ID4A 1F2TB 2KQUA 4I14A 1XZJA 3DNMA 4QC2A 4BLUA 4QUGA 2NP7A 3FR7A 4MITA 1JMKC 4ZU6X 4PLZA 1D0VA 4FOPA 3SF0A 5LDHA 2XQKA 4FZVA 4DMKA 5LXTA 1V1RA 2CXSA 3KR1A 3KJXA 1QBKC 1QGUA 3AVPA 4M8KA 1FSGA 1TC1A 3GP5A 1T9GS 4KMRA 4PLFA 2WP8J 1MH9A 1QJ4A 4FSXA 1TKRA 5EIHA 3EIHA 1SUDA 2OWEA 2QAGA 3I12A 4MUYA 1XD2A 3WLNA 3RABA 5BVHA 1Y82A 5BSMA 2HMTA 2X2PA 1NXOA 3SBXA 1QHGA 5CB0A 1GWNA 1M9NA 5I7SA 3PLRA 5JCPA 1WD7A 3NBZC 3V1NA 2IHTA 2QD4A 2BEWA 2VJOA 4PZCA 1T4BA 4IQFA 2G77B 3I3OA 3N8DA 4KE9A 1MC5A 2H9YA 3NOVA 4KV9A 4Y6PA 5AVXA 2VTBB 1IYZA 3X2FA 1N2JA 1NG9A 3R9XA 1HZJA 1E1CB 4ZU1X 4HT3B 2FJPA 2A5YB 5CB4B 3UJ8A 3MCZA 4DY6A 4C4PA 2MSCB 3HZOA 2HYIC 1DEAA 3TI7A 3TRDA 1J6UA 4MICA 1FXUA 5EA2A 2ONJA 1XQVA 2OPBA 2V58A 4QTZA 1EHIA 1ZZEA 4IJKA 1BXGB 2MYUA 4UEWA 4HF7A 5JBQA 3K6JA 5I9LA 1OXTA 1D0SA 2PWBA 2G9UA 2XVAA 3KP1A 2Y8EA 3DDUA 3T7SA 3GGOA 5JNRA 2OFFA 2EXXA 2ZXFA 4MA0A 5ELLA 3FJOA 1R4AA 4FM9A 2WJVA 1XCLA 1D4OA 3DWEX 4LMRA 5G3YA 2XUDA 3DOIA 4MGHA 4JITA 3ZI0A 1XLVA 2C42A 2KMLA 4WNYA 4LK3A 1J8YF 5IP5A 1VB5A 3L8DA 3RWMB 2GAAA 1STOA 4QU8A 1VGQA 4I4NA 4RH1A 1VHLA 3Q7TA 3KFLA 4OOEA 1FB5A 2F48A 2YRXA 4C2TA 2PYZA 1S1MA 1NI5A 2XAAA 5A4FS 4ZD6A 3I9V1 3OLYA 1M5UA 3BL6A 3UOAB 5DYGA 5H7XA 4HLUC 4DV2B 2W4MA 1T0UA 4BFSA 1T3GA 4HDRB 4LZLA 4KGDA 4V0KA 4F6LA 1VJ1A 3UUGA 3G9QA 2ODWA 3LL4A 2AMVA 2WT4A 3G5AA 4TT3D 3NYRA 4CMEC 2O2SA 5ADHA 2BIFA 1BYIA 4HVAA 1OZGA 1ZESA 1ULUA 2OAGA 4FDUA 2A9PA 1IY9A 1KFCB 1HQYE 1AS0A 3AHEA 3H9GA 3HKCA 3O75A 4P3KA 1E0KA 2BBOA 5B6PA 1Z12A 1NUQA 2ZIXA 3IURA 3WGGA 1JEOA 4KUEA 3BMNA 1D09A 2WSIA 1HX7A 2XAUA 4DLWA 4JGIA 5DO9A 5JE8A 2WILA 4G4SO 4R3WA 2BVNA 1LNZA 4HG2A 4M8NE 4JROA 3PYLA 1DDIA 3QPCA 4E5PA 2QORA 2H31A 3T7AA 1ODIA 3GPDG 2AXQA 4XJSA 4KWHA 3ZGNA 2P6NA 4IKOA 4PO1A 1HWYA 1C50A 3NEAA 3BWMA 2IEGA 3HRIA 3EWAA 4RKYA 1ZD3A 1K27A 2H2DA 4CKBA 1VIVA 2GEFA 4IWYA 3QQPA 1KH2A 4UXIA 2CV2A 4PC1A 4PPQA 4I5EA 4DNOA 1NVKA 3RHSA 1U1FA 4H27A 2Z08A 3RIGA 2XMDA 1NSFA 1EEHA 2XNDA 5ALSA 3SXUB 3HA7A 2EW2A 5ADUS 3EISA 4ALLA 4G23A 1EA5A 1WOYA 1QDLB 2A0KA 2PT9A 2WAXA 3JS5A 5GVRA 5J9FA 4BEVA 5LJLA 1OV4A 1EA7A 2HK6A 4PSVA 4XM2A 4JH0A 1UBLS 4QPPA 5IHPA 3KJEA 3IS3A 4B46A 4ZYVA 5A9SA 5GOZA 1Q0UA 5FPTA 3QYFA 3TJZA 3CZAA 4JY7A 5CH8A 2F3SA 4ZZ3A 4KVFA 3REFA 3AF5A 3QTLA 7MDHA 3TXXA 3ERCA 1UXGA 2XLCA 1KYQA 3ABZA 4BKOA 3UHPA 1TI7A 3KYCA 3PXUA 3SFZA 4A8JA 4JEUA 5HOEA 4L78A 1JFLA 5KU7A 1TQDA 1E77A 3PQ2A 5KKNB 3JQPA 1Z18A 4DZTA 1IH8A 1SHKA 1I9CA 3MFQA 3LK7A 1Z3CA 3Q3CA 4FPXA 4H3SA 4QOSA 4RFSA 3LFHA 4S1VA 3H18A 2ISQA 3CE6A 4CIVA 3IESA 1JG2A 1JECA 5FTJA 3QENA 5HS6A 4PAGA 2Z2ZA 1ND6A 4ZK6A 4YFVA 5LOVA 1K6MA 1EJ6A 1RYYA 3K0EA 1ZN8A 2GNOA 4H1UA 1W88B 2HF2A 1ZKDA 2E1RA 2V55B 1I0LA 3N0RA 3AJAA 3QHPA 2B8WA 2PN1A 4MJ3A 3UC5A 1N2ZA 3CLUD 4P81A 4ZEMA 4O5AA 4M49A 2IXAA 1DP4A 4YDSA 4B3FX 3QXCA 4KYIB 1Y1SA 3EZNA 4EG3A 2FPIB 4DZRA 1Y9AA 5K0NA 1G42A 2VBIA 1LPSA 1PV1A 5NULA 3NZEA 2QNRA 5U9CA 3MWYW 5FQNA 1TUGA 3JARA 3JQ8A 4JAVC 3C15C 1HE3A 1LA2A 4JU8A 4F85A 4WX2B 1W75A 4HLQB 1DG1G 4NULA 3JRNA 8ABPA 1MG5A 4OB7A 3KQMA 1TKBA 3NOXA 2K2WA 1ETHA 1U94A 3OP1A 5FCDA 1BS1A 3TFQA 3HJTA 3RF7A 5AJUA 1A8PA 2P0AA 1ZWKA 1YGYA 2W6ID 3UK7A 4M87A 3IDFA 4NAUA 3W8FA 1J8FA 1XYYA 2JLQA 1Q0TA 1QDEA 3D7MA 3JPWA 4U8HA 1GGJA 3TBHA 4HAYA 3WY9A 1SFRA 2HPAA 4DG8A 1N92A 3M1IA 4G0OA 1X80B 2Z6VA 2NAFA 5CB8A 1WW8A 3HPRA 1RR6A 3LQKA 3NYQA 4UW9A 4BO4A 4YIHA 3QXHA 2H0QA 1EDOA 2R44A 2HA3A 1X8XA 3ZDEA 1TZBA 4JBHA 3UG6A 2BTQB 3U4HA 4RPIA 5CX1A 4ND4A 2GAFA 5EWLA 4C3UA 3V8BA 1QIEA 4MYCA 1NLMA 4FS8A 2R751 3LG2A 3UFXA 3MGBA 1BOOA 1L4GA 4NMXB 4Z1MD 2XUJA 4FFRA 4FILA 1DC8A 3E58A 4Z4CA 1PX0A 4OBEA 3O8LA 5DGIA 3ROZA 4HYEA 1C41A 2L17A 4JYBA 2EVWX 1Y3AA 2D0PB 2ORWA 4CKWA 5B3JC 2JRCA 3P4UA 3NBMA 1ZH0A 1UZAA 1H4VB 4MWOA 1DIRA 3HB7A 4UEJA 1KP9A 1NXSA 3W5CA 1JQ3A 1XMPA 2GD1O 3AINA 2EG5A 1DLJA 4P82A 1XKXA 1X0XA 4AKEA 3ZE8A 1U0RA 5AOAA 5IVHA 1JSZA 1J49A 1U7DA 1YK1A 3L7LA 3TRIA 4GO1A 5JQGA 2BHTA 3L4BC 3NAGA 1VIMA 1HV8A 2J33A 4FJ0A 5KJEA 2BFFA 4DIOA 3IH5A 1UWCA 1WZEA 5KJCA 2A3RA 4YAIA 4UFNA 1G20E 1W4ZA 4TQGA 2CNWD 3IRUA 2YUIA 4Z9BA 1CFJA 1I1NA 3BS4A 3D7NA 4B33A 1V7CA 2OAP1 3MIZA 5JJLA 1JAHA 3B9BA 3JWIA 3LRPA 2G7MC 2QSUA 1AHHA 1Y6QA 3E1KA 2HXSA 4FSDA 4WKCA 3QOXA 2NO7A 4YMLA 1Y33E 2DY1A 4BMCA 2BKEA 2FP4A 1XZ8A 1RDFA 2VCEA 1GILA 3S1LA 3VSEA 4HRAA 4EPYA 5CDFE 1JZSA 5FBLB 3VYTB 5B5SA 3DEFA 3NBAA 4QAJA 4X20B 5FPQA 3GCGA 2PLFA 1TYDE 3KOWA 4EDHA 4KQKA 3KXLA 1WG8A 2EU8A 3GNTA 3Q2KA 5FHRA 2GN1A 1N1DA 3S27A 3SLRA 2NU8A 4IIBA 4OCZA 4RMIA 3UB3A 1VCOA 1XNHA 2ZJ7A 4R2KA 1G9SA 1FNCA 3M4JA 2IQIA 2E1PA 1J25A 3NLLA 2IXTA 2BDEA 2ZPTX 4J0CA 1VG9B 5B7NA 1CNEA 3GFRA 4KQXA 3DW1X 1O94A 2N46A 5EVCA 4EARA 1QP4A 3QU7A 4DXHA 2AOVA 1T29A 5IRCD 1FYWA 1O2DA 4UATA 1XAGA 3PZBA 1L4MA 3RRYA 4G89A 1W93A 2WNSA 2XIJA 5IKMA 2QX9A 3IB3A 3RIEA 1SUAA 1VBNA 5FI5A 1T34A 1VL1A 1WQ3A 3BZUA 2KHZA 4BXOB 2C7QA 1N3YA 3GRZA 4MRVA 2BFEB 3M4NA 4LISA 5A1TA 2EDCA 1KP3A 1X8KA 2EIHA 4YJDA 2CJYA 2OM2A 5CRIA 4A0QA 4BCCA 2PKYX 3PL1A 1NMQA 1U2GC 1GADO 1ISMA 3PNLA 2O1WA 1WZUA 3FTPA 3FCEA 2ZBFA 3KHTA 1H8HD 3H9BA 1RRMA 4OQ4A 4PLVA 1NLFA 3ZU6A 3IDSA 1ENOA 2DPHA 1QHHA 2RC5A 3GZJA 3LDGA 3NKLA 2JAXA 3QVMA 4FE7A 1YJXA 3S70A 3SJZA 3WKDA 2FYTA 5B7PA 5IXSA 2OPHA 3V5NA 1PR4A 1FTNA 2I2WA 2QVXX 2Q0SA 2RGUA 4WDQA 1KDOA 2YXBA 3II6X 1QXSA 3H16A 1CV2A 2AI2A 3IAS1 1E1MA 5C8YA 5BMOA 4OHRA 1HBJA 3E7PA 1QV7A 1B8VA 2XMGA 2IHUA 4IUYA 2F1KA 2WMOB 1GZ7A 3PNKA 4NFSA 3WLKX 4CMBA 3HY6A 1WXQA 4L6AA 4YROA 4XJXA 2BGTA 2KPOA 1HOTA 1SZCA 3QJYA 2CK3D 2JZNA 4NFLA 2H8KA 4WCFB 2GZSA 4B3RB 2QU7A 4L4YA 1E60A 1I01A 3Q0IA 1PQ4A 5AW6A 3DWGA 4BRUA 4A23A 4YB8A 1U98A 2GJ4A 3KVVA 3AF2A 4GIBA 1WNFA 4BMSA 3KE8A 3UM9A 1GZ3A 5AM2A 5CG1A 2R65A 1N0UA 1RI1A 1L4LA 1ENYA 1BMTA 2LR0A 1KU0A 3E3MA 2A2ZA 1V2HE 1GU1A 2VC2B 3IKJA 3WGLA 4FIDA 4W1PA 3WMFA 4EL0A 1S7GA 2JJ2A 2NSJA 3E3NA 1QIHA 3B5IA 2ZKLA 3ZHRA 2TMKA 1KOLA 4GBMA 5ALUA 3KAKA 4B09A 2P5YA 5JIBA 1SM4A 1CERA 2W48A 3OY7A 3OURA 4IFBA 4JOSA 4O4LF 4I1YA 1KMNA 3KELA 4Q6BA 3TKYA 3QX8A 2QVCA 4EA6A 4HH4A 4QECA 4YRFA 1MDBA 4ZAWA 3RYFA 4ZVQA 3FOAA 1Z62A 2WFZA 3FTFA 2HMYB 2EKDA 1DUIA 3CNHA 1CUAA 1S9DA 4UNIA 3NGXA 4OJKA 2Q1SA 3OFSA 4JBWA 3QLEA 1EE1A 5EJ6A 4NZMA 3PL5A 3X1ZA 2RG7A 4LF8B 2VP0A 2ZWMA 1ZJ6A 1F5NA 2JD2A 4RTQA 3AVWA 4BN4A 3IUQA 2Q21A 4M9XA 3HA5A 5B4TA 4XDYA 4YCJA 1PG2A 1QPBA 2DFDA 3GIWA 3MINB 3W0LB 1LQ2A 4HAUA 1QLJA 1HFWA 3PR3A 5JSHA 2GCGA 1RZVA 4KLCA 1ESEA 2IGTA 4H4EA 4AP5A 2ID9A 2RFLA 5KVSA 5A3QA 5D6NA 1Q7TA 3G88A 2Q6VA 3GMTA 3PGVA 3DO5A 3Q6NA 3T3EA 4CM4B 1OB5A 2QTBA 2YMQA 1TEXA 4M7OA 1BWSA 1N6RA 3MJCA 4RD4A 2OZKA 2P9JA 3PNYA 1IHDA 1NLYA 3I23A 5DXAA 2FN3A 1J0CA 4O1HA 2JG3A 2FW6A 1I7DA 1ONNA 3TCNA 3SSNA 3VNAA 4EY6A 4HB3A 3QPWA 3FMIA 1MO5A 1UODA 3R5FA 4NK4A 3OTQA 4HNUA 2J7PA 1OI2A 2KB0A 1WBBA 4NPAA 2G09A 1JDZA 1YHNA 3ZVLA 3LPMA 5DVZA 1QGOA 3AQIA 2GAJA 5CLHA 5I7EA 1XCOA 2OHJA 3T3GA 1CUYA 3OSZA 2CFOA 3AIMA 1L7NA 3IILA 1JR3A 2XNSA 3MG9A 2JAWA 3MS4A 5DHFA 4GM4A 3KTOA 5HZMA 1G291 3R76A 2GBGA 4ER7A 1S8AA 2UV8A 3KDAA 2A5DA 4UUOA 4Y67A 5JXGA 1B0PA 1J2EA 2JFQA 3SX4A 2IS1A 2NUTB 3TPCA 4RC9A 4WEQA 4I8XA 1DXOA 1QU2A 2PBFA 1DJPA 3HCRA 1AJEA 4NZOA 5KSYA 5LQDA 1XQXA 1XRJA 1QF6A 3UMCA 1KE2A 5KMGA 1H2EA 2OGZA 3VC3A 5K99A 1UBJS 4OQPA 1TD9A 2YMLA 4A1OA 2C4MA 2BMJA 3QMVA 1PEKE 4CPDA 4O1IA 4CETA 3SYRA 2IZ0A 3DJYA 1DCKA 2KYRA 3JQDA 4QLBA 4Z0NA 2GZ1A 4YDQA 3A7EA 5ES4B 1QZTA 3TIFA 1BFKA 1RWMA 1D2HA 2LV8A 2V6JA 1RRVA 3TSZA 2IS2A 4L5AA 3AEYA 5EPOA 2CT8A 1LJ8A 4HX5A 4IEFB 4UHEA 4G41A 3ND9A 1E32A 5H3LA 3TLJA 5IS2A 2HBZA 2X86A 1DGQA 4GGMX 4BVJA 3ZVMA 5K8CA 1M6VB 1PJ4A 3VR6D 2D8MA 4BE7B 4KFSA 1NQWA 2X14A 1X87A 1Z6YA 2O3RA 2VZ9A 4U4AA 5KQPA 2VJDA 3GLFB 3BE5A 1J8DA 3MTEA 4RZ3A 5K51A 4D5GA 4W9RA 4JIMA 1ZFNA 1R8YA 3DTVA 3HHEA 3TAUA 1DCMA 4L5CA 1G6KA 4ZI7B 1OBOA 2EX4A 3OJCA 7MHTA 4F3YA 3ZK7A 3EG5A 4FYMA 2J7KA 4B6GA 3F5SA 8AT1A 3DHNA 1QIDA 3WQRA 3DONA 2PGDA 2YWCA 2ZOSA 2OHHA 3KOXA 3O8QB 4JXKA 4RTKA 2IV7A 2KS6A 1V8FA 4IJ6A 5K1ZA 1FXWF 4KCGA 5FUMA 3OQHA 4BN5A 4R7GA 2JAHA 6ADHA 4RFVA 1N8NA 1QO7A 4DPLA 2LIVA 2XKJE 5JEEA 4O2RA 3PITA 2GKOA 3GT3A 2G5GX 1ZY2A 3Q3IA 1A8HA 4JT8A 1U9CA 1Z6AA 5LA6B 3WVNA 4N12A 5GZ3A 4OQFA 1FSFA 1XJQA 3ZV7A 2RCNA 2CD7A 3UAZA 4MI3A 3L7BA 4AJOA 2JAUA 1L4EA 2C5LA 1ODCA 3HN7A 2JI8A 3IQFA 3TLXA 1TK9A 3BEDA 1WMDA 2CLEB 1J22A 2EQBA 2XTMA 2ZYGA 3B13B 3EZGA 3GC6A 4IGFA 5AJWA 4ZKDA 1YK0A 4EBFA 2DAPA 2PZAA 3GGDA 1QK4A 5AP9A 4AQYB 3CR7A 1V7QA 1MP0A 1VPEA 4I6GA 3V2UA 3VR4H 1JB1A 4MR8A 4A5OA 2HPVA 1M2KA 3EGOA 5L95A 5JAOA 5F76A 3JASB 1V6SA 3TLGA 1QH8B 2PKCA 2PMFA 2V9CA 1W87A 3BE6A 3EIFA 2UXCB 1FJGB 2F4NA 1Y8RB 4LYFA 4US0R 2PUCA 3U1BA 3KYBA 1CF9A 1Z5GA 2VYQA 4EL5A 3WYAA 3MS7A 1Y8QA 2AZDA 2D5AA 2ORED 3SOZA 4HWTA 4Q12A 1INLA 4Y30A 1Q12A 1ESMA 3HU1A 5AHKA 3VHRA 3D2AA 3LHDA 4H15A 3LLUA 3WGNA 3FOFC 1PV2A 2IOFA 3ENKA 1I2BA 3Q0TA 3QY0A 4JXXA 3PQEA 3ICCA 3OPYI 2B4AA 3FPKA 3IPYA 3WNQA 3HEMA 3IQZA 5JJ5A 1E3EA 1OFHA 1Q50A 5LWHA 5JWOA 2JLWA 3OCJA 3TK1A 2AX3A 4I99A 2B98A 4G56A 5AHWA 3RJZA 4BATA 5G1NA 4LMAA 1TM4E 3BVPA 4GC9A 4JASB 1H66A 1EX6A 3N6RA 4QBHA 1B2RA 2XHZA 5ABPA 2GMWA 2BFBB 2CCJA 2R6ZA 1N6KA 2WC1A 3PDCA 3OG9A 4RTRA 2V7VA 3C85A 3L49A 4MO2A 5JFTA 1GV1A 2J48A 5CW1A 4BX8A 2FJUA 3FPJA 2Z4RA 4D3YA 5KCZA 2WJ4A 1HMYA 1K7CA 2QRLA 1I2ZA 3Q7QA 1UXKA 3TB4A 1V4NA 1G3QA 1HFEL 3FWPA 4X1OA 1AD2A 2HJHA 5TGTA 3F67A 3T99A 1ZMXA 5ALYA 1AUVA 4XUCA 1H5UA 2Z56A 3L40A 4IWXA 3V8NA 4Z7OB 2VHCA 4GH5A 3LRTA 4MR7B 2MMCA 5AD1A 2JCVA 3NDPA 3BX1A 3A6JA 4KPEC 2HI0A 2ZT6A 221PA 4PC7A 4NVRA 1MX1A 3CG4A 2OFWA 1XFAA 2ZJ2A 4N0QA 4MV6A 3BIWA 4MWEA 1NN1A 1RJ9A 1TE2A 5CXUA 2GWRA 4D4MA 4IDBA 3ANXA 1DG9A 3HUFA 4M46A 4C05A 4DCVA 4BO0A 1DKUA 3I04A 4LYYA 3K5PA 3F6EX 3AILA 3NC0C 3GFOA 3L7MA 5LP6A 1JHZA 3PDWA 5DSXA 1EP1B 2RGAA 1VLHA 4ZTBA 1YZQA 1ZGBA 3SBDA 5LQKA 1MAAA 2GUWA 5DP1A 1C0KA 3DZDA 5FR1A 1MA3A 2OQVA 2Q41A 3G68A 4EB8A 4PG8A 3VTAA 4AZ3A 5FWXA 2HTFA 4FYXA 1DIGA 2D3WA 2W2TA 4O6VA 4PLCA 4RNCA 4UU8A 1I2DA 2OP1A 4F96A 1RACA 3WMXA 3VSDA 2L42A 1P0FA 3A0RB 1D6NA 3DM9B 3U4QB 5AKYA 5TLSA 1SIOA 4QDKA 1LF0A 4IW3B 3F90A 3HN2A 1MV8A 3G5MA 1DINA 2K6GA 3DCJA 3PRHA 1WRBA 2C29D 3CQ9A 3IBTA 4JBYA 4M9ZA 4A2CA 4UUBA 2QD1A 3OIYA 4KXNA 2GXAA 1SPBS 1TMKA 3DZGA 3EF1A 6GPBA 3FVVA 1VJDA 1R4NA 1XZIA 2B6NA 2QF7A 3KEGA 1MABA 5ALPA 5C5DA 3LGXA 2CF5A 4W9NC 4BKQA 1QGZA 3AK4A 2JHCA 2R85A 3KPWA 4IFTA 5FORA 4I46A 4FHDA 4YK7A 4N7MA 5FPHA 1NPYA 3VBCA 4GG1A 2BT4A 4O4HB 4J0GA 1YWGO 5BXYA 2QRGA 3IVMA 1HXHA 2I4NA 1CX9B 2C2ZA 3HS3A 4P98A 1BX1A 1T4DA 3UJHA 5IWCA 1GUZA 1FZTA 3PC6A 3IBGA 3I42A 4JSYA 3T1YB 1H2RS 1VCNA 3K9LA 4YXWA 2IBSA 4DYDA 1S8FA 2FP3A 2ZJ5A 5AVWA 4PICA 4UTPA 1TF2A 1JJFA 4PYJA 1UK8A 3VYWA 4E2XA 5KTTA 4KQEA 2O2DA 3AESA 1LI4A 1QX4A 4R31A 2PKQO 3GGCA 3MRXA 4NQRA 4WKOA 3U7HB 4JLAA 1MC8A 3WIUA 1OZFA 1R9JA 2GO1A 1WHSA 2Y66A 2P40A 1LDNA 1H2ZA 2WAMA 3EIEA 1NVWQ 3AGQA 1F06A 1K98A 2IH2A 4XVRA 1I3OA 3C7KA 1T3ZA 2CXHA 3DV9A 1GTG1 3W78A 2C84A 3O7MA 2WWGA 3DDOA 3UJ9A 4IYJA 3K1AB 1NUTA 4EZIA 3KAPA 1VE5A 5EMNA 3DZKA 4TLBA 4CDMA 3WWOA 4EUSA 2YICA 4PGMA 1FLAA 2H52A 2QZJA 2VDRB 3ZTTA 2HNAA 3ZVKA 5BMVF 3WHIA 2RBEA 3BB4A 3FD8A 3FG9A 3QUAA 3CVYA 1YB6A 4PY2A 3UT6A 1N4DA 2O5RA 2OEPA 3CVXA 1FFXA 1T2CA 4LHWA 3IEMA 5JBIA 3RSOA 2CNKA 1RJEA 3UK1A 4TTSA 3NEYA 2F2TA 2XQVA 4B8YA 3KU4A 3BWEA 2DX7A 3U3DA 4D98A 4KR3A 2AVDA 4GU5A 5MGNA 2GXSA 1N0HA 2OV1A 2DJIA 1E98A 2G9ZA 3DFIA 1KZHA 3RWBA 3BJIC 5TQ0B 5GWXA 4BGVA 1VIYA 3AP1A 3IT3A 3JSAA 4ZK2A 4I3HA 3VU9B 4PLYA 3HYRA 4BV3A 3O92A 3DOOA 1E62A 4JVSB 2QX4A 3PUJA 2ZJ6A 1AIPA 3AOEA 1DTWA 3ZBQA 3GQBB 3V7NA 1JMYA 2W22A 1ZNWA 1C4WA 3I2JA 1SC4A 4X6UA 3BQNB 1Z34A 3IAHA 4UHBA 1DO2A 1BXZA 4Q4JA 5K09A 3WLRA 4W1SA 3FPFA 1XCBA 3NXKA 2Q4TA 1JDSA 3R5SA 3H2JA 4RIFA 4XTRA 4KK4A 4Q34A 3ORSA 1RT9A 1KOJA 3PXDA 3T52A 4NJEA 4IDEA 2CXOA 5IHXA 1EGAA 1HLDA 3PGA1 1NV9A 4KMOA 4F2DA 1QSGA 5C8VA 4YYZA 4KO4S 5BSKA 1MV5A 3NGMA 3AEZA 4MV8A 4Q1VA 4EJMA 3U7IA 1XMSA 1D2CA 2ZTHA 3KZVA 4HPJB 4F6RB 2ZE7A 1SEVA 5JLJA 1VMKA 1WS6A 3VISA 3IDQA 1T13A 4XE5A 2YJTD 3O2QB 3V2HA 1L5GB 5LN1A 2LNDA 2QI9F 4C01A 2O57A 1YAHA 1SHTX 1PF7E 4CF3A 4BQFA 1X8JA 4YJ2A 3Q41A 4TV8F 3ZGXA 1BG6A 5IDXA 1A4UA 1TF5A 2W6QA 3A9VA 4XQ0A 1QHFA 4IUCS 1SUFA 5IDYA 5AW3A 1ACJA 1G8YA 3KZCA 5CXSA 1ATZA 5BQ5A 1XMIA 4GM1A 2NZ8A 2RG1A 2V7QA 5GMOA 3HH8A 4AMZA 4W9MC 5KNBD 1NWCA 3NTVA 2LWIA 4B40A 3OJOA 2O1EA 4YPVA 5FULA 5H9WA 4DIFA 2G0AA 3P52A 1GAWA 3FF4A 5LQSA 2PLRA 4CL2A 4BO1A 2B9EA 3WBBA 1OAOC 4UAJA 5EIXA 3SX0A 2R6HA 1PL8A 1USGA 2ZKIA 4X0EA 5E6SA 1DAFA 2M1XA 2ZI9A 2M6SA 3OWXA 2O8EB 4HJRA 1Q0RA 2C2OA 4FEYA 3I8SA 4K9NA 4LSMA 3HDJA 2WINI 3TE7A 3GJZA 4FYIA 4BJHB 2VO1A 3HHPA 4G4IA 5KREA 4MW4A 1B2LA 1E94E 4FKZA 1ZINA 2P5TB 4DRYA 3DVRX 3I9KA 3PQ4A 1XMOB 3VJRA 4A36A 3H4IA 3L7DA 2FW9A 2WYWA 1BGXT 1P8JA 4HI0E 5E0OA 3ZHBA 4P4UA 3HL0A 3VI3B 5JAPA 3LPAA 4FUTA 3SYNA 1H6AA 2I3BA 5H82A 1TMYA 1ATIA 1G2QA 2NU6A 4QDOA 4NNJA 5HF5A 5TMBA 4JVLA 3RB8A 3IJEB 1H2FA 2CL5A 3L6UA 2UVPA 3SM3A 1HR0B 1EFKA 4N65A 4PONA 2XY4A 3QFRA 4G0VA 4PO3X 1P3Y1 3W2TA 3R9KA 2AKYA 3RI3A 1A8SA 2WU1A 3UUFA 1OH5A 5HHTA 4HOYA 3GEPA 2BR4A 3IKVA 3EC7A 3QKRA 1L8AA 1T8RA 2CKMA 2D1RA 2FRXA 2IFTA 3KJNA 5EEGA 1JGTA 4PZPA 5FFFA 1SBIA 4UUPA 2PO5A 4CNBA 4RAOA 1N2CB 3IQEA 1U65A 3VX4A 3VZQA 2BHRA 1J56A 5P21A 2Y68A 3FRJA 3M3PA 5KVVA 1ARZA 3KB2A 3Q15C 4M98A 2WWFA 3C3YA 3EF0A 3QI7A 1P2DA 1GA6A 1QNLA 3JQQA 3VZSA 3DWIA 1OIWA 4L95C 4N01A 4K9KA 2AN4A 4NCHA 2P68A 1I5EA 3OF3A 3QLJA 5JUWA 4IQ0A 2CJXA 4C89A 4PX5A 4L50A 4BWYA 3N6XA 4OYHA 3IQIX 1V1JA 1TVKB 3W3AH 3ZE1B 5K45A 3MERA 1OPXA 1LK0A 1RWVA 2WHEA 3B12A 1Q7BA 4FFWA 1CUDA 4HL6A 5G4KA 3H3FA 3NTOA 2ECQA 4AP9A 3G0GA 2VJMA 3UK2A 5GM2A 3E2IA 4ARSA 4YY3B 1OH6A 4K7JA 2P75A 3KR0A 3FWHA 5EIBD 3W5UA 1CUBA 4BJ1A 5IF3A 3JYLA 3L0ZA 3RS8A 1Z4IA 5K3BA 4Q16A 2P8SA 3FKJA 1P0MA 3OX3A 4FFLA 2CV0A 1G8PA 4CR6A 4FCWA 3R0XA 4ONEA 4Y9TA 3BRWA 3GT7A 3OMXA 3W4KA 1DL5A 1L4NA 4GYJA 4HGYA 4NHOA 1XF1A 2XB6A 3BQMB 3UAGA 4N6OA 5FOVA 3TVTA 3OZGA 1QH1A 1O89A 2WHPA 2WF8A 2C0CA 5J23A 4RHTA 3IQHX 1RHKA 3O8RA 3D8SA 4G1FA 2PXHA 4HQFA 3TNYA 4B6OA 5HGJA 2H51A 2IEIA 2H2GA 4GVXA 4YI3A 1ZUNB 3GV0A 4DF3A 4QT4A 3JAMA 3ETCA 1WMSA 1MENA 3OEED 1DOAA 1PHRA 4IV0A 4M1KA 3ETLA 3V80A 1AGPA 4FI3F 1R66A 1H1LB 4FEAA 3GCWA 1R8JA 4R8MA 4V0LA 4XYMA 1CUVA 5F33A 1E79D 1AT1A 4F5ZA 4CEJA 3ELUA 1BJKA 2HK7A 3M5CA 3CONA 1Z4JA 4TKMA 4XFDA 3T5PA 4G0UA 1S01A 1U90A 3ZHOA 4ZN6A 5GAJA 1L5OA 2MSKA 2CJFA 2DWCA 2UUPA 2N3ZA 1KC1A 2ZRLA 4NDZA 5IK2A 3KHKA 1UOOA 2Z5LA 1P31A 3AF0A 3IJRA 2VQEB 2J0QA 4K28A 3PHIA 4KKXB 1CQIA 1F8XA 4G63A 4DOMA 1ZH8A 2R6CA 4LY6A 4CG1A 3GFPA 2IDKA 4BO3A 2HR1A 4BDSA 2HSWA 4KZPA 4FFSA 4TRNA 1J0AA 3GLGE 2IYUA 3RQIA 2WICA 1GTMA 1WR8A 3EODA 4HNSA 4R54A 3UUEA 4FDMA 2V7UA 1JHAA 3S28A 5LMNB 2GM3A 1VE6A 2Z6UA 4QYSA 1AKMA 3LECA 4G86A 1QVZA 3PENA 4WZ6A 1SNYA 2NVBA 3H5IA 3T0GA 3COJA 3FOWA 1KVRA 1QAQA 1BOFA 3KHUA 4EFDA 3DGFC 5IKPA 5TF4A 1E3TA 3GJXC 5D7NA 4HN9A 4BNNA 4KW7A 5TR9A 5EC8A 1YNSA 4DA0A 1P2VA 3WQBA 2QX6A 1CUCA 3ILHA 1JUDA 4WKNA 3HXMA 1R0KA 1K7YA 2AMLA 2QVLA 5EP2A 4PZ9A 2AQ8A 4FGWA 2WV7A 1GXSB 1H8EA 4S2UA 3OEHA 2BFPA 1HNZB 4AX8A 1Q83A 1QYVA 1AUPA 2IYPA 2X2EA 4MPDA 1PWEA 4HXYA 2EF1A 1QORA 4HQ6A 5BSEA 2VRWA 1X92A 5HP4A 3IJPA 3H2HA 4CLOB 5EJAA 3EXFB 1EXMA 2ZIGA 3W4IA 2G4LA 3C3BA 2WU8A 3D0RA 1E2FA 3D3NA 4B35A 3IULA 1FF9A 2PGXA 3DVQX 4RJ2A 1L8QA 1TKAA 3R23A 1KMHB 1CRPA 3W6ZA 5IC5A 3JW8A 3K2IA 4PZAA 5DXFA 3K0BA 4EELA 1Q1NA 3LQ2A 3WJAA 4R68A 1SZJG 4MUKA 2D2EA 4E7PA 5IT9A 1DC6A 3GO4A 4AMUA 1C30B 2AUMA 3FR8A 2X8AA 3RWOA 3ZDXB 4MRMB 5EXPA 1AK2A 1GPWB 4IKEA 4ZYUA 1E20A 4L4SA 5IDWA 2EGGA 2VP2A 4W8GA 5H0IA 1E2PA 4DIUA 5CD9A 3WAGA 5DBEX 3CX6A 1Q95A 3LK6A 3BFVA 5HDQA 4J0FA 2B2NA 3JAWA 3PT9A 4R8VA 1EFVA 1XTVA 4XX0B 1Y9ZA 1DCFA 2GEKA 3I01A 4XVCA 3FKSA 1X9HA 4BNYA 4RV5A 3THYB 1JR6A 4N0PA 4REQB 2M32A 2B4KA 4X1YA 4EJ6A 3CKYA 1DKQA 1YULA 2AFIA 3QBDA 4D92A 5CBPB 3PBKA 5DM0A 5KS2A 2J59A 3C0KA 1PYGA 3FAZA 4O4IF 1CHNA 3TL2A 1E3IA 5FPKA 5I47A 2JGIA 2C92A 1XRSB 3G2HA 4FDLA 2CZGA 2NTYC 1GKYA 1I7PA 3EWSA 4EABA 5BV2P 5IC4A 3E9NA 5AWFC 1NQTA 1MQSA 1SULA 2PSHA 2UDPA 1DX4A 3GA7A 3A1DA 3QWIA 4NKRA 1X7WA 3OZFA 5BN3A 3U7FB 2RGEA 2ZVJA 2WHXA 3CUYA 4ND8B 3TOCA 3T7DA 5KYXA 2H8GA 2NZUG 2ZWVA 5SYMA 3W06A 4UD6A 3WK4A 1U7XA 2VRCA 4WFQA 4DEYA 5K0LA 1X7YA 3ESXA 3OCXA 4JZKA 2H4XA 4IZOA 4TWRA 2CFIA 4L3WA 5C34B 2NQTA 4AJJA 4B2PA 4E08A 3V6MA 5JVDA 1EJ0A 3LX6A 1EE2A 2FUG1 2ZSFA 1J2RA 1U4NA 4IIHA 4KC0A 4N0DA 5CFQA 3A0UA 4B80A 4DIKA 1Y9JA 5JMPA 1HETA 1PL0A 2QTZA 4UNSA 4YONB 2ZUEA 2JJ1A 4GLLA 4OX9Y 2ATCA 1E3WB 2J3EA 5BT9A 2JA1A 4XVUA 1ICIA 1RAFA 2EBHX 3EGEA 3RVSA 1GNSA 4TM8A 2C4KA 5EXXA 1YJBA 1F17A 2N0SA 1B76A 4KMMA 3P2EA 1FP7A 1W9MA 3PPYA 2V7BA 1R3DA 2VF8A 4FUQA 3WLIA 4WN9A 4I6JA 5B3JA 5BNFA 1XO1A 4MINA 4B6FA 1NMEA 1NOJA 3EC2A 3MSCA 4XM0A 4CV3A 4DN6A 1LBHA 3KXDA 4LN1A 4M6WA 1KI6A 5IW8A 1DDOA 4NE7A 2CE7A 2HHJA 4V0OA 2TSYB 4FEGA 3Q5DA 4X3PA 3AJDA 1E96A 3E27A 4PO8A 1NC1A 5HMMA 5LU9A 2IS6A 3KT0A 2O8DB 5ALVA 2HIAA 4EUNA 3O3NB 4MJLA 4U7DA 3ISVA 3JQBC 4REMA 5C1BA 5FYDA 4E5DA 1RWOA 2AI3A 3KETA 4K3VA 2WWTA 4JX8A 1G4UR 4IVPA 1NOKA 2GCEA 3I37X 3LU1A 1B0AA 1I14A 2X15A 3OLQA 4EEXA 4EPVA 2RAFA 3PTAA 3KIPA 3LYAA 4ENTA 3V6LA 4DM3A 2FLKA 3EUWA 3M3DA 1SHUX 2D5CA 3GNSA 1ILEA 2IA5A 3D7SA 3OZDA 3K31A 3QLUA 2DR3A 5CAEA 1T3HA 2I8CA 3AERB 5CDTA 1T6ZA 4NBVA 4OAOA 3SZGA 3T1NA 2IGBA 4R2XA 1N77A 1XZGA 3BWYA 2JJ8A 2G0NA 1GITA 1NJFA 5GM1A 3V8VA 3PB3A 4QYTA 2FFHA 4L75A 3AKDA 5D87A 3NBKA 2RB5A 1RW4A 4FMDF 1WXGA 1LJUA 4GE3A 4JYPA 3RC1A 3MLAA 1V26A 4CEIA 2Y2UA 2Q7OE 2EFHB 1R7RA 4J0DA 4DIDA 5JAHA 4FCTA 4Q7MB 1DKNA 4BC1A 3IEKA 3VPXA 4MUGA 3A1WA 5B57C 5A04A 1LUAA 4MWCA 5HF6A 1YL7A 4GPTA 4E30A 1U2PA 3HSKA 3RUPA 4ZALA 3TAXA 5KNCH 3QEAZ 1EB9A 3QU4A 1IXRC 3WV5A 1KYWA 1OILA 4JL5A 4PIPA 2ZVPX 3UJ6A 1BFUA 4PPGA 4Y1RA 2L19A 4DJEC 2H1IA 1VDMA 1M3SA 2VQFB 4JZYA 1CZRA 2V4ZA 3I8OA 3SR0A 1WWKA 2IEYA 3AR9A 3KFXA 5JXWA 1SKMA 2P67A 4Z7QB 4UOEA 4TS3A 1NL3A 1UAGA 4OKIA 3OT5A 2DPXA 5GV8A 2Z0MA 3KWFA 1ADYA 3RANA 3T4PA 4Z5XA 5TQVA 4CKEA 4AYTA 1RRKA 4BFCA 2YJ3A 2WFLB 3FA2A 4ILKA 4RKQA 3OUTA 1PG5A 3DKRA 3FX2A 2YJNA 4R1UA 3CZQA 3UJPA 1QO0D 4OQEA 3RRBA 3TRJA 5TB5A 4C5BA 4Z7NB 1ID1A 4KYTA 4J0IA 3DZIA 2C54A 1QOZA 1ZO8A 5JT1A 2CXPA 5F3DA 3O2SB 1L4FA 2FX5A 5D51S 2QN3A 4YH1A 1K7XB 3ANNA 521PA 2IHZA 4PPYA 1RXEA 2I6SA 3M5DA 4OA8A 3WLLA 4Z4FA 1VHWA 1LQTA 4EG5A 1MAUA 1ZA2A 2H7XA 4MAFA 5HKBA 2ADMA 3I62A 1W5AA 3REQA 1JQJC 1Y1PA 5LNK6 4DQXA 3WNCA 2FK7A 1Z6TA 2EP7A 2QXUA 5ALRA 1CRLA 4OG2A 3FNFA 1HO3A 1J9ZA 1NW6A 3KKNA 3D6AA 4PYRA 4A82A 1QP0A 3EDYA 5CNIA 1XXHB 1XHLA 4IF6A 4PO9A 2W2OA 4CV1A 4Q1FA 5EESA 1IXYA 5B3AA 3CRZA 2B20A 1EIWA 2QWXA 1AKUA 1IZ7A 2FN9A 3OE4A 3H11B 3PNVA 2CVZA 4MUBA 1KJQA 2DP4E 4DWJA 3WOVA 3L0CA 5JZMA 3UGTA 1MB2A 2ESRA 2AA3A 2QD5A 2O8BA 4GFDA 4C14A 1WDKA 1WDLA 4RK0A 4G65A 3SQDA 4C4AA 4D9GA 4AS1A 1IRXA 3AP3A 1RQRA 621PA 2G80A 3EGDA 1FYDA 3KSBC 1YVRA 3PNSA 5COAA 3NNSA 4AIIA 5E4JA 5HKOA 1GTL1 3O8CA 3ZLTA 5LP1A 2ZBEA 1FP6A 1ORIA 2AOTA 4YMVA 2NU7B 1Q1GA 3ZXUB 4UM9B 3VVBA 2W2LD 3A9SA 3QVGB 4UMFA 2IL1A 5TEVA 3ZWVA 1BU8A 1KL7A 1VPTA 2K5UA 3C7CB 2XZPA 3JQ7B 4WNAA 5EJ8A 5K3CA 1K8XB 3DVLA 5EZYA 2BHLA 5KQRA 4NSNA 2W6ZA 2PL1A 4O25A 1DKMA 1SOUA 2Q8QA 5H1YA 5C7IO 1CDDA 4HXEB 4NAHA 3EWIA 1P0QA 4D3ZA 5L8VA 2X40A 2JPDA 2IU3A 5D3ZA 2FPGA 5HE8A 4K8RB 2JFPA 4PZDA 5CA0A 4XZ3A 1CR1A 2I76A 2YZ2A 2J32A 5KOJB 3ZWQA 4JP1A 3R3WA 4AZVA 5J2TB 4FNMA 4NBNA 3I32A 3SPXA 1NXWA 2QE7A 3D31A 3SZMA 4DIEA 4EMBA 1NRJB 3GG9A 2XTJA 5F35A 3OQJA 3KEOA 2O19A 1JZQA 2PFKA 3M5WA 3H0KA 1ZH6A 4OI1A 3A8TA 2E87A 1P1RA 3IBSA 4F5YA 1NMYA 3RYCB 4D25A 2BEUA 4YWHA 3GLUA 4NK5A 3WMEA 4TYWA 3AVQA 5U4XA 3PQDA 5C5IA 3AT1A 1P7VA 1G8FA 2GLTA 4MYDA 3A4TA 2BMEA 3TM4A 3DFZA 3GJ3A 3D7RA 3OLVA 4G4SP 5B58T 5H3CA 2HWXA 1HG0A 4H4DA 3SQXA 4DV4B 2VYND 1U3UA 2PWAA 1JKFA 3L6BA 4E09A 1RC8A 2I1VB 2I03A 4RE6A 2EJBA 3ODGA 3O6VA 4UAVA 3IEUA 3OE7D 3HBAA 3ADOA 3UH1A 3MTIA 1KK3A 4CKCA 4KGZA 2W8BA 1KRXA 2BDTA 5D1NA 2OBFA 4G26A 4TKUA 4D9FA 5COBA 2NX2A 3PICA 4NS1A 4FB4A 4QM6A 3IP8A 4FFPA 1OY1A 1IIBA 3FUWA 1J1UA 1VPDA 3DMTC 1CTQA 4CM9A 1U0EA 4HMPA 2ZPAA 1CJBA 3EULA 3GGPA 3ITEA 3LUKA 4R5MA 4R8LA 5DOVA 1U8TA 1YACA 1Z33A 4PFQA 2FWNA 5ICGA 4UULA 1VSBA 1SCQA 4X44A 4LQLA 4BZZA 6NULA 3L7IA 5TPWB 3RSHA 1KBZA 3WP1B 2H5EA 5K2MA 3S8YA 1TT5A 1XFDA 3E9YA 2VJKA 4DAOA 3B60A 1X1SA 4FMCF 1AMOA 4I9GA 1XJ0A 4D2IA 1KFEB 3O3OB 1UXOA 3TLAA 4CM6A 3OFND 4CQMD 4EW6A 4CF7A 5JTUA 4DSTA 1JT9A 5CK4A 1DKLA 1X9IA 3CXRA 4ZOCA 2YN0A 4BNMA 2X23A 2J9RA 2IPXA 4R9VA 2OVBA 1J0DA 1GG9A 1GGNA 1M8PA 1D1QA 1NKSA 3W5VA 1PDWA 4D56A 5BUSA 2RH4A 2XTAA 5KVAA 3SFVA 1E2MA 1DRKA 1LV7A 3AONB 3IAEA 1J7KA 1ZVVA 5JHHB 1UKYA 2E4ZA 3QKSB 4L9SA 4BVEA 4D3SA 5FUBA 4S2EA 2VHZA 2D3TA 4W82A 2VDPB 2NXWA 4OK5A 1DFHA 4MKRA 4OQYA 4XLLA 3VNBA 2CB9A 3EMBA 3I4CA 4XPIA 1GKKA 3RVKA 4HEJA 2XCSB 1CR0A 1SUIA 4AJ4A 3GLIE 1Q92A 1XZAA 1AXEA 4FHZA 1QCCA 4MAAA 4R4JA 4MP8A 5DGDA 3UPDA 1CJCA 1EE9A 3L0SA 3OM8A 2P4SA 4HX9A 5D1HA 3I83A 3HEBA 1A7AA 1KWGA 2CZCA 3F78A 5EWMA 3SR3A 1W2GA 3F98A 4JGGA 2WD7B 1OUMA 4QAQA 1SXJC 1ESCA 4CCAA 2ZETA 3H04A 1PFQA 2CVOA 2MSWA 1M1YA 3UKDA 5JDCA 1F4PA 2A5LA 2H85A 3BSYA 5L6MB 1ODLA 1XDDA 2GRJA 3I76A 5HF8A 3R0JA 4BMVA 1UIMA 4WK6A 4I1VA 3MTDA 4NPHA 1UQUA 1L4UA 4WADA 3RTAA 4AX4A 5C0OE 2O05A 1GT91 4KE6A 2YVLA 3EPHA 4JLPA 1TUBA 1BVYF 2XRYA 3B6JA 1MC1A 5CYGA 1JEYA 3L01A 3SE0A 3AUTA 1PWHA 1FNNA 1TAGA 1J8MF 2V97A 4FGJA 3H1EA 5FTKA 4DSZA 3D3JA 3VR1A 1BRTA 4W99A 3DBOB 4J16A 2P6MA 2H06A 3ZWMA 2AMJA 4BRSA 3H19A 4MMYB 1G16A 1E5LA 1ZBDA 3N2YA 4Z49A 5ARBA 5BVGA 3I34X 3LUJA 1MW8X 4ARZB 2I87A 2BW0A 2RHJA 2QP9X 3KVOA 1E1QD 5TGZA 2B61A 3DWFA 3DMNA 3OPXA 3OTGA 4NDAA 4TSFD 3TZHA 5E3HA 1ORDA 1PJTA 2R1TA 3ST7A 1H5QA 4BRZA 4TKLA 4KXFB 1U0GA 1O4WA 1KTIA 4GVPA 3LBHA 2BFDA 3HXPA 2OO3A 3JR7A 3KKQA 4CIYA 5EIEA 2XJ4A 2AN5A 4H6VA 4MRSA 4XFJA 3F8TA 3W7AA 1QP8A 2B7LA 4RJJA 4Q4HB 2YWGA 3EZ7A 3ZS8A 4B87A 1MAVA 2O20A 3KLBA 4X7BA 2DFPA 3SKVA 4F2WA 4P3OA 3D8TA 3FLAA 5ESRA 3RIYA 4KTTE 3STTA 1UPFA 1K89A 4Q66C 1CJKC 2QR5A 3RJ9A 1GNLA 4YLGA 2BMWA 2PL5A 4O4LB 4Q24A 3T5GA 2AJCA 4LXHA 5P8WA 4UVIA 1X94A 2Q4EA 1XDGA 4Q9DA 2JASA 4HDMB 2ZAYA 3WWYA 4RY0A 5ISMA 3RO7A 3L7JA 3ZV6A 3LZ6A 4C5CA 3VNVA 2R6DA 2HD4A 4FK8A 4Y98A 3BCSA 4OU4A 5A6SA 1VKRA 3H05A 4UEQA 1NX9A 3TQTA 4F4IA 4HTAA 5HBGA 2O54A 5I3ZA 3CYFA 4GLOA 3ZD7A 1ECGA 1SG0A 2VT7A 1XALA 3WLFA 1AM4D 3TNDA 4GAEA 5GGXA 4A6DA 4R3NA 4EKNB 3FGOA 1GR1A 1WE2A 1U0FA 4IO0A 3E5HA 3ZS9A 1GG5A 3ZBPA 4IIJB 3Q11A 4DTIA 1NMZA 4YCSA 4DB4A 2CXQA 3E7DA 5IULC 1V3VA 2B94A 5BR1A 3N0WA 4ZT3A 2O7RA 2YTZA 1XTBA 1JG7A 4IDFA 5E9JA 5B4UA 4F46A 1PR6A 4J1SA 3U40A 1XTQA 3HRHA 1Z63A 3G49A 1FNBA 1VXOA 2Y1OA 5LXTF 1HZZC 3RV4A 2B4RO 1AQNA 1XAHA 2RCYA 4WN3A 1NF2A 1F4LA 4EYEA 4PXSA 4ZZ1A 1ZXLA 4C78A 1YQUA 4XGNA 3U5ZB 2OHGA 3BKXA 3CLKA 1QG6A 4MGYR 5HM8A 1VI6A 2D8AA 3L5KA 2XBLA 1B3BA 3FB1A 1SBYA 1J1IA 2WE7A 1XLUA 3O9VA 4RULA 5LL6P 1QC5B 5F1PA 1YBAA 2XQFA 3A1UA 4YJ3A 4WXPA 3B1FA 5BNTA 5JS8A 1X1QA 3OM1A 1E2UA 3ZC3A 4QUJA 1YCDA 3VSAA 16PKA 3HEAA 4RPLA 3WRYA 4DV1B 1HE2A 1VA4A 5ANRB 2QT9A 3U7QB 3IEVA 2Q5FA 4G0NA 3COVA 1PAUA 3ZY2A 1KFJB 3PPIA 1QX3A 1O97C 1JEQB 1IHPA 3AUSA 1MB3A 1VE3A 3I45A 3KQPA 1N2IA 4N9QA 1FP4B 2P9HA 1EKXA 4UQOA 2O0HA 3L7KA 3G7UA 4O8ZA 4G1BA 1TEZA 2FFJA 2AFHA 1D2GA 3I1FA 3QVLA 1HK7A 1DUSA 4D6PA 2INGX 4WI1A 5LFAA 1L5HB 1ONOA 4OI2A 4W9NA 4TVOA 3QKUA