2VFBA

The structure of mycobacterium marinum arylamine n-acetyltransferase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE
publication title Divergence of Cofactor Recognition Across Evolution: Coenzyme a Binding in a Prokaryotic Arylamine N-Acetyltransferase.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
total genus 83
structure length 272
sequence length 272
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2007-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 2vfbA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 2vfbA01
4NV7A 3LTWA 1W6FA 3D9WA 1GX3A 4C5PA 4NV8A 2VFCA 4B55A 1W5RA 2BSZA 1W4TA 4GUZA 2VFBA 1E2TA 4BGFA
chains in the Genus database with same CATH superfamily
4GJSA 4OS8A 5H9LA 4AZOA 1K24A 1VWEB 4GH7A 1U0XA 3B2LA 5B5FA 2BHVA 1EPBA 4EFGA 1RSUB 2IZDB 3WYQA 4BX7A 3RSWA 3FELA 4FQBB 2EU7X 2JGSA 4Z6JA 2IZEB 2X45A 1BSOA 2W2BA 3RDQA 1GT1A 1GX8A 1ACDA 1G5WA 1Y9LA 3LHNA 4OS0A 2FLJA 3NQ9A 4DCBA 4Z2VA 1ZNKA 2X55A 3STMX 3FW5A 3ZW0A 4FGIB 2MF6A 5FAZA 5BYPA 5HZ8A 5EEDA 1HMRA 4BX5A 4O4UA 2AKQA 1VWAB 1X8QA 4ZH9A 2JU8A 1A3YA 1KT4A 4GNYA 5EPQA 4ZGUA 4GGZA 4GGTA 2AH7X 5FENA 4I3DA 1SRGA 1OPBA 2FKJA 5F6BA 2OF8A 1PBOA 1SLDB 1UREA 4MVKA 4ORSA 3F9DA 2OVEA 2R56A 1SWFA 1VWPB 4YGZA 1SA8A 3IA8A 5HTEA 1Y53X 2YG2A 3BU1A 3D96A 4YDAA 1NP4A 5BVSA 1VWIB 1OSPO 3HWGA 1N7YA 1HQPA 2PI3O 3WJCA 4GKCA 4K19A 1YWAA 5H9AA 4DMOA 1CJ5A 1DF3A 2PQTA 5HCEC 1KT6A 1TW4A 4EKVA 5HAEA 2WQAE 1SXUA 1SWKA 1IIUA 3B2JA 3BDRA 2DM5A 4I9RA 1OBQA 3UAQA 2L67A 1QFTA 1SWJA 1VWBB 3KFHA 2IZKA 1SLFB 5K68A 1GT5A 3OE3A 3T1DA 2Q2PA 2G79A 4NW4A 1A57A 3MX7A 3VG2A 2GTLO 3HOEA 2IFBA 1MX7A 2Y3EA 3SZIA 4INNA 3RDMA 3FA9A 1ZNEA 3ZI8A 4ON1A 3APVA 1VWKB 2HMBA 4YKMA 5D45A 3WJEA 2AMMX 4CDDA 1HBPA 3MM0A 3WBGA 1FTPA 3EBWA 4JHQA 3CQRA 1SWHA 1FE3A 3Q6LA 3D97A 4NLIA 1A18A 4TKHA 1HBQA 4O4OA 2A2GA 4YBPA 4CDCA 1I78A 1EPAA 3BU9A 2HZQA 2W2FA 5B27A 4U8UM 1GM6A 1STSB 1KT7A 1YUPA 4QZTA 2X32A 2A5BA 4Z28A 5IO7A 3RDXA 5IXGA 4TKBA 2HLVA 2OY8A 5B3MO 3FIQA 2WWPA 1O1UA 5IRAA 1YWCA 1N4JA 2FTBA 3FA7A 1KFFA 4O3WA 3NQKA 1G74A 1AVDA 1JMXA 1SWOA 2YMSA 4QZUA 1LNMA 4QNIA 4DQ3A 3TGCA 4ZH6A 1GT3A 2IZLB 1LELA 2GH7A 4FBRA 1TXLA 2CM4A 2WQ9A 2IZAA 4Y0RA 5EZ2A 4YGGA 1IKEA 2OY5O 2FRSA 3RE6A 1T8VA 1SWRA 4Y0QA 5KHPA 5LJEA 1E06A 3G7XA 4L1NA 2F73A 3FR2A 1LF7A 2RTLA 1NC9A 5LJKA 2QCBA 4MIRA 5L8OA 2RTPB 2LA7A 4AZPA 4AZQA 1BM5A 2HNXA 4FBVA 5HCDC 2FGSA 2IZHB 2Q39A 3X00A 1KL5A 3FA6A 3WJGA 2L68A 4KIIA 1G85A 2W2AA 1ERXA 1N43A 3T2XA 3LNBA 3ELXA 2QO4A 2RTIB 1OPAA 3RY2A 3APUA 2BT9A 2K23A 2QOMA 4QYPA 5IO5A 3WJDA 2RTBB 1DZMA 4AW8A 2OFBA 4ZFXA 2OF9A 2Y32A 1ADLA 3JQOA 3BSZE 4IB7A 1FDQA 1N9MA 1L6MA 1NDJA 3JSQA 2P8GA 1UYOX 5IRUA 1ZNLA 1DFVA 2VDFA 1OEKA 1SWPA 2MJIA 4Y59A 1HMSA 1VWGB 2RTJA 4O9SA 3FENA 2PY1A 4ZHGA 1LIBA 1MK5A 4IRWA 2F01A 2GTLM 4MVIA 1RLBE 1SY0A 4ZHDA 3ZW2A 1I06A 3WZPA 3S5XA 1JJXA 1Y0GA 1BBPA 1OBPA 1Y52X 2GJ5A 4O4XA 4EDEA 4KT5A 1SLGB 4ZHCA 3APXA 4O4SA 5D47A 3UEXA 2ACOA 3CWKA 5KIDA 5KICA 3P6FA 3ZZVA 4XMEA 4CSBA 1VPRA 4KC8A 4CPEA 3VG7A 1FJ1E 3SLOA 3OD9A 4GK9A 4LKTA 3HWEA 4FBOA 4CDFA 4RUUA 5CYBA 4PSQA 1PEEA 5DG4A 1SY1A 3O22A 4ORRA 5HBSA 4AYHA 1S7DA 2UYWA 4BGFA 3DSZA 4BOEA 3VG3A 3MBTA 2ALLX 3PK2A 2OVSA 3PECA 4YKOA 1KL4A 2ASNX 4GETA 1SWTA 3PH6A 5LKFA 5AQ6A 3PP6A 3K3LA 4YCHA 2BC3A 3GAQA 2BLGA 2CBSA 1X8NA 4ORWA 3C78X 3BX7A 4MVEA 2FHNX 5B10O 1E02A 1NGLA 1ALBA 3SZJA 1EI5A 2X46A 1SY3A 3PH5A 1I05A 3U9PC 1QABE 4BBOA 2C4IA 2VFCA 1X89A 2RTMA 1VWNB 4LKPA 1EALA 4ALBA 3NQ3A 5B11O 2RTFB 3ZUIA 2RTRB 4OMWA 3RE5A 5K67A 3RDSA 4OEMA 4XMHA 2O62A 4A60A 2UZ2A 3HPEA 2IJAA 3STKA 2KT4B 3KFFA 4ES7A 3SOTA 4CPHA 3KFGA 3WOVA 4ZJ0A 1AELA 1GKAB 1VWCB 1GX9A 4WHIA 1BSQA 3MVFA 4U8UN 4YFQA 4AZRA 4CPIA 1I9HA 1EIIA 4A1HA 1RSTB 1W5RA 2AVIA 2MWHA 1N0SA 4HWMA 4NNTA 2WUTA 5HA0A 5D48A 1ZNHA 3FA8A 1FENA 3TF6A 4YFRA 3KVNA 1KT3A 3T6LA 4N7DA 2Z4IA 1KXOA 3C77X 2IZIA 2QOSC 3NADA 5B2AO 4IAXA 4KCAA 3D4RA 3VGWA 2QO6A 4YH0A 2FR2A 4JGLA 4TQ2A 1Z24A 4D6BA 4DNEA 3UEVA 5IO6A 3HWDA 4L3RA 3N91A 2R74A 4I60A 4YBUA 3KZAA 3NX2A 3S26A 1T0VA 4GE1A 2C1QA 1JV4A 4LZVA 4OS3A 1JJJA 4TLJA 4JNJA 1BLRA 2AT3X 4UU3A 4GUZA 2L5PA 1RXKA 3BS2A 1MUPA 2DJGA 3AEHA 3OJYC 3D9WA 2JN3A 2FT9A 2G7BA 5CHKA 3P6DA 4U9CA 1NBXA 1MOYA 1Y9TA 3CKFA 3PQUA 4ALOA 1GXAA 3ZW1A 3NPOA 2DJFA 1VWDB 3P6CA 1HQQA 2M4LA 5D4AA 3ZUOA 3VE1A 4YFPA 1SXWA 5HA1A 4BX6B 2XKLA 4MEEA 3B2IA 3TZSA 1VWMB 2ANSA 1S2PA 1DF8A 1UZ2X 1B4MA 4EXZA 3QKGA 1QWDA 2XSTA 2BS5A 1SY2A 4IMNA 1E00A 2OVDA 3BY0A 3FIDA 3PDFA 4IBAA 4ODDA 4ORYA 4NV8A 4A1YA 5K06A 1B56A 3D95A 3VG5A 2WSJA 1KT5A 1OEJA 2X34A 4O49A 3ZQ3A 2CBRA 2IZJA 2KD2A 4AZMA 3EM0A 4ZR2A 5FQ6E 1E5PA 4ZCBA 2BS6A 4BX7B 2G5LA 3EMMA 3WJFA 1S44A 4NYQA 3P24A 4BVMA 1CBSA 2FR3A 1BRQA 2HYSA 4NNSA 3QQ2A 1ML7A 2GTLN 1STPA 3F8AA 3UEUA 1U17A 2KTDA 3NBXX 4R0BA 3ZW0B 1SMPI 4BX5B 2IZCB 4WFVA 3P02A 4XMDA 1SWLA 1SREA 2FWVA 5AEOA 2WEWA 2JMBA 2HKDA 2ZSCA 3CBSA 5F58A 3HTYA 4D6AA 2FHLA 5BVQA 2LB6A 3VHIA 1PMPA 3CQNA 3OBLA 1SWNA 2NNQA 1GGLA 1VWHB 2F09A 4GNWA 1JIWI 3WZOA 5AJCA 5H9KA 1B8EA 4ZGFA 2CAMA 2LFOA 1VYFA 1BSYA 5L8IA 4EEJA 1JZUA 1QFVA 2KTSA 1OBUA 3IFBA 3VHMA 2X8TA 1AQBA 4ML7B 5F6ZA 3WZQA 3FR4A 2HZRA 1O1VA 1QY2A 2G8CO 2RA6A 1GT4A 5D8JA 4YMYA 1AB0A 1BEBA 1MDCA 2QM9A 4HPDA 5B5GA 2OFRX 4O3YA 3L4RA 5F2BA 2RN4A 2OZQA 3FW4A 4BCSA 1VWQB 1EW3A 1IJ8A 1TOUA 2WEXA 1X71A 1SLEB 1NP1A 1FELA 2POAA 1TOWA 1LDOA 2FS7A 1BWYA 4HPBA 3E3CA 4M7MA 3U0DA 1TVQA 1JQPA 3BRNA 2NP1A 4HFOA 4IABA 4LQZA 4XMFA 3BX8A 2AL0X 1HXZA 2RD7C 2X8SA 4GZVA 4Y0PA 1SWQA 3SAOA 5IRWA 2FS6A 3WYPA 1QQSA 4JO6A 3P6GA 3RDOA 2LBAA 1ICNA 2OY1O 2Q2MA 4IB6A 2MHDA 3V8UA 3WZNA 1LPJA 1RXHA 5F7GA 1D3SA 1LFOA 2RTKA 4BJ8A 1LDQA 3VG6A 2Q9SA 4IAWA 3AKMA 1MX8A 1HXLA 1GX3A 2CM9A 1SRJA 4TNNA 2IZFB 1VWLB 1X8PA 5FQ7E 3SZHA 1LIDA 1PTSA 1SWBA 1VWJB 3FDCA 3S5VA 2ZAIA 1LICA 1SWAA 2RTOB 3VE2A 1SWCA 4ARHA 1WBIA 2RTGB 2A5CA 1EXSA 3APWA 4IB9A 1KOIA 4CPFA 1G7NA 2RCQA 5HWZA 1KZXA 4O3ZA 4O3XB 5B29A 2RCTA 5LJCA 3AKNA 3CR6A 3EW1A 3LTWA 3P6EA 4BQUA 1PBYA 4ZHFA 1CBRA 3VG4A 1ERBA 2A3FX 4YCEA 1MM9A 2IZBA 4ZHHA 1ZNDA 1KL3A 3WXQA 4RUNA 1SXXA 1JJUA 2NNDA 2AT8X 3FEPA 3FR5A 1RAVA 2QO5A 3MG5A 1H91A 3STNA 4GJVA 4QRLA 2MM3A 2A8GA 2RTEB 2AT5X 3VPJE 2JW1A 4GDZA 1IKJA 3PPTA 4QGVA 3I0AA 5L8NA 2X56A 2L9CA 2OYBO 4ORUA 1K3BA 1YWBA 2N93A 4M6SA 1SWSA 2A13A 1LIEA 3BLGA 3C76X 3WJBA 2JU7A 4A8ZA 1R0UA 1SXYA 3Q34A 3RDUA 3O2YA 4I95A 3HOLA 2LKKA 1MVGA 2NNEA 1X8OA 1N9YA 4IMOA 3TGAA 2VFBA 2PFRA 2AT6X 2IZGB 3DTQA 4CDEA 1HY2A 1KGLA 1EUOA 2RTNB 3O19A 3P6HA 4NYRA 4DQ4A 5HCCC 1SRIA 2R73A 1LIFA 1JBHA 1IFBA 1CBQA 1SWUA 1SWEA 1DC9A 2WR6A 3NP1A 5BVTA 1RBPA 1X8UA 5CSEA 5L3YA 4Z2OA 3TGBA 5HZ6A 5DPQA 1CRBA 5H9NA 2OL6O 2Q4NA 1W4TA 4XMCA 1YWDA 2FKGA 1WUBA 1OEEA 3RWXA 2OY7A 3VHHA 1W6FA 4N7CA 4GRJA 1NQNA 2OL8O 3I17A 3KFIA 1ZNGA 5LJGA 4OKAA 2RTQB 1YIVA 1XKIA 3AUMO 3CBCA 1UYNX 3RBYA 1LCZA 3GE2A 2GC9A 1KQXA 1IFCA 3T6FA 2I5VO 2QMIA 2Y3FA 2OVAA 4GD9A 4MVLA 1VWRB 3ZWEA 5LJBA 2E4JA 4U46A 1JYDA 4GU8A 3S60A 1MEPA 2RTDB 4I9SA 1VYGA 3PEDA 4OMXA 1Y55X 4U3QA 1LCWA 4CV7A 1BJ7A 4NV7A 1D2UA 4YVBA 3SLTA 5FFHA 4QYNA 3FMZA 2RTHB 4OELA 1KQWA 2JOZA 5EDCA 3T2WA 2X8FA 2G78A 1IW2A 4QGWA 3NR3A 1LCVA 4KH8A 4IB8A 4NP1A 2KW1A 4B55A 4HPCA 1E2TA 3HWFA 3FYFA 1ZRYA 4I3BA 2ACPX 1SWGA 3UEWA 2AT0X 2I5ZO 4AZNA 4WFUA 4HPAA 4WBKA 3F6ZB 4CK4A 1FEMA 4COTA 1SRFA 1B0OA 1DZJA 1GKAA 1AVGI 4LZUA 3KQ0A 5LJDA 3WVMA 4Y5DA 5JR8A 1VWFB 1JMZA 1T68X 2GTFX 1DZKA 4PJ2A 4TKJA 1SWDA 2A2UA 2OFMX 2JU3A 3B2HA 3RKGA 1U18A 3U03A 2C1SA 4YDBA 5H8TA 5C0NA 3FEKA 1QY1A 1EIOA 1I04A 1VYOA 4TJZA 5FQ8E 3H3IA 1SRHA 1JYJA 3LV4A 4CPHB 3RZYA 1LUQA 1PM1X 4GDAA 3ELZA 5HZ9A 4GGRA 1O8VA 2Z4HA 3RY1A 2RTAA 4C5PA 1KZWA 2LBVA 3VU1A 4QAEA 1I4UA 2RQ0A 4YGHA 4EQAC 5HZ5A 1BRPA 4Z2PA 1QY0A 1VWOB 4KC7A 1HN2A 1HMTA 1XCAA 3EYCA 2BSZA 1QG5A 1AVEA 5EDBA 1YP6A 4QGXA 2X4MA 4NLJA 1NQMA 1ICMA 1YP7A 3SLJA 5EEEA 3HK1A 4ORXA 2CZTA 3EC5A 1DZPA 3NX1A 1CBIA 5JD2A 3JS1A 3CKGA 4Z27A 1DV9A 1A2DA 1EQDA 4BX6A 4I3CA 5F1EA 4Y0SA 3PQSA 2MO5A 2CZUA 2WPUA 3FLLA 2A0AA 1STRB 3CMPA 3EBKA 2OL7A 4QQ1A 1LKEA 2ZAGA 2OFAA 4XMGA 1RXJA 5AJBA 5LJHA 5HTDA 1P6PA 5CE4A 4U8UO 4I6SA 3EW2A 4UU2A 5HZQA 4MISA 3B2KA 3ZW1B 2K62A 5LKEA 2RTCB 4ID2A 2AF5A
chains in the Genus database with same CATH topology
3HHIA 1M6DA 5K16A 2AYNA 2R9MA 1TLOA 1AU4A 2CB5A 2B1NA 3CH2X 4AXLA 2FO5A 1AU0A 2XU1A 1GMYA 2YJCA 3KKUA 1CQDA 1ME4A 3WXEA 2H7JA 2E01A 3H8CA 3IMAA 4MSXA 2ATOA 3WXFA 2E00A 4BPVA 4I04A 1POPA 4QRVA 1EWLA 3H89A 3OISA 4FIPA 1PCIA 1AYWA 3B79A 1KHPA 1SNKA 1AU2A 2O6XA 4ZUXU 2AYOA 2R9NA 1MDWA 2AIMA 3MTNA 1PPOA 1Y4HA 1GLOA 3KWBX 4YYQA 4G54A 3KX1A 4X6JA 3H8BA 1MIRA 1ATKA 3N4CA 1U9WA 3K8UA 4K7CA 1F2CA 9PAPA 5CHTA 4CZWA 1CVZA 3HD3A 1YK7A 2F7DA 1F2BA 1PPDA 2P86A 4WA6A 1ICFA 4PP2E 1NLJA 3IOQA 2HXZA 3USVA 1U9XA 2AS8A 1CJLA 2Y5BA 2Y6EA 3I06A 3KSEA 1CTEA 1YALA 1TU6A 1CV8A 3S3QA 2DCDA 2CIOA 3AI8A 2OP3A 1PPPA 3PNRA 1BY8A 1DEUA 2YJ9A 1K3BB 1PADA 1KHQA 3MHHA 4N79A 3BPFA 3CBJA 1BP4A 1ZIVA 4CDEB 4YYSA 1PPNA 1NQCA 4YYVA 2GFOA 2DC6A 4XUIA 2PBHA 2DZYA 3QT4A 5CVOB 1S4VA 4BQVA 4KLBA 1FH0A 7PCKA 1PIPA 2JQGR 4P6EA 1CPJA 4BGFA 2FRQA 3KWZA 2BDZA 2FYEA 3OVXA 3H7DA 2XU5A 1PXVA 3BCNA 2XU3A 1THEA 1KXRA 5F02A 2OULA 2VFCA 3S3RA 1XKGA 2DCCA 3ERVA 4OEMA 1CB5A 2DCAA 3OF8A 2VHSA 1U9VA 4PI3A 2GHUA 2R6NA 1AYVA 1W5RA 1DF0A 1AIMA 4QRXA 3KFQA 3I3TA 4QRGA 2YJ8A 4DMXA 3IV2A 3HWNA 2R9CA 3P5WA 1F29A 1A6RA 3V6EA 4GUZA 1U9QX 3BPMA 3WXGA 1NPZA 1TL9A 3D9WA 1KFXL 2G8EA 2HHNA 3O0UA 1AECA 4X6HA 3TNXA 1PE6A 2NQIA 2G8JA 3IUTA 2DC7A 4FJCA 3PDFA 4NV8A 2YJ2A 3OF9A 1BGOA 2G6DA 3H6SA 1SP4B 3LFYA 3M99A 1NB3A 2R9OA 1KFUL 3BOWA 5A24A 3OVZA 5FPWA 1PBHA 1QMYA 2B1MA 2HH5A 2IBIA 2PREA 3MHSA 1ZCMA 3DF0A 4YYRA 3CH3X 2HD5A 1YK8A 4QH6A 3PBHA 4BS5A 3NHEA 1QDQA 3BC3A 3IHPA 2AUXA 5EF4A 1U5IA 4YYUA 3GCBA 1F2AA 3ZUAA 1Y08A 2R9FA 4P6GA 4I07A 1VSNA 1JQPA 4W5CA 4W4UA 2IPPB 3E1ZB 5CVNB 5PADA 4CDDB 4MZSA 2AUZA 1QOLA 3KW9A 1VJVA 2NQGA 1EF7A 1GX3A 3LXSA 3N3KA 4CDCB 1STFE 4XR7A 5J94A 1MEGA 2FT2A 2G7YA 4N4ZA 1ITOA 3LTWA 3U8EA 2OZ2A 3O1GA 3C9EA 1X9YA 2NQDB 3F5VA 3D6SA 3P5UA 3V6CA 3CBKA 2AU1A 3P5XA 1EWOA 2VFBA 1AYUA 2DC8A 2F1GA 2P0RA 4HWYA 3RVVA 1AU3A 4QBBA 1W4TA 1GCBA 5JH3A 1W6FA 1QXPA 1CSBB 3IEJA 2BDLA 2XU4A 1IWDA 1MEMA 2FTDA 4BS6A 2WBFX 4MZOA 3BWKA 2DZZA 3RVWA 4PP1A 1MHWA 4CDFB 1CS8A 2JQFR 4NV7A 4PADA 2P7UA 4AXMA 3QJ3A 4OELA 3PW3A 2E02A 2PNSA 4DMYA 5EGWA 1YVBA 4Q8HA 1HUCB 1EWMA 2DCBA 1E2TA 2E03A 4B55A 2DC9A 3RVXA 4YV8A 4RY2A 4FK5A 2FRAA 2C0YA 1ME3A 6PADA 2ARYA 2AVWA 4YYWA 3P5VA 3K9MA 1MS6A 2YJBA 4Q8GA 2PADA 1BQIA 3K24A 4W5BA 4C5PA 4N8WA 1NL6A 1O0EA 1YT7A 2BSZA 2VHFA 4X6IA 5CHVA 5CVMA 1EWPA 2FUDA 4BSQA 4I05A 2FQ9A 2ACTA 1NB5A 3N3GA 3F75A 1Q6KA 8PCHA 4YVAA 5JA7A 2DJGB 1GECE 3HHAA 2NQAA 2DJFB 3QSDA 3MORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NV7 A;  3LTW A;  1W6F A;  3D9W A;  1GX3 A;  4C5P A;  4NV8 A;  2VFC A;  4B55 A;  1W5R A;  2BSZ A;  1W4T A;  4GUZ A;  2VFB A;  1E2T A;  4BGF A; 
#chains in the Genus database with same CATH topology
 4GJS A;  4OS8 A;  5H9L A;  4AZO A;  1K24 A;  1VWE B;  4GH7 A;  1U0X A;  3B2L A;  5B5F A;  2BHV A;  1EPB A;  4EFG A;  1RSU B;  2IZD B;  3WYQ A;  4BX7 A;  3RSW A;  3FEL A;  4FQB B;  2EU7 X;  2JGS A;  4Z6J A;  2IZE B;  2X45 A;  1BSO A;  2W2B A;  3RDQ A;  1GT1 A;  1GX8 A;  1ACD A;  1G5W A;  1Y9L A;  3LHN A;  4OS0 A;  2FLJ A;  3NQ9 A;  4DCB A;  4Z2V A;  1ZNK A;  2X55 A;  3STM X;  3FW5 A;  3ZW0 A;  4FGI B;  2MF6 A;  5FAZ A;  5BYP A;  5HZ8 A;  5EED A;  1HMR A;  4BX5 A;  4O4U A;  2AKQ A;  1VWA B;  1X8Q A;  4ZH9 A;  2JU8 A;  1A3Y A;  1KT4 A;  4GNY A;  5EPQ A;  4ZGU A;  4GGZ A;  4GGT A;  2AH7 X;  5FEN A;  4I3D A;  1SRG A;  1OPB A;  2FKJ A;  5F6B A;  2OF8 A;  1PBO A;  1SLD B;  1URE A;  4MVK A;  4ORS A;  3F9D A;  2OVE A;  2R56 A;  1SWF A;  1VWP B;  4YGZ A;  1SA8 A;  3IA8 A;  5HTE A;  1Y53 X;  2YG2 A;  3BU1 A;  3D96 A;  4YDA A;  1NP4 A;  5BVS A;  1VWI B;  1OSP O;  3HWG A;  1N7Y A;  1HQP A;  2PI3 O;  3WJC A;  4GKC A;  4K19 A;  1YWA A;  5H9A A;  4DMO A;  1CJ5 A;  1DF3 A;  2PQT A;  5HCE C;  1KT6 A;  1TW4 A;  4EKV A;  5HAE A;  2WQA E;  1SXU A;  1SWK A;  1IIU A;  3B2J A;  3BDR A;  2DM5 A;  4I9R A;  1OBQ A;  3UAQ A;  2L67 A;  1QFT A;  1SWJ A;  1VWB B;  3KFH A;  2IZK A;  1SLF B;  5K68 A;  1GT5 A;  3OE3 A;  3T1D A;  2Q2P A;  2G79 A;  4NW4 A;  1A57 A;  3MX7 A;  3VG2 A;  2GTL O;  3HOE A;  2IFB A;  1MX7 A;  2Y3E A;  3SZI A;  4INN A;  3RDM A;  3FA9 A;  1ZNE A;  3ZI8 A;  4ON1 A;  3APV A;  1VWK B;  2HMB A;  4YKM A;  5D45 A;  3WJE A;  2AMM X;  4CDD A;  1HBP A;  3MM0 A;  3WBG A;  1FTP A;  3EBW A;  4JHQ A;  3CQR A;  1SWH A;  1FE3 A;  3Q6L A;  3D97 A;  4NLI A;  1A18 A;  4TKH A;  1HBQ A;  4O4O A;  2A2G A;  4YBP A;  4CDC A;  1I78 A;  1EPA A;  3BU9 A;  2HZQ A;  2W2F A;  5B27 A;  4U8U M;  1GM6 A;  1STS B;  1KT7 A;  1YUP A;  4QZT A;  2X32 A;  2A5B A;  4Z28 A;  5IO7 A;  3RDX A;  5IXG A;  4TKB A;  2HLV A;  2OY8 A;  5B3M O;  3FIQ A;  2WWP A;  1O1U A;  5IRA A;  1YWC A;  1N4J A;  2FTB A;  3FA7 A;  1KFF A;  4O3W A;  3NQK A;  1G74 A;  1AVD A;  1JMX A;  1SWO A;  2YMS A;  4QZU A;  1LNM A;  4QNI A;  4DQ3 A;  3TGC A;  4ZH6 A;  1GT3 A;  2IZL B;  1LEL A;  2GH7 A;  4FBR A;  1TXL A;  2CM4 A;  2WQ9 A;  2IZA A;  4Y0R A;  5EZ2 A;  4YGG A;  1IKE A;  2OY5 O;  2FRS A;  3RE6 A;  1T8V A;  1SWR A;  4Y0Q A;  5KHP A;  5LJE A;  1E06 A;  3G7X A;  4L1N A;  2F73 A;  3FR2 A;  1LF7 A;  2RTL A;  1NC9 A;  5LJK A;  2QCB A;  4MIR A;  5L8O A;  2RTP B;  2LA7 A;  4AZP A;  4AZQ A;  1BM5 A;  2HNX A;  4FBV A;  5HCD C;  2FGS A;  2IZH B;  2Q39 A;  3X00 A;  1KL5 A;  3FA6 A;  3WJG A;  2L68 A;  4KII A;  1G85 A;  2W2A A;  1ERX A;  1N43 A;  3T2X A;  3LNB A;  3ELX A;  2QO4 A;  2RTI B;  1OPA A;  3RY2 A;  3APU A;  2BT9 A;  2K23 A;  2QOM A;  4QYP A;  5IO5 A;  3WJD A;  2RTB B;  1DZM A;  4AW8 A;  2OFB A;  4ZFX A;  2OF9 A;  2Y32 A;  1ADL A;  3JQO A;  3BSZ E;  4IB7 A;  1FDQ A;  1N9M A;  1L6M A;  1NDJ A;  3JSQ A;  2P8G A;  1UYO X;  5IRU A;  1ZNL A;  1DFV A;  2VDF A;  1OEK A;  1SWP A;  2MJI A;  4Y59 A;  1HMS A;  1VWG B;  2RTJ A;  4O9S A;  3FEN A;  2PY1 A;  4ZHG A;  1LIB A;  1MK5 A;  4IRW A;  2F01 A;  2GTL M;  4MVI A;  1RLB E;  1SY0 A;  4ZHD A;  3ZW2 A;  1I06 A;  3WZP A;  3S5X A;  1JJX A;  1Y0G A;  1BBP A;  1OBP A;  1Y52 X;  2GJ5 A;  4O4X A;  4EDE A;  4KT5 A;  1SLG B;  4ZHC A;  3APX A;  4O4S A;  5D47 A;  3UEX A;  2ACO A;  3CWK A;  5KID A;  5KIC A;  3P6F A;  3ZZV A;  4XME A;  4CSB A;  1VPR A;  4KC8 A;  4CPE A;  3VG7 A;  1FJ1 E;  3SLO A;  3OD9 A;  4GK9 A;  4LKT A;  3HWE A;  4FBO A;  4CDF A;  4RUU A;  5CYB A;  4PSQ A;  1PEE A;  5DG4 A;  1SY1 A;  3O22 A;  4ORR A;  5HBS A;  4AYH A;  1S7D A;  2UYW A;  4BGF A;  3DSZ A;  4BOE A;  3VG3 A;  3MBT A;  2ALL X;  3PK2 A;  2OVS A;  3PEC A;  4YKO A;  1KL4 A;  2ASN X;  4GET A;  1SWT A;  3PH6 A;  5LKF A;  5AQ6 A;  3PP6 A;  3K3L A;  4YCH A;  2BC3 A;  3GAQ A;  2BLG A;  2CBS A;  1X8N A;  4ORW A;  3C78 X;  3BX7 A;  4MVE A;  2FHN X;  5B10 O;  1E02 A;  1NGL A;  1ALB A;  3SZJ A;  1EI5 A;  2X46 A;  1SY3 A;  3PH5 A;  1I05 A;  3U9P C;  1QAB E;  4BBO A;  2C4I A;  2VFC A;  1X89 A;  2RTM A;  1VWN B;  4LKP A;  1EAL A;  4ALB A;  3NQ3 A;  5B11 O;  2RTF B;  3ZUI A;  2RTR B;  4OMW A;  3RE5 A;  5K67 A;  3RDS A;  4OEM A;  4XMH A;  2O62 A;  4A60 A;  2UZ2 A;  3HPE A;  2IJA A;  3STK A;  2KT4 B;  3KFF A;  4ES7 A;  3SOT A;  4CPH A;  3KFG A;  3WOV A;  4ZJ0 A;  1AEL A;  1GKA B;  1VWC B;  1GX9 A;  4WHI A;  1BSQ A;  3MVF A;  4U8U N;  4YFQ A;  4AZR A;  4CPI A;  1I9H A;  1EII A;  4A1H A;  1RST B;  1W5R A;  2AVI A;  2MWH A;  1N0S A;  4HWM A;  4NNT A;  2WUT A;  5HA0 A;  5D48 A;  1ZNH A;  3FA8 A;  1FEN A;  3TF6 A;  4YFR A;  3KVN A;  1KT3 A;  3T6L A;  4N7D A;  2Z4I A;  1KXO A;  3C77 X;  2IZI A;  2QOS C;  3NAD A;  5B2A O;  4IAX A;  4KCA A;  3D4R A;  3VGW A;  2QO6 A;  4YH0 A;  2FR2 A;  4JGL A;  4TQ2 A;  1Z24 A;  4D6B A;  4DNE A;  3UEV A;  5IO6 A;  3HWD A;  4L3R A;  3N91 A;  2R74 A;  4I60 A;  4YBU A;  3KZA A;  3NX2 A;  3S26 A;  1T0V A;  4GE1 A;  2C1Q A;  1JV4 A;  4LZV A;  4OS3 A;  1JJJ A;  4TLJ A;  4JNJ A;  1BLR A;  2AT3 X;  4UU3 A;  4GUZ A;  2L5P A;  1RXK A;  3BS2 A;  1MUP A;  2DJG A;  3AEH A;  3OJY C;  3D9W A;  2JN3 A;  2FT9 A;  2G7B A;  5CHK A;  3P6D A;  4U9C A;  1NBX A;  1MOY A;  1Y9T A;  3CKF A;  3PQU A;  4ALO A;  1GXA A;  3ZW1 A;  3NPO A;  2DJF A;  1VWD B;  3P6C A;  1HQQ A;  2M4L A;  5D4A A;  3ZUO A;  3VE1 A;  4YFP A;  1SXW A;  5HA1 A;  4BX6 B;  2XKL A;  4MEE A;  3B2I A;  3TZS A;  1VWM B;  2ANS A;  1S2P A;  1DF8 A;  1UZ2 X;  1B4M A;  4EXZ A;  3QKG A;  1QWD A;  2XST A;  2BS5 A;  1SY2 A;  4IMN A;  1E00 A;  2OVD A;  3BY0 A;  3FID A;  3PDF A;  4IBA A;  4ODD A;  4ORY A;  4NV8 A;  4A1Y A;  5K06 A;  1B56 A;  3D95 A;  3VG5 A;  2WSJ A;  1KT5 A;  1OEJ A;  2X34 A;  4O49 A;  3ZQ3 A;  2CBR A;  2IZJ A;  2KD2 A;  4AZM A;  3EM0 A;  4ZR2 A;  5FQ6 E;  1E5P A;  4ZCB A;  2BS6 A;  4BX7 B;  2G5L A;  3EMM A;  3WJF A;  1S44 A;  4NYQ A;  3P24 A;  4BVM A;  1CBS A;  2FR3 A;  1BRQ A;  2HYS A;  4NNS A;  3QQ2 A;  1ML7 A;  2GTL N;  1STP A;  3F8A A;  3UEU A;  1U17 A;  2KTD A;  3NBX X;  4R0B A;  3ZW0 B;  1SMP I;  4BX5 B;  2IZC B;  4WFV A;  3P02 A;  4XMD A;  1SWL A;  1SRE A;  2FWV A;  5AEO A;  2WEW A;  2JMB A;  2HKD A;  2ZSC A;  3CBS A;  5F58 A;  3HTY A;  4D6A A;  2FHL A;  5BVQ A;  2LB6 A;  3VHI A;  1PMP A;  3CQN A;  3OBL A;  1SWN A;  2NNQ A;  1GGL A;  1VWH B;  2F09 A;  4GNW A;  1JIW I;  3WZO A;  5AJC A;  5H9K A;  1B8E A;  4ZGF A;  2CAM A;  2LFO A;  1VYF A;  1BSY A;  5L8I A;  4EEJ A;  1JZU A;  1QFV A;  2KTS A;  1OBU A;  3IFB A;  3VHM A;  2X8T A;  1AQB A;  4ML7 B;  5F6Z A;  3WZQ A;  3FR4 A;  2HZR A;  1O1V A;  1QY2 A;  2G8C O;  2RA6 A;  1GT4 A;  5D8J A;  4YMY A;  1AB0 A;  1BEB A;  1MDC A;  2QM9 A;  4HPD A;  5B5G A;  2OFR X;  4O3Y A;  3L4R A;  5F2B A;  2RN4 A;  2OZQ A;  3FW4 A;  4BCS A;  1VWQ B;  1EW3 A;  1IJ8 A;  1TOU A;  2WEX A;  1X71 A;  1SLE B;  1NP1 A;  1FEL A;  2POA A;  1TOW A;  1LDO A;  2FS7 A;  1BWY A;  4HPB A;  3E3C A;  4M7M A;  3U0D A;  1TVQ A;  1JQP A;  3BRN A;  2NP1 A;  4HFO A;  4IAB A;  4LQZ A;  4XMF A;  3BX8 A;  2AL0 X;  1HXZ A;  2RD7 C;  2X8S A;  4GZV A;  4Y0P A;  1SWQ A;  3SAO A;  5IRW A;  2FS6 A;  3WYP A;  1QQS A;  4JO6 A;  3P6G A;  3RDO A;  2LBA A;  1ICN A;  2OY1 O;  2Q2M A;  4IB6 A;  2MHD A;  3V8U A;  3WZN A;  1LPJ A;  1RXH A;  5F7G A;  1D3S A;  1LFO A;  2RTK A;  4BJ8 A;  1LDQ A;  3VG6 A;  2Q9S A;  4IAW A;  3AKM A;  1MX8 A;  1HXL A;  1GX3 A;  2CM9 A;  1SRJ A;  4TNN A;  2IZF B;  1VWL B;  1X8P A;  5FQ7 E;  3SZH A;  1LID A;  1PTS A;  1SWB A;  1VWJ B;  3FDC A;  3S5V A;  2ZAI A;  1LIC A;  1SWA A;  2RTO B;  3VE2 A;  1SWC A;  4ARH A;  1WBI A;  2RTG B;  2A5C A;  1EXS A;  3APW A;  4IB9 A;  1KOI A;  4CPF A;  1G7N A;  2RCQ A;  5HWZ A;  1KZX A;  4O3Z A;  4O3X B;  5B29 A;  2RCT A;  5LJC A;  3AKN A;  3CR6 A;  3EW1 A;  3LTW A;  3P6E A;  4BQU A;  1PBY A;  4ZHF A;  1CBR A;  3VG4 A;  1ERB A;  2A3F X;  4YCE A;  1MM9 A;  2IZB A;  4ZHH A;  1ZND A;  1KL3 A;  3WXQ A;  4RUN A;  1SXX A;  1JJU A;  2NND A;  2AT8 X;  3FEP A;  3FR5 A;  1RAV A;  2QO5 A;  3MG5 A;  1H91 A;  3STN A;  4GJV A;  4QRL A;  2MM3 A;  2A8G A;  2RTE B;  2AT5 X;  3VPJ E;  2JW1 A;  4GDZ A;  1IKJ A;  3PPT A;  4QGV A;  3I0A A;  5L8N A;  2X56 A;  2L9C A;  2OYB O;  4ORU A;  1K3B A;  1YWB A;  2N93 A;  4M6S A;  1SWS A;  2A13 A;  1LIE A;  3BLG A;  3C76 X;  3WJB A;  2JU7 A;  4A8Z A;  1R0U A;  1SXY A;  3Q34 A;  3RDU A;  3O2Y A;  4I95 A;  3HOL A;  2LKK A;  1MVG A;  2NNE A;  1X8O A;  1N9Y A;  4IMO A;  3TGA A;  2VFB A;  2PFR A;  2AT6 X;  2IZG B;  3DTQ A;  4CDE A;  1HY2 A;  1KGL A;  1EUO A;  2RTN B;  3O19 A;  3P6H A;  4NYR A;  4DQ4 A;  5HCC C;  1SRI A;  2R73 A;  1LIF A;  1JBH A;  1IFB A;  1CBQ A;  1SWU A;  1SWE A;  1DC9 A;  2WR6 A;  3NP1 A;  5BVT A;  1RBP A;  1X8U A;  5CSE A;  5L3Y A;  4Z2O A;  3TGB A;  5HZ6 A;  5DPQ A;  1CRB A;  5H9N A;  2OL6 O;  2Q4N A;  1W4T A;  4XMC A;  1YWD A;  2FKG A;  1WUB A;  1OEE A;  3RWX A;  2OY7 A;  3VHH A;  1W6F A;  4N7C A;  4GRJ A;  1NQN A;  2OL8 O;  3I17 A;  3KFI A;  1ZNG A;  5LJG A;  4OKA A;  2RTQ B;  1YIV A;  1XKI A;  3AUM O;  3CBC A;  1UYN X;  3RBY A;  1LCZ A;  3GE2 A;  2GC9 A;  1KQX A;  1IFC A;  3T6F A;  2I5V O;  2QMI A;  2Y3F A;  2OVA A;  4GD9 A;  4MVL A;  1VWR B;  3ZWE A;  5LJB A;  2E4J A;  4U46 A;  1JYD A;  4GU8 A;  3S60 A;  1MEP A;  2RTD B;  4I9S A;  1VYG A;  3PED A;  4OMX A;  1Y55 X;  4U3Q A;  1LCW A;  4CV7 A;  1BJ7 A;  4NV7 A;  1D2U A;  4YVB A;  3SLT A;  5FFH A;  4QYN A;  3FMZ A;  2RTH B;  4OEL A;  1KQW A;  2JOZ A;  5EDC A;  3T2W A;  2X8F A;  2G78 A;  1IW2 A;  4QGW A;  3NR3 A;  1LCV A;  4KH8 A;  4IB8 A;  4NP1 A;  2KW1 A;  4B55 A;  4HPC A;  1E2T A;  3HWF A;  3FYF A;  1ZRY A;  4I3B A;  2ACP X;  1SWG A;  3UEW A;  2AT0 X;  2I5Z O;  4AZN A;  4WFU A;  4HPA A;  4WBK A;  3F6Z B;  4CK4 A;  1FEM A;  4COT A;  1SRF A;  1B0O A;  1DZJ A;  1GKA A;  1AVG I;  4LZU A;  3KQ0 A;  5LJD A;  3WVM A;  4Y5D A;  5JR8 A;  1VWF B;  1JMZ A;  1T68 X;  2GTF X;  1DZK A;  4PJ2 A;  4TKJ A;  1SWD A;  2A2U A;  2OFM X;  2JU3 A;  3B2H A;  3RKG A;  1U18 A;  3U03 A;  2C1S A;  4YDB A;  5H8T A;  5C0N A;  3FEK A;  1QY1 A;  1EIO A;  1I04 A;  1VYO A;  4TJZ A;  5FQ8 E;  3H3I A;  1SRH A;  1JYJ A;  3LV4 A;  4CPH B;  3RZY A;  1LUQ A;  1PM1 X;  4GDA A;  3ELZ A;  5HZ9 A;  4GGR A;  1O8V A;  2Z4H A;  3RY1 A;  2RTA A;  4C5P A;  1KZW A;  2LBV A;  3VU1 A;  4QAE A;  1I4U A;  2RQ0 A;  4YGH A;  4EQA C;  5HZ5 A;  1BRP A;  4Z2P A;  1QY0 A;  1VWO B;  4KC7 A;  1HN2 A;  1HMT A;  1XCA A;  3EYC A;  2BSZ A;  1QG5 A;  1AVE A;  5EDB A;  1YP6 A;  4QGX A;  2X4M A;  4NLJ A;  1NQM A;  1ICM A;  1YP7 A;  3SLJ A;  5EEE A;  3HK1 A;  4ORX A;  2CZT A;  3EC5 A;  1DZP A;  3NX1 A;  1CBI A;  5JD2 A;  3JS1 A;  3CKG A;  4Z27 A;  1DV9 A;  1A2D A;  1EQD A;  4BX6 A;  4I3C A;  5F1E A;  4Y0S A;  3PQS A;  2MO5 A;  2CZU A;  2WPU A;  3FLL A;  2A0A A;  1STR B;  3CMP A;  3EBK A;  2OL7 A;  4QQ1 A;  1LKE A;  2ZAG A;  2OFA A;  4XMG A;  1RXJ A;  5AJB A;  5LJH A;  5HTD A;  1P6P A;  5CE4 A;  4U8U O;  4I6S A;  3EW2 A;  4UU2 A;  5HZQ A;  4MIS A;  3B2K A;  3ZW1 B;  2K62 A;  5LKE A;  2RTC B;  4ID2 A;  2AF5 A; 
#chains in the Genus database with same CATH homology
 3HHI A;  1M6D A;  5K16 A;  2AYN A;  2R9M A;  1TLO A;  1AU4 A;  2CB5 A;  2B1N A;  3CH2 X;  4AXL A;  2FO5 A;  1AU0 A;  2XU1 A;  1GMY A;  2YJC A;  3KKU A;  1CQD A;  1ME4 A;  3WXE A;  2H7J A;  2E01 A;  3H8C A;  3IMA A;  4MSX A;  2ATO A;  3WXF A;  2E00 A;  4BPV A;  4I04 A;  1POP A;  4QRV A;  1EWL A;  3H89 A;  3OIS A;  4FIP A;  1PCI A;  1AYW A;  3B79 A;  1KHP A;  1SNK A;  1AU2 A;  2O6X A;  4ZUX U;  2AYO A;  2R9N A;  1MDW A;  2AIM A;  3MTN A;  1PPO A;  1Y4H A;  1GLO A;  3KWB X;  4YYQ A;  4G54 A;  3KX1 A;  4X6J A;  3H8B A;  1MIR A;  1ATK A;  3N4C A;  1U9W A;  3K8U A;  4K7C A;  1F2C A;  9PAP A;  5CHT A;  4CZW A;  1CVZ A;  3HD3 A;  1YK7 A;  2F7D A;  1F2B A;  1PPD A;  2P86 A;  4WA6 A;  1ICF A;  4PP2 E;  1NLJ A;  3IOQ A;  2HXZ A;  3USV A;  1U9X A;  2AS8 A;  1CJL A;  2Y5B A;  2Y6E A;  3I06 A;  3KSE A;  1CTE A;  1YAL A;  1TU6 A;  1CV8 A;  3S3Q A;  2DCD A;  2CIO A;  3AI8 A;  2OP3 A;  1PPP A;  3PNR A;  1BY8 A;  1DEU A;  2YJ9 A;  1K3B B;  1PAD A;  1KHQ A;  3MHH A;  4N79 A;  3BPF A;  3CBJ A;  1BP4 A;  1ZIV A;  4CDE B;  4YYS A;  1PPN A;  1NQC A;  4YYV A;  2GFO A;  2DC6 A;  4XUI A;  2PBH A;  2DZY A;  3QT4 A;  5CVO B;  1S4V A;  4BQV A;  4KLB A;  1FH0 A;  7PCK A;  1PIP A;  2JQG R;  4P6E A;  1CPJ A;  4BGF A;  2FRQ A;  3KWZ A;  2BDZ A;  2FYE A;  3OVX A;  3H7D A;  2XU5 A;  1PXV A;  3BCN A;  2XU3 A;  1THE A;  1KXR A;  5F02 A;  2OUL A;  2VFC A;  3S3R A;  1XKG A;  2DCC A;  3ERV A;  4OEM A;  1CB5 A;  2DCA A;  3OF8 A;  2VHS A;  1U9V A;  4PI3 A;  2GHU A;  2R6N A;  1AYV A;  1W5R A;  1DF0 A;  1AIM A;  4QRX A;  3KFQ A;  3I3T A;  4QRG A;  2YJ8 A;  4DMX A;  3IV2 A;  3HWN A;  2R9C A;  3P5W A;  1F29 A;  1A6R A;  3V6E A;  4GUZ A;  1U9Q X;  3BPM A;  3WXG A;  1NPZ A;  1TL9 A;  3D9W A;  1KFX L;  2G8E A;  2HHN A;  3O0U A;  1AEC A;  4X6H A;  3TNX A;  1PE6 A;  2NQI A;  2G8J A;  3IUT A;  2DC7 A;  4FJC A;  3PDF A;  4NV8 A;  2YJ2 A;  3OF9 A;  1BGO A;  2G6D A;  3H6S A;  1SP4 B;  3LFY A;  3M99 A;  1NB3 A;  2R9O A;  1KFU L;  3BOW A;  5A24 A;  3OVZ A;  5FPW A;  1PBH A;  1QMY A;  2B1M A;  2HH5 A;  2IBI A;  2PRE A;  3MHS A;  1ZCM A;  3DF0 A;  4YYR A;  3CH3 X;  2HD5 A;  1YK8 A;  4QH6 A;  3PBH A;  4BS5 A;  3NHE A;  1QDQ A;  3BC3 A;  3IHP A;  2AUX A;  5EF4 A;  1U5I A;  4YYU A;  3GCB A;  1F2A A;  3ZUA A;  1Y08 A;  2R9F A;  4P6G A;  4I07 A;  1VSN A;  1JQP A;  4W5C A;  4W4U A;  2IPP B;  3E1Z B;  5CVN B;  5PAD A;  4CDD B;  4MZS A;  2AUZ A;  1QOL A;  3KW9 A;  1VJV A;  2NQG A;  1EF7 A;  1GX3 A;  3LXS A;  3N3K A;  4CDC B;  1STF E;  4XR7 A;  5J94 A;  1MEG A;  2FT2 A;  2G7Y A;  4N4Z A;  1ITO A;  3LTW A;  3U8E A;  2OZ2 A;  3O1G A;  3C9E A;  1X9Y A;  2NQD B;  3F5V A;  3D6S A;  3P5U A;  3V6C A;  3CBK A;  2AU1 A;  3P5X A;  1EWO A;  2VFB A;  1AYU A;  2DC8 A;  2F1G A;  2P0R A;  4HWY A;  3RVV A;  1AU3 A;  4QBB A;  1W4T A;  1GCB A;  5JH3 A;  1W6F A;  1QXP A;  1CSB B;  3IEJ A;  2BDL A;  2XU4 A;  1IWD A;  1MEM A;  2FTD A;  4BS6 A;  2WBF X;  4MZO A;  3BWK A;  2DZZ A;  3RVW A;  4PP1 A;  1MHW A;  4CDF B;  1CS8 A;  2JQF R;  4NV7 A;  4PAD A;  2P7U A;  4AXM A;  3QJ3 A;  4OEL A;  3PW3 A;  2E02 A;  2PNS A;  4DMY A;  5EGW A;  1YVB A;  4Q8H A;  1HUC B;  1EWM A;  2DCB A;  1E2T A;  2E03 A;  4B55 A;  2DC9 A;  3RVX A;  4YV8 A;  4RY2 A;  4FK5 A;  2FRA A;  2C0Y A;  1ME3 A;  6PAD A;  2ARY A;  2AVW A;  4YYW A;  3P5V A;  3K9M A;  1MS6 A;  2YJB A;  4Q8G A;  2PAD A;  1BQI A;  3K24 A;  4W5B A;  4C5P A;  4N8W A;  1NL6 A;  1O0E A;  1YT7 A;  2BSZ A;  2VHF A;  4X6I A;  5CHV A;  5CVM A;  1EWP A;  2FUD A;  4BSQ A;  4I05 A;  2FQ9 A;  2ACT A;  1NB5 A;  3N3G A;  3F75 A;  1Q6K A;  8PCH A;  4YVA A;  5JA7 A;  2DJG B;  1GEC E;  3HHA A;  2NQA A;  2DJF B;  3QSD A;  3MOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...