2VFBA

The structure of mycobacterium marinum arylamine n-acetyltransferase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
b'DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE
molecule tags Transferase
source organism Mycobacterium marinum
publication title Divergence of Cofactor Recognition Across Evolution: Coenzyme a Binding in a Prokaryotic Arylamine N-Acetyltransferase.
pubmed doi rcsb
total genus 83
structure length 272
sequence length 272
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2007-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 2vfbA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 2vfbA01
1W4TA 2VFBA 2BSZA 3D9WA 3LTWA 4NV7A 4NV8A 1W6FA 4C5PA 1W5RA 2VFCA 1E2TA 4B55A 4BGFA 4GUZA 1GX3A
chains in the Genus database with same CATH superfamily
3EW1A 1VWCB 3TGAA 1B56A 1KGLA 1DF8A 3HOEA 2OZQA 3FENA 2X45A 4YDAA 5EEDA 3ZW0B 1X8QA 2AT8X 3UAQA 3WZOA 3BX8A 3RE5A 1N4JA 4COTA 5BYPA 4DMOA 3SZHA 3MVFA 3NBXX 3WXQA 2X46A 4GNWA 2OY8A 2F01A 3EM0A 1PMPA 2ZSCA 5LKFA 4CV7A 1SXXA 2X56A 1E06A 1XCAA 4L1NA 1LFOA 2QCBA 5C0NA 3BU9A 5HTDA 4U9CA 3WJBA 4MVLA 1MDCA 2IZCB 2RN4A 1JQPA 3NQ3A 5B10O 3VPJE 2FRSA 2GTFX 1TVQA 3I17A 5HTEA 3HOLA 1SY2A 1ZNLA 5B3MO 1IFBA 4GETA 4Y0PA 1IKJA 1SWJA 5AJCA 5DG4A 4AZPA 4NV8A 4Z6JA 2AT5X 1B0OA 4MISA 4ORYA 4HFOA 1QY1A 2OY1O 1MX8A 2Q4NA 4IB9A 2IZHB 1I9HA 5EPQA 3RBYA 3ZW1B 1SXYA 4HPDA 2OF9A 1CRBA 1HBQA 1OEJA 1HXLA 1STRB 4Y0SA 1YWDA 1K24A 1N9MA 3PQSA 2RTLA 1O1VA 2GTLN 4ORRA 4YBUA 2KW1A 1SLDB 1SWSA 3JQOA 2A2GA 3H3IA 5D8JA 2R74A 3NX1A 5FQ6E 4ALOA 4Y0QA 1BSOA 3CBSA 2N93A 4ES7A 2ZAGA 4YFQA 4O3YA 1EUOA 1KZWA 2FS6A 4U8UN 1STSB 3P6FA 3KQ0A 2RTOB 3NADA 2OFBA 3ZQ3A 2JU8A 1MOYA 5F6ZA 5B27A 2I5ZO 2RTQB 2MM3A 2UYWA 5IRAA 4CPIA 1SWGA 2OVSA 2AT3X 4D6AA 2PY1A 3IA8A 3LTWA 3TGCA 3E3CA 1CBRA 4KCAA 3HTYA 3Q6LA 5F58A 3RDMA 1LKEA 1U17A 2WEWA 4NW4A 3RZYA 3S5XA 1IIUA 1YP7A 2A2UA 2RTFB 3FIDA 1R0UA 2F09A 3GAQA 2RTEB 1AVDA 2NNQA 1OEKA 3HWDA 1AVEA 1LNMA 2FT9A 1ACDA 3BSZE 3RY1A 5FENA 4ML7B 4BGFA 3OJYC 3PP6A 4TQ2A 2FHNX 4CDDA 4ZFXA 2M4LA 1ERXA 1GKAB 1HBPA 3V8UA 1YWCA 1LDQA 1VYGA 1IFCA 1YWBA 3KVNA 4EXZA 3STNA 2IZGB 4GKCA 1OBUA 4YCEA 4GDZA 2RTGB 3D95A 4I60A 3ZW1A 3ZWEA 3T6FA 2CBRA 4CDFA 3EC5A 1D2UA 3TZSA 2RD7C 4LQZA 4AZRA 4ZHDA 2X32A 4KIIA 3B2JA 3QQ2A 1BSYA 3LV4A 5HA0A 4ZH9A 1KL4A 3VHHA 4QYPA 4CPHA 1T68X 1EQDA 4PSQA 3ELZA 5K68A 4I3BA 4AYHA 2HZQA 2A5BA 2RTCB 1X8UA 1BBPA 2QO6A 4ORSA 2DJGA 1VWPB 4EKVA 2I5VO 2DM5A 1VPRA 1VWFB 3APXA 1RAVA 2LB6A 1MEPA 1KT3A 1PM1X 2Q2MA 1VWAB 1PBYA 4I3DA 2OL6O 4EDEA 4ZHCA 3LNBA 4B55A 4ZJ0A 1MX7A 4QZTA 4DQ3A 2RTJA 4NNSA 4CK4A 4EFGA 5HAEA 5K06A 2WR6A 4QYNA 5HZ9A 3F6ZB 3VU1A 1SXUA 4D6BA 1SWPA 4ORWA 3OD9A 3T2WA 1CBQA 1LICA 4O3WA 5IO7A 2PFRA 1JBHA 1BM5A 2OFMX 2VFCA 1SRFA 1FE3A 1UYOX 2HKDA 2GJ5A 2VFBA 1X8NA 2K62A 1IKEA 2OFAA 2F73A 4HWMA 1W6FA 2L5PA 4KH8A 4ON1A 4XMCA 5B11O 3UEVA 4BCSA 3ELXA 5KICA 1VWIB 2ANSA 4BQUA 2CM4A 3JS1A 2BT9A 2KTSA 1ZNHA 2AL0X 3RY2A 3VE1A 1EALA 4O9SA 5IRWA 4IAXA 2W2FA 2Y32A 5FQ8E 1FJ1E 1SLEB 3ZUIA 4OS3A 3VG6A 5HZ6A 2EU7X 4WHIA 2K23A 4YGGA 1VWMB 2Z4HA 2NNDA 4TNNA 1OPBA 1Y55X 4UU2A 3HWFA 1JZUA 3WYPA 1OPAA 4Z27A 3SLJA 4YKOA 3EYCA 1LUQA 5HCCC 4GJSA 3RDUA 3WVMA 5D4AA 3UEWA 3PPTA 1SWLA 2KD2A 4O3ZA 1A2DA 2G7BA 1G74A 3KFIA 1XKIA 2WUTA 3QKGA 4Y59A 2IFBA 1KT5A 1SWAA 3T6LA 1YIVA 2FGSA 3WJFA 1NC9A 2C1SA 1Y9LA 5H9AA 5HA1A 2BS5A 3STKA 3T2XA 4CPEA 1P6PA 4TKBA 3PH6A 4WFVA 4N7CA 2VDFA 4I95A 1U18A 1VWJB 3D97A 1KOIA 3RDOA 3SZJA 1D3SA 1NDJA 1MK5A 5LJCA 1X8PA 2FWVA 1BSQA 3F8AA 3RDQA 1RLBE 4IABA 3EW2A 1SRJA 3FIQA 5FAZA 3EBWA 4IMOA 3PH5A 2POAA 4O3XB 3BS2A 5F1EA 5B5GA 5FQ7E 3BU1A 1ZRYA 4U8UO 3FA7A 1KT4A 5CHKA 1VWGB 5H8TA 1G85A 1EXSA 1DZPA 1I4UA 4GGRA 5L8NA 4EQAC 2WSJA 1S2PA 4YBPA 2L68A 3VE2A 3CQNA 3AKMA 2GTLM 5HCDC 1AB0A 2W2BA 1SY3A 2QO4A 1Y0GA 2FTBA 2OVDA 3BDRA 5LJDA 2KTDA 1I78A 4YFRA 1IJ8A 1HQPA 1QFVA 1SMPI 1SY1A 1HMTA 5D47A 1DC9A 5LKEA 1ML7A 3HPEA 1B4MA 3FLLA 1Y53X 4Z28A 1JYDA 2HMBA 2RQ0A 2AH7X 1YWAA 3OE3A 3RDXA 3FEKA 1VWHB 4I9RA 4ARHA 4QRLA 1HN2A 1OSPO 1YUPA 2LBAA 3FA6A 1GX8A 1GT5A 1AVGI 4Z2OA 4YMYA 4FQBB 4FBRA 5HZ8A 1S7DA 1SA8A 4QZUA 2CM9A 3U0DA 1SRIA 3RDSA 3C78X 2RTIB 4LZUA 1QABE 2HLVA 1BEBA 3WJCA 1ICMA 1UYNX 3CKGA 1GXAA 1EIOA 1SRHA 2QM9A 1WBIA 2FLJA 2A5CA 4OS0A 4M7MA 2RA6A 4K19A 4O49A 4HPBA 2X8SA 2LBVA 1SWHA 4WFUA 4TJZA 3P02A 3C77X 2GTLO 3UEXA 1KZXA 4YKMA 1VWNB 4YFPA 2X8FA 4BX6B 3WBGA 3C76X 4R0BA 3MM0A 4INNA 3FEPA 5JR8A 3WZQA 1E00A 2WWPA 4NLIA 4NNTA 2GC9A 3S26A 1OEEA 2OYBO 2RTDB 4C5PA 2FHLA 1NGLA 2AF5A 3SLTA 5LJBA 3MX7A 1BJ7A 3HWEA 3K3LA 2Y3FA 3O2YA 5D45A 5H9NA 5B2AO 2OY7A 1CBSA 1GM6A 4FGIB 1ALBA 1K3BA 2CZUA 4IRWA 1EPAA 3U9PC 1ICNA 1OBQA 3VG4A 2E4JA 2JN3A 2W2AA 4TLJA 1SXWA 1JJXA 1SRGA 3N91A 1KT6A 4GDAA 5HZ5A 1LCWA 4RUNA 1SREA 1QY0A 2PI3O 4GH7A 4KT5A 4GK9A 1MM9A 2QOMA 2WPUA 2JMBA 4YH0A 5BVSA 4CPFA 5DPQA 5HCEC 5EZ2A 3FW5A 3D4RA 5JD2A 1N9YA 1SWEA 1LCZA 3IFBA 3PECA 1VWEB 3CMPA 1NQMA 1ZNGA 4XMGA 2YMSA 1Z24A 5F7GA 4ZGUA 1LIDA 4CDEA 5IXGA 1SWUA 2NNEA 5D48A 3BLGA 2BC3A 4GE1A 3NQKA 3SOTA 2BS6A 2MO5A 3D96A 1JIWI 1RXHA 1VYOA 2A0AA 3Q34A 3APUA 4IMNA 1X71A 1IW2A 1ADLA 1HXZA 1NQNA 1JMXA 3FA8A 3FMZA 1VWQB 4O4OA 4O4XA 1JYJA 1HQQA 4O4SA 2HZRA 4A1YA 1A18A 1UZ2X 4ZHFA 1ZNKA 4GU8A 4GRJA 2QO5A 2MHDA 1T0VA 4JO6A 4BX7B 4KC8A 2L9CA 4NP1A 3P6DA 3MBTA 3ZUOA 2FKJA 1A3YA 1L6MA 1KQXA 1SWQA 2G78A 3CBCA 1GT3A 2AVIA 3KFFA 2AT6X 1SWCA 3WJEA 2LFOA 1RXKA 2NP1A 4DNEA 2IZLB 1W4TA 3NR3A 2A3FX 5LJEA 2QMIA 3NX2A 1QWDA 4IB8A 4A60A 3OBLA 1MUPA 1A57A 4CSBA 1S44A 2MWHA 2WQAE 3KFHA 1NP1A 1RXJA 3P6EA 2RTHB 1N7YA 4OEMA 2BHVA 1HMSA 4ZCBA 2OF8A 3SZIA 4BJ8A 3DTQA 3TF6A 5L3YA 1LIEA 1SWTA 4AZQA 2IJAA 1ERBA 3PK2A 4BVMA 1VWDB 2JGSA 4GGZA 3WJDA 1LPJA 3PQUA 4I9SA 5H9KA 2YG2A 5H9LA 1BWYA 4GZVA 1LELA 2G8CO 4OELA 4ALBA 5AEOA 3WOVA 5FFHA 4BOEA 4QGWA 3PDFA 2DJFA 5L8IA 3RKGA 1TW4A 3L4RA 2ALLX 3KFGA 2RCQA 3SLOA 3F9DA 3ZZVA 1LF7A 4XMEA 2JU3A 5EDBA 4ZH6A 1KQWA 2FKGA 1H91A 1Y52X 3NQ9A 3O22A 4JNJA 4ORXA 2MF6A 1SWNA 1PTSA 1QG5A 4JGLA 1EI5A 3P6GA 4Z2VA 1SLFB 3FR2A 4TKHA 3I0AA 3KZAA 1ZNEA 4GGTA 4HPCA 3HWGA 4KC7A 2FR3A 3FR4A 1E2TA 2IZBA 4A8ZA 2AMMX 1EIIA 2XKLA 3VG3A 3RWXA 3NPOA 1G5WA 1N0SA 1HMRA 5EDCA 1KL3A 5EEEA 5BVQA 2OL8O 1TOWA 2R56A 1TOUA 3DSZA 3UEUA 2PQTA 1GX9A 3NP1A 5HWZA 3B2KA 2LA7A 2RTAA 3CQRA 3VGWA 4BX6A 4M6SA 1YP6A 4ID2A 3FYFA 4OMWA 4UU3A 3RE6A 4AW8A 4AZNA 1HY2A 3P24A 1SWRA 1GGLA 1GX3A 2CBSA 2UZ2A 4ZHHA 4L3RA 4O4UA 3VG5A 3EMMA 1DZJA 1B8EA 3P6CA 1GT1A 1VWBB 3B2IA 4FBVA 1FTPA 4QGXA 2AKQA 2C4IA 4Y5DA 1N43A 4LKPA 1PBOA 2OVEA 4CDCA 1JV4A 1STPA 1DZMA 1PEEA 1E02A 4U46A 2ZAIA 4YCHA 1FELA 4A1HA 2X8TA 4RUUA 1DFVA 1Y9TA 2Z4IA 3AKNA 3LHNA 4MVEA 2ACOA 5AJBA 1DV9A 3FDCA 4I6SA 4XMFA 1VWLB 2P8GA 1SLGB 2R73A 4EEJA 4IB7A 1GKAA 2Q2PA 3B2LA 3WZNA 3ZW2A 1LCVA 3S60A 3CKFA 4NYQA 2RCTA 4BBOA 5L8OA 4ORUA 3JSQA 2G5LA 5B29A 4U8UM 1MVGA 2A8GA 3FW4A 3G7XA 4IB6A 2MJIA 4PJ2A 2HNXA 1O1UA 3HK1A 1OBPA 1CBIA 1VWKB 1VYFA 2IZKA 2RTBB 2X55A 3S5VA 2BSZA 3TGBA 2JU7A 5F6BA 3ZI8A 2A13A 3P6HA 4BX5B 1QY2A 1LIFA 4NYRA 4Z2PA 1KFFA 4OS8A 4ZR2A 4ZGFA 2RTPB 3FA9A 4IBAA 5LJHA 5F2BA 1FDQA 1ZNDA 2ASNX 1SWFA 4LZVA 4BX7A 1I05A 5KIDA 5K67A 3FELA 3D9WA 4JHQA 1LDOA 2CAMA 1KXOA 1X89A 1JMZA 1CJ5A 3CR6A 1O8VA 4GJVA 4N7DA 3U03A 4QQ1A 1RBPA 4TKJA 3T1DA 2C1QA 1TXLA 4ODDA 3WJGA 2O62A 2RTKA 3VHIA 3SAOA 3MG5A 1W5RA 1SWKA 1FEMA 3AEHA 2OVAA 1JJJA 3APWA 4QNIA 1E5PA 1I06A 1KL5A 1RSTB 4LKTA 4MVKA 4YVBA 5BVTA 3EBKA 4NV7A 5HBSA 5LJKA 2WQ9A 2XSTA 4NLJA 1QQSA 2ACPX 2JW1A 3WZPA 1QFTA 1BRQA 3GE2A 2AT0X 3STMX 5HZQA 1UREA 5B5FA 1LIBA 2RTMA 4HPAA 2OY5O 2IZJA 2OFRX 3ZW0A 2IZEB 3VG2A 1JJUA 4Y0RA 4ZHGA 4MVIA 4YGHA 3WYQA 4DCBA 3VHMA 2RTRB 4YGZA 3BY0A 2GH7A 4FBOA 1I04A 5CSEA 5AQ6A 5IRUA 2IZDB 1X8OA 2LKKA 3PEDA 1SWBA 5CYBA 4BX5A 4XMHA 4GNYA 2G79A 3BX7A 4DQ4A 1DZKA 2FS7A 1G7NA 2HYSA 2Y3EA 1GT4A 1NP4A 3B2HA 5LJGA 2IZAA 1DF3A 1T8VA 2OL7A 1NBXA 1BLRA 2IZIA 2RTNB 4CPHB 1FENA 2X4MA 1AQBA 1EPBA 1KT7A 3CWKA 4OMXA 3APVA 1SWOA 3RSWA 2KT4B 4MIRA 5IO6A 1SY0A 4GUZA 4QAEA 4QGVA 4AZOA 2L67A 1EW3A 1U0XA 1SWDA 4GD9A 2JOZA 4YDBA 2FR2A 3O19A 2X34A 2Q9SA 2BLGA 3X00A 2QOSC 1AELA 4MEEA 4AZMA 4WBKA 2CZTA 3VG7A 4U3QA 4IAWA 1WUBA 1BRPA 4I3CA 3AUMO 1RSUB 5CE4A 2Q39A 5KHPA 2WEXA 3BRNA 4XMDA 5IO5A 1VWOB 2IZFB 1VWRB 4OKAA 3FR5A
chains in the Genus database with same CATH topology
2P86A 2AVWA 2OULA 1XKGA 1GECE 1VJVA 1YALA 1YVBA 3IOQA 1PBHA 3ZUAA 3HD3A 3HHAA 4DMYA 3P5XA 4QRVA 2YJBA 1MHWA 2G6DA 1A6RA 1CVZA 5A24A 4K7CA 1JQPA 1AU3A 4W4UA 4FJCA 4X6JA 4BS5A 1EWPA 2Y6EA 4NV8A 4CZWA 3BWKA 1YK7A 2H7JA 3HWNA 1MS6A 2PADA 1AU0A 3KW9A 6PADA 5J94A 4N8WA 1THEA 1HUCB 1ICFA 4QRGA 1NLJA 4FK5A 2ARYA 2AYNA 1F2CA 3H89A 2FRQA 3LTWA 4I04A 2C0YA 1SNKA 2R9OA 4P6EA 3RVXA 4AXMA 4MZOA 2BDLA 4X6IA 5CHTA 1AYUA 5F02A 4BGFA 3CBKA 2E02A 2DC8A 3B79A 1AYVA 1NB3A 1S4VA 1ZCMA 3F75A 3QSDA 1Q6KA 3MORA 2E00A 2DZYA 2NQGA 1U9XA 3MTNA 1GCBA 2NQDB 2F7DA 1M6DA 2O6XA 1ME4A 3GCBA 5CVMA 2Y5BA 1STFE 3MHHA 2VHSA 4YVAA 1CSBB 3E1ZB 4PADA 7PCKA 3PBHA 4B55A 1GLOA 2XU4A 3AI8A 4G54A 3BC3A 4QRXA 2DC6A 1PIPA 1ZIVA 3U8EA 1CB5A 2PBHA 2FRAA 2OP3A 2VFCA 1PXVA 2VFBA 1KFUL 3MHSA 1W6FA 1QXPA 1PPOA 1PPDA 4KLBA 3WXEA 1BY8A 3IUTA 2R6NA 2ATOA 3CH3X 4BSQA 1AECA 1IWDA 1SP4B 2FYEA 3C9EA 1YK8A 2YJCA 4BQVA 4MSXA 2AIMA 1MDWA 2AUXA 3IV2A 3S3QA 3H6SA 2FO5A 2R9FA 2DCBA 3D6SA 1CV8A 3OVZA 2YJ8A 1TU6A 3P5WA 2DCDA 3KSEA 1K3BB 3I06A 1CJLA 4BPVA 1AIMA 1U9WA 2FUDA 1PADA 5K16A 5EGWA 3RVVA 1PPNA 2HXZA 2HHNA 4Q8HA 2XU3A 2FQ9A 4W5CA 4DMXA 2DC7A 4W5BA 4PP1A 1GMYA 5PADA 4YYVA 4WA6A 2DJGB 2YJ9A 1BGOA 1BQIA 3K24A 1PE6A 1QDQA 2OZ2A 1NL6A 1ITOA 2E03A 2AS8A 2DC9A 2IBIA 2AU1A 4XR7A 3IEJA 2IPPB 4C5PA 3QT4A 3DF0A 3OF9A 2R9NA 4BS6A 2P7UA 3N3KA 4YYUA 1ME3A 3HHIA 1U9QX 3P5UA 3KKUA 1PPPA 2DCAA 2P0RA 3RVWA 1NPZA 4CDEB 1Y4HA 1ATKA 4YYQA 1KHPA 2R9CA 3OVXA 2FT2A 9PAPA 4I07A 2DJFB 2XU1A 1YT7A 4X6HA 4HWYA 1DEUA 2JQGR 1CS8A 2B1MA 2G7YA 5JA7A 3IHPA 2R9MA 4AXLA 5JH3A 4P6GA 3H8CA 1W4TA 2FTDA 1KFXL 4Q8GA 4OEMA 2CB5A 3KFQA 2WBFX 3USVA 1X9YA 2E01A 1CPJA 4N4ZA 4OELA 3BPFA 4PP2E 1QMYA 2PNSA 3PDFA 3V6CA 2VHFA 2B1NA 5EF4A 4RY2A 2ACTA 2NQAA 5CHVA 3BPMA 5CVNB 1PCIA 1E2TA 1F2BA 3ERVA 8PCHA 1EF7A 4I05A 3KWZA 2JQFR 2AYOA 2GHUA 3LXSA 1U5IA 1AYWA 2PREA 1GX3A 1MIRA 1MEMA 3PNRA 3QJ3A 4QH6A 3O0UA 1TLOA 3BCNA 3K9MA 4N79A 1NQCA 1QOLA 1KXRA 3WXFA 4MZSA 1VSNA 3K8UA 1Y08A 1O0EA 3KX1A 4CDDB 3CBJA 4YV8A 3CH2X 4CDFB 4QBBA 3BOWA 2G8JA 5CVOB 5FPWA 2BSZA 4FIPA 4PI3A 3KWBX 2G8EA 3N4CA 1BP4A 1FH0A 4XUIA 2F1GA 3D9WA 1EWOA 3M99A 3V6EA 4ZUXU 2DZZA 2XU5A 1AU4A 3OISA 2NQIA 1W5RA 3PW3A 2HH5A 2AUZA 3H8BA 4NV7A 3H7DA 3I3TA 1NB5A 2GFOA 4CDCB 1AU2A 3F5VA 3N3GA 1U9VA 4YYSA 3TNXA 2HD5A 2YJ2A 3IMAA 4YYWA 1F29A 4YYRA 3NHEA 1CQDA 1MEGA 1KHQA 3S3RA 1CTEA 3OF8A 1EWMA 1EWLA 1F2AA 3WXGA 4GUZA 3O1GA 2DCCA 1POPA 2BDZA 3P5VA 1DF0A 2CIOA 1TL9A 3LFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4T A;  2VFB A;  2BSZ A;  3D9W A;  3LTW A;  4NV7 A;  4NV8 A;  1W6F A;  4C5P A;  1W5R A;  2VFC A;  1E2T A;  4B55 A;  4BGF A;  4GUZ A;  1GX3 A; 
#chains in the Genus database with same CATH topology
 3EW1 A;  1VWC B;  3TGA A;  1B56 A;  1KGL A;  1DF8 A;  3HOE A;  2OZQ A;  3FEN A;  2X45 A;  4YDA A;  5EED A;  3ZW0 B;  1X8Q A;  2AT8 X;  3UAQ A;  3WZO A;  3BX8 A;  3RE5 A;  1N4J A;  4COT A;  5BYP A;  4DMO A;  3SZH A;  3MVF A;  3NBX X;  3WXQ A;  2X46 A;  4GNW A;  2OY8 A;  2F01 A;  3EM0 A;  1PMP A;  2ZSC A;  5LKF A;  4CV7 A;  1SXX A;  2X56 A;  1E06 A;  1XCA A;  4L1N A;  1LFO A;  2QCB A;  5C0N A;  3BU9 A;  5HTD A;  4U9C A;  3WJB A;  4MVL A;  1MDC A;  2IZC B;  2RN4 A;  1JQP A;  3NQ3 A;  5B10 O;  3VPJ E;  2FRS A;  2GTF X;  1TVQ A;  3I17 A;  5HTE A;  3HOL A;  1SY2 A;  1ZNL A;  5B3M O;  1IFB A;  4GET A;  4Y0P A;  1IKJ A;  1SWJ A;  5AJC A;  5DG4 A;  4AZP A;  4NV8 A;  4Z6J A;  2AT5 X;  1B0O A;  4MIS A;  4ORY A;  4HFO A;  1QY1 A;  2OY1 O;  1MX8 A;  2Q4N A;  4IB9 A;  2IZH B;  1I9H A;  5EPQ A;  3RBY A;  3ZW1 B;  1SXY A;  4HPD A;  2OF9 A;  1CRB A;  1HBQ A;  1OEJ A;  1HXL A;  1STR B;  4Y0S A;  1YWD A;  1K24 A;  1N9M A;  3PQS A;  2RTL A;  1O1V A;  2GTL N;  4ORR A;  4YBU A;  2KW1 A;  1SLD B;  1SWS A;  3JQO A;  2A2G A;  3H3I A;  5D8J A;  2R74 A;  3NX1 A;  5FQ6 E;  4ALO A;  4Y0Q A;  1BSO A;  3CBS A;  2N93 A;  4ES7 A;  2ZAG A;  4YFQ A;  4O3Y A;  1EUO A;  1KZW A;  2FS6 A;  4U8U N;  1STS B;  3P6F A;  3KQ0 A;  2RTO B;  3NAD A;  2OFB A;  3ZQ3 A;  2JU8 A;  1MOY A;  5F6Z A;  5B27 A;  2I5Z O;  2RTQ B;  2MM3 A;  2UYW A;  5IRA A;  4CPI A;  1SWG A;  2OVS A;  2AT3 X;  4D6A A;  2PY1 A;  3IA8 A;  3LTW A;  3TGC A;  3E3C A;  1CBR A;  4KCA A;  3HTY A;  3Q6L A;  5F58 A;  3RDM A;  1LKE A;  1U17 A;  2WEW A;  4NW4 A;  3RZY A;  3S5X A;  1IIU A;  1YP7 A;  2A2U A;  2RTF B;  3FID A;  1R0U A;  2F09 A;  3GAQ A;  2RTE B;  1AVD A;  2NNQ A;  1OEK A;  3HWD A;  1AVE A;  1LNM A;  2FT9 A;  1ACD A;  3BSZ E;  3RY1 A;  5FEN A;  4ML7 B;  4BGF A;  3OJY C;  3PP6 A;  4TQ2 A;  2FHN X;  4CDD A;  4ZFX A;  2M4L A;  1ERX A;  1GKA B;  1HBP A;  3V8U A;  1YWC A;  1LDQ A;  1VYG A;  1IFC A;  1YWB A;  3KVN A;  4EXZ A;  3STN A;  2IZG B;  4GKC A;  1OBU A;  4YCE A;  4GDZ A;  2RTG B;  3D95 A;  4I60 A;  3ZW1 A;  3ZWE A;  3T6F A;  2CBR A;  4CDF A;  3EC5 A;  1D2U A;  3TZS A;  2RD7 C;  4LQZ A;  4AZR A;  4ZHD A;  2X32 A;  4KII A;  3B2J A;  3QQ2 A;  1BSY A;  3LV4 A;  5HA0 A;  4ZH9 A;  1KL4 A;  3VHH A;  4QYP A;  4CPH A;  1T68 X;  1EQD A;  4PSQ A;  3ELZ A;  5K68 A;  4I3B A;  4AYH A;  2HZQ A;  2A5B A;  2RTC B;  1X8U A;  1BBP A;  2QO6 A;  4ORS A;  2DJG A;  1VWP B;  4EKV A;  2I5V O;  2DM5 A;  1VPR A;  1VWF B;  3APX A;  1RAV A;  2LB6 A;  1MEP A;  1KT3 A;  1PM1 X;  2Q2M A;  1VWA B;  1PBY A;  4I3D A;  2OL6 O;  4EDE A;  4ZHC A;  3LNB A;  4B55 A;  4ZJ0 A;  1MX7 A;  4QZT A;  4DQ3 A;  2RTJ A;  4NNS A;  4CK4 A;  4EFG A;  5HAE A;  5K06 A;  2WR6 A;  4QYN A;  5HZ9 A;  3F6Z B;  3VU1 A;  1SXU A;  4D6B A;  1SWP A;  4ORW A;  3OD9 A;  3T2W A;  1CBQ A;  1LIC A;  4O3W A;  5IO7 A;  2PFR A;  1JBH A;  1BM5 A;  2OFM X;  2VFC A;  1SRF A;  1FE3 A;  1UYO X;  2HKD A;  2GJ5 A;  2VFB A;  1X8N A;  2K62 A;  1IKE A;  2OFA A;  2F73 A;  4HWM A;  1W6F A;  2L5P A;  4KH8 A;  4ON1 A;  4XMC A;  5B11 O;  3UEV A;  4BCS A;  3ELX A;  5KIC A;  1VWI B;  2ANS A;  4BQU A;  2CM4 A;  3JS1 A;  2BT9 A;  2KTS A;  1ZNH A;  2AL0 X;  3RY2 A;  3VE1 A;  1EAL A;  4O9S A;  5IRW A;  4IAX A;  2W2F A;  2Y32 A;  5FQ8 E;  1FJ1 E;  1SLE B;  3ZUI A;  4OS3 A;  3VG6 A;  5HZ6 A;  2EU7 X;  4WHI A;  2K23 A;  4YGG A;  1VWM B;  2Z4H A;  2NND A;  4TNN A;  1OPB A;  1Y55 X;  4UU2 A;  3HWF A;  1JZU A;  3WYP A;  1OPA A;  4Z27 A;  3SLJ A;  4YKO A;  3EYC A;  1LUQ A;  5HCC C;  4GJS A;  3RDU A;  3WVM A;  5D4A A;  3UEW A;  3PPT A;  1SWL A;  2KD2 A;  4O3Z A;  1A2D A;  2G7B A;  1G74 A;  3KFI A;  1XKI A;  2WUT A;  3QKG A;  4Y59 A;  2IFB A;  1KT5 A;  1SWA A;  3T6L A;  1YIV A;  2FGS A;  3WJF A;  1NC9 A;  2C1S A;  1Y9L A;  5H9A A;  5HA1 A;  2BS5 A;  3STK A;  3T2X A;  4CPE A;  1P6P A;  4TKB A;  3PH6 A;  4WFV A;  4N7C A;  2VDF A;  4I95 A;  1U18 A;  1VWJ B;  3D97 A;  1KOI A;  3RDO A;  3SZJ A;  1D3S A;  1NDJ A;  1MK5 A;  5LJC A;  1X8P A;  2FWV A;  1BSQ A;  3F8A A;  3RDQ A;  1RLB E;  4IAB A;  3EW2 A;  1SRJ A;  3FIQ A;  5FAZ A;  3EBW A;  4IMO A;  3PH5 A;  2POA A;  4O3X B;  3BS2 A;  5F1E A;  5B5G A;  5FQ7 E;  3BU1 A;  1ZRY A;  4U8U O;  3FA7 A;  1KT4 A;  5CHK A;  1VWG B;  5H8T A;  1G85 A;  1EXS A;  1DZP A;  1I4U A;  4GGR A;  5L8N A;  4EQA C;  2WSJ A;  1S2P A;  4YBP A;  2L68 A;  3VE2 A;  3CQN A;  3AKM A;  2GTL M;  5HCD C;  1AB0 A;  2W2B A;  1SY3 A;  2QO4 A;  1Y0G A;  2FTB A;  2OVD A;  3BDR A;  5LJD A;  2KTD A;  1I78 A;  4YFR A;  1IJ8 A;  1HQP A;  1QFV A;  1SMP I;  1SY1 A;  1HMT A;  5D47 A;  1DC9 A;  5LKE A;  1ML7 A;  3HPE A;  1B4M A;  3FLL A;  1Y53 X;  4Z28 A;  1JYD A;  2HMB A;  2RQ0 A;  2AH7 X;  1YWA A;  3OE3 A;  3RDX A;  3FEK A;  1VWH B;  4I9R A;  4ARH A;  4QRL A;  1HN2 A;  1OSP O;  1YUP A;  2LBA A;  3FA6 A;  1GX8 A;  1GT5 A;  1AVG I;  4Z2O A;  4YMY A;  4FQB B;  4FBR A;  5HZ8 A;  1S7D A;  1SA8 A;  4QZU A;  2CM9 A;  3U0D A;  1SRI A;  3RDS A;  3C78 X;  2RTI B;  4LZU A;  1QAB E;  2HLV A;  1BEB A;  3WJC A;  1ICM A;  1UYN X;  3CKG A;  1GXA A;  1EIO A;  1SRH A;  2QM9 A;  1WBI A;  2FLJ A;  2A5C A;  4OS0 A;  4M7M A;  2RA6 A;  4K19 A;  4O49 A;  4HPB A;  2X8S A;  2LBV A;  1SWH A;  4WFU A;  4TJZ A;  3P02 A;  3C77 X;  2GTL O;  3UEX A;  1KZX A;  4YKM A;  1VWN B;  4YFP A;  2X8F A;  4BX6 B;  3WBG A;  3C76 X;  4R0B A;  3MM0 A;  4INN A;  3FEP A;  5JR8 A;  3WZQ A;  1E00 A;  2WWP A;  4NLI A;  4NNT A;  2GC9 A;  3S26 A;  1OEE A;  2OYB O;  2RTD B;  4C5P A;  2FHL A;  1NGL A;  2AF5 A;  3SLT A;  5LJB A;  3MX7 A;  1BJ7 A;  3HWE A;  3K3L A;  2Y3F A;  3O2Y A;  5D45 A;  5H9N A;  5B2A O;  2OY7 A;  1CBS A;  1GM6 A;  4FGI B;  1ALB A;  1K3B A;  2CZU A;  4IRW A;  1EPA A;  3U9P C;  1ICN A;  1OBQ A;  3VG4 A;  2E4J A;  2JN3 A;  2W2A A;  4TLJ A;  1SXW A;  1JJX A;  1SRG A;  3N91 A;  1KT6 A;  4GDA A;  5HZ5 A;  1LCW A;  4RUN A;  1SRE A;  1QY0 A;  2PI3 O;  4GH7 A;  4KT5 A;  4GK9 A;  1MM9 A;  2QOM A;  2WPU A;  2JMB A;  4YH0 A;  5BVS A;  4CPF A;  5DPQ A;  5HCE C;  5EZ2 A;  3FW5 A;  3D4R A;  5JD2 A;  1N9Y A;  1SWE A;  1LCZ A;  3IFB A;  3PEC A;  1VWE B;  3CMP A;  1NQM A;  1ZNG A;  4XMG A;  2YMS A;  1Z24 A;  5F7G A;  4ZGU A;  1LID A;  4CDE A;  5IXG A;  1SWU A;  2NNE A;  5D48 A;  3BLG A;  2BC3 A;  4GE1 A;  3NQK A;  3SOT A;  2BS6 A;  2MO5 A;  3D96 A;  1JIW I;  1RXH A;  1VYO A;  2A0A A;  3Q34 A;  3APU A;  4IMN A;  1X71 A;  1IW2 A;  1ADL A;  1HXZ A;  1NQN A;  1JMX A;  3FA8 A;  3FMZ A;  1VWQ B;  4O4O A;  4O4X A;  1JYJ A;  1HQQ A;  4O4S A;  2HZR A;  4A1Y A;  1A18 A;  1UZ2 X;  4ZHF A;  1ZNK A;  4GU8 A;  4GRJ A;  2QO5 A;  2MHD A;  1T0V A;  4JO6 A;  4BX7 B;  4KC8 A;  2L9C A;  4NP1 A;  3P6D A;  3MBT A;  3ZUO A;  2FKJ A;  1A3Y A;  1L6M A;  1KQX A;  1SWQ A;  2G78 A;  3CBC A;  1GT3 A;  2AVI A;  3KFF A;  2AT6 X;  1SWC A;  3WJE A;  2LFO A;  1RXK A;  2NP1 A;  4DNE A;  2IZL B;  1W4T A;  3NR3 A;  2A3F X;  5LJE A;  2QMI A;  3NX2 A;  1QWD A;  4IB8 A;  4A60 A;  3OBL A;  1MUP A;  1A57 A;  4CSB A;  1S44 A;  2MWH A;  2WQA E;  3KFH A;  1NP1 A;  1RXJ A;  3P6E A;  2RTH B;  1N7Y A;  4OEM A;  2BHV A;  1HMS A;  4ZCB A;  2OF8 A;  3SZI A;  4BJ8 A;  3DTQ A;  3TF6 A;  5L3Y A;  1LIE A;  1SWT A;  4AZQ A;  2IJA A;  1ERB A;  3PK2 A;  4BVM A;  1VWD B;  2JGS A;  4GGZ A;  3WJD A;  1LPJ A;  3PQU A;  4I9S A;  5H9K A;  2YG2 A;  5H9L A;  1BWY A;  4GZV A;  1LEL A;  2G8C O;  4OEL A;  4ALB A;  5AEO A;  3WOV A;  5FFH A;  4BOE A;  4QGW A;  3PDF A;  2DJF A;  5L8I A;  3RKG A;  1TW4 A;  3L4R A;  2ALL X;  3KFG A;  2RCQ A;  3SLO A;  3F9D A;  3ZZV A;  1LF7 A;  4XME A;  2JU3 A;  5EDB A;  4ZH6 A;  1KQW A;  2FKG A;  1H91 A;  1Y52 X;  3NQ9 A;  3O22 A;  4JNJ A;  4ORX A;  2MF6 A;  1SWN A;  1PTS A;  1QG5 A;  4JGL A;  1EI5 A;  3P6G A;  4Z2V A;  1SLF B;  3FR2 A;  4TKH A;  3I0A A;  3KZA A;  1ZNE A;  4GGT A;  4HPC A;  3HWG A;  4KC7 A;  2FR3 A;  3FR4 A;  1E2T A;  2IZB A;  4A8Z A;  2AMM X;  1EII A;  2XKL A;  3VG3 A;  3RWX A;  3NPO A;  1G5W A;  1N0S A;  1HMR A;  5EDC A;  1KL3 A;  5EEE A;  5BVQ A;  2OL8 O;  1TOW A;  2R56 A;  1TOU A;  3DSZ A;  3UEU A;  2PQT A;  1GX9 A;  3NP1 A;  5HWZ A;  3B2K A;  2LA7 A;  2RTA A;  3CQR A;  3VGW A;  4BX6 A;  4M6S A;  1YP6 A;  4ID2 A;  3FYF A;  4OMW A;  4UU3 A;  3RE6 A;  4AW8 A;  4AZN A;  1HY2 A;  3P24 A;  1SWR A;  1GGL A;  1GX3 A;  2CBS A;  2UZ2 A;  4ZHH A;  4L3R A;  4O4U A;  3VG5 A;  3EMM A;  1DZJ A;  1B8E A;  3P6C A;  1GT1 A;  1VWB B;  3B2I A;  4FBV A;  1FTP A;  4QGX A;  2AKQ A;  2C4I A;  4Y5D A;  1N43 A;  4LKP A;  1PBO A;  2OVE A;  4CDC A;  1JV4 A;  1STP A;  1DZM A;  1PEE A;  1E02 A;  4U46 A;  2ZAI A;  4YCH A;  1FEL A;  4A1H A;  2X8T A;  4RUU A;  1DFV A;  1Y9T A;  2Z4I A;  3AKN A;  3LHN A;  4MVE A;  2ACO A;  5AJB A;  1DV9 A;  3FDC A;  4I6S A;  4XMF A;  1VWL B;  2P8G A;  1SLG B;  2R73 A;  4EEJ A;  4IB7 A;  1GKA A;  2Q2P A;  3B2L A;  3WZN A;  3ZW2 A;  1LCV A;  3S60 A;  3CKF A;  4NYQ A;  2RCT A;  4BBO A;  5L8O A;  4ORU A;  3JSQ A;  2G5L A;  5B29 A;  4U8U M;  1MVG A;  2A8G A;  3FW4 A;  3G7X A;  4IB6 A;  2MJI A;  4PJ2 A;  2HNX A;  1O1U A;  3HK1 A;  1OBP A;  1CBI A;  1VWK B;  1VYF A;  2IZK A;  2RTB B;  2X55 A;  3S5V A;  2BSZ A;  3TGB A;  2JU7 A;  5F6B A;  3ZI8 A;  2A13 A;  3P6H A;  4BX5 B;  1QY2 A;  1LIF A;  4NYR A;  4Z2P A;  1KFF A;  4OS8 A;  4ZR2 A;  4ZGF A;  2RTP B;  3FA9 A;  4IBA A;  5LJH A;  5F2B A;  1FDQ A;  1ZND A;  2ASN X;  1SWF A;  4LZV A;  4BX7 A;  1I05 A;  5KID A;  5K67 A;  3FEL A;  3D9W A;  4JHQ A;  1LDO A;  2CAM A;  1KXO A;  1X89 A;  1JMZ A;  1CJ5 A;  3CR6 A;  1O8V A;  4GJV A;  4N7D A;  3U03 A;  4QQ1 A;  1RBP A;  4TKJ A;  3T1D A;  2C1Q A;  1TXL A;  4ODD A;  3WJG A;  2O62 A;  2RTK A;  3VHI A;  3SAO A;  3MG5 A;  1W5R A;  1SWK A;  1FEM A;  3AEH A;  2OVA A;  1JJJ A;  3APW A;  4QNI A;  1E5P A;  1I06 A;  1KL5 A;  1RST B;  4LKT A;  4MVK A;  4YVB A;  5BVT A;  3EBK A;  4NV7 A;  5HBS A;  5LJK A;  2WQ9 A;  2XST A;  4NLJ A;  1QQS A;  2ACP X;  2JW1 A;  3WZP A;  1QFT A;  1BRQ A;  3GE2 A;  2AT0 X;  3STM X;  5HZQ A;  1URE A;  5B5F A;  1LIB A;  2RTM A;  4HPA A;  2OY5 O;  2IZJ A;  2OFR X;  3ZW0 A;  2IZE B;  3VG2 A;  1JJU A;  4Y0R A;  4ZHG A;  4MVI A;  4YGH A;  3WYQ A;  4DCB A;  3VHM A;  2RTR B;  4YGZ A;  3BY0 A;  2GH7 A;  4FBO A;  1I04 A;  5CSE A;  5AQ6 A;  5IRU A;  2IZD B;  1X8O A;  2LKK A;  3PED A;  1SWB A;  5CYB A;  4BX5 A;  4XMH A;  4GNY A;  2G79 A;  3BX7 A;  4DQ4 A;  1DZK A;  2FS7 A;  1G7N A;  2HYS A;  2Y3E A;  1GT4 A;  1NP4 A;  3B2H A;  5LJG A;  2IZA A;  1DF3 A;  1T8V A;  2OL7 A;  1NBX A;  1BLR A;  2IZI A;  2RTN B;  4CPH B;  1FEN A;  2X4M A;  1AQB A;  1EPB A;  1KT7 A;  3CWK A;  4OMX A;  3APV A;  1SWO A;  3RSW A;  2KT4 B;  4MIR A;  5IO6 A;  1SY0 A;  4GUZ A;  4QAE A;  4QGV A;  4AZO A;  2L67 A;  1EW3 A;  1U0X A;  1SWD A;  4GD9 A;  2JOZ A;  4YDB A;  2FR2 A;  3O19 A;  2X34 A;  2Q9S A;  2BLG A;  3X00 A;  2QOS C;  1AEL A;  4MEE A;  4AZM A;  4WBK A;  2CZT A;  3VG7 A;  4U3Q A;  4IAW A;  1WUB A;  1BRP A;  4I3C A;  3AUM O;  1RSU B;  5CE4 A;  2Q39 A;  5KHP A;  2WEX A;  3BRN A;  4XMD A;  5IO5 A;  1VWO B;  2IZF B;  1VWR B;  4OKA A;  3FR5 A; 
#chains in the Genus database with same CATH homology
 2P86 A;  2AVW A;  2OUL A;  1XKG A;  1GEC E;  1VJV A;  1YAL A;  1YVB A;  3IOQ A;  1PBH A;  3ZUA A;  3HD3 A;  3HHA A;  4DMY A;  3P5X A;  4QRV A;  2YJB A;  1MHW A;  2G6D A;  1A6R A;  1CVZ A;  5A24 A;  4K7C A;  1JQP A;  1AU3 A;  4W4U A;  4FJC A;  4X6J A;  4BS5 A;  1EWP A;  2Y6E A;  4NV8 A;  4CZW A;  3BWK A;  1YK7 A;  2H7J A;  3HWN A;  1MS6 A;  2PAD A;  1AU0 A;  3KW9 A;  6PAD A;  5J94 A;  4N8W A;  1THE A;  1HUC B;  1ICF A;  4QRG A;  1NLJ A;  4FK5 A;  2ARY A;  2AYN A;  1F2C A;  3H89 A;  2FRQ A;  3LTW A;  4I04 A;  2C0Y A;  1SNK A;  2R9O A;  4P6E A;  3RVX A;  4AXM A;  4MZO A;  2BDL A;  4X6I A;  5CHT A;  1AYU A;  5F02 A;  4BGF A;  3CBK A;  2E02 A;  2DC8 A;  3B79 A;  1AYV A;  1NB3 A;  1S4V A;  1ZCM A;  3F75 A;  3QSD A;  1Q6K A;  3MOR A;  2E00 A;  2DZY A;  2NQG A;  1U9X A;  3MTN A;  1GCB A;  2NQD B;  2F7D A;  1M6D A;  2O6X A;  1ME4 A;  3GCB A;  5CVM A;  2Y5B A;  1STF E;  3MHH A;  2VHS A;  4YVA A;  1CSB B;  3E1Z B;  4PAD A;  7PCK A;  3PBH A;  4B55 A;  1GLO A;  2XU4 A;  3AI8 A;  4G54 A;  3BC3 A;  4QRX A;  2DC6 A;  1PIP A;  1ZIV A;  3U8E A;  1CB5 A;  2PBH A;  2FRA A;  2OP3 A;  2VFC A;  1PXV A;  2VFB A;  1KFU L;  3MHS A;  1W6F A;  1QXP A;  1PPO A;  1PPD A;  4KLB A;  3WXE A;  1BY8 A;  3IUT A;  2R6N A;  2ATO A;  3CH3 X;  4BSQ A;  1AEC A;  1IWD A;  1SP4 B;  2FYE A;  3C9E A;  1YK8 A;  2YJC A;  4BQV A;  4MSX A;  2AIM A;  1MDW A;  2AUX A;  3IV2 A;  3S3Q A;  3H6S A;  2FO5 A;  2R9F A;  2DCB A;  3D6S A;  1CV8 A;  3OVZ A;  2YJ8 A;  1TU6 A;  3P5W A;  2DCD A;  3KSE A;  1K3B B;  3I06 A;  1CJL A;  4BPV A;  1AIM A;  1U9W A;  2FUD A;  1PAD A;  5K16 A;  5EGW A;  3RVV A;  1PPN A;  2HXZ A;  2HHN A;  4Q8H A;  2XU3 A;  2FQ9 A;  4W5C A;  4DMX A;  2DC7 A;  4W5B A;  4PP1 A;  1GMY A;  5PAD A;  4YYV A;  4WA6 A;  2DJG B;  2YJ9 A;  1BGO A;  1BQI A;  3K24 A;  1PE6 A;  1QDQ A;  2OZ2 A;  1NL6 A;  1ITO A;  2E03 A;  2AS8 A;  2DC9 A;  2IBI A;  2AU1 A;  4XR7 A;  3IEJ A;  2IPP B;  4C5P A;  3QT4 A;  3DF0 A;  3OF9 A;  2R9N A;  4BS6 A;  2P7U A;  3N3K A;  4YYU A;  1ME3 A;  3HHI A;  1U9Q X;  3P5U A;  3KKU A;  1PPP A;  2DCA A;  2P0R A;  3RVW A;  1NPZ A;  4CDE B;  1Y4H A;  1ATK A;  4YYQ A;  1KHP A;  2R9C A;  3OVX A;  2FT2 A;  9PAP A;  4I07 A;  2DJF B;  2XU1 A;  1YT7 A;  4X6H A;  4HWY A;  1DEU A;  2JQG R;  1CS8 A;  2B1M A;  2G7Y A;  5JA7 A;  3IHP A;  2R9M A;  4AXL A;  5JH3 A;  4P6G A;  3H8C A;  1W4T A;  2FTD A;  1KFX L;  4Q8G A;  4OEM A;  2CB5 A;  3KFQ A;  2WBF X;  3USV A;  1X9Y A;  2E01 A;  1CPJ A;  4N4Z A;  4OEL A;  3BPF A;  4PP2 E;  1QMY A;  2PNS A;  3PDF A;  3V6C A;  2VHF A;  2B1N A;  5EF4 A;  4RY2 A;  2ACT A;  2NQA A;  5CHV A;  3BPM A;  5CVN B;  1PCI A;  1E2T A;  1F2B A;  3ERV A;  8PCH A;  1EF7 A;  4I05 A;  3KWZ A;  2JQF R;  2AYO A;  2GHU A;  3LXS A;  1U5I A;  1AYW A;  2PRE A;  1GX3 A;  1MIR A;  1MEM A;  3PNR A;  3QJ3 A;  4QH6 A;  3O0U A;  1TLO A;  3BCN A;  3K9M A;  4N79 A;  1NQC A;  1QOL A;  1KXR A;  3WXF A;  4MZS A;  1VSN A;  3K8U A;  1Y08 A;  1O0E A;  3KX1 A;  4CDD B;  3CBJ A;  4YV8 A;  3CH2 X;  4CDF B;  4QBB A;  3BOW A;  2G8J A;  5CVO B;  5FPW A;  2BSZ A;  4FIP A;  4PI3 A;  3KWB X;  2G8E A;  3N4C A;  1BP4 A;  1FH0 A;  4XUI A;  2F1G A;  3D9W A;  1EWO A;  3M99 A;  3V6E A;  4ZUX U;  2DZZ A;  2XU5 A;  1AU4 A;  3OIS A;  2NQI A;  1W5R A;  3PW3 A;  2HH5 A;  2AUZ A;  3H8B A;  4NV7 A;  3H7D A;  3I3T A;  1NB5 A;  2GFO A;  4CDC B;  1AU2 A;  3F5V A;  3N3G A;  1U9V A;  4YYS A;  3TNX A;  2HD5 A;  2YJ2 A;  3IMA A;  4YYW A;  1F29 A;  4YYR A;  3NHE A;  1CQD A;  1MEG A;  1KHQ A;  3S3R A;  1CTE A;  3OF8 A;  1EWM A;  1EWL A;  1F2A A;  3WXG A;  4GUZ A;  3O1G A;  2DCC A;  1POP A;  2BDZ A;  3P5V A;  1DF0 A;  2CIO A;  1TL9 A;  3LFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...