2VFCA

The structure of mycobacterium marinum arylamine n-acetyltransferase in complex with coa
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
272
structure length
272
Chain Sequence
DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Cofactor Recognition Across Evolution: Coenzyme a Binding in a Prokaryotic Arylamine N-Acetyltransferase.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE
total genus 78
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2007-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 2vfcA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 2vfcA01
1W4TA 1E2TA 1GX3A 3LTWA 3D9WA 4GUZA 4BGFA 4B55A 2VFBA 1W6FA 4NV8A 2BSZA 2VFCA 4NV7A 4C5PA 1W5RA
chains in the Genus database with same CATH superfamily
3KVNA 3EM0A 1U17A 2JU8A 3DTQA 4YGHA 2W2FA 2ACPX 5FAZA 1KT3A 1EUOA 5K67A 5KICA 3WXQA 3BRNA 3PK2A 1QY1A 2A2GA 4JHQA 4EEJA 1SWBA 5EDBA 2CAMA 3ZW0A 2QOMA 3UEUA 1A3YA 1Y9LA 1HMSA 2KD2A 2PQTA 2AT6X 1VWHB 1G74A 1HBQA 1JQPA 3NBXX 1K3BA 2CBSA 3EW1A 1EPAA 4L1NA 4O3XB 4KC8A 2MF6A 4TKHA 1EIOA 2L9CA 4OKAA 3TGBA 4Z2OA 3BS2A 4GDZA 3ZI8A 4KCAA 1XCAA 1QQSA 1SWRA 2OL7A 2FT9A 2OFMX 2C4IA 2OY8A 3JS1A 4OELA 4QGXA 3EW2A 3STNA 4OS3A 4CPFA 1SWCA 5L3YA 2WEWA 3S5XA 1GT1A 2RTGB 2L68A 2NNEA 5AEOA 3FEPA 4LKTA 1WBIA 3KFFA 4R0BA 3FA9A 2OF9A 3VG7A 1N9MA 2QO6A 2HKDA 1EW3A 1X89A 2HNXA 1EXSA 3B2HA 3HWGA 1KL3A 5IO7A 1SY3A 4DNEA 1O8VA 3CKGA 1SWLA 2N93A 1OPAA 3KZAA 3B2JA 4RUNA 2ZAGA 3ELXA 4GDAA 4IAXA 4WHIA 4GK9A 4BVMA 1SXUA 3VGWA 3FW5A 3KQ0A 2AL0X 3APXA 3SOTA 4ZHHA 5HZ9A 2AT3X 4D6AA 1DC9A 4I60A 4YKMA 5FQ8E 2CM9A 1TW4A 4U8UM 1HBPA 1S2PA 3SAOA 4AW8A 1TVQA 3SLTA 4ORWA 2HYSA 1RLBE 5IO6A 1N0SA 3HOLA 3MVFA 4GNYA 4ORUA 4TKBA 5B2AO 3WZQA 2PI3O 2RN4A 5IXGA 5B5FA 2RTOB 3P6CA 3QQ2A 2I5VO 2RTRB 1SWNA 2AVIA 2OVAA 3RDMA 4ZFXA 3C78X 4YGZA 4ARHA 1VWJB 1XKIA 2G79A 3Q34A 1EQDA 3D97A 4KH8A 4XMGA 5JD2A 5D8JA 3WJBA 4O4XA 4JNJA 4ZHFA 4GETA 1VYGA 2QM9A 5HTEA 3PP6A 4LQZA 4EKVA 3IFBA 2OFRX 1SRGA 2BS6A 1SXXA 1N43A 1YWCA 4Y0SA 5HCCC 1NP4A 2GJ5A 3LTWA 5K68A 2FKGA 3RE5A 1IW2A 1LIFA 3P6HA 1YIVA 2RA6A 4N7DA 4Z28A 4RUUA 1T8VA 4AZOA 1PMPA 1SRFA 4MVEA 3FIDA 2IZKA 4OEMA 1HXZA 2RTIB 4YCHA 5HWZA 2IZBA 2F09A 2A2UA 1SREA 2QO4A 2RTQB 4GKCA 2JU7A 3E3CA 4IB7A 5H9KA 1Y53X 5K06A 1TOWA 2XKLA 2Q2MA 4M6SA 3WJGA 3UEVA 4TQ2A 4UU2A 5LJDA 4ES7A 2HZRA 4YVBA 4ZGUA 4PJ2A 4NYQA 2RTMA 3FA7A 2JW1A 4ID2A 4NP1A 3RKGA 4XMEA 4BGFA 4C5PA 3I0AA 4IB8A 2C1SA 2F01A 1ZNEA 3O2YA 2MO5A 2RTBB 1VWFB 3AUMO 1AVDA 1NC9A 1UYOX 1CBSA 1EPBA 1LDQA 1YWDA 2FS7A 3HWFA 3IA8A 2FGSA 4TKJA 5H9LA 5DPQA 1RBPA 5F7GA 4KIIA 1SMPI 1BLRA 4DQ3A 2Y3EA 2FR3A 4GRJA 3PEDA 2OL6O 1CBRA 1W6FA 2WPUA 4BQUA 4ZHCA 1X71A 3NR3A 3VG6A 2ASNX 4LZUA 1SWOA 4LKPA 1U18A 2X46A 1CBIA 2G78A 2GH7A 1GKAA 2WQAE 4EQAC 1I05A 3P6DA 3MG5A 3GAQA 3PQSA 2LB6A 3FR4A 1AVEA 3Q6LA 1HY2A 4I3DA 4JGLA 4QQ1A 4CDCA 2AT8X 1NP1A 4XMDA 2K62A 1DF3A 1MX7A 1GT3A 3JSQA 5CE4A 1RSTB 3NX1A 4A8ZA 1SRIA 1VWKB 1X8QA 2UYWA 3SZIA 2AH7X 1SWJA 5FQ6E 1X8OA 4HWMA 1KZWA 1EALA 2IZIA 4I3BA 1SLEB 2QMIA 5IO5A 1LFOA 2A13A 5F6BA 3U9PC 2GC9A 2W2BA 1IFCA 1MM9A 1N7YA 1D2UA 2LFOA 1B56A 1VYFA 2R74A 3RDSA 4A60A 4CDEA 1MVGA 1VWAB 2X4MA 2IZAA 3TGAA 2C1QA 4A1YA 2VDFA 4MVIA 1DV9A 5L8OA 2JMBA 4U8UO 4CV7A 2FRSA 1DF8A 1STRB 4GH7A 3KFHA 3ZW1B 3VG5A 2BT9A 4OS0A 1KT7A 1E00A 3WZOA 4AZNA 5KHPA 2A5BA 4PSQA 1QFVA 1LICA 4YBUA 1A18A 1E5PA 1KXOA 3C76X 4ODDA 3L4RA 4U8UN 2AF5A 2P8GA 1WUBA 1I04A 3FIQA 4YFRA 1GX3A 3SZHA 1DZPA 1VPRA 2OVDA 4I3CA 1E06A 5F6ZA 2IZJA 4AZQA 2FHNX 1RXHA 1JJUA 4GJVA 1GM6A 1NBXA 4KT5A 1UZ2X 3WYQA 2IFBA 2R73A 2X45A 4CPEA 1SWKA 1OBPA 1Y55X 2G7BA 1TXLA 1SRHA 1SRJA 2MHDA 3BX8A 5F58A 1SWTA 5B11O 5H9AA 3S5VA 3S60A 1SY1A 2R56A 5KIDA 1KT6A 4XMHA 3F8AA 1DZMA 1YUPA 3FENA 4GJSA 4I6SA 1AVGI 2WR6A 3RDUA 2BS5A 1G5WA 4NV7A 1LNMA 2DJFA 4Y5DA 1SWDA 3B2KA 5B27A 4ALOA 1MOYA 3ZQ3A 1EI5A 3VG4A 4XMFA 1CRBA 5BVSA 3VE2A 5HAEA 1QWDA 1YP6A 4O3ZA 4ZCBA 1FTPA 1SLDB 4NNTA 3D4RA 1AELA 3B2IA 2HMBA 1ZNDA 1NQNA 3EC5A 3VG3A 4JO6A 2GTFX 2L67A 4FGIB 4OMXA 1VWQB 3STMX 1U0XA 3NQ9A 4BX7B 1SLFB 1FDQA 1GXAA 5BYPA 2VFCA 4FBVA 2OFAA 3FW4A 4GGRA 5HA0A 5AJBA 1VWOB 3BSZE 3FYFA 4ORYA 4IAWA 4YDBA 4I95A 3RDQA 5HZ8A 2G8CO 2RTCB 3D9WA 5EEEA 1LF7A 2AT5X 3APVA 4OS8A 3ZW1A 1I06A 2IZEB 4BX6A 1FENA 3MM0A 4I9SA 5B10O 2O62A 1ICMA 5HBSA 5L8IA 4HPBA 3HTYA 1OSPO 2CZUA 4GGTA 4MEEA 3I17A 5H9NA 4CPHB 4EXZA 2BLGA 4BOEA 1I78A 4MVLA 1SWAA 1ALBA 1SY0A 1GT4A 3FA6A 1KGLA 1L6MA 4IRWA 2FKJA 1BSYA 4IMNA 3CQNA 3NX2A 1STSB 4CPHA 1MK5A 3NQKA 2HLVA 1GGLA 1LCZA 2RTFB 5AQ6A 2X8SA 1VWGB 3BU9A 1ZRYA 3SLJA 4YMYA 3NADA 4INNA 1MEPA 1VWLB 1SA8A 3K3LA 3EYCA 3HOEA 4GU8A 4QYNA 4Z2PA 3CMPA 3FR2A 1HMRA 2QO5A 2RCTA 3PPTA 3EMMA 1D3SA 1BSOA 4FBOA 4IMOA 1BBPA 4ZH6A 3T2XA 2ANSA 4HPDA 1KQWA 4DCBA 5LJHA 4QNIA 5F2BA 5B3MO 3WVMA 2A5CA 4Y0PA 5F1EA 3T1DA 4BX5B 3QKGA 1AB0A 2AMMX 3RDXA 3UAQA 5H8TA 4HPCA 3SLOA 1ML7A 1LDOA 2XSTA 2KT4B 1IIUA 1JYDA 5LJGA 1GKAB 5D4AA 4AZMA 5IRWA 2M4LA 4ML7B 1HMTA 1QFTA 2IZCB 4ZH9A 5IRUA 1UYNX 2OZQA 1YWBA 2A0AA 3O22A 3P02A 3FEKA 2OL8O 1KL4A 2OY7A 2W2AA 4EFGA 1Z24A 3EBWA 1FE3A 1O1VA 1PTSA 1YWAA 1JZUA 4QAEA 3V8UA 4HFOA 4QGWA 1FELA 2X8FA 4Y0RA 5D45A 4ZHDA 1OEKA 3CWKA 1HN2A 3P6EA 3BDRA 1SY2A 2FTBA 2LA7A 1ZNLA 1A2DA 4IB9A 1KOIA 4O4OA 4BBOA 1QY2A 5EDCA 2Q2PA 1CBQA 2BSZA 4Y0QA 1HXLA 4NLJA 2F73A 4ORXA 3FDCA 4M7MA 4ZHGA 2JN3A 3CKFA 5AJCA 4DMOA 1N9YA 4BX7A 1MX8A 1S7DA 1QABE 3KFIA 3T2WA 1QY0A 1IKEA 4EDEA 1B8EA 2X55A 1JJXA 2RTKA 2X32A 4OMWA 1G7NA 2PY1A 5EPQA 1KL5A 3G7XA 2Y32A 1ZNKA 3RY2A 2GTLM 1OEEA 2ZSCA 2BHVA 3LHNA 2NNQA 3VPJE 3ZUIA 2A8GA 5HZ5A 2MWHA 4LZVA 4YH0A 5IRAA 1MUPA 2POAA 1RXJA 3AEHA 3AKNA 3PH5A 1STPA 2OYBO 2WSJA 3RBYA 4QGVA 1NQMA 4YGGA 3O19A 2FLJA 3APUA 3BY0A 3HWEA 5FENA 4ON1A 3PH6A 1LIBA 2Y3FA 1BWYA 4Z2VA 1VWCB 1VWBB 1VWRB 3CQRA 5L8NA 2ZAIA 4ORSA 2RTEB 3RWXA 1A57A 3STKA 2FR2A 1SXYA 2ALLX 3ZWEA 4O4SA 3NPOA 5JR8A 2FS6A 3U03A 1RXKA 1FJ1E 1PBOA 2Q9SA 4WFUA 4YCEA 3GE2A 3S26A 1SWPA 3ELZA 1NGLA 3SZJA 3N91A 4KC7A 4GD9A 2RCQA 1TOUA 2AT0X 2YG2A 4IABA 5HCEC 3WYPA 1IFBA 4TNNA 1JMZA 2OVSA 2AKQA 2RTHB 3TGCA 2QOSC 4QYPA 5CYBA 4Z27A 4NW4A 5HZ6A 1ERXA 2IZLB 3PDFA 4YDAA 1KT5A 2IZDB 2OY1O 4O3YA 1SWEA 1W5RA 4CDDA 1VWEB 4YFQA 1RSUB 3LV4A 4NYRA 2OFBA 1DZJA 2KTDA 3BX7A 1P6PA 1I4UA 1SWQA 2CBRA 4O4UA 1VWIB 2YMSA 4TJZA 3WOVA 1LKEA 4BX6B 1T68X 4AYHA 2Q39A 1FEMA 1Y52X 1JV4A 2CM4A 4YKOA 1LIEA 2ACOA 3TZSA 3LNBA 4O49A 4GUZA 3P6GA 5HCDC 3P6FA 4YBPA 1SXWA 1VWNB 4FQBB 4ZR2A 2WEXA 4Z6JA 2G5LA 2Z4HA 1X8NA 1YP7A 1X8PA 3CBCA 2BC3A 3JQOA 4FBRA 4NV8A 4MIRA 4N7CA 2X8TA 3OJYC 2Q4NA 1CJ5A 4QZUA 1W4TA 1GX9A 3KFGA 5CHKA 2WQ9A 5EZ2A 4GZVA 3T6LA 1ZNGA 4QRLA 2HZQA 4ZGFA 4COTA 1OBQA 4GGZA 5CSEA 3BU1A 1LIDA 4NLIA 1PM1X 2GTLN 4CPIA 3WJDA 2EU7X 4U3QA 2OF8A 3H3IA 1O1UA 2OVEA 3PECA 1LUQA 5LJBA 1SWGA 3D95A 1UREA 1ICNA 3FMZA 1G85A 2RTPB 5FQ7E 1GX8A 5DG4A 4ALBA 1RAVA 3FA8A 4I9RA 1LPJA 3PQUA 2FWVA 2RD7C 3WJFA 3WZPA 4CK4A 2DJGA 3VE1A 3NP1A 4YFPA 5BVQA 3UEWA 3WZNA 3OD9A 2QCBA 3TF6A 3P24A 2JU3A 1X8UA 4TLJA 4U46A 3VHIA 4ZJ0A 2JGSA 1LCWA 1SLGB 3AKMA 3MX7A 3MBTA 1E2TA 2IZFB 3OBLA 4HPAA 3ZUOA 1KQXA 3BLGA 4O3WA 5HA1A 3C77X 3RZYA 1B0OA 2MJIA 4QZTA 1PBYA 1SWHA 1ZNHA 2X34A 4A1HA 5LJKA 1Y0GA 3OE3A 2RQ0A 1S44A 2OY5O 1OEJA 3VHHA 2A3FX 4IB6A 3T6FA 4AZPA 1B4MA 4BX5A 3HPEA 3VU1A 3CR6A 3NQ3A 1BRQA 1R0UA 5HZQA 1VYOA 5C0NA 1SWFA 4GE1A 2WUTA 1Y9TA 3VG2A 1VWPB 2RTDB 2RTAA 3HWDA 3RSWA 4CSBA 3WJCA 1JJJA 2WWPA 1IKJA 3WJEA 1KFFA 1IJ8A 3APWA 1ADLA 2NNDA 1H91A 2E4JA 3RDOA 1KT4A 4K19A 1NDJA 4BCSA 2RTNB 4CDFA 4D6BA 1N4JA 1JBHA 2FHLA 3FLLA 1AQBA 2KTSA 4MISA 2PFRA 1MDCA 4GNWA 5D47A 4U9CA 5D48A 5B29A 1I9HA 2I5ZO 1VWDB 2IZHB 1SWSA 1SWUA 2L5PA 3F9DA 1PEEA 4B55A 1BJ7A 3ZW2A 3U0DA 4AZRA 3WBGA 1KZXA 4L3RA 4WBKA 1ERBA 5EEDA 5FFHA 3FR5A 5LJCA 2GTLO 1EIIA 1LCVA 3X00A 5LKEA 1OPBA 1T0VA 2JOZA 2X56A 1OBUA 2LKKA 1DZKA 3DSZA 1JIWI 3UEXA 4BJ8A 2RTJA 4ORRA 1BM5A 1DFVA 5BVTA 4MVKA 1LELA 1QG5A 1VWMB 2NP1A 2RTLA 2Z4IA 4IBAA 5LKFA 1BRPA 1BEBA 2VFBA 2DM5A 1GT5A 1ACDA 2CZTA 4NNSA 1E02A 1JMXA 1HQPA 2K23A 4Y59A 5HTDA 3B2LA 1BSQA 1K24A 3FELA 3RE6A 3ZZVA 3VHMA 4DQ4A 2KW1A 4O9SA 2UZ2A 3HK1A 2IZGB 5B5GA 1HQQA 4XMCA 2LBVA 2IJAA 4WFVA 1JYJA 3CBSA 3D96A 4UU3A 3RY1A 3F6ZB 5LJEA 2LBAA 3EBKA 2MM3A 3ZW0B
chains in the Genus database with same CATH topology
1ITOA 3S3QA 1U9XA 1ZIVA 4W4UA 1NPZA 3V6CA 2DC7A 3C9EA 1ZCMA 1QXPA 2P86A 1FH0A 1JQPA 3KSEA 3N3KA 2AS8A 1HUCB 2NQAA 3O1GA 4OELA 2ARYA 1K3BB 1MHWA 2DCCA 2Y5BA 3ERVA 3KKUA 1O0EA 3BWKA 2AYNA 3F75A 3QSDA 4X6HA 4MZSA 1EWLA 4CDEB 4I04A 1XKGA 2F1GA 3MHSA 4Q8GA 4YV8A 2AVWA 1AU0A 2DCDA 4YYSA 1A6RA 2XU1A 3GCBA 2OULA 3P5WA 2BDZA 1MS6A 2E02A 4DMYA 2E03A 1AECA 1PIPA 4X6IA 1SP4B 2WBFX 3HWNA 1F2AA 2DZZA 2YJ2A 3PW3A 1CS8A 3BOWA 1YT7A 1CB5A 3LTWA 2DJFB 2G8EA 2DC6A 3P5VA 3D6SA 1AYWA 4OEMA 3CBKA 2AYOA 2YJ8A 2H7JA 4BGFA 4C5PA 3E1ZB 4X6JA 4W5BA 3S3RA 2R6NA 3KWBX 3M99A 4FK5A 3PBHA 1W6FA 2NQIA 1MEGA 4BPVA 1U9WA 5CVNB 3BPMA 2DCAA 1KFUL 3CH2X 1STFE 2IPPB 2BDLA 3H89A 2R9NA 2R9OA 2R9MA 1YK7A 4BS6A 1EWOA 1CV8A 1U9QX 1ME3A 4I05A 5J94A 2G7YA 2NQDB 4CDDB 2XU5A 2AU1A 5EGWA 3QT4A 4P6EA 3CBJA 1BGOA 3HHAA 3I3TA 3IHPA 1ICFA 2XU3A 1GX3A 4HWYA 4YYQA 8PCHA 2AUXA 4BS5A 1NL6A 3MHHA 1NB5A 1X9YA 1AU2A 3MTNA 1GMYA 1KHQA 4CZWA 7PCKA 1IWDA 2OP3A 1U9VA 4G54A 4DMXA 4NV7A 3RVXA 4XR7A 1SNKA 4YYUA 4QRVA 3WXEA 3B79A 4K7CA 2FTDA 2HHNA 1PPNA 2JQFR 3K9MA 4YVAA 1U5IA 1VJVA 3TNXA 1BP4A 2C0YA 1PXVA 2VFCA 2G6DA 3D9WA 3HHIA 4W5CA 2NQGA 1Y08A 2FQ9A 3ZUAA 1Y4HA 3IOQA 2R9FA 4YYVA 2PBHA 2F7DA 5F02A 3RVVA 1PPPA 2FYEA 3BCNA 2DJGB 2DZYA 5CVOB 3IMAA 9PAPA 3HD3A 2YJBA 1DF0A 2XU4A 2FUDA 4Q8HA 3P5UA 4MZOA 3KX1A 4N8WA 4PADA 3AI8A 2HH5A 4KLBA 4QRGA 5JH3A 4BSQA 3OF8A 2HD5A 3OVZA 2B1NA 2R9CA 4QBBA 1EWMA 3IEJA 4PI3A 3V6EA 2BSZA 4BQVA 2E00A 1CQDA 2P7UA 1NQCA 3IUTA 3LXSA 3U8EA 1KXRA 3N3GA 1AYUA 3BC3A 1TL9A 2P0RA 1KHPA 1F2CA 1PCIA 4MSXA 3H7DA 4I07A 1CPJA 5CVMA 3H8CA 1ATKA 3MORA 3DF0A 5K16A 2Y6EA 5PADA 1AYVA 1QOLA 1MDWA 2GHUA 4QRXA 4AXLA 1VSNA 2ATOA 4QH6A 1YVBA 4YYWA 3LFYA 1PPOA 3P5XA 2CB5A 1AIMA 2FT2A 1MEMA 1CJLA 1POPA 2JQGR 1NB3A 3PDFA 1CTEA 3PNRA 1W5RA 2B1MA 2DC9A 1CSBB 3WXGA 1BY8A 1KFXL 3NHEA 2HXZA 4GUZA 1PADA 2E01A 4AXMA 5CHVA 2FRAA 2AIMA 3H6SA 1BQIA 4N4ZA 3H8BA 4NV8A 3KFQA 2O6XA 4ZUXU 2PADA 3K8UA 1W4TA 3F5VA 2YJCA 2FO5A 3KW9A 4PP1A 4P6GA 2VHSA 4RY2A 5EF4A 3OISA 1F2BA 2DC8A 4XUIA 4WA6A 1TLOA 1S4VA 2AUZA 5A24A 2PREA 1QMYA 2ACTA 3N4CA 1E2TA 3CH3X 1NLJA 1F29A 3RVWA 1CVZA 1GECE 3I06A 2PNSA 1THEA 1M6DA 4CDFB 1MIRA 1QDQA 5CHTA 1GLOA 1TU6A 4CDCB 4FIPA 3K24A 1AU4A 3USVA 4YYRA 2YJ9A 4FJCA 4N79A 1EWPA 1YK8A 1GCBA 2G8JA 4B55A 2VHFA 1YALA 3OVXA 5JA7A 3BPFA 1EF7A 1PPDA 2IBIA 1DEUA 2FRQA 2GFOA 3QJ3A 3KWZA 3WXFA 6PADA 4PP2E 2VFBA 1PBHA 2DCBA 3O0UA 3OF9A 1Q6KA 1PE6A 2OZ2A 1ME4A 3IV2A 2CIOA 5FPWA 1AU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4T A;  1E2T A;  1GX3 A;  3LTW A;  3D9W A;  4GUZ A;  4BGF A;  4B55 A;  2VFB A;  1W6F A;  4NV8 A;  2BSZ A;  2VFC A;  4NV7 A;  4C5P A;  1W5R A; 
#chains in the Genus database with same CATH topology
 3KVN A;  3EM0 A;  1U17 A;  2JU8 A;  3DTQ A;  4YGH A;  2W2F A;  2ACP X;  5FAZ A;  1KT3 A;  1EUO A;  5K67 A;  5KIC A;  3WXQ A;  3BRN A;  3PK2 A;  1QY1 A;  2A2G A;  4JHQ A;  4EEJ A;  1SWB A;  5EDB A;  2CAM A;  3ZW0 A;  2QOM A;  3UEU A;  1A3Y A;  1Y9L A;  1HMS A;  2KD2 A;  2PQT A;  2AT6 X;  1VWH B;  1G74 A;  1HBQ A;  1JQP A;  3NBX X;  1K3B A;  2CBS A;  3EW1 A;  1EPA A;  4L1N A;  4O3X B;  4KC8 A;  2MF6 A;  4TKH A;  1EIO A;  2L9C A;  4OKA A;  3TGB A;  4Z2O A;  3BS2 A;  4GDZ A;  3ZI8 A;  4KCA A;  1XCA A;  1QQS A;  1SWR A;  2OL7 A;  2FT9 A;  2OFM X;  2C4I A;  2OY8 A;  3JS1 A;  4OEL A;  4QGX A;  3EW2 A;  3STN A;  4OS3 A;  4CPF A;  1SWC A;  5L3Y A;  2WEW A;  3S5X A;  1GT1 A;  2RTG B;  2L68 A;  2NNE A;  5AEO A;  3FEP A;  4LKT A;  1WBI A;  3KFF A;  4R0B A;  3FA9 A;  2OF9 A;  3VG7 A;  1N9M A;  2QO6 A;  2HKD A;  1EW3 A;  1X89 A;  2HNX A;  1EXS A;  3B2H A;  3HWG A;  1KL3 A;  5IO7 A;  1SY3 A;  4DNE A;  1O8V A;  3CKG A;  1SWL A;  2N93 A;  1OPA A;  3KZA A;  3B2J A;  4RUN A;  2ZAG A;  3ELX A;  4GDA A;  4IAX A;  4WHI A;  4GK9 A;  4BVM A;  1SXU A;  3VGW A;  3FW5 A;  3KQ0 A;  2AL0 X;  3APX A;  3SOT A;  4ZHH A;  5HZ9 A;  2AT3 X;  4D6A A;  1DC9 A;  4I60 A;  4YKM A;  5FQ8 E;  2CM9 A;  1TW4 A;  4U8U M;  1HBP A;  1S2P A;  3SAO A;  4AW8 A;  1TVQ A;  3SLT A;  4ORW A;  2HYS A;  1RLB E;  5IO6 A;  1N0S A;  3HOL A;  3MVF A;  4GNY A;  4ORU A;  4TKB A;  5B2A O;  3WZQ A;  2PI3 O;  2RN4 A;  5IXG A;  5B5F A;  2RTO B;  3P6C A;  3QQ2 A;  2I5V O;  2RTR B;  1SWN A;  2AVI A;  2OVA A;  3RDM A;  4ZFX A;  3C78 X;  4YGZ A;  4ARH A;  1VWJ B;  1XKI A;  2G79 A;  3Q34 A;  1EQD A;  3D97 A;  4KH8 A;  4XMG A;  5JD2 A;  5D8J A;  3WJB A;  4O4X A;  4JNJ A;  4ZHF A;  4GET A;  1VYG A;  2QM9 A;  5HTE A;  3PP6 A;  4LQZ A;  4EKV A;  3IFB A;  2OFR X;  1SRG A;  2BS6 A;  1SXX A;  1N43 A;  1YWC A;  4Y0S A;  5HCC C;  1NP4 A;  2GJ5 A;  3LTW A;  5K68 A;  2FKG A;  3RE5 A;  1IW2 A;  1LIF A;  3P6H A;  1YIV A;  2RA6 A;  4N7D A;  4Z28 A;  4RUU A;  1T8V A;  4AZO A;  1PMP A;  1SRF A;  4MVE A;  3FID A;  2IZK A;  4OEM A;  1HXZ A;  2RTI B;  4YCH A;  5HWZ A;  2IZB A;  2F09 A;  2A2U A;  1SRE A;  2QO4 A;  2RTQ B;  4GKC A;  2JU7 A;  3E3C A;  4IB7 A;  5H9K A;  1Y53 X;  5K06 A;  1TOW A;  2XKL A;  2Q2M A;  4M6S A;  3WJG A;  3UEV A;  4TQ2 A;  4UU2 A;  5LJD A;  4ES7 A;  2HZR A;  4YVB A;  4ZGU A;  4PJ2 A;  4NYQ A;  2RTM A;  3FA7 A;  2JW1 A;  4ID2 A;  4NP1 A;  3RKG A;  4XME A;  4BGF A;  4C5P A;  3I0A A;  4IB8 A;  2C1S A;  2F01 A;  1ZNE A;  3O2Y A;  2MO5 A;  2RTB B;  1VWF B;  3AUM O;  1AVD A;  1NC9 A;  1UYO X;  1CBS A;  1EPB A;  1LDQ A;  1YWD A;  2FS7 A;  3HWF A;  3IA8 A;  2FGS A;  4TKJ A;  5H9L A;  5DPQ A;  1RBP A;  5F7G A;  4KII A;  1SMP I;  1BLR A;  4DQ3 A;  2Y3E A;  2FR3 A;  4GRJ A;  3PED A;  2OL6 O;  1CBR A;  1W6F A;  2WPU A;  4BQU A;  4ZHC A;  1X71 A;  3NR3 A;  3VG6 A;  2ASN X;  4LZU A;  1SWO A;  4LKP A;  1U18 A;  2X46 A;  1CBI A;  2G78 A;  2GH7 A;  1GKA A;  2WQA E;  4EQA C;  1I05 A;  3P6D A;  3MG5 A;  3GAQ A;  3PQS A;  2LB6 A;  3FR4 A;  1AVE A;  3Q6L A;  1HY2 A;  4I3D A;  4JGL A;  4QQ1 A;  4CDC A;  2AT8 X;  1NP1 A;  4XMD A;  2K62 A;  1DF3 A;  1MX7 A;  1GT3 A;  3JSQ A;  5CE4 A;  1RST B;  3NX1 A;  4A8Z A;  1SRI A;  1VWK B;  1X8Q A;  2UYW A;  3SZI A;  2AH7 X;  1SWJ A;  5FQ6 E;  1X8O A;  4HWM A;  1KZW A;  1EAL A;  2IZI A;  4I3B A;  1SLE B;  2QMI A;  5IO5 A;  1LFO A;  2A13 A;  5F6B A;  3U9P C;  2GC9 A;  2W2B A;  1IFC A;  1MM9 A;  1N7Y A;  1D2U A;  2LFO A;  1B56 A;  1VYF A;  2R74 A;  3RDS A;  4A60 A;  4CDE A;  1MVG A;  1VWA B;  2X4M A;  2IZA A;  3TGA A;  2C1Q A;  4A1Y A;  2VDF A;  4MVI A;  1DV9 A;  5L8O A;  2JMB A;  4U8U O;  4CV7 A;  2FRS A;  1DF8 A;  1STR B;  4GH7 A;  3KFH A;  3ZW1 B;  3VG5 A;  2BT9 A;  4OS0 A;  1KT7 A;  1E00 A;  3WZO A;  4AZN A;  5KHP A;  2A5B A;  4PSQ A;  1QFV A;  1LIC A;  4YBU A;  1A18 A;  1E5P A;  1KXO A;  3C76 X;  4ODD A;  3L4R A;  4U8U N;  2AF5 A;  2P8G A;  1WUB A;  1I04 A;  3FIQ A;  4YFR A;  1GX3 A;  3SZH A;  1DZP A;  1VPR A;  2OVD A;  4I3C A;  1E06 A;  5F6Z A;  2IZJ A;  4AZQ A;  2FHN X;  1RXH A;  1JJU A;  4GJV A;  1GM6 A;  1NBX A;  4KT5 A;  1UZ2 X;  3WYQ A;  2IFB A;  2R73 A;  2X45 A;  4CPE A;  1SWK A;  1OBP A;  1Y55 X;  2G7B A;  1TXL A;  1SRH A;  1SRJ A;  2MHD A;  3BX8 A;  5F58 A;  1SWT A;  5B11 O;  5H9A A;  3S5V A;  3S60 A;  1SY1 A;  2R56 A;  5KID A;  1KT6 A;  4XMH A;  3F8A A;  1DZM A;  1YUP A;  3FEN A;  4GJS A;  4I6S A;  1AVG I;  2WR6 A;  3RDU A;  2BS5 A;  1G5W A;  4NV7 A;  1LNM A;  2DJF A;  4Y5D A;  1SWD A;  3B2K A;  5B27 A;  4ALO A;  1MOY A;  3ZQ3 A;  1EI5 A;  3VG4 A;  4XMF A;  1CRB A;  5BVS A;  3VE2 A;  5HAE A;  1QWD A;  1YP6 A;  4O3Z A;  4ZCB A;  1FTP A;  1SLD B;  4NNT A;  3D4R A;  1AEL A;  3B2I A;  2HMB A;  1ZND A;  1NQN A;  3EC5 A;  3VG3 A;  4JO6 A;  2GTF X;  2L67 A;  4FGI B;  4OMX A;  1VWQ B;  3STM X;  1U0X A;  3NQ9 A;  4BX7 B;  1SLF B;  1FDQ A;  1GXA A;  5BYP A;  2VFC A;  4FBV A;  2OFA A;  3FW4 A;  4GGR A;  5HA0 A;  5AJB A;  1VWO B;  3BSZ E;  3FYF A;  4ORY A;  4IAW A;  4YDB A;  4I95 A;  3RDQ A;  5HZ8 A;  2G8C O;  2RTC B;  3D9W A;  5EEE A;  1LF7 A;  2AT5 X;  3APV A;  4OS8 A;  3ZW1 A;  1I06 A;  2IZE B;  4BX6 A;  1FEN A;  3MM0 A;  4I9S A;  5B10 O;  2O62 A;  1ICM A;  5HBS A;  5L8I A;  4HPB A;  3HTY A;  1OSP O;  2CZU A;  4GGT A;  4MEE A;  3I17 A;  5H9N A;  4CPH B;  4EXZ A;  2BLG A;  4BOE A;  1I78 A;  4MVL A;  1SWA A;  1ALB A;  1SY0 A;  1GT4 A;  3FA6 A;  1KGL A;  1L6M A;  4IRW A;  2FKJ A;  1BSY A;  4IMN A;  3CQN A;  3NX2 A;  1STS B;  4CPH A;  1MK5 A;  3NQK A;  2HLV A;  1GGL A;  1LCZ A;  2RTF B;  5AQ6 A;  2X8S A;  1VWG B;  3BU9 A;  1ZRY A;  3SLJ A;  4YMY A;  3NAD A;  4INN A;  1MEP A;  1VWL B;  1SA8 A;  3K3L A;  3EYC A;  3HOE A;  4GU8 A;  4QYN A;  4Z2P A;  3CMP A;  3FR2 A;  1HMR A;  2QO5 A;  2RCT A;  3PPT A;  3EMM A;  1D3S A;  1BSO A;  4FBO A;  4IMO A;  1BBP A;  4ZH6 A;  3T2X A;  2ANS A;  4HPD A;  1KQW A;  4DCB A;  5LJH A;  4QNI A;  5F2B A;  5B3M O;  3WVM A;  2A5C A;  4Y0P A;  5F1E A;  3T1D A;  4BX5 B;  3QKG A;  1AB0 A;  2AMM X;  3RDX A;  3UAQ A;  5H8T A;  4HPC A;  3SLO A;  1ML7 A;  1LDO A;  2XST A;  2KT4 B;  1IIU A;  1JYD A;  5LJG A;  1GKA B;  5D4A A;  4AZM A;  5IRW A;  2M4L A;  4ML7 B;  1HMT A;  1QFT A;  2IZC B;  4ZH9 A;  5IRU A;  1UYN X;  2OZQ A;  1YWB A;  2A0A A;  3O22 A;  3P02 A;  3FEK A;  2OL8 O;  1KL4 A;  2OY7 A;  2W2A A;  4EFG A;  1Z24 A;  3EBW A;  1FE3 A;  1O1V A;  1PTS A;  1YWA A;  1JZU A;  4QAE A;  3V8U A;  4HFO A;  4QGW A;  1FEL A;  2X8F A;  4Y0R A;  5D45 A;  4ZHD A;  1OEK A;  3CWK A;  1HN2 A;  3P6E A;  3BDR A;  1SY2 A;  2FTB A;  2LA7 A;  1ZNL A;  1A2D A;  4IB9 A;  1KOI A;  4O4O A;  4BBO A;  1QY2 A;  5EDC A;  2Q2P A;  1CBQ A;  2BSZ A;  4Y0Q A;  1HXL A;  4NLJ A;  2F73 A;  4ORX A;  3FDC A;  4M7M A;  4ZHG A;  2JN3 A;  3CKF A;  5AJC A;  4DMO A;  1N9Y A;  4BX7 A;  1MX8 A;  1S7D A;  1QAB E;  3KFI A;  3T2W A;  1QY0 A;  1IKE A;  4EDE A;  1B8E A;  2X55 A;  1JJX A;  2RTK A;  2X32 A;  4OMW A;  1G7N A;  2PY1 A;  5EPQ A;  1KL5 A;  3G7X A;  2Y32 A;  1ZNK A;  3RY2 A;  2GTL M;  1OEE A;  2ZSC A;  2BHV A;  3LHN A;  2NNQ A;  3VPJ E;  3ZUI A;  2A8G A;  5HZ5 A;  2MWH A;  4LZV A;  4YH0 A;  5IRA A;  1MUP A;  2POA A;  1RXJ A;  3AEH A;  3AKN A;  3PH5 A;  1STP A;  2OYB O;  2WSJ A;  3RBY A;  4QGV A;  1NQM A;  4YGG A;  3O19 A;  2FLJ A;  3APU A;  3BY0 A;  3HWE A;  5FEN A;  4ON1 A;  3PH6 A;  1LIB A;  2Y3F A;  1BWY A;  4Z2V A;  1VWC B;  1VWB B;  1VWR B;  3CQR A;  5L8N A;  2ZAI A;  4ORS A;  2RTE B;  3RWX A;  1A57 A;  3STK A;  2FR2 A;  1SXY A;  2ALL X;  3ZWE A;  4O4S A;  3NPO A;  5JR8 A;  2FS6 A;  3U03 A;  1RXK A;  1FJ1 E;  1PBO A;  2Q9S A;  4WFU A;  4YCE A;  3GE2 A;  3S26 A;  1SWP A;  3ELZ A;  1NGL A;  3SZJ A;  3N91 A;  4KC7 A;  4GD9 A;  2RCQ A;  1TOU A;  2AT0 X;  2YG2 A;  4IAB A;  5HCE C;  3WYP A;  1IFB A;  4TNN A;  1JMZ A;  2OVS A;  2AKQ A;  2RTH B;  3TGC A;  2QOS C;  4QYP A;  5CYB A;  4Z27 A;  4NW4 A;  5HZ6 A;  1ERX A;  2IZL B;  3PDF A;  4YDA A;  1KT5 A;  2IZD B;  2OY1 O;  4O3Y A;  1SWE A;  1W5R A;  4CDD A;  1VWE B;  4YFQ A;  1RSU B;  3LV4 A;  4NYR A;  2OFB A;  1DZJ A;  2KTD A;  3BX7 A;  1P6P A;  1I4U A;  1SWQ A;  2CBR A;  4O4U A;  1VWI B;  2YMS A;  4TJZ A;  3WOV A;  1LKE A;  4BX6 B;  1T68 X;  4AYH A;  2Q39 A;  1FEM A;  1Y52 X;  1JV4 A;  2CM4 A;  4YKO A;  1LIE A;  2ACO A;  3TZS A;  3LNB A;  4O49 A;  4GUZ A;  3P6G A;  5HCD C;  3P6F A;  4YBP A;  1SXW A;  1VWN B;  4FQB B;  4ZR2 A;  2WEX A;  4Z6J A;  2G5L A;  2Z4H A;  1X8N A;  1YP7 A;  1X8P A;  3CBC A;  2BC3 A;  3JQO A;  4FBR A;  4NV8 A;  4MIR A;  4N7C A;  2X8T A;  3OJY C;  2Q4N A;  1CJ5 A;  4QZU A;  1W4T A;  1GX9 A;  3KFG A;  5CHK A;  2WQ9 A;  5EZ2 A;  4GZV A;  3T6L A;  1ZNG A;  4QRL A;  2HZQ A;  4ZGF A;  4COT A;  1OBQ A;  4GGZ A;  5CSE A;  3BU1 A;  1LID A;  4NLI A;  1PM1 X;  2GTL N;  4CPI A;  3WJD A;  2EU7 X;  4U3Q A;  2OF8 A;  3H3I A;  1O1U A;  2OVE A;  3PEC A;  1LUQ A;  5LJB A;  1SWG A;  3D95 A;  1URE A;  1ICN A;  3FMZ A;  1G85 A;  2RTP B;  5FQ7 E;  1GX8 A;  5DG4 A;  4ALB A;  1RAV A;  3FA8 A;  4I9R A;  1LPJ A;  3PQU A;  2FWV A;  2RD7 C;  3WJF A;  3WZP A;  4CK4 A;  2DJG A;  3VE1 A;  3NP1 A;  4YFP A;  5BVQ A;  3UEW A;  3WZN A;  3OD9 A;  2QCB A;  3TF6 A;  3P24 A;  2JU3 A;  1X8U A;  4TLJ A;  4U46 A;  3VHI A;  4ZJ0 A;  2JGS A;  1LCW A;  1SLG B;  3AKM A;  3MX7 A;  3MBT A;  1E2T A;  2IZF B;  3OBL A;  4HPA A;  3ZUO A;  1KQX A;  3BLG A;  4O3W A;  5HA1 A;  3C77 X;  3RZY A;  1B0O A;  2MJI A;  4QZT A;  1PBY A;  1SWH A;  1ZNH A;  2X34 A;  4A1H A;  5LJK A;  1Y0G A;  3OE3 A;  2RQ0 A;  1S44 A;  2OY5 O;  1OEJ A;  3VHH A;  2A3F X;  4IB6 A;  3T6F A;  4AZP A;  1B4M A;  4BX5 A;  3HPE A;  3VU1 A;  3CR6 A;  3NQ3 A;  1BRQ A;  1R0U A;  5HZQ A;  1VYO A;  5C0N A;  1SWF A;  4GE1 A;  2WUT A;  1Y9T A;  3VG2 A;  1VWP B;  2RTD B;  2RTA A;  3HWD A;  3RSW A;  4CSB A;  3WJC A;  1JJJ A;  2WWP A;  1IKJ A;  3WJE A;  1KFF A;  1IJ8 A;  3APW A;  1ADL A;  2NND A;  1H91 A;  2E4J A;  3RDO A;  1KT4 A;  4K19 A;  1NDJ A;  4BCS A;  2RTN B;  4CDF A;  4D6B A;  1N4J A;  1JBH A;  2FHL A;  3FLL A;  1AQB A;  2KTS A;  4MIS A;  2PFR A;  1MDC A;  4GNW A;  5D47 A;  4U9C A;  5D48 A;  5B29 A;  1I9H A;  2I5Z O;  1VWD B;  2IZH B;  1SWS A;  1SWU A;  2L5P A;  3F9D A;  1PEE A;  4B55 A;  1BJ7 A;  3ZW2 A;  3U0D A;  4AZR A;  3WBG A;  1KZX A;  4L3R A;  4WBK A;  1ERB A;  5EED A;  5FFH A;  3FR5 A;  5LJC A;  2GTL O;  1EII A;  1LCV A;  3X00 A;  5LKE A;  1OPB A;  1T0V A;  2JOZ A;  2X56 A;  1OBU A;  2LKK A;  1DZK A;  3DSZ A;  1JIW I;  3UEX A;  4BJ8 A;  2RTJ A;  4ORR A;  1BM5 A;  1DFV A;  5BVT A;  4MVK A;  1LEL A;  1QG5 A;  1VWM B;  2NP1 A;  2RTL A;  2Z4I A;  4IBA A;  5LKF A;  1BRP A;  1BEB A;  2VFB A;  2DM5 A;  1GT5 A;  1ACD A;  2CZT A;  4NNS A;  1E02 A;  1JMX A;  1HQP A;  2K23 A;  4Y59 A;  5HTD A;  3B2L A;  1BSQ A;  1K24 A;  3FEL A;  3RE6 A;  3ZZV A;  3VHM A;  4DQ4 A;  2KW1 A;  4O9S A;  2UZ2 A;  3HK1 A;  2IZG B;  5B5G A;  1HQQ A;  4XMC A;  2LBV A;  2IJA A;  4WFV A;  1JYJ A;  3CBS A;  3D96 A;  4UU3 A;  3RY1 A;  3F6Z B;  5LJE A;  2LBA A;  3EBK A;  2MM3 A;  3ZW0 B; 
#chains in the Genus database with same CATH homology
 1ITO A;  3S3Q A;  1U9X A;  1ZIV A;  4W4U A;  1NPZ A;  3V6C A;  2DC7 A;  3C9E A;  1ZCM A;  1QXP A;  2P86 A;  1FH0 A;  1JQP A;  3KSE A;  3N3K A;  2AS8 A;  1HUC B;  2NQA A;  3O1G A;  4OEL A;  2ARY A;  1K3B B;  1MHW A;  2DCC A;  2Y5B A;  3ERV A;  3KKU A;  1O0E A;  3BWK A;  2AYN A;  3F75 A;  3QSD A;  4X6H A;  4MZS A;  1EWL A;  4CDE B;  4I04 A;  1XKG A;  2F1G A;  3MHS A;  4Q8G A;  4YV8 A;  2AVW A;  1AU0 A;  2DCD A;  4YYS A;  1A6R A;  2XU1 A;  3GCB A;  2OUL A;  3P5W A;  2BDZ A;  1MS6 A;  2E02 A;  4DMY A;  2E03 A;  1AEC A;  1PIP A;  4X6I A;  1SP4 B;  2WBF X;  3HWN A;  1F2A A;  2DZZ A;  2YJ2 A;  3PW3 A;  1CS8 A;  3BOW A;  1YT7 A;  1CB5 A;  3LTW A;  2DJF B;  2G8E A;  2DC6 A;  3P5V A;  3D6S A;  1AYW A;  4OEM A;  3CBK A;  2AYO A;  2YJ8 A;  2H7J A;  4BGF A;  4C5P A;  3E1Z B;  4X6J A;  4W5B A;  3S3R A;  2R6N A;  3KWB X;  3M99 A;  4FK5 A;  3PBH A;  1W6F A;  2NQI A;  1MEG A;  4BPV A;  1U9W A;  5CVN B;  3BPM A;  2DCA A;  1KFU L;  3CH2 X;  1STF E;  2IPP B;  2BDL A;  3H89 A;  2R9N A;  2R9O A;  2R9M A;  1YK7 A;  4BS6 A;  1EWO A;  1CV8 A;  1U9Q X;  1ME3 A;  4I05 A;  5J94 A;  2G7Y A;  2NQD B;  4CDD B;  2XU5 A;  2AU1 A;  5EGW A;  3QT4 A;  4P6E A;  3CBJ A;  1BGO A;  3HHA A;  3I3T A;  3IHP A;  1ICF A;  2XU3 A;  1GX3 A;  4HWY A;  4YYQ A;  8PCH A;  2AUX A;  4BS5 A;  1NL6 A;  3MHH A;  1NB5 A;  1X9Y A;  1AU2 A;  3MTN A;  1GMY A;  1KHQ A;  4CZW A;  7PCK A;  1IWD A;  2OP3 A;  1U9V A;  4G54 A;  4DMX A;  4NV7 A;  3RVX A;  4XR7 A;  1SNK A;  4YYU A;  4QRV A;  3WXE A;  3B79 A;  4K7C A;  2FTD A;  2HHN A;  1PPN A;  2JQF R;  3K9M A;  4YVA A;  1U5I A;  1VJV A;  3TNX A;  1BP4 A;  2C0Y A;  1PXV A;  2VFC A;  2G6D A;  3D9W A;  3HHI A;  4W5C A;  2NQG A;  1Y08 A;  2FQ9 A;  3ZUA A;  1Y4H A;  3IOQ A;  2R9F A;  4YYV A;  2PBH A;  2F7D A;  5F02 A;  3RVV A;  1PPP A;  2FYE A;  3BCN A;  2DJG B;  2DZY A;  5CVO B;  3IMA A;  9PAP A;  3HD3 A;  2YJB A;  1DF0 A;  2XU4 A;  2FUD A;  4Q8H A;  3P5U A;  4MZO A;  3KX1 A;  4N8W A;  4PAD A;  3AI8 A;  2HH5 A;  4KLB A;  4QRG A;  5JH3 A;  4BSQ A;  3OF8 A;  2HD5 A;  3OVZ A;  2B1N A;  2R9C A;  4QBB A;  1EWM A;  3IEJ A;  4PI3 A;  3V6E A;  2BSZ A;  4BQV A;  2E00 A;  1CQD A;  2P7U A;  1NQC A;  3IUT A;  3LXS A;  3U8E A;  1KXR A;  3N3G A;  1AYU A;  3BC3 A;  1TL9 A;  2P0R A;  1KHP A;  1F2C A;  1PCI A;  4MSX A;  3H7D A;  4I07 A;  1CPJ A;  5CVM A;  3H8C A;  1ATK A;  3MOR A;  3DF0 A;  5K16 A;  2Y6E A;  5PAD A;  1AYV A;  1QOL A;  1MDW A;  2GHU A;  4QRX A;  4AXL A;  1VSN A;  2ATO A;  4QH6 A;  1YVB A;  4YYW A;  3LFY A;  1PPO A;  3P5X A;  2CB5 A;  1AIM A;  2FT2 A;  1MEM A;  1CJL A;  1POP A;  2JQG R;  1NB3 A;  3PDF A;  1CTE A;  3PNR A;  1W5R A;  2B1M A;  2DC9 A;  1CSB B;  3WXG A;  1BY8 A;  1KFX L;  3NHE A;  2HXZ A;  4GUZ A;  1PAD A;  2E01 A;  4AXM A;  5CHV A;  2FRA A;  2AIM A;  3H6S A;  1BQI A;  4N4Z A;  3H8B A;  4NV8 A;  3KFQ A;  2O6X A;  4ZUX U;  2PAD A;  3K8U A;  1W4T A;  3F5V A;  2YJC A;  2FO5 A;  3KW9 A;  4PP1 A;  4P6G A;  2VHS A;  4RY2 A;  5EF4 A;  3OIS A;  1F2B A;  2DC8 A;  4XUI A;  4WA6 A;  1TLO A;  1S4V A;  2AUZ A;  5A24 A;  2PRE A;  1QMY A;  2ACT A;  3N4C A;  1E2T A;  3CH3 X;  1NLJ A;  1F29 A;  3RVW A;  1CVZ A;  1GEC E;  3I06 A;  2PNS A;  1THE A;  1M6D A;  4CDF B;  1MIR A;  1QDQ A;  5CHT A;  1GLO A;  1TU6 A;  4CDC B;  4FIP A;  3K24 A;  1AU4 A;  3USV A;  4YYR A;  2YJ9 A;  4FJC A;  4N79 A;  1EWP A;  1YK8 A;  1GCB A;  2G8J A;  4B55 A;  2VHF A;  1YAL A;  3OVX A;  5JA7 A;  3BPF A;  1EF7 A;  1PPD A;  2IBI A;  1DEU A;  2FRQ A;  2GFO A;  3QJ3 A;  3KWZ A;  3WXF A;  6PAD A;  4PP2 E;  2VFB A;  1PBH A;  2DCB A;  3O0U A;  3OF9 A;  1Q6K A;  1PE6 A;  2OZ2 A;  1ME4 A;  3IV2 A;  2CIO A;  5FPW A;  1AU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...