2VFCA

The structure of mycobacterium marinum arylamine n-acetyltransferase in complex with coa
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
272
structure length
272
Chain Sequence
DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE
publication title Divergence of Cofactor Recognition Across Evolution: Coenzyme a Binding in a Prokaryotic Arylamine N-Acetyltransferase.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
total genus 78
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2007-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 2vfcA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 2vfcA01
1W4TA 1W5RA 2BSZA 3LTWA 3D9WA 4C5PA 1E2TA 4GUZA 4B55A 4NV8A 4BGFA 1GX3A 1W6FA 4NV7A 2VFBA 2VFCA
chains in the Genus database with same CATH superfamily
2FHLA 5HAEA 2C1QA 1FDQA 2UYWA 3NPOA 4QRLA 1LCVA 1VWHB 4IAWA 2RTFB 2RTMA 3FA6A 1P6PA 2RQ0A 3F6ZB 1NGLA 1STPA 1SWPA 2DJFA 3NADA 3UEXA 3VE1A 4U8UN 3O19A 4ORWA 5JR8A 2E4JA 4ODDA 4M7MA 2OL8O 4DQ4A 2C1SA 3TGAA 5IO5A 1BJ7A 1YUPA 2Y3FA 5FQ8E 1JZUA 2IJAA 2AMMX 1N9YA 2HNXA 5H9NA 4D6AA 1AQBA 1EIOA 1LNMA 1U17A 2GTFX 3UEWA 2NNQA 4HPDA 4CV7A 5HTDA 5L8NA 3OE3A 1QWDA 2A13A 3SLOA 1QY0A 3APUA 4YGZA 2JU8A 1SRHA 4ZHFA 4YFPA 1X8PA 4BQUA 3KZAA 5D47A 1HQPA 2CAMA 1VWKB 2OZQA 5L8OA 3WZOA 2MJIA 4BOEA 4YKMA 2QM9A 4O4OA 3UEVA 4QGXA 5LJHA 1X8UA 3PQUA 5JD2A 4D6BA 1S2PA 2AT0X 4COTA 1FTPA 1LIFA 2AT3X 3GAQA 1B4MA 3B2KA 1Y0GA 5DPQA 5BVQA 3MM0A 4CSBA 3BLGA 4I9RA 4IB6A 3IFBA 2LBVA 4BCSA 1KL5A 1N4JA 3VPJE 1SXUA 2X45A 4ORXA 4IB7A 5HCDC 1VWEB 1ICNA 2HYSA 4RUNA 2NP1A 2RTKA 5B10O 4NYRA 2OFBA 5F6ZA 1MVGA 2LKKA 5B11O 3C76X 4HPBA 1MOYA 4XMFA 5LJKA 1SWNA 4QYPA 1TXLA 5IO7A 4CPIA 2HLVA 2QO6A 3P6FA 1TOWA 3BDRA 5HCCC 1JYJA 3RE5A 1B8EA 3CR6A 4U46A 3TZSA 3TGBA 1W4TA 2WPUA 2RTPB 3AKMA 5LJBA 3T2XA 2LB6A 1KT7A 4O4XA 1BWYA 3D96A 1SWHA 1L6MA 1SWJA 5HA0A 4AZQA 3PEDA 1SA8A 3KFHA 4HPAA 4CPFA 2WQ9A 4ZHHA 2X56A 4BX5B 1QY1A 3PP6A 2I5VO 1FELA 3HOLA 1SWQA 4OKAA 3SZHA 4AZNA 5CE4A 5LKFA 2QO4A 3MVFA 4EKVA 2BC3A 4LZUA 3LNBA 1VYFA 2IZAA 4WBKA 1KQXA 4BX5A 3VGWA 1GKAB 2FKGA 4OS3A 4BX7B 2Y32A 3P6CA 1VWNB 4ZGFA 1NQMA 4IMNA 2FKJA 1NC9A 1RXHA 3LTWA 5H9KA 2X8FA 1ZNKA 1GKAA 2IZHB 3P6GA 5LJCA 1VWCB 4BX7A 1E06A 3D4RA 2KTSA 1SMPI 3PECA 2CZUA 1VWQB 3OD9A 3STKA 1OBUA 1WBIA 2QMIA 1Z24A 2O62A 4ORUA 3BU1A 5FFHA 3WXQA 1JJJA 1O1UA 2A0AA 3NQ3A 1GT1A 1EIIA 1PBYA 1ZNGA 2OF9A 2W2FA 4NNSA 3FELA 3WJEA 1JBHA 4Z28A 2F09A 1STSB 4AW8A 5H9AA 3DTQA 1KL3A 2BHVA 5D8JA 3NQ9A 3NBXX 1DZJA 1NP4A 5DG4A 1K3BA 5B3MO 4Z6JA 3CMPA 1GX9A 4KT5A 3E3CA 3PPTA 2BSZA 4ZHDA 3QQ2A 3KVNA 1BSOA 1LUQA 2MO5A 4IBAA 2K62A 1I78A 4C5PA 4DMOA 3EC5A 1BSQA 4YKOA 3T6LA 5B5FA 1EPAA 2CM9A 1VWOB 3O22A 1SLDB 2RTHB 4OMXA 2OY1O 2RD7C 4GDAA 2RCQA 3FA7A 2WEWA 3EM0A 4QAEA 3RBYA 1RLBE 3KFIA 3ZZVA 1SXWA 1VWRB 5LJDA 4CPEA 4IAXA 1HMSA 3S26A 3V8UA 4Z27A 3P6EA 4IRWA 1AELA 2X34A 2PQTA 2CM4A 4BGFA 3Q34A 1EI5A 1IW2A 1EPBA 2RTNB 2I5ZO 3HWFA 3MX7A 4YBPA 4Z2OA 3P6DA 1NDJA 4HPCA 4O3ZA 3JSQA 4QNIA 4Y5DA 1PTSA 2X46A 4TKJA 4NW4A 2OYBO 4MVEA 1RXJA 1OSPO 3HWGA 4DQ3A 2FWVA 1OEJA 4KCAA 2RA6A 3SOTA 3B2HA 4CDEA 2W2AA 5L8IA 4Z2PA 1VWMB 4NNTA 1N7YA 1SWGA 4OS0A 3X00A 3WYPA 1ACDA 4QZUA 2NNEA 1FE3A 2JGSA 3CKGA 1BRPA 2WWPA 2CZTA 4YDAA 1ZNLA 3WJBA 1IFCA 2IZIA 1KZWA 4K19A 1SRFA 4NYQA 3VG2A 2MM3A 5F58A 1BBPA 1LDOA 2NNDA 4GGRA 2OY7A 4KC8A 2DM5A 2IFBA 3WBGA 1I06A 2FRSA 2A2GA 4ZH6A 4QGWA 3RZYA 2LBAA 3B2JA 3RDMA 2AF5A 1I04A 1VWAB 4LZVA 1E2TA 3APWA 2W2BA 3RE6A 1SWDA 3WVMA 2G7BA 3F9DA 4WFVA 3GE2A 1O8VA 3HPEA 5EEEA 4UU2A 3AUMO 3ZQ3A 2Q4NA 3C77X 2A5CA 4KC7A 5B29A 2RTDB 1AVDA 4YBUA 4Y59A 1HXZA 2Z4IA 4YVBA 4N7DA 1BEBA 1EUOA 4JHQA 1LFOA 1Y9TA 2GC9A 4ID2A 1BLRA 2OL7A 3I0AA 4BBOA 2PFRA 4A1YA 1DF8A 4YCEA 2XKLA 1LPJA 4IB8A 3D97A 4RUUA 1XKIA 3STNA 4ZR2A 5BVTA 4TKBA 5IXGA 2RTOB 2BLGA 1N9MA 2GJ5A 4YDBA 1H91A 3F8AA 3UAQA 5IRWA 1QQSA 3LHNA 4INNA 4OEMA 2Q2MA 2RTGB 5H8TA 4IABA 4ZHGA 4ZJ0A 3MBTA 5HZ6A 4AZOA 4BX6B 5K06A 5KICA 1RAVA 3SLTA 2FR3A 2JW1A 2AL0X 4I3BA 4TNNA 3PH6A 4QGVA 3PDFA 3P24A 2RTAA 4GKCA 2IZKA 1X89A 5FENA 3VE2A 3S5VA 1X8OA 1OBPA 5K67A 4ZHCA 1FEMA 1Y52X 3IA8A 3VG6A 4BX6A 1JJXA 4WFUA 3JS1A 3APVA 1U0XA 3EBWA 1ZRYA 2FTBA 2CBSA 4CDCA 1ALBA 1SY3A 1EALA 4U9CA 4WHIA 2RCTA 1SWLA 2AH7X 1A57A 1KL4A 3BX7A 3EW2A 3KFGA 1W6FA 4EDEA 1HMTA 1CBRA 5C0NA 2QOMA 3PQSA 1E00A 1LELA 3T1DA 1ZNEA 3D9WA 1EXSA 3B2LA 1SXYA 2R73A 4O4UA 1DZKA 5LJGA 3RY2A 2AVIA 3HWDA 1GT5A 1JQPA 5HZ9A 4TJZA 1KT5A 3U9PC 1GT4A 3JQOA 2OY5O 1A18A 1UYNX 3TF6A 3BY0A 4O3XB 2F73A 3OBLA 3NR3A 3FIQA 3SLJA 2VFCA 4PSQA 2BS6A 2XSTA 4GRJA 2HZQA 3DSZA 3FW4A 2BS5A 1PMPA 1SREA 1GGLA 4NV7A 4GUZA 3TGCA 5F7GA 1VWIB 5K68A 4CDFA 4FGIB 1RSTB 1MUPA 2X55A 3CBCA 2RTIB 1FJ1E 2POAA 1I4UA 3EW1A 4YMYA 1VWBB 4L3RA 1UZ2X 5IRAA 4GGZA 5B2AO 1CBQA 5H9LA 1I9HA 1Y55X 1QABE 2OVEA 3BSZE 4IB9A 1QG5A 1JV4A 2R56A 1DFVA 4O9SA 2R74A 3PH5A 3ZW1B 1CBSA 1VWDB 1LCWA 1S44A 1ERXA 1NBXA 1SY2A 4ORYA 2ACPX 3LV4A 3HWEA 5AQ6A 2YMSA 4MVLA 4FBOA 4ORRA 4YH0A 1K24A 2Y3EA 1UREA 3ZW1A 2G79A 3KFFA 3T6FA 4HFOA 2C4IA 2RTRB 4MISA 4I9SA 1MEPA 2LA7A 3WJDA 3FR4A 4QZTA 3FR2A 1QY2A 3WOVA 2AT6X 4O4SA 1IJ8A 3ZW0A 2JN3A 1KT3A 2BT9A 4JGLA 3P02A 1VWPB 3FLLA 1T68X 3NX2A 2QO5A 2IZJA 3CKFA 4YCHA 4B55A 2A3FX 1E5PA 5L3YA 1UYOX 1RSUB 3PK2A 2YG2A 1AVGI 2G5LA 3HTYA 1SWOA 3U0DA 2KTDA 1OBQA 2WEXA 2G78A 1JMZA 2GTLO 3ZWEA 1ADLA 4GETA 5CYBA 1TVQA 4ORSA 3WZQA 4DCBA 3HK1A 1NQNA 1LIBA 1G74A 1S7DA 2ACOA 1SWTA 1GX3A 2X32A 4XMEA 4DNEA 1DZPA 1BSYA 1O1VA 2FT9A 3S5XA 5LJEA 1GX8A 3RDQA 2L5PA 4I6SA 2WR6A 5AJCA 3SZIA 2DJGA 1KQWA 1B56A 2PI3O 5IO6A 2RTEB 4GU8A 2X8SA 1T8VA 3ELXA 4GNYA 1G85A 2EU7X 1PBOA 2MF6A 3BU9A 4PJ2A 3N91A 1MX8A 1YP6A 1RBPA 1KT4A 4LKPA 1QFVA 5HCEC 1GT3A 2ANSA 4ALBA 3U03A 1KOIA 3FA8A 1OPBA 2JU7A 2RTLA 1SLEB 2N93A 1KXOA 4I95A 1SLGB 4NLIA 4GGTA 5F1EA 4OELA 3VU1A 2KW1A 1DC9A 2IZFB 1A3YA 3I17A 4QQ1A 1SLFB 1VWFB 1ZNHA 3RKGA 2IZDB 2IZGB 2OVDA 4I60A 4JNJA 2HKDA 3H3IA 4XMHA 5FQ6E 1DZMA 2G8CO 1ZNDA 3K3LA 3ZI8A 1SWEA 1YWBA 2X4MA 4GK9A 5HZ5A 2A8GA 1LF7A 2ALLX 1LCZA 2AT5X 4GH7A 4I3CA 1SWKA 2IZCB 3EYCA 2Z4HA 4MEEA 1X71A 4ZGUA 2RN4A 2MHDA 4YFQA 2OVSA 4NP1A 1IIUA 1OEEA 2QCBA 3EMMA 3G7XA 1T0VA 4MIRA 1EW3A 4BJ8A 2JOZA 4U8UO 5EPQA 4CDDA 2IZLB 1SY0A 1YP7A 3FR5A 1PM1X 4ZH9A 4AZRA 4UU3A 2F01A 3C78X 2A2UA 4MVKA 4FQBB 4ML7B 1SRJA 1YIVA 5EEDA 1B0OA 4EFGA 4L1NA 4XMCA 4YGHA 4FBRA 2FS7A 2ZAIA 4Y0QA 5EZ2A 3AEHA 1CBIA 5D45A 2KD2A 1VPRA 1HQQA 3UEUA 1E02A 1YWAA 4MVIA 1MX7A 4ALOA 1G7NA 1VWLB 2OY8A 3KQ0A 5BYPA 4GE1A 1SWBA 4LKTA 3HOEA 1HY2A 3NX1A 4AYHA 2OFRX 1D3SA 4EQAC 5HZ8A 1R0UA 2JMBA 4IMOA 4ARHA 1KZXA 3VHHA 1IKEA 3NQKA 1KGLA 2GH7A 1A2DA 5HA1A 3RSWA 1WUBA 4GJSA 3WZPA 4YFRA 5LKEA 5CHKA 5FQ7E 1KFFA 1ML7A 3FEPA 5F2BA 4O49A 1I05A 1MK5A 2X8TA 4GJVA 3FYFA 2WQAE 2OL6O 1YWCA 1W5RA 3BS2A 4Y0RA 1PEEA 3WJCA 1SWFA 5B5GA 3RWXA 1OEKA 4A1HA 1GM6A 1YWDA 1CRBA 1BRQA 3FEKA 4BVMA 3WJFA 2VFBA 3FDCA 4AZMA 4EXZA 1SY1A 2FHNX 2ASNX 3CQRA 1MM9A 3D95A 2L67A 2A5BA 3EBKA 3P6HA 1N43A 2JU3A 1EQDA 1SRIA 1VWGB 3WJGA 3WYQA 1NP1A 5FAZA 2KT4B 4ZFXA 4N7CA 1TOUA 1BM5A 4Y0SA 1QFTA 3AKNA 3ZUOA 4TKHA 2CBRA 1U18A 1VYGA 5B27A 3RDOA 2VDFA 2HMBA 3CBSA 1DF3A 1SWRA 1IFBA 4TLJA 3ELZA 2Q9SA 1N0SA 2OF8A 5HBSA 2FGSA 1ICMA 1HN2A 1SWCA 2OFAA 3RDUA 1JMXA 2GTLM 3BX8A 4ES7A 1GXAA 3FIDA 3FW5A 2ZSCA 3ZUIA 1Y9LA 4JO6A 1IKJA 3L4RA 4YGGA 3WZNA 4FBVA 4CPHB 1RXKA 3OJYC 4OMWA 1KT6A 1LKEA 4M6SA 1AVEA 3RY1A 1SWUA 1AB0A 3QKGA 1JJUA 4GNWA 1SRGA 5AJBA 5F6BA 2ZAGA 1SXXA 3ZW2A 4CPHA 4ON1A 4Y0PA 1HXLA 3VG4A 2Q39A 4I3DA 4NV8A 2RTCB 3SAOA 3ZW0B 2PY1A 3STMX 2WSJA 4GZVA 1CJ5A 3APXA 2Q2PA 2WUTA 3B2IA 4XMDA 2FR2A 3FA9A 2RTBB 3SZJA 2UZ2A 4ZCBA 1FENA 3CQNA 1LIDA 3MG5A 2RTQB 4A60A 4EEJA 2AT8X 3VG7A 2M4LA 4A8ZA 1JYDA 4OS8A 3VHMA 5HZQA 1LDQA 2GTLN 3NP1A 4AZPA 1DV9A 1STRB 1ERBA 5KHPA 4KIIA 3CWKA 3O2YA 2K23A 3S60A 5D48A 3VG3A 5AEOA 1Y53X 4GDZA 1VYOA 5HWZA 2IZEB 1X8QA 1OPAA 1JIWI 4R0BA 3VG5A 3FMZA 2QOSC 1LIEA 4HWMA 4U8UM 5IRUA 1HBQA 1LICA 4QYNA 4XMGA 2HZRA 1VWJB 4TQ2A 1HBPA 1SWAA 3Q6LA 1X8NA 2FLJA 2MWHA 5CSEA 5EDBA 1G5WA 2LFOA 4LQZA 1HMRA 2L9CA 2OVAA 2RTJA 3T2WA 3RDSA 2OFMX 4O3YA 3BRNA 3FENA 5KIDA 5D4AA 3VHIA 1D2UA 2P8GA 4Z2VA 4O3WA 1TW4A 1XCAA 4KH8A 4NLJA 4GD9A 4U3QA 1MDCA 4CK4A 5BVSA 2IZBA 5EDCA 5HTEA 3RDXA 2AKQA 1SWSA 2L68A 2FS6A
chains in the Genus database with same CATH topology
2YJ8A 2VHSA 1AECA 1YALA 1BY8A 2DCCA 3C9EA 5K16A 3KX1A 1ICFA 4CDDB 3KSEA 3H89A 1F2AA 1ME4A 3P5WA 1TU6A 1SNKA 1MIRA 5J94A 3V6EA 5EF4A 1AU3A 1X9YA 5CHTA 1SP4B 1MEGA 1YVBA 3HD3A 1CTEA 4XUIA 3QT4A 1PADA 2WBFX 4DMYA 1CPJA 2OULA 4YYSA 3H7DA 4BSQA 4X6HA 2DZZA 2Y5BA 4PI3A 2AS8A 3N3GA 1KFUL 3OVZA 2NQAA 3QSDA 4QRGA 4QRVA 2HHNA 3PBHA 3OF9A 2Y6EA 2NQDB 3S3RA 1BQIA 1NPZA 3IOQA 4FIPA 1W4TA 4YV8A 4YVAA 2AUXA 2GFOA 1AIMA 2AUZA 3ERVA 2DCDA 1PPOA 3IUTA 2PREA 2XU5A 7PCKA 2G7YA 2AYOA 8PCHA 4MZOA 1M6DA 4MZSA 4XR7A 2NQGA 1AU4A 3LTWA 1PBHA 2FRAA 1PCIA 2P0RA 2JQGR 1F29A 4PP1A 1PXVA 4W4UA 1CSBB 4G54A 4PADA 4KLBA 1S4VA 1K3BB 1PPNA 1KFXL 3BPMA 1GCBA 2B1NA 3DF0A 1PE6A 2HH5A 2G8EA 4BS6A 2BSZA 2P7UA 1U9QX 4DMXA 1ME3A 3AI8A 4I07A 4BQVA 1IWDA 1QXPA 1EWLA 3CBJA 1U5IA 1PPPA 1BP4A 1KHQA 3BPFA 3IV2A 2CIOA 1F2BA 4BGFA 2C0YA 4CDFB 4YYQA 4BS5A 2HXZA 1F2CA 4CDEB 1NLJA 1PIPA 4CZWA 1Y08A 4I05A 2AIMA 2R9FA 3RVXA 1GECE 1MHWA 1VSNA 3BOWA 5PADA 3HHAA 1AYWA 1CVZA 3KFQA 3P5VA 1KHPA 3MTNA 1NB5A 4K7CA 4Q8GA 3K8UA 3QJ3A 2R9MA 1E2TA 5FPWA 2B1MA 3E1ZB 3IMAA 2HD5A 1HUCB 1NB3A 4AXMA 2NQIA 2E00A 3OISA 3O1GA 1GMYA 3KWZA 1XKGA 4OEMA 2YJBA 4AXLA 1Q6KA 3MHSA 5JA7A 2VHFA 3N4CA 3PDFA 3P5UA 4CDCB 4W5CA 4ZUXU 1AYVA 1ZIVA 2YJ9A 2GHUA 4MSXA 2R9OA 4FJCA 1W6FA 3BWKA 4Q8HA 3WXGA 4PP2E 3D9WA 3GCBA 1JQPA 5EGWA 4YYVA 1ZCMA 1AU2A 1Y4HA 2CB5A 9PAPA 2VFCA 1O0EA 3LXSA 1QOLA 2DC6A 3IEJA 3K9MA 1KXRA 4NV7A 4GUZA 4X6JA 2FUDA 2R6NA 2DCAA 1ITOA 2FTDA 3BCNA 4YYUA 3MORA 3K24A 1YK8A 6PADA 1THEA 3I06A 3RVWA 3WXFA 1GLOA 1QMYA 1AYUA 2DZYA 3N3KA 1STFE 3RVVA 2DC9A 4I04A 5F02A 3OVXA 1DEUA 2H7JA 2DC7A 2YJCA 3TNXA 2FO5A 4B55A 4W5BA 1YK7A 1CS8A 2E02A 4N4ZA 4X6IA 1EWMA 4RY2A 2ACTA 4N79A 2IPPB 2AYNA 1GX3A 5CHVA 2R9CA 2O6XA 3USVA 3KW9A 3H8BA 3HWNA 1CQDA 3H6SA 1CJLA 1TL9A 3PW3A 4QH6A 2OZ2A 5CVOB 4OELA 3CBKA 4QBBA 1POPA 3S3QA 3F75A 3P5XA 5CVNB 1DF0A 1U9XA 2R9NA 3OF8A 2PADA 2BDLA 2G6DA 1VJVA 3NHEA 3I3TA 1U9VA 4YYWA 1EWPA 2PBHA 4P6GA 2FRQA 2F7DA 1NL6A 2FT2A 2DCBA 1CB5A 2AVWA 1EWOA 3H8CA 2XU4A 2P86A 2OP3A 3D6SA 1PPDA 2XU3A 2DC8A 3KKUA 3MHHA 1W5RA 4HWYA 4N8WA 4YYRA 2VFBA 2FQ9A 3V6CA 2AU1A 1MEMA 3CH3X 3BC3A 3U8EA 3M99A 3IHPA 2ARYA 4QRXA 2YJ2A 4WA6A 3ZUAA 4C5PA 4BPVA 5JH3A 1NQCA 4FK5A 5CVMA 2JQFR 1AU0A 1U9WA 2PNSA 1CV8A 1TLOA 4NV8A 3KWBX 2G8JA 1YT7A 1MS6A 3O0UA 4P6EA 2XU1A 2IBIA 5A24A 1QDQA 3CH2X 1ATKA 3F5VA 2DJGB 2BDZA 2E01A 1FH0A 2FYEA 2F1GA 3WXEA 1A6RA 1BGOA 2ATOA 3PNRA 2E03A 3LFYA 3B79A 1MDWA 3HHIA 2DJFB 1EF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4T A;  1W5R A;  2BSZ A;  3LTW A;  3D9W A;  4C5P A;  1E2T A;  4GUZ A;  4B55 A;  4NV8 A;  4BGF A;  1GX3 A;  1W6F A;  4NV7 A;  2VFB A;  2VFC A; 
#chains in the Genus database with same CATH topology
 2FHL A;  5HAE A;  2C1Q A;  1FDQ A;  2UYW A;  3NPO A;  4QRL A;  1LCV A;  1VWH B;  4IAW A;  2RTF B;  2RTM A;  3FA6 A;  1P6P A;  2RQ0 A;  3F6Z B;  1NGL A;  1STP A;  1SWP A;  2DJF A;  3NAD A;  3UEX A;  3VE1 A;  4U8U N;  3O19 A;  4ORW A;  5JR8 A;  2E4J A;  4ODD A;  4M7M A;  2OL8 O;  4DQ4 A;  2C1S A;  3TGA A;  5IO5 A;  1BJ7 A;  1YUP A;  2Y3F A;  5FQ8 E;  1JZU A;  2IJA A;  2AMM X;  1N9Y A;  2HNX A;  5H9N A;  4D6A A;  1AQB A;  1EIO A;  1LNM A;  1U17 A;  2GTF X;  3UEW A;  2NNQ A;  4HPD A;  4CV7 A;  5HTD A;  5L8N A;  3OE3 A;  1QWD A;  2A13 A;  3SLO A;  1QY0 A;  3APU A;  4YGZ A;  2JU8 A;  1SRH A;  4ZHF A;  4YFP A;  1X8P A;  4BQU A;  3KZA A;  5D47 A;  1HQP A;  2CAM A;  1VWK B;  2OZQ A;  5L8O A;  3WZO A;  2MJI A;  4BOE A;  4YKM A;  2QM9 A;  4O4O A;  3UEV A;  4QGX A;  5LJH A;  1X8U A;  3PQU A;  5JD2 A;  4D6B A;  1S2P A;  2AT0 X;  4COT A;  1FTP A;  1LIF A;  2AT3 X;  3GAQ A;  1B4M A;  3B2K A;  1Y0G A;  5DPQ A;  5BVQ A;  3MM0 A;  4CSB A;  3BLG A;  4I9R A;  4IB6 A;  3IFB A;  2LBV A;  4BCS A;  1KL5 A;  1N4J A;  3VPJ E;  1SXU A;  2X45 A;  4ORX A;  4IB7 A;  5HCD C;  1VWE B;  1ICN A;  2HYS A;  4RUN A;  2NP1 A;  2RTK A;  5B10 O;  4NYR A;  2OFB A;  5F6Z A;  1MVG A;  2LKK A;  5B11 O;  3C76 X;  4HPB A;  1MOY A;  4XMF A;  5LJK A;  1SWN A;  4QYP A;  1TXL A;  5IO7 A;  4CPI A;  2HLV A;  2QO6 A;  3P6F A;  1TOW A;  3BDR A;  5HCC C;  1JYJ A;  3RE5 A;  1B8E A;  3CR6 A;  4U46 A;  3TZS A;  3TGB A;  1W4T A;  2WPU A;  2RTP B;  3AKM A;  5LJB A;  3T2X A;  2LB6 A;  1KT7 A;  4O4X A;  1BWY A;  3D96 A;  1SWH A;  1L6M A;  1SWJ A;  5HA0 A;  4AZQ A;  3PED A;  1SA8 A;  3KFH A;  4HPA A;  4CPF A;  2WQ9 A;  4ZHH A;  2X56 A;  4BX5 B;  1QY1 A;  3PP6 A;  2I5V O;  1FEL A;  3HOL A;  1SWQ A;  4OKA A;  3SZH A;  4AZN A;  5CE4 A;  5LKF A;  2QO4 A;  3MVF A;  4EKV A;  2BC3 A;  4LZU A;  3LNB A;  1VYF A;  2IZA A;  4WBK A;  1KQX A;  4BX5 A;  3VGW A;  1GKA B;  2FKG A;  4OS3 A;  4BX7 B;  2Y32 A;  3P6C A;  1VWN B;  4ZGF A;  1NQM A;  4IMN A;  2FKJ A;  1NC9 A;  1RXH A;  3LTW A;  5H9K A;  2X8F A;  1ZNK A;  1GKA A;  2IZH B;  3P6G A;  5LJC A;  1VWC B;  4BX7 A;  1E06 A;  3D4R A;  2KTS A;  1SMP I;  3PEC A;  2CZU A;  1VWQ B;  3OD9 A;  3STK A;  1OBU A;  1WBI A;  2QMI A;  1Z24 A;  2O62 A;  4ORU A;  3BU1 A;  5FFH A;  3WXQ A;  1JJJ A;  1O1U A;  2A0A A;  3NQ3 A;  1GT1 A;  1EII A;  1PBY A;  1ZNG A;  2OF9 A;  2W2F A;  4NNS A;  3FEL A;  3WJE A;  1JBH A;  4Z28 A;  2F09 A;  1STS B;  4AW8 A;  5H9A A;  3DTQ A;  1KL3 A;  2BHV A;  5D8J A;  3NQ9 A;  3NBX X;  1DZJ A;  1NP4 A;  5DG4 A;  1K3B A;  5B3M O;  4Z6J A;  3CMP A;  1GX9 A;  4KT5 A;  3E3C A;  3PPT A;  2BSZ A;  4ZHD A;  3QQ2 A;  3KVN A;  1BSO A;  1LUQ A;  2MO5 A;  4IBA A;  2K62 A;  1I78 A;  4C5P A;  4DMO A;  3EC5 A;  1BSQ A;  4YKO A;  3T6L A;  5B5F A;  1EPA A;  2CM9 A;  1VWO B;  3O22 A;  1SLD B;  2RTH B;  4OMX A;  2OY1 O;  2RD7 C;  4GDA A;  2RCQ A;  3FA7 A;  2WEW A;  3EM0 A;  4QAE A;  3RBY A;  1RLB E;  3KFI A;  3ZZV A;  1SXW A;  1VWR B;  5LJD A;  4CPE A;  4IAX A;  1HMS A;  3S26 A;  3V8U A;  4Z27 A;  3P6E A;  4IRW A;  1AEL A;  2X34 A;  2PQT A;  2CM4 A;  4BGF A;  3Q34 A;  1EI5 A;  1IW2 A;  1EPB A;  2RTN B;  2I5Z O;  3HWF A;  3MX7 A;  4YBP A;  4Z2O A;  3P6D A;  1NDJ A;  4HPC A;  4O3Z A;  3JSQ A;  4QNI A;  4Y5D A;  1PTS A;  2X46 A;  4TKJ A;  4NW4 A;  2OYB O;  4MVE A;  1RXJ A;  1OSP O;  3HWG A;  4DQ3 A;  2FWV A;  1OEJ A;  4KCA A;  2RA6 A;  3SOT A;  3B2H A;  4CDE A;  2W2A A;  5L8I A;  4Z2P A;  1VWM B;  4NNT A;  1N7Y A;  1SWG A;  4OS0 A;  3X00 A;  3WYP A;  1ACD A;  4QZU A;  2NNE A;  1FE3 A;  2JGS A;  3CKG A;  1BRP A;  2WWP A;  2CZT A;  4YDA A;  1ZNL A;  3WJB A;  1IFC A;  2IZI A;  1KZW A;  4K19 A;  1SRF A;  4NYQ A;  3VG2 A;  2MM3 A;  5F58 A;  1BBP A;  1LDO A;  2NND A;  4GGR A;  2OY7 A;  4KC8 A;  2DM5 A;  2IFB A;  3WBG A;  1I06 A;  2FRS A;  2A2G A;  4ZH6 A;  4QGW A;  3RZY A;  2LBA A;  3B2J A;  3RDM A;  2AF5 A;  1I04 A;  1VWA B;  4LZV A;  1E2T A;  3APW A;  2W2B A;  3RE6 A;  1SWD A;  3WVM A;  2G7B A;  3F9D A;  4WFV A;  3GE2 A;  1O8V A;  3HPE A;  5EEE A;  4UU2 A;  3AUM O;  3ZQ3 A;  2Q4N A;  3C77 X;  2A5C A;  4KC7 A;  5B29 A;  2RTD B;  1AVD A;  4YBU A;  4Y59 A;  1HXZ A;  2Z4I A;  4YVB A;  4N7D A;  1BEB A;  1EUO A;  4JHQ A;  1LFO A;  1Y9T A;  2GC9 A;  4ID2 A;  1BLR A;  2OL7 A;  3I0A A;  4BBO A;  2PFR A;  4A1Y A;  1DF8 A;  4YCE A;  2XKL A;  1LPJ A;  4IB8 A;  3D97 A;  4RUU A;  1XKI A;  3STN A;  4ZR2 A;  5BVT A;  4TKB A;  5IXG A;  2RTO B;  2BLG A;  1N9M A;  2GJ5 A;  4YDB A;  1H91 A;  3F8A A;  3UAQ A;  5IRW A;  1QQS A;  3LHN A;  4INN A;  4OEM A;  2Q2M A;  2RTG B;  5H8T A;  4IAB A;  4ZHG A;  4ZJ0 A;  3MBT A;  5HZ6 A;  4AZO A;  4BX6 B;  5K06 A;  5KIC A;  1RAV A;  3SLT A;  2FR3 A;  2JW1 A;  2AL0 X;  4I3B A;  4TNN A;  3PH6 A;  4QGV A;  3PDF A;  3P24 A;  2RTA A;  4GKC A;  2IZK A;  1X89 A;  5FEN A;  3VE2 A;  3S5V A;  1X8O A;  1OBP A;  5K67 A;  4ZHC A;  1FEM A;  1Y52 X;  3IA8 A;  3VG6 A;  4BX6 A;  1JJX A;  4WFU A;  3JS1 A;  3APV A;  1U0X A;  3EBW A;  1ZRY A;  2FTB A;  2CBS A;  4CDC A;  1ALB A;  1SY3 A;  1EAL A;  4U9C A;  4WHI A;  2RCT A;  1SWL A;  2AH7 X;  1A57 A;  1KL4 A;  3BX7 A;  3EW2 A;  3KFG A;  1W6F A;  4EDE A;  1HMT A;  1CBR A;  5C0N A;  2QOM A;  3PQS A;  1E00 A;  1LEL A;  3T1D A;  1ZNE A;  3D9W A;  1EXS A;  3B2L A;  1SXY A;  2R73 A;  4O4U A;  1DZK A;  5LJG A;  3RY2 A;  2AVI A;  3HWD A;  1GT5 A;  1JQP A;  5HZ9 A;  4TJZ A;  1KT5 A;  3U9P C;  1GT4 A;  3JQO A;  2OY5 O;  1A18 A;  1UYN X;  3TF6 A;  3BY0 A;  4O3X B;  2F73 A;  3OBL A;  3NR3 A;  3FIQ A;  3SLJ A;  2VFC A;  4PSQ A;  2BS6 A;  2XST A;  4GRJ A;  2HZQ A;  3DSZ A;  3FW4 A;  2BS5 A;  1PMP A;  1SRE A;  1GGL A;  4NV7 A;  4GUZ A;  3TGC A;  5F7G A;  1VWI B;  5K68 A;  4CDF A;  4FGI B;  1RST B;  1MUP A;  2X55 A;  3CBC A;  2RTI B;  1FJ1 E;  2POA A;  1I4U A;  3EW1 A;  4YMY A;  1VWB B;  4L3R A;  1UZ2 X;  5IRA A;  4GGZ A;  5B2A O;  1CBQ A;  5H9L A;  1I9H A;  1Y55 X;  1QAB E;  2OVE A;  3BSZ E;  4IB9 A;  1QG5 A;  1JV4 A;  2R56 A;  1DFV A;  4O9S A;  2R74 A;  3PH5 A;  3ZW1 B;  1CBS A;  1VWD B;  1LCW A;  1S44 A;  1ERX A;  1NBX A;  1SY2 A;  4ORY A;  2ACP X;  3LV4 A;  3HWE A;  5AQ6 A;  2YMS A;  4MVL A;  4FBO A;  4ORR A;  4YH0 A;  1K24 A;  2Y3E A;  1URE A;  3ZW1 A;  2G79 A;  3KFF A;  3T6F A;  4HFO A;  2C4I A;  2RTR B;  4MIS A;  4I9S A;  1MEP A;  2LA7 A;  3WJD A;  3FR4 A;  4QZT A;  3FR2 A;  1QY2 A;  3WOV A;  2AT6 X;  4O4S A;  1IJ8 A;  3ZW0 A;  2JN3 A;  1KT3 A;  2BT9 A;  4JGL A;  3P02 A;  1VWP B;  3FLL A;  1T68 X;  3NX2 A;  2QO5 A;  2IZJ A;  3CKF A;  4YCH A;  4B55 A;  2A3F X;  1E5P A;  5L3Y A;  1UYO X;  1RSU B;  3PK2 A;  2YG2 A;  1AVG I;  2G5L A;  3HTY A;  1SWO A;  3U0D A;  2KTD A;  1OBQ A;  2WEX A;  2G78 A;  1JMZ A;  2GTL O;  3ZWE A;  1ADL A;  4GET A;  5CYB A;  1TVQ A;  4ORS A;  3WZQ A;  4DCB A;  3HK1 A;  1NQN A;  1LIB A;  1G74 A;  1S7D A;  2ACO A;  1SWT A;  1GX3 A;  2X32 A;  4XME A;  4DNE A;  1DZP A;  1BSY A;  1O1V A;  2FT9 A;  3S5X A;  5LJE A;  1GX8 A;  3RDQ A;  2L5P A;  4I6S A;  2WR6 A;  5AJC A;  3SZI A;  2DJG A;  1KQW A;  1B56 A;  2PI3 O;  5IO6 A;  2RTE B;  4GU8 A;  2X8S A;  1T8V A;  3ELX A;  4GNY A;  1G85 A;  2EU7 X;  1PBO A;  2MF6 A;  3BU9 A;  4PJ2 A;  3N91 A;  1MX8 A;  1YP6 A;  1RBP A;  1KT4 A;  4LKP A;  1QFV A;  5HCE C;  1GT3 A;  2ANS A;  4ALB A;  3U03 A;  1KOI A;  3FA8 A;  1OPB A;  2JU7 A;  2RTL A;  1SLE B;  2N93 A;  1KXO A;  4I95 A;  1SLG B;  4NLI A;  4GGT A;  5F1E A;  4OEL A;  3VU1 A;  2KW1 A;  1DC9 A;  2IZF B;  1A3Y A;  3I17 A;  4QQ1 A;  1SLF B;  1VWF B;  1ZNH A;  3RKG A;  2IZD B;  2IZG B;  2OVD A;  4I60 A;  4JNJ A;  2HKD A;  3H3I A;  4XMH A;  5FQ6 E;  1DZM A;  2G8C O;  1ZND A;  3K3L A;  3ZI8 A;  1SWE A;  1YWB A;  2X4M A;  4GK9 A;  5HZ5 A;  2A8G A;  1LF7 A;  2ALL X;  1LCZ A;  2AT5 X;  4GH7 A;  4I3C A;  1SWK A;  2IZC B;  3EYC A;  2Z4H A;  4MEE A;  1X71 A;  4ZGU A;  2RN4 A;  2MHD A;  4YFQ A;  2OVS A;  4NP1 A;  1IIU A;  1OEE A;  2QCB A;  3EMM A;  3G7X A;  1T0V A;  4MIR A;  1EW3 A;  4BJ8 A;  2JOZ A;  4U8U O;  5EPQ A;  4CDD A;  2IZL B;  1SY0 A;  1YP7 A;  3FR5 A;  1PM1 X;  4ZH9 A;  4AZR A;  4UU3 A;  2F01 A;  3C78 X;  2A2U A;  4MVK A;  4FQB B;  4ML7 B;  1SRJ A;  1YIV A;  5EED A;  1B0O A;  4EFG A;  4L1N A;  4XMC A;  4YGH A;  4FBR A;  2FS7 A;  2ZAI A;  4Y0Q A;  5EZ2 A;  3AEH A;  1CBI A;  5D45 A;  2KD2 A;  1VPR A;  1HQQ A;  3UEU A;  1E02 A;  1YWA A;  4MVI A;  1MX7 A;  4ALO A;  1G7N A;  1VWL B;  2OY8 A;  3KQ0 A;  5BYP A;  4GE1 A;  1SWB A;  4LKT A;  3HOE A;  1HY2 A;  3NX1 A;  4AYH A;  2OFR X;  1D3S A;  4EQA C;  5HZ8 A;  1R0U A;  2JMB A;  4IMO A;  4ARH A;  1KZX A;  3VHH A;  1IKE A;  3NQK A;  1KGL A;  2GH7 A;  1A2D A;  5HA1 A;  3RSW A;  1WUB A;  4GJS A;  3WZP A;  4YFR A;  5LKE A;  5CHK A;  5FQ7 E;  1KFF A;  1ML7 A;  3FEP A;  5F2B A;  4O49 A;  1I05 A;  1MK5 A;  2X8T A;  4GJV A;  3FYF A;  2WQA E;  2OL6 O;  1YWC A;  1W5R A;  3BS2 A;  4Y0R A;  1PEE A;  3WJC A;  1SWF A;  5B5G A;  3RWX A;  1OEK A;  4A1H A;  1GM6 A;  1YWD A;  1CRB A;  1BRQ A;  3FEK A;  4BVM A;  3WJF A;  2VFB A;  3FDC A;  4AZM A;  4EXZ A;  1SY1 A;  2FHN X;  2ASN X;  3CQR A;  1MM9 A;  3D95 A;  2L67 A;  2A5B A;  3EBK A;  3P6H A;  1N43 A;  2JU3 A;  1EQD A;  1SRI A;  1VWG B;  3WJG A;  3WYQ A;  1NP1 A;  5FAZ A;  2KT4 B;  4ZFX A;  4N7C A;  1TOU A;  1BM5 A;  4Y0S A;  1QFT A;  3AKN A;  3ZUO A;  4TKH A;  2CBR A;  1U18 A;  1VYG A;  5B27 A;  3RDO A;  2VDF A;  2HMB A;  3CBS A;  1DF3 A;  1SWR A;  1IFB A;  4TLJ A;  3ELZ A;  2Q9S A;  1N0S A;  2OF8 A;  5HBS A;  2FGS A;  1ICM A;  1HN2 A;  1SWC A;  2OFA A;  3RDU A;  1JMX A;  2GTL M;  3BX8 A;  4ES7 A;  1GXA A;  3FID A;  3FW5 A;  2ZSC A;  3ZUI A;  1Y9L A;  4JO6 A;  1IKJ A;  3L4R A;  4YGG A;  3WZN A;  4FBV A;  4CPH B;  1RXK A;  3OJY C;  4OMW A;  1KT6 A;  1LKE A;  4M6S A;  1AVE A;  3RY1 A;  1SWU A;  1AB0 A;  3QKG A;  1JJU A;  4GNW A;  1SRG A;  5AJB A;  5F6B A;  2ZAG A;  1SXX A;  3ZW2 A;  4CPH A;  4ON1 A;  4Y0P A;  1HXL A;  3VG4 A;  2Q39 A;  4I3D A;  4NV8 A;  2RTC B;  3SAO A;  3ZW0 B;  2PY1 A;  3STM X;  2WSJ A;  4GZV A;  1CJ5 A;  3APX A;  2Q2P A;  2WUT A;  3B2I A;  4XMD A;  2FR2 A;  3FA9 A;  2RTB B;  3SZJ A;  2UZ2 A;  4ZCB A;  1FEN A;  3CQN A;  1LID A;  3MG5 A;  2RTQ B;  4A60 A;  4EEJ A;  2AT8 X;  3VG7 A;  2M4L A;  4A8Z A;  1JYD A;  4OS8 A;  3VHM A;  5HZQ A;  1LDQ A;  2GTL N;  3NP1 A;  4AZP A;  1DV9 A;  1STR B;  1ERB A;  5KHP A;  4KII A;  3CWK A;  3O2Y A;  2K23 A;  3S60 A;  5D48 A;  3VG3 A;  5AEO A;  1Y53 X;  4GDZ A;  1VYO A;  5HWZ A;  2IZE B;  1X8Q A;  1OPA A;  1JIW I;  4R0B A;  3VG5 A;  3FMZ A;  2QOS C;  1LIE A;  4HWM A;  4U8U M;  5IRU A;  1HBQ A;  1LIC A;  4QYN A;  4XMG A;  2HZR A;  1VWJ B;  4TQ2 A;  1HBP A;  1SWA A;  3Q6L A;  1X8N A;  2FLJ A;  2MWH A;  5CSE A;  5EDB A;  1G5W A;  2LFO A;  4LQZ A;  1HMR A;  2L9C A;  2OVA A;  2RTJ A;  3T2W A;  3RDS A;  2OFM X;  4O3Y A;  3BRN A;  3FEN A;  5KID A;  5D4A A;  3VHI A;  1D2U A;  2P8G A;  4Z2V A;  4O3W A;  1TW4 A;  1XCA A;  4KH8 A;  4NLJ A;  4GD9 A;  4U3Q A;  1MDC A;  4CK4 A;  5BVS A;  2IZB A;  5EDC A;  5HTE A;  3RDX A;  2AKQ A;  1SWS A;  2L68 A;  2FS6 A; 
#chains in the Genus database with same CATH homology
 2YJ8 A;  2VHS A;  1AEC A;  1YAL A;  1BY8 A;  2DCC A;  3C9E A;  5K16 A;  3KX1 A;  1ICF A;  4CDD B;  3KSE A;  3H89 A;  1F2A A;  1ME4 A;  3P5W A;  1TU6 A;  1SNK A;  1MIR A;  5J94 A;  3V6E A;  5EF4 A;  1AU3 A;  1X9Y A;  5CHT A;  1SP4 B;  1MEG A;  1YVB A;  3HD3 A;  1CTE A;  4XUI A;  3QT4 A;  1PAD A;  2WBF X;  4DMY A;  1CPJ A;  2OUL A;  4YYS A;  3H7D A;  4BSQ A;  4X6H A;  2DZZ A;  2Y5B A;  4PI3 A;  2AS8 A;  3N3G A;  1KFU L;  3OVZ A;  2NQA A;  3QSD A;  4QRG A;  4QRV A;  2HHN A;  3PBH A;  3OF9 A;  2Y6E A;  2NQD B;  3S3R A;  1BQI A;  1NPZ A;  3IOQ A;  4FIP A;  1W4T A;  4YV8 A;  4YVA A;  2AUX A;  2GFO A;  1AIM A;  2AUZ A;  3ERV A;  2DCD A;  1PPO A;  3IUT A;  2PRE A;  2XU5 A;  7PCK A;  2G7Y A;  2AYO A;  8PCH A;  4MZO A;  1M6D A;  4MZS A;  4XR7 A;  2NQG A;  1AU4 A;  3LTW A;  1PBH A;  2FRA A;  1PCI A;  2P0R A;  2JQG R;  1F29 A;  4PP1 A;  1PXV A;  4W4U A;  1CSB B;  4G54 A;  4PAD A;  4KLB A;  1S4V A;  1K3B B;  1PPN A;  1KFX L;  3BPM A;  1GCB A;  2B1N A;  3DF0 A;  1PE6 A;  2HH5 A;  2G8E A;  4BS6 A;  2BSZ A;  2P7U A;  1U9Q X;  4DMX A;  1ME3 A;  3AI8 A;  4I07 A;  4BQV A;  1IWD A;  1QXP A;  1EWL A;  3CBJ A;  1U5I A;  1PPP A;  1BP4 A;  1KHQ A;  3BPF A;  3IV2 A;  2CIO A;  1F2B A;  4BGF A;  2C0Y A;  4CDF B;  4YYQ A;  4BS5 A;  2HXZ A;  1F2C A;  4CDE B;  1NLJ A;  1PIP A;  4CZW A;  1Y08 A;  4I05 A;  2AIM A;  2R9F A;  3RVX A;  1GEC E;  1MHW A;  1VSN A;  3BOW A;  5PAD A;  3HHA A;  1AYW A;  1CVZ A;  3KFQ A;  3P5V A;  1KHP A;  3MTN A;  1NB5 A;  4K7C A;  4Q8G A;  3K8U A;  3QJ3 A;  2R9M A;  1E2T A;  5FPW A;  2B1M A;  3E1Z B;  3IMA A;  2HD5 A;  1HUC B;  1NB3 A;  4AXM A;  2NQI A;  2E00 A;  3OIS A;  3O1G A;  1GMY A;  3KWZ A;  1XKG A;  4OEM A;  2YJB A;  4AXL A;  1Q6K A;  3MHS A;  5JA7 A;  2VHF A;  3N4C A;  3PDF A;  3P5U A;  4CDC B;  4W5C A;  4ZUX U;  1AYV A;  1ZIV A;  2YJ9 A;  2GHU A;  4MSX A;  2R9O A;  4FJC A;  1W6F A;  3BWK A;  4Q8H A;  3WXG A;  4PP2 E;  3D9W A;  3GCB A;  1JQP A;  5EGW A;  4YYV A;  1ZCM A;  1AU2 A;  1Y4H A;  2CB5 A;  9PAP A;  2VFC A;  1O0E A;  3LXS A;  1QOL A;  2DC6 A;  3IEJ A;  3K9M A;  1KXR A;  4NV7 A;  4GUZ A;  4X6J A;  2FUD A;  2R6N A;  2DCA A;  1ITO A;  2FTD A;  3BCN A;  4YYU A;  3MOR A;  3K24 A;  1YK8 A;  6PAD A;  1THE A;  3I06 A;  3RVW A;  3WXF A;  1GLO A;  1QMY A;  1AYU A;  2DZY A;  3N3K A;  1STF E;  3RVV A;  2DC9 A;  4I04 A;  5F02 A;  3OVX A;  1DEU A;  2H7J A;  2DC7 A;  2YJC A;  3TNX A;  2FO5 A;  4B55 A;  4W5B A;  1YK7 A;  1CS8 A;  2E02 A;  4N4Z A;  4X6I A;  1EWM A;  4RY2 A;  2ACT A;  4N79 A;  2IPP B;  2AYN A;  1GX3 A;  5CHV A;  2R9C A;  2O6X A;  3USV A;  3KW9 A;  3H8B A;  3HWN A;  1CQD A;  3H6S A;  1CJL A;  1TL9 A;  3PW3 A;  4QH6 A;  2OZ2 A;  5CVO B;  4OEL A;  3CBK A;  4QBB A;  1POP A;  3S3Q A;  3F75 A;  3P5X A;  5CVN B;  1DF0 A;  1U9X A;  2R9N A;  3OF8 A;  2PAD A;  2BDL A;  2G6D A;  1VJV A;  3NHE A;  3I3T A;  1U9V A;  4YYW A;  1EWP A;  2PBH A;  4P6G A;  2FRQ A;  2F7D A;  1NL6 A;  2FT2 A;  2DCB A;  1CB5 A;  2AVW A;  1EWO A;  3H8C A;  2XU4 A;  2P86 A;  2OP3 A;  3D6S A;  1PPD A;  2XU3 A;  2DC8 A;  3KKU A;  3MHH A;  1W5R A;  4HWY A;  4N8W A;  4YYR A;  2VFB A;  2FQ9 A;  3V6C A;  2AU1 A;  1MEM A;  3CH3 X;  3BC3 A;  3U8E A;  3M99 A;  3IHP A;  2ARY A;  4QRX A;  2YJ2 A;  4WA6 A;  3ZUA A;  4C5P A;  4BPV A;  5JH3 A;  1NQC A;  4FK5 A;  5CVM A;  2JQF R;  1AU0 A;  1U9W A;  2PNS A;  1CV8 A;  1TLO A;  4NV8 A;  3KWB X;  2G8J A;  1YT7 A;  1MS6 A;  3O0U A;  4P6E A;  2XU1 A;  2IBI A;  5A24 A;  1QDQ A;  3CH2 X;  1ATK A;  3F5V A;  2DJG B;  2BDZ A;  2E01 A;  1FH0 A;  2FYE A;  2F1G A;  3WXE A;  1A6R A;  1BGO A;  2ATO A;  3PNR A;  2E03 A;  3LFY A;  3B79 A;  1MDW A;  3HHI A;  2DJF B;  1EF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...