2VFCA

The structure of mycobacterium marinum arylamine n-acetyltransferase in complex with coa
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
272
structure length
272
Chain Sequence
b'DLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE
publication title Divergence of Cofactor Recognition Across Evolution: Coenzyme a Binding in a Prokaryotic Arylamine N-Acetyltransferase.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
total genus 78
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2007-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 2vfcA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 2vfcA01
1W6FA 4C5PA 1W5RA 2VFCA 2VFBA 3LTWA 2BSZA 4B55A 1E2TA 4GUZA 3D9WA 4BGFA 1GX3A 1W4TA 4NV7A 4NV8A
chains in the Genus database with same CATH superfamily
3PDFA 3APUA 2IZAA 1AVGI 3TF6A 5BYPA 1T0VA 1SRFA 2FT9A 1VWEB 3PPTA 1EQDA 1XCAA 4ZHFA 4I6SA 2AT6X 1SWRA 1XKIA 2OVSA 3FW4A 2PY1A 5LJHA 1S7DA 4ZFXA 4QYNA 4Z6JA 1LCWA 4LQZA 2CZUA 5IO7A 3F9DA 4GKCA 2RCTA 2NNEA 3OJYC 3VHMA 5HCDC 4GE1A 2MWHA 2BT9A 1UYOX 1ZNGA 4ID2A 3T2WA 1BJ7A 1GT5A 2A2GA 2AH7X 4EDEA 1OBUA 3I0AA 1P6PA 1HY2A 2HLVA 2JU7A 5CHKA 3ZI8A 1KZWA 1VWNB 1QY2A 2CBRA 3FIDA 4RUUA 2OL7A 1SY2A 3WJFA 3HTYA 2O62A 5CE4A 4GNYA 3AKNA 3BRNA 1SY1A 5JR8A 1SWGA 1ZRYA 2Q2PA 1G5WA 2OY8A 1IIUA 2X46A 4OS0A 1FJ1E 1X8QA 4YCHA 4YVBA 4DQ4A 1KGLA 2JMBA 1BSQA 2KD2A 4O3XB 5HCEC 1JJJA 4ALBA 2IZIA 1AQBA 1KOIA 1PEEA 1B56A 1ZNEA 4I3CA 1GM6A 4INNA 4K19A 4HFOA 4UU2A 3VG3A 5HA1A 3WYPA 5H9LA 1YP7A 1HBQA 1MM9A 2Q9SA 2FHLA 3D95A 5LJCA 1A57A 1BSOA 2WSJA 5L3YA 1JBHA 5EPQA 4YCEA 1WUBA 2ACOA 1RBPA 2GJ5A 4U3QA 3TZSA 3FEKA 3RDMA 3APXA 1IFCA 3B2JA 4Y5DA 5HZ6A 1HXLA 2AVIA 1KXOA 1YUPA 2IZBA 4I95A 4QGXA 2X8SA 5K68A 4C5PA 4ZGFA 2RTCB 5FQ6E 4XMDA 2RCQA 4AYHA 4BX5A 2LKKA 2C1SA 2Z4HA 2NNQA 4MVEA 4ORRA 2BSZA 2MO5A 1VWPB 4KCAA 3S26A 1LIFA 1TW4A 3CQRA 4HPDA 3HWDA 4I3BA 3P6DA 1ZNDA 2Q39A 3RDOA 3SLOA 4ZHDA 4GNWA 1N9MA 4I3DA 4QNIA 4QYPA 4ZH9A 4DNEA 4QAEA 1HXZA 1LICA 1LF7A 3AKMA 2OVAA 4O4UA 4GETA 1VWQB 1LDOA 1ERXA 1BLRA 1MVGA 1HMSA 4QGWA 3HWGA 1VYOA 4O9SA 3D4RA 2YMSA 4FQBB 4AZQA 1PBOA 2RTLA 1SWDA 2DJFA 2HMBA 4NV7A 3VG4A 1LIEA 4I9SA 2L67A 1VWIB 3BS2A 5B29A 3FEPA 2G79A 5D4AA 3LTWA 4EXZA 3NBXX 3CBCA 2KW1A 2QO5A 2R73A 3OD9A 3HPEA 3D97A 3B2IA 1SY3A 2W2AA 3O2YA 5IXGA 5HTEA 1AELA 4GGZA 4CPHB 1JQPA 1O8VA 5IRUA 5LJDA 3HOEA 3PK2A 5BVQA 3PQSA 3SZJA 1SRHA 2N93A 4WBKA 4IABA 4AZOA 1HMRA 1EPAA 2AF5A 3FIQA 2QO6A 2RTPB 2RTBB 2K62A 2RQ0A 3T1DA 2OF8A 1SXUA 3S5VA 1LFOA 4TKBA 3RBYA 3MX7A 4IMOA 1GGLA 2QM9A 1PM1X 1X8PA 2NNDA 2BS5A 1SWQA 1ADLA 2W2BA 3MVFA 3JQOA 4FBVA 4YFQA 3B2HA 1KT3A 3C77X 1A2DA 5HA0A 3VE1A 2MHDA 1VWCB 1VWJB 1YWBA 4GJSA 4HPAA 5EEEA 3ZZVA 2OF9A 2OZQA 2A3FX 2Z4IA 2Y3EA 4Z2OA 1SWUA 1TOWA 2EU7X 1LCZA 3BSZE 5DG4A 5KICA 2FLJA 1YWCA 3NR3A 4MVLA 3P6HA 2FGSA 5F6ZA 2X8TA 1Y0GA 2FR3A 3ZUIA 2AT8X 3CQNA 3K3LA 2ALLX 3NQ3A 1DZJA 2ANSA 5B3MO 4A1YA 2JGSA 5F1EA 1KL4A 3FA9A 3KFIA 4ALOA 3ZWEA 1STSB 3WJBA 1SWHA 3D96A 2A5BA 1QY1A 2FS7A 1HQPA 1RSUB 2WWPA 2R56A 2GTLN 4Y59A 1EIOA 1JYJA 4IB9A 5B5GA 1MOYA 5HZ8A 3BX8A 2I5VO 5HZ5A 3WZNA 1DF8A 5HTDA 1FEMA 1HBPA 2A0AA 4I9RA 4U8UM 4EKVA 4BX7B 2QOMA 3NQKA 4TKHA 2BC3A 4GD9A 3EMMA 1BBPA 2RTEB 1VWRB 3C78X 4QQ1A 2IZDB 3NQ9A 1ERBA 2VFBA 5K06A 2IJAA 4LKTA 1ZNKA 2RTQB 3ZW1B 4GGRA 1NBXA 3VU1A 1ZNHA 1OPBA 2RA6A 4CPEA 3HOLA 1SWEA 1SMPI 4TJZA 4YGHA 5D45A 4OEMA 3NX2A 4GH7A 3FENA 4NP1A 4TLJA 3FYFA 3L4RA 5B2AO 1UREA 2WR6A 2FKJA 1FTPA 3CKFA 5HZQA 1MX7A 3BU9A 1A18A 1GX8A 1KT6A 1Y9TA 2ASNX 1BRPA 2P8GA 1VWDB 5LJGA 3RDSA 3RDXA 4EEJA 1DZMA 3IA8A 2XKLA 1IKEA 2WUTA 3CMPA 1QQSA 2OY7A 4U46A 2KT4B 2HYSA 2WEWA 3Q6LA 3AEHA 1JYDA 1OBQA 2AT3X 4MIRA 2IZHB 2BS6A 5IRWA 1BEBA 2FWVA 2RTNB 3WJDA 4GZVA 2A5CA 5LJBA 1WBIA 4ML7B 1JIWI 1I05A 2LA7A 2LFOA 4YGZA 3RZYA 2IFBA 2X32A 4MISA 2MM3A 1YP6A 2L5PA 2WPUA 2OL8O 2OVDA 3CR6A 4XMFA 4A60A 5JD2A 4TQ2A 4IBAA 1B4MA 4PJ2A 1DZPA 1SRGA 1JZUA 3MM0A 3P24A 4YKMA 4ORUA 5D47A 4CDDA 2CM9A 4TNNA 3FA8A 1IKJA 4CPHA 2OY1O 4ZCBA 2Q4NA 4NW4A 3HK1A 4AZNA 3KFFA 1U0XA 3WVMA 4Y0QA 4KIIA 4CSBA 2RTOB 2RTMA 1E06A 2Y3FA 5BVSA 2QO4A 3LV4A 3RWXA 3PQUA 4MVIA 2PFRA 3FR2A 3VPJE 4CDEA 1U18A 1AVDA 4CDCA 1KQXA 2BLGA 3KVNA 4QZTA 4ZH6A 5L8IA 2IZLB 1I06A 1CBSA 2AKQA 4D6BA 2JU3A 3X00A 3UEXA 1SWSA 1K24A 3QQ2A 1X71A 5FQ7E 3SAOA 4BJ8A 3AUMO 4ORWA 5KIDA 5CSEA 1G85A 2CBSA 1YWDA 1RXHA 1VYGA 2FHNX 1GX9A 1SXWA 2PI3O 1QWDA 2ZSCA 3F6ZB 3FDCA 4KH8A 4KC7A 4RUNA 5FFHA 2RTHB 1BM5A 3KFGA 1NGLA 1NP1A 2QMIA 2RD7C 2F01A 3P6GA 5H9KA 1GT3A 5F58A 1LUQA 1JJXA 1LKEA 1GX3A 2ZAIA 5H9AA 1JMZA 3NP1A 3P02A 1EALA 1GXAA 3ZW0B 3STKA 1T8VA 4LKPA 2JN3A 2OY5O 4CK4A 2ZAGA 3SZIA 5HZ9A 1N7YA 3PH6A 2RTGB 1ICMA 2G5LA 1TOUA 2OFBA 3OE3A 4ARHA 3B2LA 1VWMB 1ALBA 3P6CA 1E00A 1PMPA 4ORSA 4D6AA 5LJKA 1O1UA 4YGGA 4ZHCA 4IMNA 1SLFB 3U9PC 4XMGA 1Z24A 5B10O 1BSYA 1W5RA 2FS6A 5H8TA 4BX7A 5FENA 4GGTA 1JMXA 1EUOA 4YDBA 4BBOA 4WFUA 3I17A 3UEWA 4A8ZA 1KT4A 4YMYA 1GKAB 2OFAA 4GDAA 2X4MA 4O4XA 1VWKB 2MF6A 4YBPA 1N0SA 4OMWA 3FA6A 2OFMX 3FR4A 4JHQA 1A3YA 3DSZA 4Z2VA 4IB6A 3RE6A 4PSQA 3ZW1A 3SLTA 4OS3A 4Y0SA 1Y55X 2IZJA 5KHPA 1SWFA 1JJUA 4NLIA 2FTBA 4OELA 2RTKA 4U8UO 2RTIB 4O4OA 4Z28A 3ELXA 1OPAA 1SRIA 4ZHGA 3S5XA 2CAMA 1I04A 5CYBA 1SWBA 4BGFA 1N43A 1W6FA 1RLBE 2FRSA 1ICNA 3OBLA 5AJCA 3PECA 4DQ3A 1LIBA 5D8JA 3IFBA 5FAZA 1QFTA 4QGVA 2NP1A 3FELA 4JNJA 1CRBA 2OVEA 4GJVA 2XSTA 3NPOA 1DFVA 1X8OA 3VE2A 5LJEA 4WHIA 1G74A 1PTSA 2MJIA 2WQAE 4NLJA 5HAEA 3MG5A 2X45A 3BDRA 1N9YA 3KZAA 3T6LA 2C1QA 4MVKA 4ORXA 2RTJA 1E2TA 3TGAA 1R0UA 2CM4A 2FR2A 1SWOA 3U0DA 1GT1A 1D2UA 4HWMA 3FA7A 1EI5A 2RTAA 4B55A 4BX6B 3FR5A 1CBRA 2UYWA 1VPRA 1OSPO 2RN4A 5BVTA 1NC9A 1KL3A 3RDQA 2Y32A 4HPCA 1MEPA 4DCBA 3MBTA 4IB8A 3P6EA 2JU8A 1X8NA 1IW2A 3VG6A 2I5ZO 1VWOB 5H9NA 1L6MA 3H3IA 4LZVA 1SREA 3F8AA 4ON1A 1G7NA 5B5FA 1LPJA 1NDJA 1SWKA 1SXXA 2GTLO 3DTQA 3FLLA 2IZGB 4XMEA 1HN2A 3UEVA 4O4SA 2AL0X 4A1HA 2LB6A 1CBQA 4WFVA 2ACPX 4NV8A 1RXKA 3VG7A 3S60A 3U03A 3TGBA 1IFBA 3WZQA 4Z27A 1K3BA 1MDCA 5HBSA 3LNBA 3N91A 2POAA 2HZQA 4L3RA 1KT5A 2DM5A 1VWGB 4ZJ0A 1LIDA 2C4IA 1B8EA 1SY0A 2A8GA 5FQ8E 1VWBB 2OFRX 3EYCA 3T2XA 3VHHA 3ZW2A 2IZKA 3PH5A 1KFFA 1TXLA 3NADA 3O19A 4NNTA 1EXSA 2L9CA 1OBPA 1OEEA 2YG2A 4COTA 4CPIA 5LKFA 3ZW0A 3APWA 3VG5A 2X55A 3EC5A 4AZPA 4YH0A 4OS8A 1N4JA 4GUZA 1NQNA 2K23A 3G7XA 1Y52X 1O1VA 1RXJA 4FBRA 2CZTA 2Q2MA 3O22A 4O3ZA 2GTLM 5IRAA 5IO6A 4Z2PA 1VWAB 1JV4A 3BY0A 4BQUA 4YFRA 5F2BA 2G78A 3E3CA 3SOTA 2RTRB 4BCSA 4HPBA 1GT4A 1QY0A 2G7BA 1GKAA 3WZPA 3TGCA 4FBOA 1FENA 1AVEA 3ZUOA 5F6BA 5AQ6A 4ODDA 4YFPA 4Y0RA 2WQ9A 4EQAC 4CDFA 1EPBA 1SLDB 1SWNA 1RSTB 3BU1A 1SLEB 2HKDA 3EBWA 2E4JA 3UEUA 3QKGA 5B27A 3RKGA 5IO5A 2KTSA 4QZUA 4GK9A 2VFCA 4N7CA 5K67A 4KT5A 4CPFA 3SLJA 1PBYA 1HMTA 4BOEA 5EEDA 3WBGA 2RTFB 3ZQ3A 4AW8A 1AB0A 1STRB 4ORYA 2GTFX 3WOVA 2A13A 2IZEB 2OL6O 2FKGA 3PEDA 1KT7A 4AZRA 2UZ2A 2IZCB 2GC9A 5EDCA 3STNA 1EW3A 1VWLB 2X56A 4NYQA 1ML7A 3PP6A 2LBAA 4EFGA 3EM0A 3UAQA 1QG5A 3D9WA 2HNXA 1I78A 2WEXA 3GE2A 3APVA 1SWPA 4FGIB 2QOSC 5D48A 2IZFB 2HZRA 1STPA 4DMOA 4YKOA 2AMMX 2QCBA 4ZR2A 1BWYA 2PQTA 1X8UA 2F09A 1DC9A 2JOZA 5AEOA 1UYNX 2GH7A 1SA8A 4LZUA 2A2UA 3HWFA 3WJCA 3CKGA 4YDAA 4BX6A 4IAXA 4ZGUA 1LCVA 3P6FA 5B11O 3ELZA 1FE3A 1I9HA 3EBKA 5HCCC 1SWLA 4L1NA 5L8OA 1FDQA 3CWKA 3NX1A 4IB7A 3SZHA 1I4UA 1S44A 5AJBA 4O3YA 4KC8A 4ZHHA 1KQWA 1E02A 2OYBO 2DJGA 1SLGB 3Q34A 1CBIA 4M6SA 1MK5A 3HWEA 4I60A 4NYRA 3BLGA 3B2KA 2LBVA 3CBSA 5L8NA 4U8UN 1FELA 4N7DA 1D3SA 4Y0PA 2AT0X 5EDBA 3JSQA 4O49A 3STMX 1VWFB 2BHVA 3FMZA 1TVQA 3RDUA 3KQ0A 3WYQA 2M4LA 3WXQA 2JW1A 4OKAA 3FW5A 4M7MA 1NQMA 2W2FA 4JO6A 4XMHA 1CJ5A 1LDQA 3RY1A 3T6FA 1SWCA 1S2PA 1SWTA 3WZOA 3RSWA 4GRJA 1X89A 4JGLA 5C0NA 1ZNLA 4NNSA 2VDFA 1IJ8A 4BX5B 1QFVA 1SWJA 4ES7A 2F73A 1DZKA 4TKJA 4AZMA 4OMXA 3BX7A 4XMCA 3JS1A 1H91A 4U9CA 5F7GA 1EIIA 3RY2A 2RTDB 3GAQA 1KL5A 4O3WA 4CV7A 3EW2A 1OEJA 2X34A 4QRLA 1E5PA 1HQQA 3WJEA 1DF3A 1BRQA 1SXYA 1LELA 1MX8A 1SWAA 2G8CO 3EW1A 3LHNA 4IAWA 4GDZA 5DPQA 3WJGA 4BVMA 4UU3A 3RE5A 1YIVA 1U17A 1W4TA 3VGWA 5EZ2A 4IRWA 1UZ2X 4MEEA 2KTDA 5LKEA 1ACDA 3C76X 1OEKA 4R0BA 3VHIA 1QABE 1Y9LA 1MUPA 3KFHA 1SRJA 2X8FA 4GU8A 1KZXA 1VWHB 1RAVA 1T68X 1VYFA 1YWAA 1B0OA 2AT5X 2L68A 3V8UA 2R74A 5HWZA 3VG2A 1Y53X 4YBUA 1NP4A 1LNMA 1DV9A
chains in the Genus database with same CATH topology
2FYEA 3PDFA 1AECA 3IUTA 3MTNA 1PE6A 5JA7A 1NLJA 4WA6A 3RVVA 2R9CA 4AXMA 7PCKA 1AIMA 1NB5A 4BS6A 2R9FA 1MEMA 3BCNA 4MZOA 5CVNB 3CBKA 3IOQA 3OF9A 1EWOA 3N4CA 1AYUA 1POPA 2DC6A 3AI8A 4QRVA 3O0UA 1PBHA 2AUZA 1YK7A 3F5VA 4QRXA 1VJVA 2YJ9A 1AU0A 1QOLA 3OF8A 1Q6KA 2YJBA 1YVBA 1ME4A 1CS8A 6PADA 2HHNA 1X9YA 2C0YA 4AXLA 1TL9A 1A6RA 3CH2X 3V6CA 4C5PA 5JH3A 1PPDA 2E00A 2BSZA 3KX1A 2OZ2A 1KFUL 2AVWA 1MHWA 2AS8A 2GFOA 3MORA 3E1ZB 2G8JA 4YYSA 2BDZA 1CQDA 4NV7A 1ATKA 3IHPA 3LTWA 1NPZA 1PIPA 3K8UA 4K7CA 1STFE 4X6IA 4W5CA 4CDDB 2B1MA 1JQPA 2H7JA 2HXZA 4X6HA 2P7UA 2F7DA 4HWYA 3RVWA 4CDEB 1CB5A 1QDQA 4CDCB 1DF0A 3WXEA 2ATOA 1ZCMA 2B1NA 2F1GA 2ARYA 1F2AA 3DF0A 1MIRA 1Y08A 1S4VA 4QH6A 5CHTA 1YK8A 2FRAA 1F2CA 4PI3A 3QSDA 2DC7A 1F2BA 1PPNA 1U9WA 2YJ8A 4XUIA 3P5XA 2AYNA 1PPPA 2VFBA 5A24A 2P86A 2YJ2A 2FUDA 3KKUA 3H8BA 2AU1A 4OEMA 1KFXL 3OISA 1NQCA 3IMAA 2E03A 2YJCA 4RY2A 1CSBB 4N79A 2DCCA 2IBIA 1TLOA 1O0EA 2VHSA 3H6SA 4YYQA 3M99A 2GHUA 4FIPA 4DMXA 3K24A 2G7YA 3RVXA 2NQAA 3QJ3A 1QXPA 4I07A 4BPVA 4I05A 1KXRA 1AU4A 3TNXA 1SNKA 2NQIA 5PADA 4YYVA 2CIOA 9PAPA 2ACTA 1YT7A 4P6EA 2R9OA 1HUCB 3D6SA 4YYWA 3S3QA 2DCDA 3HHAA 3NHEA 3GCBA 2XU1A 1ICFA 4X6JA 4MZSA 1K3BB 2AUXA 1ITOA 2BDLA 5FPWA 3U8EA 1GX3A 5EGWA 2VHFA 1EWLA 4PP2E 2AYOA 1IWDA 2JQGR 5CHVA 4G54A 1THEA 2DZYA 2FO5A 3KFQA 1ME3A 2E01A 3BPMA 2NQGA 1BGOA 3H8CA 1W5RA 4ZUXU 4MSXA 2XU4A 3BOWA 3P5VA 3KWZA 1ZIVA 3HD3A 1AYVA 2FT2A 4KLBA 2R9NA 4YYRA 3V6EA 4CDFB 3F75A 2HD5A 3I06A 4BSQA 4W5BA 1U9VA 2HH5A 1GLOA 4OELA 1XKGA 2O6XA 2E02A 4BGFA 2Y5BA 3LFYA 1W6FA 1AU2A 1MS6A 3BPFA 3P5UA 4FK5A 3MHSA 3BWKA 4QRGA 1TU6A 1QMYA 2DC9A 2NQDB 3WXGA 2WBFX 4Q8GA 1E2TA 3HWNA 2PNSA 8PCHA 4B55A 4QBBA 2DZZA 3KSEA 4P6GA 1CV8A 1NB3A 2DJGB 3QT4A 1EF7A 2PREA 5F02A 1BQIA 3H89A 4NV8A 1NL6A 4CZWA 3KW9A 2DCBA 4BS5A 1YALA 2R9MA 2XU5A 3LXSA 3KWBX 4YYUA 2FTDA 2XU3A 5EF4A 3I3TA 4GUZA 3PBHA 3CBJA 1KHPA 1MDWA 2P0RA 2IPPB 1AYWA 4Q8HA 1Y4HA 4I04A 2PBHA 3BC3A 5CVOB 1MEGA 5K16A 4YV8A 3B79A 1AU3A 1GMYA 1DEUA 3H7DA 2VFCA 3IV2A 1EWPA 1SP4B 1PXVA 1BP4A 3MHHA 2JQFR 4XR7A 2CB5A 3S3RA 4DMYA 3CH3X 2DC8A 1GECE 3D9WA 3ZUAA 3WXFA 1KHQA 1CTEA 2G6DA 1U5IA 4BQVA 3O1GA 1CPJA 3OVXA 2Y6EA 1M6DA 3C9EA 4N4ZA 2G8EA 2OULA 2DCAA 2R6NA 1CVZA 4PADA 1U9XA 4N8WA 4FJCA 3PW3A 1FH0A 1CJLA 1PADA 3N3KA 1GCBA 2AIMA 2OP3A 1U9QX 3N3GA 1VSNA 5CVMA 1F29A 4PP1A 1PCIA 3USVA 3OVZA 2PADA 3P5WA 4YVAA 3ERVA 2FQ9A 2FRQA 3K9MA 3PNRA 1W4TA 2DJFB 3IEJA 4W4UA 1PPOA 1BY8A 5J94A 3HHIA 1EWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6F A;  4C5P A;  1W5R A;  2VFC A;  2VFB A;  3LTW A;  2BSZ A;  4B55 A;  1E2T A;  4GUZ A;  3D9W A;  4BGF A;  1GX3 A;  1W4T A;  4NV7 A;  4NV8 A; 
#chains in the Genus database with same CATH topology
 3PDF A;  3APU A;  2IZA A;  1AVG I;  3TF6 A;  5BYP A;  1T0V A;  1SRF A;  2FT9 A;  1VWE B;  3PPT A;  1EQD A;  1XCA A;  4ZHF A;  4I6S A;  2AT6 X;  1SWR A;  1XKI A;  2OVS A;  3FW4 A;  2PY1 A;  5LJH A;  1S7D A;  4ZFX A;  4QYN A;  4Z6J A;  1LCW A;  4LQZ A;  2CZU A;  5IO7 A;  3F9D A;  4GKC A;  2RCT A;  2NNE A;  3OJY C;  3VHM A;  5HCD C;  4GE1 A;  2MWH A;  2BT9 A;  1UYO X;  1ZNG A;  4ID2 A;  3T2W A;  1BJ7 A;  1GT5 A;  2A2G A;  2AH7 X;  4EDE A;  1OBU A;  3I0A A;  1P6P A;  1HY2 A;  2HLV A;  2JU7 A;  5CHK A;  3ZI8 A;  1KZW A;  1VWN B;  1QY2 A;  2CBR A;  3FID A;  4RUU A;  2OL7 A;  1SY2 A;  3WJF A;  3HTY A;  2O62 A;  5CE4 A;  4GNY A;  3AKN A;  3BRN A;  1SY1 A;  5JR8 A;  1SWG A;  1ZRY A;  2Q2P A;  1G5W A;  2OY8 A;  1IIU A;  2X46 A;  4OS0 A;  1FJ1 E;  1X8Q A;  4YCH A;  4YVB A;  4DQ4 A;  1KGL A;  2JMB A;  1BSQ A;  2KD2 A;  4O3X B;  5HCE C;  1JJJ A;  4ALB A;  2IZI A;  1AQB A;  1KOI A;  1PEE A;  1B56 A;  1ZNE A;  4I3C A;  1GM6 A;  4INN A;  4K19 A;  4HFO A;  4UU2 A;  3VG3 A;  5HA1 A;  3WYP A;  5H9L A;  1YP7 A;  1HBQ A;  1MM9 A;  2Q9S A;  2FHL A;  3D95 A;  5LJC A;  1A57 A;  1BSO A;  2WSJ A;  5L3Y A;  1JBH A;  5EPQ A;  4YCE A;  1WUB A;  2ACO A;  1RBP A;  2GJ5 A;  4U3Q A;  3TZS A;  3FEK A;  3RDM A;  3APX A;  1IFC A;  3B2J A;  4Y5D A;  5HZ6 A;  1HXL A;  2AVI A;  1KXO A;  1YUP A;  2IZB A;  4I95 A;  4QGX A;  2X8S A;  5K68 A;  4C5P A;  4ZGF A;  2RTC B;  5FQ6 E;  4XMD A;  2RCQ A;  4AYH A;  4BX5 A;  2LKK A;  2C1S A;  2Z4H A;  2NNQ A;  4MVE A;  4ORR A;  2BSZ A;  2MO5 A;  1VWP B;  4KCA A;  3S26 A;  1LIF A;  1TW4 A;  3CQR A;  4HPD A;  3HWD A;  4I3B A;  3P6D A;  1ZND A;  2Q39 A;  3RDO A;  3SLO A;  4ZHD A;  4GNW A;  1N9M A;  4I3D A;  4QNI A;  4QYP A;  4ZH9 A;  4DNE A;  4QAE A;  1HXZ A;  1LIC A;  1LF7 A;  3AKM A;  2OVA A;  4O4U A;  4GET A;  1VWQ B;  1LDO A;  1ERX A;  1BLR A;  1MVG A;  1HMS A;  4QGW A;  3HWG A;  1VYO A;  4O9S A;  3D4R A;  2YMS A;  4FQB B;  4AZQ A;  1PBO A;  2RTL A;  1SWD A;  2DJF A;  2HMB A;  4NV7 A;  3VG4 A;  1LIE A;  4I9S A;  2L67 A;  1VWI B;  3BS2 A;  5B29 A;  3FEP A;  2G79 A;  5D4A A;  3LTW A;  4EXZ A;  3NBX X;  3CBC A;  2KW1 A;  2QO5 A;  2R73 A;  3OD9 A;  3HPE A;  3D97 A;  3B2I A;  1SY3 A;  2W2A A;  3O2Y A;  5IXG A;  5HTE A;  1AEL A;  4GGZ A;  4CPH B;  1JQP A;  1O8V A;  5IRU A;  5LJD A;  3HOE A;  3PK2 A;  5BVQ A;  3PQS A;  3SZJ A;  1SRH A;  2N93 A;  4WBK A;  4IAB A;  4AZO A;  1HMR A;  1EPA A;  2AF5 A;  3FIQ A;  2QO6 A;  2RTP B;  2RTB B;  2K62 A;  2RQ0 A;  3T1D A;  2OF8 A;  1SXU A;  3S5V A;  1LFO A;  4TKB A;  3RBY A;  3MX7 A;  4IMO A;  1GGL A;  2QM9 A;  1PM1 X;  1X8P A;  2NND A;  2BS5 A;  1SWQ A;  1ADL A;  2W2B A;  3MVF A;  3JQO A;  4FBV A;  4YFQ A;  3B2H A;  1KT3 A;  3C77 X;  1A2D A;  5HA0 A;  3VE1 A;  2MHD A;  1VWC B;  1VWJ B;  1YWB A;  4GJS A;  4HPA A;  5EEE A;  3ZZV A;  2OF9 A;  2OZQ A;  2A3F X;  2Z4I A;  2Y3E A;  4Z2O A;  1SWU A;  1TOW A;  2EU7 X;  1LCZ A;  3BSZ E;  5DG4 A;  5KIC A;  2FLJ A;  1YWC A;  3NR3 A;  4MVL A;  3P6H A;  2FGS A;  5F6Z A;  2X8T A;  1Y0G A;  2FR3 A;  3ZUI A;  2AT8 X;  3CQN A;  3K3L A;  2ALL X;  3NQ3 A;  1DZJ A;  2ANS A;  5B3M O;  4A1Y A;  2JGS A;  5F1E A;  1KL4 A;  3FA9 A;  3KFI A;  4ALO A;  3ZWE A;  1STS B;  3WJB A;  1SWH A;  3D96 A;  2A5B A;  1QY1 A;  2FS7 A;  1HQP A;  1RSU B;  2WWP A;  2R56 A;  2GTL N;  4Y59 A;  1EIO A;  1JYJ A;  4IB9 A;  5B5G A;  1MOY A;  5HZ8 A;  3BX8 A;  2I5V O;  5HZ5 A;  3WZN A;  1DF8 A;  5HTD A;  1FEM A;  1HBP A;  2A0A A;  4I9R A;  4U8U M;  4EKV A;  4BX7 B;  2QOM A;  3NQK A;  4TKH A;  2BC3 A;  4GD9 A;  3EMM A;  1BBP A;  2RTE B;  1VWR B;  3C78 X;  4QQ1 A;  2IZD B;  3NQ9 A;  1ERB A;  2VFB A;  5K06 A;  2IJA A;  4LKT A;  1ZNK A;  2RTQ B;  3ZW1 B;  4GGR A;  1NBX A;  3VU1 A;  1ZNH A;  1OPB A;  2RA6 A;  4CPE A;  3HOL A;  1SWE A;  1SMP I;  4TJZ A;  4YGH A;  5D45 A;  4OEM A;  3NX2 A;  4GH7 A;  3FEN A;  4NP1 A;  4TLJ A;  3FYF A;  3L4R A;  5B2A O;  1URE A;  2WR6 A;  2FKJ A;  1FTP A;  3CKF A;  5HZQ A;  1MX7 A;  3BU9 A;  1A18 A;  1GX8 A;  1KT6 A;  1Y9T A;  2ASN X;  1BRP A;  2P8G A;  1VWD B;  5LJG A;  3RDS A;  3RDX A;  4EEJ A;  1DZM A;  3IA8 A;  2XKL A;  1IKE A;  2WUT A;  3CMP A;  1QQS A;  2OY7 A;  4U46 A;  2KT4 B;  2HYS A;  2WEW A;  3Q6L A;  3AEH A;  1JYD A;  1OBQ A;  2AT3 X;  4MIR A;  2IZH B;  2BS6 A;  5IRW A;  1BEB A;  2FWV A;  2RTN B;  3WJD A;  4GZV A;  2A5C A;  5LJB A;  1WBI A;  4ML7 B;  1JIW I;  1I05 A;  2LA7 A;  2LFO A;  4YGZ A;  3RZY A;  2IFB A;  2X32 A;  4MIS A;  2MM3 A;  1YP6 A;  2L5P A;  2WPU A;  2OL8 O;  2OVD A;  3CR6 A;  4XMF A;  4A60 A;  5JD2 A;  4TQ2 A;  4IBA A;  1B4M A;  4PJ2 A;  1DZP A;  1SRG A;  1JZU A;  3MM0 A;  3P24 A;  4YKM A;  4ORU A;  5D47 A;  4CDD A;  2CM9 A;  4TNN A;  3FA8 A;  1IKJ A;  4CPH A;  2OY1 O;  4ZCB A;  2Q4N A;  4NW4 A;  3HK1 A;  4AZN A;  3KFF A;  1U0X A;  3WVM A;  4Y0Q A;  4KII A;  4CSB A;  2RTO B;  2RTM A;  1E06 A;  2Y3F A;  5BVS A;  2QO4 A;  3LV4 A;  3RWX A;  3PQU A;  4MVI A;  2PFR A;  3FR2 A;  3VPJ E;  4CDE A;  1U18 A;  1AVD A;  4CDC A;  1KQX A;  2BLG A;  3KVN A;  4QZT A;  4ZH6 A;  5L8I A;  2IZL B;  1I06 A;  1CBS A;  2AKQ A;  4D6B A;  2JU3 A;  3X00 A;  3UEX A;  1SWS A;  1K24 A;  3QQ2 A;  1X71 A;  5FQ7 E;  3SAO A;  4BJ8 A;  3AUM O;  4ORW A;  5KID A;  5CSE A;  1G85 A;  2CBS A;  1YWD A;  1RXH A;  1VYG A;  2FHN X;  1GX9 A;  1SXW A;  2PI3 O;  1QWD A;  2ZSC A;  3F6Z B;  3FDC A;  4KH8 A;  4KC7 A;  4RUN A;  5FFH A;  2RTH B;  1BM5 A;  3KFG A;  1NGL A;  1NP1 A;  2QMI A;  2RD7 C;  2F01 A;  3P6G A;  5H9K A;  1GT3 A;  5F58 A;  1LUQ A;  1JJX A;  1LKE A;  1GX3 A;  2ZAI A;  5H9A A;  1JMZ A;  3NP1 A;  3P02 A;  1EAL A;  1GXA A;  3ZW0 B;  3STK A;  1T8V A;  4LKP A;  2JN3 A;  2OY5 O;  4CK4 A;  2ZAG A;  3SZI A;  5HZ9 A;  1N7Y A;  3PH6 A;  2RTG B;  1ICM A;  2G5L A;  1TOU A;  2OFB A;  3OE3 A;  4ARH A;  3B2L A;  1VWM B;  1ALB A;  3P6C A;  1E00 A;  1PMP A;  4ORS A;  4D6A A;  5LJK A;  1O1U A;  4YGG A;  4ZHC A;  4IMN A;  1SLF B;  3U9P C;  4XMG A;  1Z24 A;  5B10 O;  1BSY A;  1W5R A;  2FS6 A;  5H8T A;  4BX7 A;  5FEN A;  4GGT A;  1JMX A;  1EUO A;  4YDB A;  4BBO A;  4WFU A;  3I17 A;  3UEW A;  4A8Z A;  1KT4 A;  4YMY A;  1GKA B;  2OFA A;  4GDA A;  2X4M A;  4O4X A;  1VWK B;  2MF6 A;  4YBP A;  1N0S A;  4OMW A;  3FA6 A;  2OFM X;  3FR4 A;  4JHQ A;  1A3Y A;  3DSZ A;  4Z2V A;  4IB6 A;  3RE6 A;  4PSQ A;  3ZW1 A;  3SLT A;  4OS3 A;  4Y0S A;  1Y55 X;  2IZJ A;  5KHP A;  1SWF A;  1JJU A;  4NLI A;  2FTB A;  4OEL A;  2RTK A;  4U8U O;  2RTI B;  4O4O A;  4Z28 A;  3ELX A;  1OPA A;  1SRI A;  4ZHG A;  3S5X A;  2CAM A;  1I04 A;  5CYB A;  1SWB A;  4BGF A;  1N43 A;  1W6F A;  1RLB E;  2FRS A;  1ICN A;  3OBL A;  5AJC A;  3PEC A;  4DQ3 A;  1LIB A;  5D8J A;  3IFB A;  5FAZ A;  1QFT A;  4QGV A;  2NP1 A;  3FEL A;  4JNJ A;  1CRB A;  2OVE A;  4GJV A;  2XST A;  3NPO A;  1DFV A;  1X8O A;  3VE2 A;  5LJE A;  4WHI A;  1G74 A;  1PTS A;  2MJI A;  2WQA E;  4NLJ A;  5HAE A;  3MG5 A;  2X45 A;  3BDR A;  1N9Y A;  3KZA A;  3T6L A;  2C1Q A;  4MVK A;  4ORX A;  2RTJ A;  1E2T A;  3TGA A;  1R0U A;  2CM4 A;  2FR2 A;  1SWO A;  3U0D A;  1GT1 A;  1D2U A;  4HWM A;  3FA7 A;  1EI5 A;  2RTA A;  4B55 A;  4BX6 B;  3FR5 A;  1CBR A;  2UYW A;  1VPR A;  1OSP O;  2RN4 A;  5BVT A;  1NC9 A;  1KL3 A;  3RDQ A;  2Y32 A;  4HPC A;  1MEP A;  4DCB A;  3MBT A;  4IB8 A;  3P6E A;  2JU8 A;  1X8N A;  1IW2 A;  3VG6 A;  2I5Z O;  1VWO B;  5H9N A;  1L6M A;  3H3I A;  4LZV A;  1SRE A;  3F8A A;  4ON1 A;  1G7N A;  5B5F A;  1LPJ A;  1NDJ A;  1SWK A;  1SXX A;  2GTL O;  3DTQ A;  3FLL A;  2IZG B;  4XME A;  1HN2 A;  3UEV A;  4O4S A;  2AL0 X;  4A1H A;  2LB6 A;  1CBQ A;  4WFV A;  2ACP X;  4NV8 A;  1RXK A;  3VG7 A;  3S60 A;  3U03 A;  3TGB A;  1IFB A;  3WZQ A;  4Z27 A;  1K3B A;  1MDC A;  5HBS A;  3LNB A;  3N91 A;  2POA A;  2HZQ A;  4L3R A;  1KT5 A;  2DM5 A;  1VWG B;  4ZJ0 A;  1LID A;  2C4I A;  1B8E A;  1SY0 A;  2A8G A;  5FQ8 E;  1VWB B;  2OFR X;  3EYC A;  3T2X A;  3VHH A;  3ZW2 A;  2IZK A;  3PH5 A;  1KFF A;  1TXL A;  3NAD A;  3O19 A;  4NNT A;  1EXS A;  2L9C A;  1OBP A;  1OEE A;  2YG2 A;  4COT A;  4CPI A;  5LKF A;  3ZW0 A;  3APW A;  3VG5 A;  2X55 A;  3EC5 A;  4AZP A;  4YH0 A;  4OS8 A;  1N4J A;  4GUZ A;  1NQN A;  2K23 A;  3G7X A;  1Y52 X;  1O1V A;  1RXJ A;  4FBR A;  2CZT A;  2Q2M A;  3O22 A;  4O3Z A;  2GTL M;  5IRA A;  5IO6 A;  4Z2P A;  1VWA B;  1JV4 A;  3BY0 A;  4BQU A;  4YFR A;  5F2B A;  2G78 A;  3E3C A;  3SOT A;  2RTR B;  4BCS A;  4HPB A;  1GT4 A;  1QY0 A;  2G7B A;  1GKA A;  3WZP A;  3TGC A;  4FBO A;  1FEN A;  1AVE A;  3ZUO A;  5F6B A;  5AQ6 A;  4ODD A;  4YFP A;  4Y0R A;  2WQ9 A;  4EQA C;  4CDF A;  1EPB A;  1SLD B;  1SWN A;  1RST B;  3BU1 A;  1SLE B;  2HKD A;  3EBW A;  2E4J A;  3UEU A;  3QKG A;  5B27 A;  3RKG A;  5IO5 A;  2KTS A;  4QZU A;  4GK9 A;  2VFC A;  4N7C A;  5K67 A;  4KT5 A;  4CPF A;  3SLJ A;  1PBY A;  1HMT A;  4BOE A;  5EED A;  3WBG A;  2RTF B;  3ZQ3 A;  4AW8 A;  1AB0 A;  1STR B;  4ORY A;  2GTF X;  3WOV A;  2A13 A;  2IZE B;  2OL6 O;  2FKG A;  3PED A;  1KT7 A;  4AZR A;  2UZ2 A;  2IZC B;  2GC9 A;  5EDC A;  3STN A;  1EW3 A;  1VWL B;  2X56 A;  4NYQ A;  1ML7 A;  3PP6 A;  2LBA A;  4EFG A;  3EM0 A;  3UAQ A;  1QG5 A;  3D9W A;  2HNX A;  1I78 A;  2WEX A;  3GE2 A;  3APV A;  1SWP A;  4FGI B;  2QOS C;  5D48 A;  2IZF B;  2HZR A;  1STP A;  4DMO A;  4YKO A;  2AMM X;  2QCB A;  4ZR2 A;  1BWY A;  2PQT A;  1X8U A;  2F09 A;  1DC9 A;  2JOZ A;  5AEO A;  1UYN X;  2GH7 A;  1SA8 A;  4LZU A;  2A2U A;  3HWF A;  3WJC A;  3CKG A;  4YDA A;  4BX6 A;  4IAX A;  4ZGU A;  1LCV A;  3P6F A;  5B11 O;  3ELZ A;  1FE3 A;  1I9H A;  3EBK A;  5HCC C;  1SWL A;  4L1N A;  5L8O A;  1FDQ A;  3CWK A;  3NX1 A;  4IB7 A;  3SZH A;  1I4U A;  1S44 A;  5AJB A;  4O3Y A;  4KC8 A;  4ZHH A;  1KQW A;  1E02 A;  2OYB O;  2DJG A;  1SLG B;  3Q34 A;  1CBI A;  4M6S A;  1MK5 A;  3HWE A;  4I60 A;  4NYR A;  3BLG A;  3B2K A;  2LBV A;  3CBS A;  5L8N A;  4U8U N;  1FEL A;  4N7D A;  1D3S A;  4Y0P A;  2AT0 X;  5EDB A;  3JSQ A;  4O49 A;  3STM X;  1VWF B;  2BHV A;  3FMZ A;  1TVQ A;  3RDU A;  3KQ0 A;  3WYQ A;  2M4L A;  3WXQ A;  2JW1 A;  4OKA A;  3FW5 A;  4M7M A;  1NQM A;  2W2F A;  4JO6 A;  4XMH A;  1CJ5 A;  1LDQ A;  3RY1 A;  3T6F A;  1SWC A;  1S2P A;  1SWT A;  3WZO A;  3RSW A;  4GRJ A;  1X89 A;  4JGL A;  5C0N A;  1ZNL A;  4NNS A;  2VDF A;  1IJ8 A;  4BX5 B;  1QFV A;  1SWJ A;  4ES7 A;  2F73 A;  1DZK A;  4TKJ A;  4AZM A;  4OMX A;  3BX7 A;  4XMC A;  3JS1 A;  1H91 A;  4U9C A;  5F7G A;  1EII A;  3RY2 A;  2RTD B;  3GAQ A;  1KL5 A;  4O3W A;  4CV7 A;  3EW2 A;  1OEJ A;  2X34 A;  4QRL A;  1E5P A;  1HQQ A;  3WJE A;  1DF3 A;  1BRQ A;  1SXY A;  1LEL A;  1MX8 A;  1SWA A;  2G8C O;  3EW1 A;  3LHN A;  4IAW A;  4GDZ A;  5DPQ A;  3WJG A;  4BVM A;  4UU3 A;  3RE5 A;  1YIV A;  1U17 A;  1W4T A;  3VGW A;  5EZ2 A;  4IRW A;  1UZ2 X;  4MEE A;  2KTD A;  5LKE A;  1ACD A;  3C76 X;  1OEK A;  4R0B A;  3VHI A;  1QAB E;  1Y9L A;  1MUP A;  3KFH A;  1SRJ A;  2X8F A;  4GU8 A;  1KZX A;  1VWH B;  1RAV A;  1T68 X;  1VYF A;  1YWA A;  1B0O A;  2AT5 X;  2L68 A;  3V8U A;  2R74 A;  5HWZ A;  3VG2 A;  1Y53 X;  4YBU A;  1NP4 A;  1LNM A;  1DV9 A; 
#chains in the Genus database with same CATH homology
 2FYE A;  3PDF A;  1AEC A;  3IUT A;  3MTN A;  1PE6 A;  5JA7 A;  1NLJ A;  4WA6 A;  3RVV A;  2R9C A;  4AXM A;  7PCK A;  1AIM A;  1NB5 A;  4BS6 A;  2R9F A;  1MEM A;  3BCN A;  4MZO A;  5CVN B;  3CBK A;  3IOQ A;  3OF9 A;  1EWO A;  3N4C A;  1AYU A;  1POP A;  2DC6 A;  3AI8 A;  4QRV A;  3O0U A;  1PBH A;  2AUZ A;  1YK7 A;  3F5V A;  4QRX A;  1VJV A;  2YJ9 A;  1AU0 A;  1QOL A;  3OF8 A;  1Q6K A;  2YJB A;  1YVB A;  1ME4 A;  1CS8 A;  6PAD A;  2HHN A;  1X9Y A;  2C0Y A;  4AXL A;  1TL9 A;  1A6R A;  3CH2 X;  3V6C A;  4C5P A;  5JH3 A;  1PPD A;  2E00 A;  2BSZ A;  3KX1 A;  2OZ2 A;  1KFU L;  2AVW A;  1MHW A;  2AS8 A;  2GFO A;  3MOR A;  3E1Z B;  2G8J A;  4YYS A;  2BDZ A;  1CQD A;  4NV7 A;  1ATK A;  3IHP A;  3LTW A;  1NPZ A;  1PIP A;  3K8U A;  4K7C A;  1STF E;  4X6I A;  4W5C A;  4CDD B;  2B1M A;  1JQP A;  2H7J A;  2HXZ A;  4X6H A;  2P7U A;  2F7D A;  4HWY A;  3RVW A;  4CDE B;  1CB5 A;  1QDQ A;  4CDC B;  1DF0 A;  3WXE A;  2ATO A;  1ZCM A;  2B1N A;  2F1G A;  2ARY A;  1F2A A;  3DF0 A;  1MIR A;  1Y08 A;  1S4V A;  4QH6 A;  5CHT A;  1YK8 A;  2FRA A;  1F2C A;  4PI3 A;  3QSD A;  2DC7 A;  1F2B A;  1PPN A;  1U9W A;  2YJ8 A;  4XUI A;  3P5X A;  2AYN A;  1PPP A;  2VFB A;  5A24 A;  2P86 A;  2YJ2 A;  2FUD A;  3KKU A;  3H8B A;  2AU1 A;  4OEM A;  1KFX L;  3OIS A;  1NQC A;  3IMA A;  2E03 A;  2YJC A;  4RY2 A;  1CSB B;  4N79 A;  2DCC A;  2IBI A;  1TLO A;  1O0E A;  2VHS A;  3H6S A;  4YYQ A;  3M99 A;  2GHU A;  4FIP A;  4DMX A;  3K24 A;  2G7Y A;  3RVX A;  2NQA A;  3QJ3 A;  1QXP A;  4I07 A;  4BPV A;  4I05 A;  1KXR A;  1AU4 A;  3TNX A;  1SNK A;  2NQI A;  5PAD A;  4YYV A;  2CIO A;  9PAP A;  2ACT A;  1YT7 A;  4P6E A;  2R9O A;  1HUC B;  3D6S A;  4YYW A;  3S3Q A;  2DCD A;  3HHA A;  3NHE A;  3GCB A;  2XU1 A;  1ICF A;  4X6J A;  4MZS A;  1K3B B;  2AUX A;  1ITO A;  2BDL A;  5FPW A;  3U8E A;  1GX3 A;  5EGW A;  2VHF A;  1EWL A;  4PP2 E;  2AYO A;  1IWD A;  2JQG R;  5CHV A;  4G54 A;  1THE A;  2DZY A;  2FO5 A;  3KFQ A;  1ME3 A;  2E01 A;  3BPM A;  2NQG A;  1BGO A;  3H8C A;  1W5R A;  4ZUX U;  4MSX A;  2XU4 A;  3BOW A;  3P5V A;  3KWZ A;  1ZIV A;  3HD3 A;  1AYV A;  2FT2 A;  4KLB A;  2R9N A;  4YYR A;  3V6E A;  4CDF B;  3F75 A;  2HD5 A;  3I06 A;  4BSQ A;  4W5B A;  1U9V A;  2HH5 A;  1GLO A;  4OEL A;  1XKG A;  2O6X A;  2E02 A;  4BGF A;  2Y5B A;  3LFY A;  1W6F A;  1AU2 A;  1MS6 A;  3BPF A;  3P5U A;  4FK5 A;  3MHS A;  3BWK A;  4QRG A;  1TU6 A;  1QMY A;  2DC9 A;  2NQD B;  3WXG A;  2WBF X;  4Q8G A;  1E2T A;  3HWN A;  2PNS A;  8PCH A;  4B55 A;  4QBB A;  2DZZ A;  3KSE A;  4P6G A;  1CV8 A;  1NB3 A;  2DJG B;  3QT4 A;  1EF7 A;  2PRE A;  5F02 A;  1BQI A;  3H89 A;  4NV8 A;  1NL6 A;  4CZW A;  3KW9 A;  2DCB A;  4BS5 A;  1YAL A;  2R9M A;  2XU5 A;  3LXS A;  3KWB X;  4YYU A;  2FTD A;  2XU3 A;  5EF4 A;  3I3T A;  4GUZ A;  3PBH A;  3CBJ A;  1KHP A;  1MDW A;  2P0R A;  2IPP B;  1AYW A;  4Q8H A;  1Y4H A;  4I04 A;  2PBH A;  3BC3 A;  5CVO B;  1MEG A;  5K16 A;  4YV8 A;  3B79 A;  1AU3 A;  1GMY A;  1DEU A;  3H7D A;  2VFC A;  3IV2 A;  1EWP A;  1SP4 B;  1PXV A;  1BP4 A;  3MHH A;  2JQF R;  4XR7 A;  2CB5 A;  3S3R A;  4DMY A;  3CH3 X;  2DC8 A;  1GEC E;  3D9W A;  3ZUA A;  3WXF A;  1KHQ A;  1CTE A;  2G6D A;  1U5I A;  4BQV A;  3O1G A;  1CPJ A;  3OVX A;  2Y6E A;  1M6D A;  3C9E A;  4N4Z A;  2G8E A;  2OUL A;  2DCA A;  2R6N A;  1CVZ A;  4PAD A;  1U9X A;  4N8W A;  4FJC A;  3PW3 A;  1FH0 A;  1CJL A;  1PAD A;  3N3K A;  1GCB A;  2AIM A;  2OP3 A;  1U9Q X;  3N3G A;  1VSN A;  5CVM A;  1F29 A;  4PP1 A;  1PCI A;  3USV A;  3OVZ A;  2PAD A;  3P5W A;  4YVA A;  3ERV A;  2FQ9 A;  2FRQ A;  3K9M A;  3PNR A;  1W4T A;  2DJF B;  3IEJ A;  4W4U A;  1PPO A;  1BY8 A;  5J94 A;  3HHI A;  1EWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...