2VFDA

Crystal structure of the f96s mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
247
structure length
247
Chain Sequence
ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHSERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Biochemical and Structural Characterization of Residue 96 Mutants of Plasmodium Falciparum Triosephosphate Isomerase: Active-Site Loop Conformation, Hydration and Identification of a Dimer-Interface Ligand-Binding Site.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 97
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2007-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vfdA00
4QISA 1HL2A 3PY2A 4FNTA 1R30A 5H91A 5ABTA 2JKEA 4QJ1A 3M16A 4NX0A 3GKFA 4HNUA 3L21A 1ADOA 4DBDA 5K7JA 2NXHA 2QUTA 1X6UA 1FWSA 3M5VA 4Y96A 1FWRA 1H7RA 3CT7A 4JTIA 1LBFA 2GVLA 3LTYA 3BGJA 3HIJA 1WBHA 3PBUA 3W7MA 1W3NA 3UY8A 5K9XA 2ZQ0A 3W1AA 3PAJA 2AQWA 2JGYA 1GVRA 3ZS4A 2CZDA 1SFJA 5FESA 2RFGA 3W86A 3WJZA 4HPXA 4S1FA 2A6LA 3HG3A 4LWWA 4RZ5A 5AHMA 1DL3A 5K4ZA 4RK8A 5FF7A 2HMCA 3L9CA 1ZALA 1OX4A 3CIWA 4L4LA 3W71A 3G22A 3W1QA 3BG5A 1PCKA 3GAYA 1W5NA 4ZVJA 3TQ0A 5DN1A 4QQ3A 1XDMA 4JN6A 3C6CA 1QCWA 3TQKA 3NQDA 3CEPA 4AF0B 3QQ1A 1EIXA 2YW4A 1ZAIA 3TW7A 1RD5A 1M7OA 3B03A 1J5TA 1GVFA 3ATYA 2BZNA 3DFPA 1LOQA 4UTMA 1W3IA 1TV5A 1DORA 2FFCA 4O10A 3LCIA 3PC0A 2VFGA 3O16A 1KFJA 2I1OA 4C1LA 1VH7A 4K39A 1D3HA 2NX3A 1IF2A 3GDLA 1K8XA 5U4NA 3NM1A 1SZEA 2VEKA 4Y6GA 3SIZA 3QM3A 4AWUA 3NQEA 3VKJA 1F6KA 2VFEA 3UWUA 2A5HA 2QJGA 3P60A 3WK3A 3KRSA 4IWWA 3OVPA 3N73A 3IIPA 4RX0A 4OE7A 3E02A 2Q3RA 3DI1A 5EBUA 4QNEA 3W1PA 2R8WA 1F74A 2QDGA 3W9ZA 2NWSA 3MHFA 3WJWA 4RJEA 2BX7A 6TIMA 2OT0A 3GDMA 3G1DA 2ZRWA 3QF0A 3RMJA 3PR2A 2WV8A 1FX6A 4ADUA 1CW2A 1TPWA 3TC7A 3ZWTA 1QO5A 1IGSA 3CQ0A 4HSNA 3TSMA 3IIXA 4O1BA 2Z1BA 1J2WA 4JY9A 5CKSA 5CSRA 3KRUA 4LUIA 3DGRA 2I14A 2RHGA 4FNRA 4KFOA 2ZBTA 3GR7A 3E96A 4K8EA 4EWND 4AEOA 4EF8A 5DCBA 4FX8A 3I7QA 4NX5A 4HPJA 3DFTA 3NL2A 4JTKA 1VGAA 1V7YA 5LNVA 1K02A 1NSJA 3EXTA 2WQPA 4JX4A 3W7HA 5KINA 1W5MA 4O57A 1QOQA 5C2XA 5FEWA 2A7RA 3NNTA 3GXPA 1I2QA 2NWRA 2FIQA 3M6YA 3G8EA 3CTLA 3ANYA 3OVQA 3DKLA 2FJKA 1H7NA 2EKCA 4UUIA 4K6AA 5FF3A 3RLUA 1VC4A 4XZ9A 4CNPA 4K38A 3W3OA 5F2IA 2TRSA 3G8RA 1RQHA 1XDLA 1NVMA 3LV5A 1E51A 1ME8A 3H54A 1C29A 4WXYA 2QAPA 1DQXA 1A53A 1I4NA 1EUNA 4LVDA 1X7FA 5CG7A 5DY3A 3TMQA 2VOMA 3W7KA 3E9AA 1L9WA 2RDUA 3L68A 5EA9A 3C61A 4XBSA 1NEYA 4WUIA 1H7XA 3G1FA 5AFDA 3EWZA 3W1XA 5K9DA 2VFHA 4O1AA 2EGZA 3GAKA 1EP3A 4MJZA 5AOUA 1KLZA 3B05A 3MI6A 4DPPA 4UNKA 2KZHA 3HQ1A 2Z6IA 2DZXA 4CQ8A 3G1YA 2BWGA 4AWTA 4O13A 3TR2A 4UTWC 3TDFA 1VHCA 4WQ6A 4YL2A 1YXCA 3THQA 5LKYA 2G95A 3PB2A 3BPWA 2DZTA 1JUBA 3W1NA 4FHAA 1LLZA 3RK8A 3QEZA 2PRHA 1JCNA 2VELA 5CZ0A 3PBWA 1I2NA 1W0MA 3HG2A 1K8YA 2QCGA 3CB8A 3Q94A 3W1LA 1FWWA 4FNSA 2Y7EA 1BWLA 3NVTA 3HGOA 5CZJA 4Y90A 3SJ3A 2QJHA 5AYYA 3EWXA 2A85A 4UR7A 1FY6A 4AAJA 1S5VA 1RV8A 1ZNNA 2ATSA 4W9TA 3BG3A 2JBMA 4UR8A 2YX0A 3NL3A 4UMAA 5F4XA 4LTSA 3GDTA 4NJJA 4IOTA 4A21A 3NQ2A 4IUOA 3UWYA 3L0KA 4DXVA 5A5WA 2QUUA 1F5ZA 1H5YA 3Q37A 3S5OA 5AHIA 5D2VA 3F4WA 2Y89A 4NNBA 5AHLA 1PL9A 3FOKA 3E12A 4MOZA 5HWMA 3B0UX 2A0NA 3LCFA 3L2IA 1QR7A 3EXSA 4L4MA 3H55A 1A5SA 1THFD 3MI3A 1R46A 1G4SA 4AWSA 4LS0A 4Q33A 2EPHA 1KTNA 2YCEA 3HO8A 5HNRA 2YYUA 4O14A 2GJNA 3U8GA 4A3UA 3NZRA 2W6RA 5G1YA 1KLYA 1GEQA 1PCWA 4TIMA 3C2VA 3S1VA 4K8HA 1VYPX 1JUEA 2DZPA 3WJSA 3V75A 3S8HA 3P62A 1W37A 4Q32A 3NM3A 4RXFA 4MZYA 2JKPA 3M1ZA 1QFEA 5AHEA 3N34A 4Z1AA 2DJLA 3NQ6A 5D32A 2E6YA 4PC8A 2FB2A 3O15A 4O18A 1OFBA 2J9XA 3DBPA 4AMAA 3NL6A 1ZCOA 4U28A 4NXSA 2NXGA 3EXRA 1H61A 3STCA 2ATMA 1NF0A 4IMCA 1JRBA 3N9SA 4ZL1A 1W5QA 3IIZA 1YTDA 4WD0A 3EWUA 3W70A 5DELA 2YGYA 3PB0A 2QCMA 3PF3A 2J24A 4XBKA 1FCVA 4E2BA 2Z0IA 3WK1A 1SZNA 4ZQMA 2C18A 2WO5A 3BW2A 1K8ZA 1T96A 3GIYA 1W5PA 1JUKA 4GUJA 3DU0A 3P67A 4NJKA 4BI6A 2FQIA 2A1YA 3FS2A 3G1SA 3SECA 1S5TA 5G2HA 1Z44A 3IVTA 3M44A 4I7VA 4CCCA 1GOXA 1KTCA 3KAOA 4JTSA 5D2WA 2DZSA 1OFOA 3DXIA 1XKYA 3B0VC 1NFBA 3NA8A 1LRTA 1LLWA 1TQXA 1VLWA 3IVSA 4PTNA 1QWGA 3NPUA 1PS9A 1EP1A 3LHZA 3TSDA 3MP4A 1LOSA 5FF0A 3HGSA 4JTHA 3IVUA 5A8GA 2X1UA 3IRDA 2C15A 2R94A 1SSGA 1XCFA 3A22A 4PL1A 3KVKA 1ME9A 3UY7A 3PSVA 3L5MA 4JX6A 4UCGA 3P8IA 5LZLA 3VE9A 5D38A 1VYRA 2WSRA 3NQFA 1OABA 4IJBA 4MFDA 5LNSA 3CIXA 2ZZ5A 3NQAA 3LBCA 4AF0A 4BWLA 5T26A 2HS6A 4GJ1A 1KFKA 5KZDA 5E0KA 3PULA 1SU5A 5FF2A 8TIMA 3TC6A 4Q4KA 3IIVA 2ZA2A 4G1KA 1TPFA 2VFIA 3RLVA 3UPWA 3W73A 4O17A 1XBYA 1ALDA 4N6EA 3P80A 3VNDA 4KFPA 2FPTA 1FCQA 3HGRA 1GQNA 4TR9A 4KWWA 3BVJA 1H7OA 3QMRA 5F2LA 3JRKA 3W7JA 3CC1A 1A5BA 1KBJA 2ZCGA 4PCFA 4JTEA 1TPEA 2J6XA 4MZ8A 1VRDA 3QMSA 4MFEA 2V82A 1R2RA 5EPDA 1JQXA 3SGUA 3TFXA 2YR1A 3A23A 3M5YA 4FNQA 1ZHAA 5CGQA 3DI0A 3MP3A 3W74A 5L9FA 1TO3A 2H3DA 1OFRA 1QPNA 1DHPA 2WSYA 4JICA 3ATZA 5L6UA 1YDVA 2ZDRA 2GQ8A 3NL5A 3DFSA 2QKFA 5DXXA 3VE7A 3NQ8A 2GUUA 1OF6A 4YMZA 1FDYA 2CLFA 4JDBA 1QDSA 5HR7A 4WOQA 3M5ZA 5FF4A 1FCBA 4QAIA 1QOPA 5I3IA 4PH6A 3PM6A 4DEFA 1ME7A 4NJIA 1R2SA 3KOFA 1WDWA 4IMEA 5CPOA 2JGQA 5FI8A 1WYIA 3W2UA 1VCGA 4BF9A 1G4TA 1VJIA 4LVAA 1W56A 3EX6A 4RLIA 1GT8A 1WBJA 4JTUA 3KXQA 1FUYA 1ZAJA 3DZ1A 2O7SA 4PEKA 2VXNA 1ZENA 3G1VA 3CPRA 1TV7A 5G2IA 1H1YA 4O53A 5BOOA 4JYEA 3DFQA 1LBLA 1SW7A 1KFCA 5IBXA 3NOEA 1H51A 1MEHA 4AVFA 3NPVA 3CWNA 2ZA3A 7TIMA 1KFLA 1MEIA 5J5DA 1BEUA 1U83A 3LTPA 3SGZA 2CLMA 4Z1CA 1LOLA 2G5WA 4UFKA 3KRZA 1TPUA 1LBMA 1SO3A 5HWNA 1R47A 3MWAA 3CU2A 3N2XA 3FJLA 2NX9A 3OVRA 3L0NA 2P0OA 2WNNA 3TV8A 1GYLA 4UFMA 1YADA 3WK2A 4ZMGA 3GKAA 1L6SA 2OT1A 4IXXA 4KKXA 3PWAA 2ZZ2A 3LI0A 1VCVA 3MBDA 5BW6A 4HN4A 2QF7A 4Z0JA 3N2MA 2QEZA 4O0ZA 3LHYA 1W54A 2B7PA 1OVDA 1DJNA 3BW4A 4N4PA 2YZRA 4LRTA 2J88A 3P81A 2C6QA 1TQJA 3T40A 3HB9A 3W7EA 2FB3A 3M47A 3W7PA 2WNQA 1WAUA 2QCDA 4JY8A 4YXGA 3NQCA 1JCJA 4GRSA 2ZTKA 3LLFA 3HPSA 3JS3A 3NGJA 4IX0A 1TV8A 4O11A 4DO4A 1B4EA 1F76A 5J5RA 1RPXA 3E49A 3ABRA 3N19B 4LY8A 3YPIA 1VR6A 4H4IA 2GVGA 4QSHA 3MMTA 3R5EA 4IPJA 2TPSA 4ZQRA 3TH6A 2CU0A 2CW6A 4RZ6A 2F84A 4QM1A 4OBTA 5EMUA 4O15A 3V1PA 3AJXA 2ZTJA 3QC3A 3L65A 5F4WA 3UZJA 1TTQA 5CPMA 1G67A 1TPVA 4IGHA 3TAOA 3C2FA 3GDKA 3FA5A 1LCOA 2Q3OA 4ONVA 1QPQA 2E5BA 1I2OA 5AC7A 4N02A 1ZY9A 2VEIA 4A2SA 4B5NA 4JYFA 3UWQA 3BLIA 3NO5A 4ZQPA 2Y88A 3ABOA 5LNWA 2H8ZA 2ZZ7A 4UTUA 3BARA 5LHEA 3B06A 1X8FA 3MHUA 2DP3A 5HQEA 1LRQA 2ABAA 1QPRA 2DJXA 2Y70A 4CQ9A 3EB2A 5G1TA 5AC8A 1TPC1 1G7UA 3WFAA 1H60A 3DAQA 2CLEA 3LX9A 3Q58A 1Q3NA 4M6VA 1GPWA 1FWTA 4MLJA 4M19A 3PBYA 2E77A 5DLCA 3C56A 1SSDA 1W1ZA 2C1HA 1JR1A 3UPBA 3NEVA 2P1FA 3GDRA 1EPXA 3CHVA 5D05A 1EA0A 1UUMA 3U2OA 2V5BA 4CNOA 5HULA 2VFDA 4NUWA 3UWVA 4O1DA 1YDOA 1OFEA 3O07A 3QFEA 1S5WA 3B8DA 5C55A 3EEGA 3G1HA 1F2JA 4S2BA 5D37A 1SO4A 1RR2A 4O16A 1PIIA 2ABBA 2V2DA 3S5YA 1WX0A 4MKNA 4LVBA 2XN1A 3PVFA 2AGKA 2FPYA 4BWLC 4R33A 5GVJA 4CNNA 2CLOA 1P0NA 4K36A 2QJIA 4M5PA 3STFA 4MY1A 2Y63A 5EYWA 4LRSA 4X2RA 4MJMA 4N9BA 3RFAA 1V5XA 1JCXA 2QCCA 1SUXA 1EP2A 2PURA 3T78A 5KZEA 5CZSA 4MUZA 4NQ1A 5D33A 4RXGA 2WPBA 4GXMA 3MUXA 5FEXA 3T4CA 1Z42A 1ONRA 3NDOA 3IGSA 3F03K 1OF8A 1W8SA 3WJXA 4IQLA 3W2LA 3CLMA 1KA9F 2ZRUA 2GJLA 1LYXA 1IIGA 2XN0A 3TCEA 1N55A 1YTEA 1G4EA 1TTJA 4N9EA 5I3KA 3W2JA 1XBVA 3MBFA 3O05A 5DCDA 4ZQCA 3STEA 5EY5A 1TJRA 3GXNA 4LV9A 4DPQA 4M6QA 5CPNA 2A6NA 3GX9A 4WY0F 1SPQA 1SQ7A 3N9RA 1SFLA 1OFPA 1GVSA 2Q8LA 1ZJIA 2R91A 1JCYA 2Y6ZA 3GR8A 4X3ZA 2CLLA 4JIPA 2QCLA 1ICSA 4NVTA 3TAKA 3MYPA 3UXDA 3LB0A 3L67A 1GTHA 1SR9A 2TSYA 3RU6A 1QO2A 3HBLA 2JKAA 1W5OA 3WJYA 4XUGA 4DQWA 2X1SA 3QQ0A 4GC4A 5KTLA 3HPXA 4XTIA 5TIMA 2BSLA 1OX5A 4EIVA 1GG1A 2Y7DA 4WY0B 3HGJA 5BNKA 3BG9A 1FBAA 3SFKA 3G0XA 3ABQA 1LM1A 1RVGA 1H63A 4HIBA 4DELA 3FKKA 1RQEA 3F1QA 2D73A 3DHDA 4Z1DA 3SI9A 1EWDA 1GJPA 2QAFA 3LV6A 3CWOX 3P7YA 5IBXC 2NX1A 1UBSA 1FXQA 3N3MA 1O4UA 2H8XA 3SSJA 2J9ZA 3LDVA 1YDNA 3HJZA 1SZFA 4JX5A 4A29A 3MP5A 4BK9A 3EX1A 3C0JA 3TA6A 4ADSA 3FYOA 4I7UA 5EL1A 2A7PA 4RKAA 4CCDA 3MYOA 3S5ZA 3W7QA 3LRMA 1SO5A 4UIOA 4H3DA 1TPDA 1EEPA 3T7VA 1K7FA 1CI1A 1H50A 3Q2DA 1K3UA 2YDAA 4N6FA 3S0CA 4FB7A 4NT0A 3VFLA 3P82A 4MLRA 5AHFA 3QMTA 4IMDA 4KFNA 2GVJA 2C16A 3QH2A 4NJGA 3ZFHA 4ADTA 3PUDA 4OV4A 4UTKA 4N2YA 1AMKA 4YWIA 3O06A 3W2KA 4UTJA 3G18A 2ISSA 2X16A 4JTTA 4NZJA 4O1CA 1X1ZA 3WK0A 4TO8A 5SWUA 4Z1BA 3GXTA 1KV5A 3TXZA 2A2IA 3LHTA 2TYSA 4NXKA 1KM1A 2H90A 2X1RA 3ZR4A 4HSOA 1H7WA 2C3ZA 5DBTA 4YCOA 5EKYA 2J27A 3M7WA 3W7DA 5DY2A 4OV9A 5DXYA 5FEPA 3LRLA 3RNDA 1TB3A 4LU0A 1ICPA 2V0TA 5F1UA 3S42A 1EX5A 2QUVA 2H3BA 1W3TA 2WNZA 1SZGA 2Z2UA 3M41A 1ML1A 1H62A 2RKXA 1UJPA 1GZGA 3NQMA 2CLIA 3W07A 1DOSA 1FCUA 4JYDA 5D02A 1UB3A 1Q6RA 1T0OA 3GB6A 3NQ7A 3QW4B 1MSSA 1G4PA 3UNDA 4RR4A 4O52A 4X9SA 3LCXA 4ZQOA 1GWJA 4X22A 2E6AA 3QSRA 2NV2A 4GE8A 4DO6A 2NUXA 1KM0A 2NLIA 5LNUA 1EB3A 4ZZ9A 1XI3A 3NR0A 3M0ZA 2DZVA 2CLHA 5HWJA 2P10A 3W1MA 3TROA 1U5JA 3U6WA 4GUHA 4EF9A 3RF9A 3C8FA 1KM4A 3C2RA 3LCLA 5I3FA 3QSTA 5AHNA 5C5YA 3UD6A 1LP6A 2PC4A 2ISVA 3LHVA 3F4NA 4RCXA 1HUVA 3T44A 3ELFA 1TPH1 5K3VA 4JGDA 3IEBA 1VYSX 4JEQA 1T99A 4WZHA 3HG4A 2X30A 1OFAA 3S1WA 4FIRA 3CEUA 3S5NA 2YSWA 1DBTA 4BI5A 3OHIA 3C4UA 4HNVA 1CX9A 3QRHA 1OYCA 1VQTA 4TX9A 3M43A 1LZOA 4JTJA 5G2WA 3TU9A 2ZRXA 4OHQA 2X2GA 3BGGA 4K7VA 4UFLA 1JULA 3CM4A 4UTTA 1AL8A 2E6DA 2ZRZA 3P74A 1B57A 2PCQA 1XUUA 3EX2A 3P5ZA 3NG3A 2B7QA 1D3GA 2G97A 2NXIA 1TRDA 3EKLA 3LGEA 1SO6A 2YXGA 1KFBA 2V5LA 4CLMA 4MYXA 2CZEA 2ZA1A 1AK5A 4MIMA 4NZFA 4UFIA 2PRMA 3W7RA 2ZYFA 2HSAA 5DBUA 4BR1A 4FO4A 1XFBA 2Y62A 5I3JA 1P1XA 4LVGA 2B0MA 4I9AA 4WJEA 3B04A 1F73A 4JXCA 3FYPA 3S9YA 1DQWA 3PG8A 4LT9A 1LROA 1TRIA 3FFSA 4YLWA 3TJXA 1VPXA 1I2RA 2CZ5A 4EOUA 1PE1A 3L5AA 1LDCA 4O12A 1T8XA 2CLKA 3TW6A 3A21A 2RDWA 3VI2A 2J9YA 1OYAA 1KBIA 1VS1A 3H53A 1D9EA 4TMBA 3BO9A 3PSWA 3TUUA 4PA8A 4N9DA 1OK6A 3NQVA 3SW6A 2V9DA 3GZ3A 4LS2A 5I3GA 2BTMA 3L5LA 3W1UA 1L2UA 3I7SA 1BWKA 3W87A 4HHPA 5HR6A 4O0KA 3LM7A 4ML9A 3TXVA 1LTDA 2TMDA 1DVJA 2DZUA 4GFSA 1P5BA 2B4GA 1VLIA 4LW7A 3OG3A 4FNUA 5E1QA 2A21A 1I2PA 3W83A 5LGZA 2OJPA 4M6PA 1O5KA 3P5YA 2FLIA 1Q6OA 4LVFA 3R12A 4FIQA 2NZLA 2WJZA 1I45A 2E09A 3S1UA 3QPZA 1YPIA 4O28A 1HG3A 1TJPA 1JQVA 4LUJA 5D2YA 1NAL1 2IQTA 1KM2A 1YPFA 3S6DA 4FX7A 5BMWA 1WV2A 4AXKA 2F7FA 1FWNA 1GG0A 5C54A 5AB3A 3QJAA 1FXPA 5CPLA 2ZZ6A 4FEZA 4NNAA 1I8JA 1FQ0A 3KFTA 2ZFAA 3QPYA 4MY8A 1FDZA 4FX6M 4ALDA 4UXDA 1Q6QA 1P4CA 3G1AA 2C0AA 3STGA 2OMAA 4AHPA 1A50A 4LV4A 3W7OA 3BLFA 1O60A 4J9JA 1B4KA 3I7RA 3LXAA 3B4UA 3L0GA 3VCRA 4NNCA 1HFBA 1B9BA 3BW3A 4R34A 2H6RA 3THAA 3C2EA 4FXSA 3KHJA 4WY0A 1B3OA 3PUEA 3W1TA 5AYXA 3P61A 4HKPA 4H6KA 2GQ9A 4HT3A 1HTIA 3M5XA 1MXSA 1AG1O 4OGZA 4XKYB 3BV4A 3UYCA 1IIHA 1PVNA 2FPVA 4FF7A 1MO0A 1PHQA 4LNYA 4UMBA 2DU2A 1H1ZA 2B7NA 4OT7A 3TE9A 4N4QA 3TK7A 2X1TA 3C3NA 1XXXA 4JTFA 1P0KA 4XQ6A 5F2MA 4UFJA 4JNMA 1ZAHA 1N8FA 1EUAA 2O7QA 4Z0SA 3W84A 1O95A 2Z6JA 3NQGA 2V2CA 3W76A 3N14A 1JJKA 3W7CA 1G6CA 3EX3A 4UTLA 2E6FA 5LSMA 3G24A 3NYZA 4EVZA 4O8RA 1BTMA 5F2GA 4NJHA 3GNDA 5AYZA 3LI1A 4JD4A 4MYAA 1OHLA 3AO0A 2E1DA 4GUIA 3W7GA 1TCDA 3QW3A 3P84A 3R13A 2CWNA 3TIMA 1SW3A 4O19A 2HS8A 1K7XA 1W31A 4Y9AA 1VZWA 3W85A 5TQLA 1DJQA 1IXPA 4GBUA 3TX9A 2QCNA 3LERA 4ICNA 2WSQA 1OG0A 2W0UA 3PBVA 4QIUA 1K7EA 4I7WA 2ZRVA 4MZ1A 5LGXA 1G69A 1J4EA 1YTKA 5G4WA 1IXNA 4BFAA 5KZMA 4JTGA 4QITA 3IGXA 1M5WA 4P61A 3SR7A 4ORMA 1VHNA 4OWGA 3TSBA 1MEWA 2Y61A 1Z48A 2Y7FA 4UMCA 2VC6A 4CCEA 2JK2A 3SZ8A 2LLEA 2VKZG 4O4WA 5AN7A 1X1OA 1SW0A 1EWEA 3W1RA 3FJ6A 4JIQA 2NUWA 1KM5A 1S3HA 4UFHA 4A2RA 5HUOA 1OX4B 5HINA 3G0UA 3EKZA 4HNTA 2UV8G 1XBXA 5TBOA 3MW7A 5AC6A 1M6JA 1WOAA 3JR2A 4FNPA 4IPIA 1NF7A 2WOQA 3LXBA 1YXDA 1F7BA 1XUZA 4A22A 4MPQA 2QCDB 3LHWA 3UWZA 1JRCA 3W2NA 1VCFA 5I3HA 4R7JA 3I65A 1OK4A 1UUOA 3INPA 2Y7GA 4IMGA 5D2TA 3PS7A 2YW3A 4XTDA 2GQAA 4U4MA 1L6YA 1WXJA 3W6YA 2DORA 3A5FA 3NXFA 5K4XA 1XL9A 4DF1A 4UTTC 1GYNA 4QNWA 3DENA 5LHFA 3MI2A 3PUOA 1LRNA 2XN2A 3LCWA 1DKWA 1WQ5A 4AH7A 2V8ZA 2ZZ3A 4M7TA 4N9CA 2ZZ4A 4FXRA 5MHBA 1ICQA 2GPTA 2G96A 4HNNA 4O54A 1IXOA 4JTLA 3W7NA 2QDHA 1H7PA 5IM51 2ISWA 3HPZA 4M7SA 5LNRA 3MO7A 2WKJA 3GYEA 3KVLA 4GUFA 5BRBA 4Z08A 3EWYA 4UNLA 1OX6A 3P8JA 1LORA 2YYTA 4LOCA 3G3MA 4K7YA 4OU1A 2R14A 1FDJA 3W88A 1C8VA 4WX2A 1A5CA 2E68A 4ZQNA 1AW2A 1F05A 3EX4A 4OQVA 3UZ5A 3O63A 4C1KA 3TJLA 5D30A 4RZ4A 3UWWA 1K03A 1TPB1 4JS3A 1L6WA 3IGUA 3I68A 3OA3A 1IXQA 3W23A 1RZMA 4DF2A 3LLDA 4IX2A 4WOZA 1Q6LA 1KM3A 2Q8ZA 4GNJA 5HJLA 2PRLA 1KV8A 1TMHA 1Y0EA 3OBKA 1XBZA 1F6PA 1A5AA 1JVNA 4WXZA 5C6MA 4YCPA 3BLEA 4GWEA 2CFFA 4R53A 4LC8A 2E5CA 3T55A 4NU7A 1AW1A 3O1NA 4O50A 3W72A 1GVOA 1AW5A 2VEPA 4LS1A 2A4AA 3GVGA 4UTHA 3UQNA 5KSWA 1AL7A 5HMSA 2B7OA 2NUYA 3UXAA 3DHFA 1G7VA 4RV8A 1YXYA 4JR5A 2VEMA 3GLCA 3SY5A 3A5VA 3C52A 2FDSA 3OEXA 3LHUA 5HUPA 1HO1A 1OFDA 4O4VA 4KWVA 3ZWSA 4TMCA 3I6RA 4POCA 3LRKA 2E5DA 4PFMA 4PODA 3TNOA 5D2XA 2CZFA 3EWWA 1RQBA 1WA3A 4S2CA 4IXHA 1O94A 3EWBX 3W7LA 2W79A 1TIMA 4D2JA 1DV7A 5E93A 3W22A 1PV8A 5F1VA 1QAPA 4JDYA 3S1XA 5H2ZA 3O8AA 5K9CA 1Q45A 2ZZ1A 3O6YX 3KX6A 3ABSA 1JCLA 1TTPA 4IMFA 3HOJA 3W7IA 3W75A 1OFQA 3FLUA 3HG5A 4TU1A 3TKFA 3HMJG 5K2ZA 3L66A 1XC4A 4MVAA 4CQAA 3BK0A 3LXCA 1KFEA 4BI7A 1QMLA 4DF0A 2YPIA 2YFOA 3DKJA 1KM6A 3O6DA 1QNVA 1YLVA 2V81A 2EHHA 4UTIA 2BLEA 3LTSA 2BXVA 3DFOA 1KW1A 3IIOA 1WOBA 5D03A 4P2VA 3GK0A 4XWUA 1UASA 5DCEA 4E0CA 2ZRYA 4UC5A 2XFWA 3OIXA 2A7NA 3O6CA 2OZ0A 1TYGA 3M9YA 1OJXA 3NPXA 5D04C 3LBMA 3MJYA 5BMXA 5KITA 2Y85A 4AHQA 2OCZA 3B0PA 2QCHA 5CZTA 2QR6A 3MHGA 3R89A 3A24A 2OX1A 4UTWA 3C2OA 1PHWA 3QZEA 2C19A 3R2GA 2VENA 4ORIA 3DFNA 1O5XA 3G0SA 1KTBA 1ZFJA 3A9IA 3DH7A 2QCFA 4AHOA 2C14A 3FIGA 3KVMA 2YFNA 4E2DA 3FKRA 1QPOA 3E0IA 3GNNA 4K37A 2PE4A 3LCGA 4LC6A 5U7SA 1C9DA 6ALDA 2QCEA 1YYAA 1TREA 4MY9A 2FTPA 2V2HA 3NPWA 3TFCA 3K30A 4XKYA 3D0CA 2V30A 4E38A 5D09A 5KMYA 3G3DA 2RH9A 3TMLA 4DO5A 1MZHA 2EF9A 3HF3A 3USBA 1JCMP 2ALDA 5G5IA 3QYQA 1Z41A 3NZ1A 2GOUA 3NAVA 1UCWA 2I9EA 1M7PA 1XM3A 2RDTA 3FEMA 1N7KA 5F4SA 3R8RA 2AAMA 2VFFA 3G1XA 4AB4A 1GVQA 1GTEA 1TTIA 1TSIA 4GUGA 3KVJA 3PG9A 3LCHA 1R2TA 3IV3A 2EAWA 1HO4A 5G4EA 2HTMA 1BKSA 2NV1A 2C13A 5CSSA 1OYBA 3TQVA 2DZWA 4Y8FA 3LOTA 5FEZA 4DBEA 3W2MA 4PL2A
chains in the Genus database with same CATH superfamily
2IPWA 2Y24A 3D46A 1IR1A 3EBVA 1Q6EA 1R30A 1U5VA 2JKEA 3M16A 4NX0A 2VZTA 1XD1A 3GKFA 6XIAA 2CXGA 4HU0A 3QLLA 4IG2A 1KB3A 1ADOA 3L21A 1MRQA 2NXHA 1J79A 4LCSA 2QUTA 4MAVA 1FWRA 1H7RA 3CT7A 3TN6A 1HT6A 2ZUSA 2KAUC 3UY8A 2ZQ0A 3VZZA 4MWAD 2ICSA 4Q4SA 1M03A 3GVVA 1RJQA 1W1VA 2CZDA 1MNSA 3BSMA 1VFUA 3HG3A 3BWWA 4RZ5A 5E6ZA 2CHOA 4B2DD 3WBYA 1HKKA 3VNLA 1ZALA 3USZA 4L4LA 1E0UA 3G22A 1PCKA 2ISDA 1WZMA 1DJYA 3EOUA 2DW7A 3QR1A 4AF0B 3QQ1A 1EIXA 2YW4A 4FR6A 1BGAA 4GJJA 1XH0A 3SB0A 2OQLA 1R85A 1TV5A 3PZOA 3BQ5A 4E5TA 4O10A 3B3DA 3LCIA 3C0QA 1IF2A 3GDLA 4XAPA 1ITUA 1TA3A 1UWAA 1VEPA 2DUZA 2GGGA 1J01A 1SZEA 2CKSA 2GWNA 4DJFD 5CEWA 5CGTA 3CT2A 3WH8A 3G1RA 3ZSTA 3CAKA 3W6MA 4B3KA 3UWUA 3P60A 3AXIA 3OVPA 4BA0A 3GUWA 3UFYA 4L56A 4RX0A 3POHA 3H4GA 1EBHA 1JXKA 4OE7A 2Q3RA 3DI1A 5EBUA 4QNEA 2R8WA 1F74A 3SCWA 2NWSA 3VUSA 3NO1A 2O9RA 3GDMA 4DM2A 1XIDA 1ISXA 1REQB 1HX0A 4Q4OA 4ADUA 2CBVA 1H0IA 3CQ0A 1E6QM 2Z1BA 3WLHA 1W1PA 3KRUA 1QOXA 2ZUVA 3RO8A 2RHGA 4KFOA 4DIAA 2XVPA 3FX4A 3OGSA 4EF8A 4ERAA 2GGEA 1GKQA 1UOZA 2FH8A 4NSBA 4DXKA 4HPJA 2PWFA 2I5IA 4NYYA 2YIHA 1VGAA 1V7YA 4GACA 4MB1A 1A5LC 4JX4A 1QOQA 4IQJA 3WQVA 4FOKA 3CASA 4G6CA 2I57A 5BXSA 3NNTA 1I2QA 3M6YA 2FIQA 3OU8A 4YIWA 5CBIA 4NG3A 1DTUA 2FJKA 3AYTA 2VZVA 3RLUA 1VC4A 4XZ9A 3ZVHA 4I3GA 1XDLA 3ZMRA 1OG6A 2R1MA 4AD4A 1E51A 3E5BA 1BFNA 1HJUA 3IJ9A 5G1MA 1A53A 1EUNA 4KGJA 2VOMA 3W7KA 3A9BA 1GZJA 3VM7A 4ENLA 4LGXA 3EDKA 4XBSA 1NEYA 5JIWA 5DMLA 3EWZA 4M3PA 4GO9A 4XD6A 3WMSA 2EGZA 3A4XA 1C92A 4F0HA 1M7XA 2Z6IA 1RCOB 4JN7A 2BWGA 4U3AA 3TDFA 4UTWC 3PB2A 4M51A 5JBEA 5I7GA 1E9ZB 4IIFA 4FLOA 2FMOA 2QCGA 3Q94A 1NDYA 2OPJA 2Y7EA 1CGWA 1MZRA 4GY7A 1V03A 1WAWA 4EPDC 3FA4A 3B8UA 1FY6A 3T1GA 3WDHA 1TX2A 4HK5A 4UMAA 5FKYA 3A12A 3SRKA 4IUOA 4A05A 3II1A 1BG9A 2PDKA 3SQSA 2QUUA 2YXOA 4HZ8A 3D6NA 2W66A 3PWIA 5D2VA 5FJPA 2Y89A 3E12A 3QKEA 4MOZA 3WQPA 2A0NA 5HNTA 3H55A 1A5SA 3ITLA 4AWSA 2J47A 4L80A 1KTNA 4O14A 4WRHA 1XWYA 1LT8A 4YWSA 1SMDA 1Y8BA 2OU4A 4K8HA 4HCLA 5KETA 1RY0A 3S3GA 1V93A 5E6YA 2ZKMX 4UZSA 3P62A 2JKPA 3M1ZA 1EZ2A 3N25A 5AHEA 5FJTA 1K70A 2DJLA 2E6YA 3IJDA 4O18A 4BF7A 4O0QA 1ZCOA 1PDZA 5BCAA 2NXGA 1UH2A 3STCA 2J7EA 1QHOA 1NF0A 4KQNA 3AYVA 4C6FA 2G4FA 3W01A 5DT5A 1JYNA 1RK6A 3IIZA 4S3CA 4XAZA 3EWUA 1V8EA 3LPGA 5FJOA 2YGYA 1L2QA 4JL2A 4ZEPA 1FCVA 1DIOA 2WLZA 2C18A 2NQLA 2Y8VA 2WO5A 1C93A 4EXBA 1NWRA 1DE6A 4GUJA 4BI6A 1RCXB 2FQIA 4P7NA 1GZ1A 3CZKA 2GJPA 4H9UA 4I7VA 2NV9A 3VOIA 4NZCA 1P0EA 1S5MA 1GOXA 2OFJA 4IQDA 2DZSA 1OFOA 1XKYA 3NIYA 5FL0A 3B0VC 1NFBA 4DBUA 1VLWA 1J96A 1EF2A 3TSDA 3FV9A 3MP4A 3WELA 3W27A 4Y9OA 1UWRA 1LOSA 4LAOA 4PMJA 4FK9A 5A6SA 1E43A 2BOFX 2VTFA 1XCFA 3J7HA 6TAAA 2ZX5A 3KVKA 2C1IA 1S38A 3AUOA 4Y9NA 1V6TA 1ME9A 4GC3A 5LZLA 1M7JA 2WSRA 4NRRA 3NQFA 4GIYA 4IJBA 3QXBA 2YA2A 1C3FA 9RUBA 1IT7A 1E73M 1JZ8A 2FZ9A 2HS6A 1KFKA 3PZUA 3PULA 2CBIA 5FF2A 2JFEX 4J2MA 4HA1A 3N6HA 2ZOXA 4W4QA 4G1KA 3VD7A 1QW7A 2VFIA 3RLVA 3R8HA 4QTGA 4O17A 1XBYA 5H8MA 5XIMA 3VNDA 4NZ1A 3GG0A 4KFPA 4ATLA 3GVQA 3HGRA 1XRTA 1WO2A 1KGUA 1QI2A 4TR9A 3BVJA 3ECQA 4FI4A 3HPAA 4H19A 2OWXA 1JL8A 1UPPA 5F2LA 2VDHA 1EC9A 4JQ4A 3FXYA 3W7JA 3QY6A 3VKCA 1VRDA 4JOMA 3PNZA 1XH2A 4MFEA 1JQXA 2QIIA 3SGUA 3RR1A 1ZHAA 2WVTA 4KRUA 1WKFA 4LY4A 1V0LA 3E2VA 3DGBA 3VNZA 5L6UA 3U4AA 5DXXA 1OF6A 2RDXA 1FDYA 4JDBA 2PDYA 4C6JA 3E0FA 3GNOA 1P6BA 5CZKA 2HRWA 1OZMA 1QBBA 2J75A 3U7BA 4DYJA 1PX3A 4XZLX 5FI8A 4GX9A 7ENLA 1VJIA 3QKZA 2R9RA 1W56A 4RLIA 3R58A 4JTUA 4LYKA 3DZ1A 3IK4A 3REQB 3T05A 3G1VA 1LQ0A 3HFYA 1TV7A 4HZ7A 3LLXA 2FJUB 4H6EA 2VCAA 3VGEA 3DFQA 4GNKB 1OC6A 3KL5A 3R0DA 5IBXA 1H51A 4AVFA 2ZA3A 3MUZ1 4GOAA 1BEUA 1OWQA 4US6A 2CLMA 4Z1CA 4UFKA 1PZ1A 3U9IA 4KEMA 3FSTA 3W6LA 4KS0A 1SO3A 3WG6A 3QVQA 2DT1A 4GI8A 4Q7NA 4A35A 1X8CA 1O1HA 3RRXA 1S2UA 4MTVA 3K8KA 1YADA 4CCZA 3GKAA 2OT1A 4KKXA 1RSCA 2C0HA 1VCVA 1FWGC 2AL1A 2FGZA 4HN4A 4V33A 1HIZA 4Z0JA 1OGBA 2QEZA 1RP8A 3EMZA 2YZRA 3ARSA 3FEQA 3MY9A 3W7PA 1WAUA 4HB7A 1EEXA 4RE0A 2HXTA 3B8VA 4Q4RA 1DQUA 4GRSA 1H09A 2WBKA 3BXWA 2VNCA 3H21A 1A0EA 1UP2A 3N2OA 4BEUA 1TV8A 4O11A 2RUSA 3ABRA 2WZIA 2AQVA 3MMTA 3R5EA 2ZICA 1J0IA 1QPKA 2BOGX 2HNHA 2WVVA 4IIEA 4H9TA 3EZ4A 5GNYA 5EMUA 2ZTJA 3CL8A 3AISA 1TTQA 3QV9A 2OKTA 5CPMA 1NQKA 2CC0A 3GDKA 3FA5A 2Q3OA 4ONVA 4JCLA 5FOOA 2E5BA 4N02A 2VEIA 4B5NA 4F0LA 3NO5A 4KCUA 2VUNA 4ZO8A 2WNWA 3Q45A 1A4LA 5LHEA 4LUSB 3QN3A 4HOZA 2CYGA 3T0BA 2DP3A 2PDJA 5HQEA 4PBGA 4GYPA 2Q71A 2FTYA 4AC1X 1BQCA 4E3VA 4CQ9A 3EB2A 5AC8A 1H4PA 5IFTA 2HWGA 2XFYA 3GC5A 3Q58A 1EX1A 1A0DA 5BRQA 4OOUA 3ZR5A 4OFCA 2ODOA 2VGBA 3CHVA 5D05A 1DJHA 2UY3A 2W63A 4NUWA 1RUSA 4CEUC 1OFEA 1ZZMA 4S23A 3O07A 1KR0A 3P0XA 1TZ7A 4GQGA 5C55A 1VAHA 2WC3A 3EEGA 3WLMA 1EDQA 1VD6A 2F6UA 2NW0A 2Z28A 1WX0A 4MKNA 1J5SA 4BWLC 4CNNA 5M03A 1P0NA 2QJIA 3WLSA 4DWDA 4HPNA 4MJMA 1KWGA 4BZYA 2E1WA 2XIJA 1EP2A 3T78A 5KZEA 4MUZA 1Q6CA 1B2YA 3KS5A 4Q3MA 5D33A 1ISZA 4RXGA 3MUXA 1WE5A 2IKIA 4RNJA 1Z42A 5DQPA 3LSBA 3F03K 1W8SA 3ARVA 5TNVA 1KA9F 2ZRUA 3TCEA 3WBEA 3R79A 3FSUA 1G4EA 1XYFA 3W2JA 1FWBC 2FVMA 3UCQA 1IEQA 4LV9A 2GL5A 1SPQA 1KKOA 4S3KA 1SFLA 5BXTA 2HVOA 1ZJIA 1XSJA 2V6AA 3GR8A 5HDRA 5M5DA 3NCOA 3CUGA 3KBSA 1QNRA 3TAKA 1GQJA 3RU6A 1R0MA 2IQDA 2X1SA 4XTIA 3O7UA 2XZ7A 2Z1KA 3ZYZA 4EIVA 4MGGA 4PMYA 1DWGM 1GG1A 3FGCA 4MKVA 1PIGA 3I6EA 3DHUA 1TR9A 3HGJA 3SFKA 5EB8A 1H63A 4KERA 3F1QA 2CHRA 4NAFA 4QDPA 3VFCA 4IFOA 3E74A 2UY4A 4GQBA 4I6KA 2PWDA 3P7YA 1E4MM 4F0MA 3NJ3A 4HGXA 1O4UA 3EB3A 2JALA 2J9ZA 2W62A 1YDNA 1SZFA 2O4MA 4A29A 3OLIA 3FYOA 4RKAA 4R88A 3S5ZA 3W7QA 4UIOA 4H3DA 1TPDA 4HSHA 1B3ZA 1K7FA 1CI1A 3T7VA 2D2OA 5IDIA 3TW9A 4NASA 5GNXA 1X98A 1UD4A 4WDXA 3PPCA 5AHFA 3QMTA 2BV9A 1H49A 2C16A 4GVGA 4NJGA 5CJMA 5M3WA 1P0BA 5BOFA 4OV4A 4GCAA 3WLJA 1UW9A 1MQQA 3O06A 3W2KA 3G18A 4HA4A 3CTTA 4KESA 4DXXA 1E40A 5CAKA 4NZJA 4O1CA 4XZWA 5SWUA 1ZRQA 1KV5A 3CHEA 3TXZA 2PLCA 3GBEA 4NXKA 2H90A 2X1RA 3LYEA 1M53A 2C3ZA 4IJCA 4C60A 4WSJA 4YCOA 1S46A 4PEEA 3A4JA 1UR0A 4PUDA 1W17A 5AYIA 1Z3NA 1O1ZA 3SBFA 4AZ5A 1NTHA 4Y2WA 2QUVA 1I1XA 1MRAA 2PWVA 1AFSA 1EOKA 1W3TA 2WNZA 3EA2A 2Z2UA 1FWHC 3M41A 1ML1A 1H62A 3CS2A 2Q01A 1UJPA 3WF2A 4XZNX 3WLRA 2DPEA 6PTDA 3WQ6A 3S2NA 2WW5A 5T9BG 1K9DA 4XV0A 4JYDA 3NQ7A 2PDHA 2VR5A 4O52A 3QR0A 3M0XA 3MVTA 1R7AA 2VGGA 3QSRA 2NV2A 3V5OA 4GQ0A 2DZVA 2RGLA 4L5ZA 4LCQA 1PKNA 1K6WA 3C2RA 3FNDA 3LCLA 5AHNA 4LUYA 3E1F1 4BQ5A 1V3IA 4UCFA 2Y5JA 4DLFA 2OXNA 3WUFA 3LHVA 1FWIC 2JQXA 3WDJA 3W81A 5K3VA 3ICJA 4JGDA 5CAHA 1GVIA 4BCEA 3H8AA 2X30A 1OFAA 1XLEA 3CEUA 3ZIZA 3OBAA 3S5NA 6XIMA 1FHDA 1T5AA 1XLBA 5KEZA 1CX9A 4JFVA 3W26A 4C6MA 2VVSA 1LZOA 4HJFA 4ZFMA 4OHQA 4K7VA 4UFLA 2PCQA 4AZCB 5FJUA 1XUUA 1UC5A 1TWDA 4Q4PA 1S2AA 1GW9A 3OVGA 3P5ZA 1YNYA 3NG3A 3M6DA 3ORWA 3RX3A 1TRDA 4ZXOA 3EKLA 1SO6A 3DECA 3LN3A 2V5LA 4CLMA 4MYXA 1E3XA 4H04A 4W5ZA 4NZFA 4C6DA 3W7RA 2ZYFA 2F2KA 1WUFA 5DBUA 1R7OA 4FO4A 4IISA 1FP8A 2Y62A 4YJ5A 2X42A 4GZJA 3RM9A 3BCFA 3B04A 4JXCA 1DQWA 4C1NB 3N18A 3IANA 1TRIA 4V15A 2A3EA 1UR2A 1I2RA 2CZ5A 3MUY1 1W2PA 3N13A 1T8XA 1IEWA 2CLKA 1OYAA 3A47A 2WKLA 3CZJA 4H7VA 1TFVA 7ODCA 3BLLA 3GWQA 4FLSA 3W82A 3I3DA 5HR6A 2QJJA 3TQPA 4ML9A 3ERPA 3MJMA 2DZUA 3VNKA 1P5BA 3GO2A 2R6OA 4LW7A 4PTMA 5E1QA 1LQAA 1W2VA 3VMOA 4M6PA 2W9MA 4KH2A 4M24A 3BAIA 4LVFA 2NZLA 1I45A 2FZMA 1TV3A 1SJDA 3S5SA 4Q8NA 3SCQA 1FRBA 4X0NA 4H01A 4GISA 1XR2A 5D2YA 2INEA 3VGGA 2VJXA 2EG8A 3S6DA 5BMWA 3VXGA 1MW0A 2QW5A 4IGNA 1P6CA 5AB3A 3QJAA 1GOWA 3LZ5A 3L4WA 2ZZ6A 4EXAA 2PFHA 1ZCCA 2XVKA 3V5FA 1I8JA 2PD9A 3T8LA 3RLGA 3UG4A 3CH9A 4ALDA 4UXDA 3UXLA 2Z25A 4PCPA 5BRPA 1JI1A 4LV4A 5E9AA 3ZR6A 3LXAA 3ZZ1A 1DHKA 3H4WA 1VFMA 4J2PA 1B9BA 2H6RA 4J5NA 4LBSA 1NELA 4UR9A 4K1GA 1OY0A 1VJSA 1DWIM 3S9IA 2XIMA 3PJTA 4H6KA 4LYQA 2GQ9A 4KWSA 2O92A 4NI3A 4XKYB 3UYCA 1WXYA 4CVWA 1H1ZA 4IIBA 3TE9A 2X1TA 3C3NA 1CXKA 4RW5A 1P0KA 4HA3A 4JNMA 4L61A 4YU1A 3LQGA 5A8OA 1EUAA 3W84A 2WCGA 3W76A 2V2CA 3W7CA 1JJKA 1ITCA 1G6CA 1PZ0A 4UTLA 2E6FA 2VWTA 1M41A 3G24A 1B5TA 3ZLFA 1F6YA 4EVZA 4O8RA 3GNXA 4IF2A 1XLCA 5BXPA 5F2GA 1EJTC 3GNDA 4WKFA 3UJSA 2OLSA 5ABHA 4E3TA 4OZOA 1TCDA 1ZLPA 1S1PA 3SN1A 4PUEA 4IPLA 1V77A 1SW3A 1V3JA 1NM9A 4MDPA 4O19A 1WB0A 4Q6JA 4H41A 1W9XA 4XD3A 4DI8A 4AZ7A 1VZWA 3W85A 3KCJA 3MDUA 5TQLA 3T2QA 1DJQA 2FTWA 4LUTB 4ICNA 2WSQA 3PBVA 1K7EA 2ZX9A 2WMJA 4MNJA 1K77A 1J4EA 1I0DA 2PEVA 2DT3A 3LU2A 4B9YA 1ZBKA 3FHQA 1VBRA 4P61A 4PR4A 3PTKA 4OWGA 5JH1A 1XP3A 1VJZA 1MEWA 3O3RA 3WFLA 5HNNA 1BGGA 4UMCA 2VC6A 3WNKA 4GABA 4GY0A 5AN7A 1POJA 4GIAA 1MUCA 3W1RA 3IJ8A 2Z00A 4JIQA 2NUWA 1W91A 3AU2A 4G1NA 5HINA 1RALA 3G0UA 1JYXA 4V27A 4R27A 3O0FA 4REQA 4MPQA 1JNEA 2QCDB 1JRCA 1GGOA 5I3HA 1EJWC 4ZA0A 3I65A 1OK4A 1UUOA 3F5KA 4CEXC 2GQAA 1PWMA 1TMQA 1L6YA 1G1YA 1WXJA 2DORA 3W6YA 5REQA 1S2TA 5K4XA 4FXJA 1MXGA 1YKWA 2V3GA 5HOSA 1GYNA 4QNWA 2XG9A 5LHFA 3MI2A 1GHSA 2YCKX 3RCNA 1DIKA 1XISA 3EPOA 2ZZ3A 2YZ5A 4M7TA 2WJFA 2QMKA 2OEJA 5FACA 4O54A 5F7UA 3W7NA 2DIEA 1T6MA 4GYKA 3QHMA 3KVLA 4Z08A 1IEVA 4DJDC 3P8JA 3QGAC 4GFIA 3G3MA 1YNPA 4K7YA 2NSOA 4CQDA 3THCA 2R14A 1C8VA 1A5CA 2E68A 4E2VA 4DM1A 1WUEA 3ZT5A 2EPOA 1JGIA 3O63A 1ADSA 4AD2A 1K8CA 5D30A 2V38A 3UWWA 4QLJA 3GXMA 4JS3A 3IGUA 3WMCA 4AEEA 1CECA 2XSXA 4DF2A 5CQ1A 3NVDA 1W3KA 3OQEA 2Q8ZA 3DOPA 2PRLA 1KV8A 1Y0EA 3OBKA 1U1UA 2E5CA 3UJEA 4UQEA 4NU7A 4F66A 9XIAA 2ON3A 2X05A 4O50A 1P1MA 2VEPA 2WMGA 3AWOA 1XYAA 2OSXA 4PUWA 3QYSA 4A8RA 2Q8XA 1AL7A 1ENUA 2RJGA 2VEMA 3SY5A 5AY7A 2F9RA 2PCEA 3GW3A 3ZVHB 3W25A 3GBDA 1OFDA 1R8LA 4O4VA 3BMVA 1QWKA 2V63A 3ZWSA 5RUBA 4TMCA 4ZTYA 1TZZA 3A3WA 1EC8A 2IKJA 5DMMA 2CZFA 3EWWA 2J13A 4PB5A 3R0KA 1RCQA 1BF2A 1GJWA 4MM1A 3W7LA 2W79A 1TIMA 1DV7A 5E93A 3W22A 5H2ZA 1AQFA 3CL7A 1Q45A 1NJJA 1J12A 2Y8UA 2E9BA 2BASA 3W7IA 2WHLA 2ANUA 2PS2A 3HMJG 1RPKA 3L66A 2YLLA 1VEOA 1QMLA 1XRSA 1F3EA 4Y9PA 4BI7A 2YFOA 4JQ1A 4DF0A 4AYGA 3DKJA 1KM6A 3N6QA 5C9UA 4C7GA 3DFOA 1BG4A 3IIOA 1WOBA 4J3UA 4P2VA 3RX4A 2FVLA 4XWUA 7PTDA 5DCEA 3BQ6A 2L5HA 1QU4A 4UC5A 2XFWA 4PMXA 4CD7A 4YHGA 2J62A 1TYGA 3M9YA 3WY1A 2DSUA 1EHNA 3NWRA 5KITA 1LT7A 3MUCA 1ADDA 2PU0A 4ROPA 5CZTA 4PE8A 2PTDA 3LZ3A 1WKEA 3MHGA 3TC3A 1JAKA 3A24A 1TUFA 4FLQA 3R2GA 1O5XA 1Z89A 1VPQA 1ZFJA 1XGZA 4AHOA 2C14A 3B8SA 3FIGA 3TONA 2PBGA 2HZGA 3FKRA 1QPOA 2PE4A 3GTIA 3RPMA 1C9DA 2QCEA 1YYAA 2OVLA 3UP8A 3KL0A 1YPXA 3TFCA 3BLDA 3TMLA 1PBGA 3RGTA 2WZMA 3M0KA 3SQLA 2J7HA 1C90A 3ITYA 5G5IA 1X6LA 4WEVX 3QYQA 3NAVA 1M7PA 2CESA 2P53A 3FEMA 1N7KA 3R8RA 2VFFA 3G1XA 4AB4A 1GVQA 5DRIA 1TVLA 4GUGA 4AU0A 3PG9A 2ONEA 1CXFA 4H8UA 4AQLA 2QQ6A 1R9YA 3UZYA 3CO8A 4P7LA 1JDCA 5CSSA 3VIHA 2DZWA 1PWLA 3LOTA 3TWAA 3W2MA 4CN4A 1HL2A 4LQ1A 5EFFA 3DFHA 5CLWA 3QTGA 3UR2A 2HBVA 4ZO7A 3LPOA 3MMUA 5FD0A 2AQOA 3EOOA 1NDWA 4F2BA 1FWSA 3M5VA 4PMVA 7CGTA 4JFTA 2Z2AA 4G5DA 4HQVA 1LBFA 2GVLA 3RM8A 3LTYA 3PBUA 3W7MA 1W3NA 4PRTA 5K9XA 3PAJA 2AQWA 3CH0A 1GVRA 5FESA 1L6FA 3W86A 5I00A 4HPXA 5FCZA 2A6LA 4G2DA 1OCNA 4N7QA 1DL3A 5AHMA 5K4ZA 3WQCA 1RD6A 5FF7A 1XLFA 3PFRA 3V0UA 1OD0A 3K8LA 3BG5A 3ZJKA 3RN6A 1W5NA 3NYDA 4ZVJA 4Q7BA 4JN6A 2OZ8A 2WHMA 3XIMA 1QCWA 4ZFCA 1ZAIA 3TW7A 1GVFA 3THDA 2BZNA 1M01A 1W3IA 3S6OA 3UESA 2AGTA 1DORA 3MKCA 1WKDA 4W89A 2NQHA 1QW8A 2VFGA 1KRMA 2D2JA 1UPMB 3GTFA 1MI3A 2I1OA 2ZIDA 1D3HA 3OTRA 4PN2A 5ABGA 2BBFA 4PRWA 2HQAA 1HP4A 2VEKA 1K4HA 4ZB5A 3KL3A 3VOHA 4HD5A 3QM3A 4Q6XA 1CT5A 3NQEA 2PZ0A 2WM1A 4IIHA 2VFEA 4WK9A 3DBNA 3C2YA 4MNKA 3S4TA 3WK3A 4OOZA 1R87A 1EJRC 2PDBA 3IIPA 1V0NA 1ZPTA 3E02A 3W1PA 2BS9A 3WLQA 1WXZA 1LL4A 5MKGB 4TX6A 3IUHA 2QDGA 3RITA 2G3JA 2DW6A 3U48A 1ZUAX 2BX7A 3G1DA 3QF0A 3RMJA 3BAYA 3UYIA 4JTRA 1CW2A 4ZOBA 3TC7A 3ZWTA 3UBPC 3VUPA 4NILA 3IIXA 4GY1A 4O1BA 4YYCA 3CB3A 4S3AA 4GKLA 5FL1A 4JY9A 1G5AA 1UP3A 3DGRA 3U4FA 2GK1A 2VZUA 4K8EA 4EWND 3PZVA 2O4QA 3UCCA 5DCBA 4NX5A 4JTKA 1K02A 5KINA 1W5MA 5C2XA 3QBUA 1AZ2A 1SFSA 3CZ8A 1V6UA 1K1DA 2EJAA 3ANYA 3OVQA 3MTWA 3DKLA 3BTNA 1ITQA 2EKCA 4K6AA 5XIAA 1RHCA 1LWIA 4CNPA 3EDJA 4K38A 5F2IA 5C9XA 2TRSA 1RQHA 3N12A 1NVMA 1ME8A 4AC7C 1TX0A 1C29A 1JYWA 1DQXA 1BVNP 4CVUA 1X7FA 4PBEA 1XIJA 4BHYA 1BVWA 3VD9A 1L9WA 2RDUA 5EA9A 3C61A 1OINA 4GBDA 3G1FA 3ALFA 4PUNA 3W1XA 3NSNA 3MCNA 4O1AA 4RUBA 2OYKA 2I5GA 4J1OA 1QK0A 3UERA 3BAXA 1EJ7L 3G1YA 4AWTA 3GXIA 3GE7A 4QP0A 1HJXA 3THQA 1MDLA 2G95A 4JZ5A 3WDRA 3BPWA 3W1NA 1UJQA 2D3LA 2VP8A 4FHAA 4DBSA 1S2CA 2PRHA 1NIUA 3BH4A 1I2NA 4ZCWA 3HG2A 2OSWA 3N4EA 3W1LA 2HISA 3AYRA 1J6PA 1PTAA 5FAGA 1DE5A 3NVTA 3IRSA 2A3AA 3AFBA 2QJHA 5AYYA 2DQXA 1UIOA 3TLLA 5D9NA 1E1EA 2BFGA 3FJ4A 4PUMA 3TTEA 3VC5A 1AMYA 2TODA 4HU3A 2YX0A 4S3BA 3CUZA 2WVVB 4IOTA 4A21A 3NQ2A 5H8UA 3UWYA 3L0KA 4DXVA 2XUCA 3QFWA 2PSNA 1H5YA 3OZMA 3ABZA 5AHIA 2VD8A 2OQHA 1U30A 3AXXA 1F3XA 1AH3A 3LCFA 2BXZA 4MB4A 3L2IA 3RCMA 2J78A 3LNPA 1ISWA 1L8PA 1R46A 3MI3A 1T41A 4PTVA 3WQ5A 4LS0A 1XIGA 2YCEA 5HNRA 3F4CA 3PPGA 2UBPC 3KW3A 5G1YA 4TIMA 3S1VA 4R9XA 2ZUNA 3V75A 3AMGA 3S8HA 4Q32A 3NM3A 2QT3A 4XK2A 1UKTA 4EACA 4Z1AA 1PEZA 3UJFA 1JZ2A 2PLKA 4JQAA 5JU6A 3IARA 1OFBA 1GQLA 5HPOA 1E5NA 3VTRA 2JF6A 1JNDA 1H61A 4LPCA 1JRBA 4HNLA 3ITGA 3MSYA 4HPHA 3PF3A 2J24A 4XBKA 3WQDA 4NZ3A 3KWSA 2XH4A 3WK1A 3GIYA 1W5PA 2QUNA 3DU0A 4GH1A 2A1YA 3BAKA 3NDYA 3G1SA 4XO6A 3GY1A 4HNOA 3GVWA 3UVAA 3TJ4A 2PPGA 3KAOA 5D2WA 4FA3A 3DXIA 4MPKA 4ZSTA 1NWUA 2Z27A 4PTNA 4E8GA 1S2VA 1PS9A 2OEMA 4LAKA 3NGFA 3OZYA 4WVXA 1V6WA 3HGSA 3SCUA 3W00A 1R38A 2X1UA 3E6EA 3IRDA 2R94A 1SSGA 1SGJA 3VIMA 2XJ7A 4A8LA 3MVIA 4O1FA 3SO7A 4JX6A 4B4HA 2FKPA 2G3NA 5D38A 2P3ZA 4PUUA 2PLJA 1VF8A 4W7VA 3VNYA 5T26A 3WL1A 4GJ1A 1B54A 5KZDA 2QHAA 4E2OA 8TIMA 1P0DA 3IIVA 7A3HA 1E1CB 2O9OA 1J8VA 1TPFA 5CPSA 3UPWA 3P6LA 4WDWA 3OA5A 4ACYA 4N6EA 5E9XA 4NF7A 1V3LA 4E4UA 2FPTA 2OGYA 3RAOA 4NL1A 4Q8TA 1DXEA 3QMRA 1UR4A 3THUA 3AQUA 2VZSA 4PCFA 4JTEA 3MANA 1TPEA 3QMSA 4GMEA 1WDDA 2XH0A 2AL2A 1NFPA 2V82A 5EPDA 3FGCB 3T0DA 1CXEA 4HZMA 2YR1A 1E15A 3WH7A 3A23A 3URNA 1YE4A 2XSBA 2FZDA 5B7ZA 3DI0A 1NDZA 3MP3A 4JTCA 4L9ZA 1MDRA 1OFRA 2PDFA 1DHPA 2WSYA 3ATZA 3FDGA 4NAFB 1S3TC 4QS5A 3URQA 2GQ8A 2QKFA 3VE7A 3ABXA 4YMZA 3QR3A 4B92A 1GKPA 2Z7KA 2F38A 4WOQA 5FF4A 3WUBA 1FCBA 2WB5A 4QAIA 2OR2A 1XYBA 4NIRA 3PM6A 2WMIB 4NJIA 4J27A 2PUZA 5CPOA 3IJ6A 2BVTA 2HJPA 1XHGA 1ZTVA 4LVAA 2IS7A 4K8GA 4EAMA 1FUYA 1ZAJA 4P5UA 3TWBA 1F8MA 2O7SA 1FKWA 1IEIA 5DMNA 2ZADA 3K13A 2HE5A 3CPRA 1B3WA 4LAMA 4KETA 4WJXA 4H1ZA 5G2IA 1POKA 4O53A 3UZWA 2DVTA 1LBLA 1KFCA 4QE1A 5JXQA 3TYDA 3NOEA 3OJGA 1MEHA 4H8HA 4QJ4B 3NPVA 1LUCA 2XH2A 5J5DA 4WKAA 3LTPA 3SGZA 4E8CA 4XVEA 5FJIA 2XDFA 4R3UA 3KRZA 2J7GA 2G3MA 5HWNA 1ITXA 2QV5A 1CDGA 3MWAA 2VQTA 4DNHA 2VVNA 3OVRA 2P0OA 2WNNA 1EGVA 3TV8A 2J7CA 2NLYA 3WK2A 3BAJA 1IR2A 1L6SA 2Q09A 2Z26A 3PWAA 1N8IA 3N2MA 1W54A 2Y1HA 1UR3M 3PBMA 3CZLA 1OVDA 1VFLA 2Z29A 1TQJA 3T40A 3HFTA 3TN3A 3BOLA 3B9OA 2GVEA 4JY8A 3NQCA 4HJWA 4NAEB 5JIPA 3HPSA 3R7MA 3IS4A 1F76A 4UNIA 5J5RA 1RPXA 3YPIA 2GVGA 5CPQA 4QSHA 3TCSA 1ISVA 4ZQRA 4PMUA 4KGLA 4JFWA 1E6PA 3TH6A 2VUYA 2CW6A 4CD4A 4OBTA 1BHGA 3V1PA 5IHSA 3QC3A 4X9YA 3L65A 1YW1A 3Q65A 3DG7A 2HROA 3D3FA 1BSLA 2I56A 4IPPA 1ZY9A 3KBJA 1AQHA 2AOSA 1ZBCA 5EGRA 3BLIA 4ZQPA 1DWHM 2Y88A 3F5LA 5LNWA 1SJCA 2H8ZA 4UTUA 1E9LA 1HGWA 1RJRA 1LRQA 4Q8WA 1QPRA 1GJUA 3N15A 4ZR8A 2XIOA 5G1TA 5JBFA 1TPC1 2C7FA 3OP2A 3KOYA 1H60A 2REQA 1JD7A 1AJ0A 5I06A 1DXFA 2CLEA 3LX9A 1A3XA 1F8IA 4HU8A 4D6JA 2BVWA 1JIBA 4M19A 2J77A 4D72A 1UWIA 3R0UA 4ZSUA 5DLCA 3SAZA 4TV5A 1SSDA 5T91A 2D69A 1UKOA 1W1ZA 4CUCA 1JR1A 3UPBA 4I9MA 1EPXA 1Z7AA 3AMKA 2WJEA 2V5BA 4LBRA 3VKAA 2ZUMA 3MV01 4X60A 2NSXA 4UZUA 3VINA 1P7TB 4YVXA 2BHZA 3G1HA 4J40A 1F9CA 2OGJA 4S2BA 1DJWA 4IFKB 1SO4A 4CU6A 4O16A 1LL6A 5M17A 3DC8A 1SR0A 1NOWA 3AAMA 2PWHA 3S5YA 1BKHA 4LVBA 2FHCA 2XN1A 5LIYX 2X0HA 2AGKA 4KRTA 3DEQA 5LIKX 5GVJA 1WDQA 4QRNA 3N9KA 4MY1A 4XAFA 1CGXA 5EYWA 3RFAA 3VYLA 1V5XA 1JCXA 4JQ3A 5CZSA 4LANA 3KOXA 4BEQA 1SYTA 3NDZA 4GXMA 4DUXA 2WYSA 1EIBA 1ONRA 3NDOA 3T0CA 3UG5A 4IQLA 2PDXA 2GJLA 4OKDA 3VIIA 1XC6A 2IQ0A 5I3KA 1KRBC 4Q8VA 1OADA 1WDPA 1RP9A 2R1LA 3B4YA 3MBFA 3O05A 4ZQCA 5EY5A 3GXNA 4V1XA 1Y7VA 4M6QA 1F3WA 4WY0F 4MNMA 2E28A 3N9RA 4GK8A 1GVSA 2A3LA 4DJEC 2R91A 1JCYA 2PP1A 1R9XA 3WDIA 4Z42C 2Y6ZA 5C9RA 4GQRA 1ICSA 4NVTA 3V5CA 2DSWA 2ZVRA 1XSIA 3LB0A 2TSYA 4BF5A 1QO2A 3HBLA 1VBHA 3GFZA 2BNJA 2QPXA 2GJXA 2OO0A 4GC4A 3HPXA 2R1NA 2B31A 5TIMA 3MT1A 4V2XA 3LUTA 3EPMA 2Y7DA 3VDCA 1FBAA 3APYA 1DIDA 3G0XA 3ZJ8A 3QOKA 1LM1A 1RVGA 4HK7A 4AY7A 3DHDA 3T09A 4HMNA 1KQYA 4PMOA 3SI9A 2ZWZA 1GJPA 3CWOX 3CV2A 3HTWA 4TVDA 3WO8A 2NT0A 5FSEC 3NZGA 4QS6A 2IMRA 3CQKA 2VGFA 2CNCA 3T9PA 3ONCA 3T07A 2ALRA 3TA6A 5C8BB 3N3TA 4P8WA 4U10A 2X8RA 1ONXA 2NVCA 3MSDA 3LRMA 4AD0A 9CGTA 1U1HA 1H50A 1K3UA 2YDAA 3PHAA 3S0CA 4MWAE 3FK4A 4PSRA 1HGYA 1XLIA 1AQ0A 3VFLA 1D8CA 4ZODA 5AC5A 3P82A 4B5XA 4IMDA 4KFNA 4N42A 5E0FA 1V02A 3QH2A 4DLMA 2XGBA 3ZFHA 4O8AA 3KBNA 5TAOA 2VWSA 3H24A 4YWIA 1O5RA 2VO5A 9XIMA 4UTJA 1X1ZA 4TO8A 1EO7A 4IMAA 4TXEA 1UYQA 5GJPA 3GTXA 2TYSA 4D6HA 2F6KA 1UZHA 1QVBA 1VPYA 2QS8A 5IRPA 4MF4A 1S2WA 4YTTA 1HKWA 5DXYA 4C6EA 1BPLB 4F2TA 1CBGA 4DZIA 2V3FA 4IFRA 1TB3A 3OW1A 5F1UA 3S42A 4MAZA 5AC4A 1SZGA 1OBAA 1NY1A 2PDQA 3ARXA 4QG8A 2UY5A 2WMKA 1DOSA 1FCUA 3R4IA 1Q6RA 1T0OA 3GB6A 4FSAA 4RR4A 3QQWA 2XWEA 1FFQA 4KIRA 2E6AA 5LNUA 1EB3A 1XI3A 3BJFA 3UGRA 3TJIA 3H2EA 4GUHA 3U6WA 4EF9A 2X0YA 3TEVA 1KM4A 3O0KA 3QSTA 3QY8A 5C0QA 4HYRA 2XISA 1HL9A 3UD6A 1LP6A 1KFWA 4RCXA 3MSRA 1GNXA 3ELFA 3RYSA 3H22A 4H9VA 2EG7A 4JEQA 4UQAA 2QZRA 3WLKX 3WQEA 4DUWA 1YNQA 3R6IA 2VI0A 2YSWA 3OHIA 4B5TA 2HEJA 3AIVA 1REQA 4JTJA 5C70A 2C1GA 3UA4A 1BF6A 4FALA 2PGEA 1XRFA 2ZRXA 4WGXA 1XD0A 2X2GA 3BGGA 3F2CA 5EMKA 2FH6A 1AL8A 5HMEA 3P74A 1HKVA 4JEJA 3UXIA 1OCQA 3DFYA 1FTXA 1GEHA 2ZUWA 4UTFA 4ZENA 2G97A 2NXIA 4BQ2A 1JEZA 1WP6A 4C7DA 1W1TA 1KFBA 1PPIA 5HNUA 1X7IA 2CZEA 2JEQA 2ZA1A 1SJAA 1H41A 4MIMA 2INZA 4UFIA 2PRMA 3N1AA 2XVGA 2HSAA 3NSXA 5I3JA 1P1XA 4LVGA 2B0MA 4I9AA 4RW3A 2DGAA 4LT9A 1LROA 4YLWA 3AIQA 5C7VA 2PTYA 3VDGA 4LEFA 1PE1A 5I02A 2HK1A 1HXJA 2J4GA 3T4WA 1LDCA 4O12A 3WLIA 2RDWA 2J9YA 1KBIA 5D9PA 1VS1A 3OYZA 4ZB0A 4TMBA 3BLKA 1D3CA 2OLHA 1E9IA 1RAKA 3B8IA 2CETA 3OGVA 2XU2A 3NQVA 4LB4A 3FXGA 2I7GA 2BTMA 1DEDA 4KT2A 2GOKA 4UOZA 2P0IA 4CGTA 3LM7A 3TXVA 1EPVA 2TMDA 1DVJA 4F3HA 1Z32X 2I16A 3GU9A 4FNUA 2A21A 3PK7A 1I2PA 1Z69A 4GXWA 1O5KA 1E9YB 1Q6OA 3HMCA 1UP0A 2WJZA 5LA0A 2E09A 3S1UA 3QPZA 1DTNA 4XD5A 3UCDA 1HG3A 1JQVA 4LUJA 1DJGA 4L6DA 4M1RA 4H9ZA 5DFAA 2BGSA 3CHDA 1KM2A 3D47A 4FX7A 4BQ4A 1GW1A 3LGGA 5CPLA 1B3YA 4W84A 1RBLA 4NNAA 3PTQA 2EPLX 3I3BA 1OCBA 1VEMA 2OZTA 4AX7A 1JCTA 4MY8A 4X0VA 4IICA 3G1AA 3H26A 3STGA 1H5VA 4V28A 5LIXX 1A50A 1A47A 1M65A 4PUKA 1O60A 4J9JA 3I7RA 2G3FA 4NNCA 1ZBWA 4QAWA 4D1IA 3ES8A 1LWJA 1HFBA 1DWFM 4GO8A 4H6RA 4B15A 3QGKC 4WY0A 1TVNA 2ZXBA 3PPHA 3W1TA 3SM0A 4OECA 1QNPA 4HKPA 1BAGA 2P8BA 4NYUA 3M5XA 2DT2A 3BV4A 1IIHA 4FF7A 2E9LA 1A0CA 2DU2A 1UD5A 3TK7A 2D24A 3H2NA 4JTFA 3VMNA 4XQ6A 1C8YA 1TKKA 1SVDA 4UFJA 4F2UA 4LNCA 4PMQA 4JNYA 1PUDA 3GSMA 1O95A 1QI5A 2Z6JA 1G0CA 3N14A 3TOPA 1V6XA 1UROA 2VQUA 3KBMA 3B9EA 1CGYA 1F61A 1PKYA 1BTMA 5LIWX 1CEOA 4NJHA 1D2KA 4JD4A 5CJNA 3UVIA 1FHLA 3AO0A 2E1DA 3W7GA 4A3HA 4WSHA 3T0TA 3QW3A 3P84A 1VIZA 5CBJA 1VENA 2HS8A 3E0VA 1K7XA 1HNYA 2G37A 3K8MA 4E4FA 1E0VA 2YXXA 3TX9A 2QCNA 3LERA 4ATWA 4MZ1A 4W93A 2KX9A 3CUXA 4I5UA 1G94A 4JTGA 3IGXA 3A4AA 1M5WA 5CBBA 3TSBA 3MQTA 1IYXA 3VMPA 4P8XA 2Y7FA 2RAGA 2JK2A 1B9ZA 3SZ8A 4O4WA 1XCXA 1SW0A 1Q63A 3FJ6A 4OUIA 4GH3A 1EO5A 3EWCA 4ECLA 1S3HA 4UFHA 4ZGYA 5ABFB 3AHVA 2F61A 2G8ZA 4U3CA 4DZHA 3GC2A 4HHHA 5TBOA 3JR2A 4FNPA 1MW2A 4RNFA 1NF7A 2WOQA 1XG3A 3LXBA 2BP1A 1YXDA 3LMZA 5A94A 2FZ8A 4A22A 4ZXLA 1VCFA 3OLGA 3CUJA 3GYCA 3E2RA 1C91A 4FLRA 5D2TA 2YW3A 4U4MA 2FZNA 2D3NA 3M07A 3RXZA 3A5FA 3AALA 3UPMA 2HVMA 4DF1A 4UTTC 3MA8A 3TOYA 3FVMA 2XFFA 3DENA 3KOZA 1MQPA 1DKWA 3TN4A 5FAJA 2V8ZA 4N9CA 4J3VA 2ZZ4A 1QASA 4EX4A 2HXUA 2QPUA 4FXRA 5MHBA 1ICQA 2GPTA 5HMFA 4M1BA 2OWWA 2P50A 3AHTA 1Q5MA 2QDHA 4PMRA 4LFYA 1EKOA 4M7SA 1RA0A 2WKJA 3GYEA 4AZ6A 3TR9A 3OZOA 4GUFA 3W24A 1CB7B 2J7DA 3KDOA 3CZGA 1E6XM 3C3UA 2YYTA 4GIEA 4LOCA 4OU1A 5TD4A 1FDJA 4ZQNA 2YA1A 1AW2A 3EA1A 4CNUA 1US3A 4M81A 4YN5A 4C1KA 3ARRA 4XUYA 2MNRA 3OA3A 3LLDA 4WOZA 1GPFA 1N8WA 1F6PA 1A5AA 3CLWA 3V18A 3UJRA 5PTDA 3BOXA 4YCPA 2FDMA 3MB9A 4R53A 1G01A 4IJRA 3QC0A 3U2CA 1CENA 3O1NA 1NOFA 2Y8KA 5A2AA 1P43A 2A4AA 3N17A 3PZGA 3LY0A 5HMSA 2B7OA 3M4HA 1F07A 1EDTA 3AIEA 2PDPA 2QLYA 1FA2A 3ZJ7A 3OEXA 3LHUA 1OT2A 1Q7ZA 1UD8A 1I1WA 4JFSA 1U33A 4POCA 4XZBA 1BXNA 2YL8A 3SDOA 5D2XA 3CUIA 3SCPA 1RQBA 4Z17A 1DXIA 1RJPA 2D2HA 2QVHA 2YL6A 1E0XA 1GOOA 4HBKA 4D2JA 1QAPA 2W92A 5K9CA 1UH3A 2NQJA 2CWXA 2PTZA 4MWAC 3KX6A 1TTPA 1KRCC 3JZUA 3FLUA 4TU1A 3TKFA 2CEQA 1LWHA 1XC4A 1FKXA 4CQAA 3CXOA 2O55A 3BK0A 3WKZA 1KFEA 3ZQ9A 3O6DA 1QNVA 4UTIA 5FSDC 1TG7A 2BVYA 4GGBA 5D03A 4CU7A 1UASA 1AUSL 3NSMA 1DJXA 1RLCL 3RM4A 2A7NA 3O6CA 4PSPA 5CG0A 2POZA 3NPXA 3LBMA 4J4KA 3MJYA 4W7WA 3WMBA 4WR3A 3WIJA 3ME3A 3QV6A 3RMEA 5GJMA 2Y85A 4AHQA 2OCZA 2QCHA 3W4RA 3AZRA 1QI3A 3GW0A 1EFZA 3R89A 1GVYA 4DN1A 2OX1A 4UTWA 3C2OA 1PHWA 3QZEA 3VK5A 3K2GA 4PBFA 4YYFA 3G0SA 2IKHA 1ZBVA 5A8QA 2BB0A 4AEFA 2QCFA 4DJFC 5H1WA 4PCNA 3UJ2A 1EC7A 3GNNA 4W85A 3RIKA 3TVAA 1FP9A 3K46A 1PTGA 1PZ3A 4LUSA 2PWUA 4B5SA 5A6AA 4YVPA 3HN3A 1KQZA 3WD2A 1TE6A 2Z1VA 4IUGA 3PN8A 8CGTA 4C91A 2IW0A 5BWFA 4YTSA 3PZIA 3GG1A 1Z41A 1H2JA 1TVPA 1UCWA 2I9EA 1XG4A 1XM3A 3TZFA 2J74A 1F4AA 1A3HA 2RDTA 5DX7A 5CLTA 2P5NA 2AAMA 4AZHA 3ZXWA 3W37A 2YL9A 3BL3A 1Q6DA 1E72M 3CNYA 2Z1XA 3CYJA 1HO4A 5G4EA 1BKSA 2C13A 3APGA 3TQVA 4Y8FA 3B0XA 4FMVA 4DBEA 1YQ2A 3SSZA 3I6TA 4G7EB 3PY2A 3VGHA 1N2VA 3ZSSA 3AHZA 4QJ1A 2INFA 1IV8A 1X6UA 4Y96A 2R82A 3BGJA 3HIJA 3EGJA 3B9AA 2XGIA 3W1AA 5E5CA 3ZS4A 3PJWA 4E6MA 2BY1A 1EQPA 1R3VA 4PB4A 2VL4A 5D9MA 3WJZA 2OB3A 4XSLA 2YOCA 1QNSA 1J9YA 2DY3A 1YE6A 4RK8A 3L9CA 3B8TA 1OX4A 3N6JA 3W71A 7REQB 3W1QA 4PTXA 3GAYA 3BSHA 5FJRA 3TQ0A 2R1PA 4QQ3A 1XDMA 5LIUX 3CEPA 2IPGA 1QJWA 2PDMA 3I3EA 3S6TA 3B03A 6A3HA 1LOQA 2GSJA 4FXFA 4QEHA 2FFCA 3L12A 4HOXA 3EYPA 2OSYA 2DQWA 1VH7A 4C1LA 3R10A 2ZUTA 2NX3A 3H7VA 1E0TA 1O66A 3WLLA 3NM1A 1UQZA 1BWVA 3UZXA 4HMDA 4Y6GA 2EKGA 3SIZA 1I75A 3V4BA 4MJ2A 1W9VA 2CZVA 3I4KA 4QQUA 3K5XA 1WKYA 4H2CA 2QJGA 2Y2WA 4D6EA 2X7WA 3T0AA 3N73A 3VIJA 1OQFA 2XFRA 1GVEA 4HTYA 2JIWA 1JZ4A 4W5UA 3WJWA 6TIMA 1EYEA 1C9WA 2WV8A 4WGHA 3MMDA 2CXEA 2CLPA 3VIKA 1TPWA 1IGSA 4HSNA 3KLLA 4WF7A 1KXHA 5CSRA 4LUIA 4MKSA 3M0YA 2JF7A 4FNRA 1TE1A 1OIMA 3GR7A 1QK2A 4AEOA 3U5YA 1O7AA 1FH8A 1VRXA 4FX8A 3I7QA 1JPDX 3F2DA 3NL2A 3S83A 3WZ0E 1NSJA 3EXTA 3GDBA 1XQKA 4O57A 2AMXA 4RNHA 1GKRA 5FEWA 2A7RA 3IGHX 2NWRA 3G8EA 3M0JA 4LBUA 2O9PA 1ONEA 3R94A 3W02A 2VCCA 1LUCB 3W3OA 3G8RA 3GVRA 1BRLB 1OGGA 2HPIA 2BOEX 1I4NA 4RE4A 4FPSA 2V69A 2BDQA 4I8YA 1XF0A 3AROA 3AYSA 3SCNA 3LM3A 3XISA 7XIMA 4OIFA 1W9PA 3L68A 5AKQA 1HN1A 5AFDA 4CU8A 3GAKA 1EP3A 4MJZA 5AOUA 1KLZA 3MI6A 1UWTA 2EQDA 3RCYA 3LEPA 2DZXA 4O13A 1XLHA 2GGJA 4YL2A 3TZNA 1YXCA 5LKYA 3VDAA 4GGHA 2J7FA 4ZOCA 1VB9A 2NQ9A 1J0KA 3RK8A 2VELA 5CZ0A 1B3VA 3PBWA 2XSAA 3CHCA 1K8YA 1GOMA 1W1IE 3CB8A 1ZP3A 4FNSA 2RGMA 2VR4A 5A6TC 3HGOA 1XQLA 2QGYA 3M0MA 3SJ3A 3EWXA 4I8DA 4UR7A 2OKOA 2YCLB 3BMXA 3BG3A 4UR8A 3NL3A 4L1WA 4XIAA 4OJYA 4LTSA 1MMFA 3XINA 4JAWA 4MWAB 1MNZA 4IT1A 5A5WA 1F5ZA 3Q37A 3S5OA 4F0SA 3ARTA 4Q22A 4HCDA 1ZU8A 3TA9A 4NNBA 3EMQA 5HWMA 1UMLA 5A6MA 1R86A 3P93A 1QR7A 3TLQA 4YVVA 3ZOAA 4L4MA 4LAZA 3VM5A 1XLJA 1THFD 4U2YA 1G4SA 2O0TA 4Q33A 2YYUA 3U8GA 2VC7A 1KLYA 3AS2A 1PCWA 3B40A 1JDDA 3DUGA 3C2VA 3QHOA 4RDVA 3WD3A 3URBA 3ARWA 4FS9A 2ZX7A 3MDWA 1FWCC 2W27A 1MFVA 3WJSA 3MCMA 1W37A 4MZYA 3SY1A 4F9JA 2REQB 3IWPA 3N34A 5FA5A 1UWSA 3NQ6A 4PC8A 2PF8A 3O15A 2J8FA 2J9XA 3DBPA 1MUWA 3VCNA 3S46A 4U28A 4NXSA 3RJYA 3AMDA 3EXRA 5CGMA 2ATMA 4K2SA 3PTMA 4C1NA 3VA8A 2PDNA 5E0CA 3TYEA 4AY8A 3N9SA 2QJNA 1W5QA 4HU4A 3HM7A 3M46A 1YTDA 4WD0A 3G6LA 3VX0A 3W70A 5DELA 1FH9A 3PB0A 1H11A 2VD9A 1H3GA 2YLAA 4E2BA 2Z0IA 4HHLA 1K6AA 4A6GA 3QOMA 4JQ2A 3LPFA 1CGTA 4QE4A 4FZIA 1V0KA 1JUKA 3V35A 2PAJA 3A3HA 1US0A 3IVTA 3RO6A 1GOKA 4QROA 3M44A 3A64A 1O6IA 3PZNA 3GD6A 1D7KA 4CCCA 1KTCA 4JTSA 1AODA 1U2YA 3PWGA 1JDFA 5CJ5A 3NA8A 4B16A 4Q4QA 3CPGA 3NPUA 1NWSA 1ODUA 3LHZA 1W6TA 4GINA 3FA3A 5BROA 1BXBA 3GM8A 5FF0A 5CH9A 4JTHA 3IVUA 3BJSA 3RPTA 2C15A 4RDWA 1V79A 1GHRA 3A22A 4PL1A 1E3ZA 4I5RA 3AXMA 3UY7A 3L5MA 3L4VA 3VIGA 1CGUA 4MFDA 3BOFA 3KBWA 4NZ4A 5LNSA 3LBCA 1QNQA 1CXIA 1VBGA 4BWLA 4XD4A 2BMBA 4D1JA 3GH5A 1PO9A 3H2MA 1MFUA 2ZA2A 4DRSA 3W73A 4XZIA 1ALDA 4A4AA 1Q85A 1Z6KA 1FCQA 4KWWA 3WX7A 3WQ4A 2FFIA 4KCTA 5I5RA 2ASHA 1ZSXA 3WBXA 1LG1A 1KBJA 2GJXB 2ZCGA 3C0LA 2J6XA 4MZ8A 3HA1A 1KXQA 2XINA 5A95A 3U5UA 2X2YA 2PZNA 3NOYA 1ISYA 4R85A 1TO3A 4Z2GA 2H3DA 2ZWYA 3ANUA 1W3LA 2PF0A 4JICA 2ZDRA 4AYSA 3NL5A 3AIUA 2V5KA 3NQ8A 4P8UA 4D9PA 1IZCA 2CLFA 3WQGA 5A6LA 2VX5A 4QCEA 2A3HA 1LF1A 5HXMA 2OO6A 5HR7A 3M5ZA 4QEEA 3KBVA 1QOPA 3LGDA 5I3IA 4DEFA 2XM1A 1ME7A 3OG2A 2PP0A 5J8LA 3KOFA 5D4YA 1WDWA 3CQIA 2JGQA 4AFYA 4ZE4A 1WYIA 2BGQA 1VCGA 3KCLA 4Y7EA 1G4TA 1GT8A 2XPKA 3KXQA 2C79A 1L0PA 2VYOA 4PEKA 4XVDA 2DEPA 1PDYA 5BOOA 4LUTA 4Z2JA 4Q7IA 3DG3A 2E9MA 5A69A 4Q8OA 1FWFC 2WXDM 1KFLA 1MEIA 1QRQA 1QHPA 4HA0A 1MW3A 2VDGA 3VKKA 3VIPA 4BJHA 3UWEA 1LOLA 1B90A 4J3XA 4ACZB 2GSEA 1R47A 3ARQA 1Q2RA 3AS3A 5EMJA 3N2XA 3FJLA 2NX9A 3L0NA 4KWOA 3H23A 3ZM8A 1SMAA 2ESCA 1GYLA 5ECUA 1XJBA 1TMLA 4O1EA 4Z1YA 4ZMGA 4IXXA 3AXHA 5HAOA 4L64A 4UBPC 2QF7A 3GXFA 3WUEA 4KPLA 2NT1A 2B7PA 1B30A 3BW4A 1DJNA 3QLDA 1ECEA 2J88A 3P81A 2C6QA 2RJHA 2YB1A 3HB9A 2EXOA 4HOWA 2FB3A 2ACSA 3M47A 3EAUA 2QCDA 3VX1A 1E4IA 1JCJA 3H12A 4PB3A 4MMWA 1OEPA 1W3JA 2DH2A 1NARA 5ECVA 3NGJA 4IX0A 4DO4A 1B4EA 2PTWA 1S1RA 4KEUA 3PAOA 5LA1A 4H4IA 1CXHA 3L23A 2XIQA 4IPJA 3AS0A 2TPSA 1NDVA 3VU2A 4NP7A 4WLCA 3JVAA 3QZAA 4KBXA 2F84A 4QM1A 3M0IA 4O15A 3AJXA 2QVNA 1ZS2A 2QPSA 2YBVA 3COTA 3MCOA 4GZEA 1L6GA 4QX4A 4IGHA 3TAOA 3C2FA 1LCOA 4UB9A 4A3YA 1D8WA 3S1GA 2Z1WA 1OZQA 2DZBA 4C6PA 3UWQA 1AH4A 2YB4A 3ABOA 1GOIA 2E7FA 2ZZ7A 2PMQA 4P7RA 3BE7A 3H2OA 1PYMA 3B06A 5JVLA 1X8FA 3PJXA 3LK6A 4W8BA 4CQBA 4HZ6A 2DJXA 2A3CA 3A6OA 4IH3A 2Y70A 8A3HA 3R43A 4DZAA 3K4AA 5HBFA 4LF2A 4AXNA 3IJIA 4TUFA 1XPYA 2WBGA 1JZ7A 1FFRA 1Q3NA 4M6VA 1GPWA 1MQRA 1FWTA 1IHIA 3V7PA 4XAGA 1AD1A 2E77A 5HK4A 3C56A 4QFUA 4C6CA 2P1FA 3GDRA 3OLDA 1M3UA 1XPGA 3U2OA 4CNSA 3BLPX 1K9EA 2C8NA 3WLPA 5HULA 2VFDA 3IACA 4FP1A 4O1DA 1S5WA 1Q13A 1F2JA 2ACUA 2YCIX 4UQ9A 1XKJA 1RR2A 4DY1A 2OZ3A 1PIIA 3UU0A 1GQIA 4IG2B 3KP0A 1V08A 2CLOA 3K4WA 4K36A 5LYRA 1DJIA 2Y63A 3TTQA 1MXDA 1WDSA 3OHMB 1KRAC 1E71M 4B5UA 4EPEC 1PX8A 2E40A 4P7OA 2QCCA 3KZSA 1SUXA 3WEZA 2V68A 2W67A 4MADA 4NQ1A 3V16A 2A79A 4LEQA 3SFWA 5J04A 4WKHA 3S47A 2VURA 3N4AA 5FEXA 1ZJHA 1O5QA 4A3RA 2D23A 3G6MA 2OG9A 3MS8A 1OF8A 3WJXA 3CLMA 4MB5A