2VFIA

Crystal structure of the plasmodium falciparum triosephosphate isomerase in the loop closed state with 3-phosphoglycerate bound at the active site and interface
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Characterization of Residue 96 Mutants of Plasmodium Falciparum Triosephosphate Isomerase: Active-Site Loop Conformation, Hydration and Identification of a Dimer-Interface Ligand-Binding Site.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
total genus 93
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2007-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vfiA00
3GB6A 3RLVA 3GXNA 3DFQA 3USBA 3TFXA 3STGA 4FX7A 3W83A 2GVLA 5ABTA 3L0GA 2CU0A 5D02A 1W5QA 4JTLA 1FWRA 2I1OA 1VRDA 2G97A 1H7RA 1XM3A 1GZGA 4UTWC 2R91A 2C3ZA 1JUBA 3WJYA 3G3MA 4IXXA 3T7VA 5CZ0A 4IPIA 1W5NA 3HF3A 1K8XA 3IV3A 3NR0A 1G67A 1F76A 2J9YA 1Q6RA 3W1RA 1FWTA 4S2BA 3T40A 4MYAA 1W1ZA 2DZUA 3KRUA 3B0UX 2ZCGA 3F4NA 3KOFA 2CLOA 2CFFA 1MZHA 1KBJA 3NOEA 5DXXA 1IGSA 4CLMA 1PIIA 2NUYA 1QMLA 3CEPA 3L0KA 2NV1A 1Q6OA 1WAUA 4HT3A 3UXAA 2ZRUA 2ZRWA 1I4NA 3QC3A 1SO6A 1TRDA 1EP2A 5HWJA 1I2QA 1ICSA 3EWWA 2ISWA 5HJLA 3QYQA 1WQ5A 3IVTA 3B0VC 1ML1A 2E5BA 2EAWA 3LCLA 3W70A 1OX4A 4GUGA 3LDVA 4QISA 4WUIA 4Z1CA 2CLIA 3S5OA 4AVFA 4N9CA 3IIXA 4DO4A 2HS8A 3LOTA 3JS3A 4UTKA 1X6UA 1KFEA 4YMZA 1RZMA 2P1FA 4JTGA 5FEXA 4BI6A 1X1OA 1T99A 2RKXA 4EIVA 1VCGA 1KTNA 3L5LA 3MHGA 1H1YA 3MJYA 3TKFA 4LNYA 2WSYA 5AHLA 3C8FA 4UFKA 1LOSA 3F1QA 2VOMA 1LBFA 5CPOA 3LV5A 5HINA 1RR2A 5DLCA 4FNRA 3D0CA 1MEIA 2ZZ7A 1M6JA 4UMAA 3QH2A 1GYLA 3UY7A 1GTHA 3MO7A 5D32A 2NV2A 2Y7DA 4P61A 3TQVA 1F2JA 3E02A 4IX2A 3S5ZA 3UWWA 1QCWA 3Q37A 3TV8A 2W0UA 6TIMA 4O0KA 2GJNA 3ZFHA 1JR1A 3CQ0A 2GOUA 1H51A 2YDAA 2YSWA 2BWGA 4BFAA 1TPB1 4MFDA 1D3GA 1S5WA 3SFKA 3W3OA 4JTUA 1AW2A 3BGJA 3NQGA 4O17A 1E51A 5C5YA 3PG9A 4FO4A 4JYFA 4KWWA 1GTEA 2A6LA 5EPDA 4HHPA 5L6UA 3IIPA 2ZZ5A 4ZVJA 3I7SA 3HPSA 3P61A 5TBOA 2B7NA 4O52A 1KM3A 1VC4A 2ZRVA 1NEYA 3BLFA 4MUZA 2RDUA 3TSBA 1W3IA 4GJ1A 4O8RA 1H62A 2QCLA 4KKXA 3TUUA 3W07A 1SO5A 3W71A 2QCDB 3LRMA 3C52A 5C2XA 3HOJA 4AHPA 2WJZA 3FJLA 4WY0F 4CNOA 4MVAA 5BW6A 2FQIA 2H6RA 2E09A 2QCEA 5CKSA 1YTKA 1T0OA 1WXJA 3C4UA 4FX8A 1Q3NA 3LTPA 1Z42A 3E0IA 4ZQRA 1HO1A 1JQVA 1Q6LA 5A5WA 3NQVA 3A21A 1Z48A 3QRHA 4QITA 3N73A 3GDLA 2C14A 4DBDA 1R2TA 5LZLA 4UR8A 1G69A 1KLYA 3ABSA 4NX5A 2GPTA 3LRLA 3W2UA 4UMBA 3MHFA 4IPJA 4J9JA 2WQPA 5EY5A 5K9XA 2EGZA 5HNRA 3TCEA 1NVMA 3G1DA 4FXSA 5I3FA 1KFJA 3NDOA 3NPWA 3QMSA 1ONRA 4RR4A 1I8JA 6ALDA 1C8VA 4WX2A 3A24A 4LU0A 3B4UA 1TPVA 1VGAA 2ZA1A 4LV9A 4GE8A 3S0CA 2I9EA 4IWWA 3W2LA 3V75A 2H8ZA 4MPQA 4NT0A 2Y7FA 5GVJA 1TQXA 2YGYA 4MZ8A 1L2UA 2YYTA 1ZNNA 2GQ8A 1TV8A 3PR2A 2VFFA 1I2OA 5DCDA 5CG7A 5AC6A 3GXTA 3NPVA 3M5ZA 5LSMA 2QCFA 3O6YX 2ZDRA 2ZZ1A 4ADTA 1GJPA 1VCFA 3B8DA 2TPSA 5AYYA 4O53A 3U8GA 4JTSA 1F74A 3AO0A 3M16A 4IQLA 4N9DA 2V2HA 3W7QA 1J5TA 4H4IA 4CQ9A 1TJPA 2E5DA 3I7QA 1HUVA 1VHNA 4NVTA 4E2DA 2VFHA 2WNQA 2V8ZA 3UD6A 1RV8A 4MLJA 3NXFA 2PE4A 4FNQA 3W73A 5EMUA 4NNAA 3V1PA 1OFPA 4DQWA 2ATSA 3UWUA 2ATMA 4XBKA 4MJMA 5FI8A 2DJXA 4NZJA 5I3KA 3C61A 4LV4A 1WDWA 4WXYA 4JTJA 1F73A 1W0MA 4JTEA 5BNKA 4XWUA 1KM6A 3PVFA 4GWEA 2P10A 3TH6A 4UR7A 3NM3A 4OV9A 2B4GA 1TTJA 1ZCOA 4NJIA 5DY2A 1WBHA 4C1KA 4K7VA 1LRNA 2P0OA 5AHFA 1O94A 3CWOX 3OIXA 1FXPA 1FCVA 4A2SA 4RLIA 2X16A 5LNRA 3EX2A 4Z0SA 3DHFA 3UYCA 3W7RA 4MJZA 3HPZA 3DZ1A 3NO5A 3FYOA 4D2JA 2JKAA 3LCIA 4KFOA 1FY6A 3LHUA 2C18A 1EIXA 1F7BA 3MW7A 4O18A 3DHDA 1SFLA 2JKEA 4MLRA 3STFA 1LZOA 4BK9A 1TCDA 3TW6A 1JRCA 4QIUA 4KWVA 2FIQA 1TTPA 1K02A 2CLHA 4Z0JA 4ZQPA 1MSSA 4PL1A 2QDGA 5DN1A 3O63A 3L67A 3MWAA 2UV8G 1W5PA 4ZL1A 5HULA 4Q4KA 2C16A 4POCA 3EB2A 2Z2UA 2VFGA 4AH7A 2QF7A 3FJ6A 4K36A 2FPVA 1H60A 4N2YA 2J88A 1MEHA 1OK4A 4FIRA 4UFLA 3TK7A 2CW6A 1ZENA 2GQ9A 1QOQA 5FF4A 2Y62A 3G3DA 3L5AA 4M19A 3SECA 5D04C 2DZPA 1W8SA 3FFSA 3DAQA 3G1SA 4MKNA 1WOBA 3MP5A 4HNNA 2B7OA 3W7PA 5F1UA 1X7FA 3P84A 3TC6A 1YXDA 3RFAA 2VEIA 4GNJA 4LS2A 2E6AA 3DH7A 5AHNA 2VFDA 2Y7GA 2C19A 4GRSA 4FNPA 3M6YA 1TPWA 3ELFA 1KW1A 1DL3A 3O05A 5D38A 1W31A 3L68A 4GFSA 3M47A 3LXAA 2A1YA 3NL5A 3PC0A 5I3GA 3TJLA 4Z1BA 1OFEA 4MY1A 1M7PA 1DVJA 2A7NA 5AOUA 1THFD 1WA3A 1F05A 1TPFA 2QEZA 2V5BA 3DENA 2ZQ0A 3TAKA 1QPNA 1KFBA 3BG9A 3FIGA 1DBTA 3EWZA 4LWWA 3P7YA 2BZNA 3W84A 1OF8A 2HTMA 1LOQA 4R53A 2PC4A 3QQ1A 2CLFA 1G4EA 2NWRA 1QR7A 1XBXA 4LVBA 2Z1BA 3N2MA 2R94A 1G4TA 2YYUA 3M43A 3ZR4A 3EX6A 3R13A 3H53A 2Q3RA 1P0NA 4WQ6A 3W7NA 4HNVA 2FB3A 4UFJA 4OQVA 5FF2A 3UWQA 4OE7A 4YXGA 3HBLA 4NNCA 5HWNA 3W74A 3QW3A 1XBZA 4Q33A 5DELA 7TIMA 1W5OA 2YFNA 2O7QA 4ZZ9A 4Z1DA 4CNPA 1VHCA 1FWNA 3THQA 3GK0A 3NQ2A 4RJEA 1R46A 5LNWA 1PCKA 2F7FA 2B7QA 3R89A 3STCA 2BLEA 4CCCA 4EOUA 1JCMP 2ZFAA 4NZFA 4AEOA 3DFOA 3TR2A 1L9WA 4UTUA 4WY0A 1WOAA 1JCJA 5FF7A 4JDYA 4O1CA 5FEZA 2E68A 4ADSA 3TAOA 3NQFA 2ZTKA 3GIYA 2A2IA 3QMTA 1S5VA 2PRLA 4XKYB 4A2RA 1FWWA 2BX7A 1NAL1 2NUWA 3MHUA 1IXOA 4I7VA 3MMTA 5CSSA 5E1QA 3B04A 1SZGA 3HG2A 4UTLA 3SI9A 4CCDA 4JY8A 3EXRA 1UJPA 1ZHAA 1V5XA 4X22A 3BGGA 4OGZA 4O57A 3HMJG 1YTEA 1GVQA 2DZSA 2ZRYA 5D2VA 3RNDA 2GVGA 3S9YA 2XN0A 4AHQA 1RQHA 3TQ0A 5DCEA 4L4LA 3ABRA 1R47A 3NQAA 4WXZA 1QO2A 4FF7A 4FEZA 2FLIA 3WJZA 3NQDA 3GDKA 1YADA 3IGSA 4WD0A 1CW2A 1ZAJA 4U4MA 4CQAA 3FA5A 1UUOA 4OU1A 1S5TA 4HPXA 4EF9A 5D30A 2V82A 1DV7A 4LW7A 2YFOA 1QPQA 3PAJA 1XC4A 1V7YA 3LI0A 4L4MA 3G8RA 1KM5A 1SPQA 4IMFA 1K7FA 4O50A 4BF9A 5DCBA 3I7RA 5LNSA 5AB3A 1JRBA 1H7NA 4OWGA 3GDRA 3TXZA 4ADUA 4E38A 4QJ1A 3W7JA 3W75A 1QWGA 4O14A 2EHHA 2Z6IA 2FFCA 3E49A 3W6YA 3A5VA 1BWKA 4NXSA 3LCGA 3MYOA 1LORA 2C0AA 1VQTA 2CWNA 1F6PA 4UXDA 1J2WA 3UXDA 2A7PA 3W7LA 4CNNA 4QM1A 2G96A 2WPBA 1MEWA 4O16A 5HWMA 1SZNA 2QCCA 1TV7A 3M5XA 1BWLA 1BTMA 3STEA 5F2GA 4WOQA 3TROA 3W1NA 1XDLA 2ISVA 2QJGA 4N4QA 5AFDA 4AF0A 1A5BA 4QNEA 1OG0A 1OK6A 1TTIA 3KRSA 3IGXA 3LCFA 3VCRA 2GQAA 2J24A 1I45A 5BOOA 3G1XA 1RQEA 2NX3A 1IIHA 5AYZA 1FDJA 1YXYA 1VR6A 3WK1A 4O1BA 3QMRA 2Y6ZA 1NFBA 2YR1A 3G1FA 3DI1A 1I2NA 1LBLA 4AXKA 3CT7A 3EXTA 4XKYA 1FQ0A 5K2ZA 5KZDA 2OZ0A 3TMQA 2TYSA 2TSYA 3QQ0A 4N6EA 1GVFA 1UCWA 3PBUA 3JRKA 4O15A 3T44A 2E77A 2NLIA 1YPIA 4LY8A 1SZEA 1PHQA 1LCOA 3B03A 3HGSA 1P1XA 4WY0B 5G1TA 2FB2A 1KV5A 2XN2A 3BG5A 2TRSA 4ONVA 1KM0A 3P8IA 1TIMA 3W1MA 4BR1A 3LLDA 3W9ZA 3W22A 5C55A 1VYPX 3LLFA 1KFKA 3NL3A 3FS2A 1MXSA 1M5WA 5I3JA 4IX0A 1OX6A 2V5LA 3HGOA 3NYZA 1FWSA 4FHAA 3LX9A 4ORIA 3TC7A 2VXNA 3UWVA 3EX3A 2WNNA 1H63A 2VELA 3WK2A 2NXIA 5CPMA 1LRQA 4AWSA 3WK3A 3W2MA 1EEPA 4E0CA 2VEMA 4GUJA 1ZALA 4YWIA 5CZSA 3RF9A 4HKPA 1HTIA 2NUXA 4Y90A 5G2WA 4HNTA 3INPA 4NJHA 1L6SA 1O5XA 5LHEA 3AJXA 2ZZ2A 4AHOA 4G1KA 1G4PA 4N9EA 1XBVA 3QFEA 1BEUA 1IF2A 1LP6A 3C6CA 1VLIA 1UASA 1IXQA 3LHTA 1ME7A 4LRTA 3NM1A 2DP3A 3L66A 1KM2A 4OT7A 5EL1A 1A5SA 3NQEA 4NU7A 5D09A 2QCMA 3G24A 4M7TA 1TPDA 1OYCA 3NNTA 2Y70A 5CZTA 3SIZA 3TA6A 1ICPA 3O16A 3OHIA 4H3DA 4N9BA 3W7DA 2W79A 3M44A 3P60A 4UTTC 4IUOA 1SW3A 3C2EA 4AAJA 3P5ZA 3LCWA 2QDHA 3L0NA 4O4WA 2OT0A 3W2NA 4OHQA 3QSRA 4UTMA 3W7EA 4HSOA 3M9YA 3BG3A 3QM3A 3SSJA 4DBEA 3DGRA 2AGKA 1RPXA 2A7RA 1AL8A 3IGUA 5K9CA 3O1NA 3DXIA 4MY9A 3TNOA 2V9DA 4DPPA 1U5JA 3KFTA 5EKYA 2W6RA 4TMCA 1GWJA 1YDNA 2A85A 1TTQA 4K37A 1W5MA 3WJWA 4X3ZA 1YPFA 4QSHA 5L9FA 4PA8A 3RLUA 3FOKA 4R7JA 2Y7EA 3BVJA 1D3HA 1TB3A 3N2XA 3DFNA 4ZQMA 2ZRXA 2Y61A 5AHMA 1N7KA 3UQNA 5KMYA 2Z0IA 4KFNA 2J9XA 4TO8A 3HGJA 4BWLA 1G7UA 3P82A 1LM1A 1LDCA 4GXMA 4JTTA 4RKAA 3G22A 4XTIA 2D73A 2DZTA 4M6QA 1GVSA 3W1TA 4RXGA 4LOCA 2QCDA 2BTMA 3GZ3A 3ZS4A 5C6MA 1SW7A 3IRDA 4O0ZA 1N55A 2H3DA 3B0PA 1W56A 2TMDA 1K8ZA 4LC8A 2DU2A 5HUOA 3A23A 1PL9A 1HL2A 1FXQA 2HS6A 3LERA 3C56A 4K38A 1G7VA 3CTLA 3O15A 4UTWA 1GVOA 4TIMA 3M5YA 2Y88A 1O5KA 1AL7A 5K4XA 3GNDA 5G4WA 3LRKA 2R8WA 3S1VA 1ICQA 3K30A 3GDMA 4JIQA 4X9SA 3GX9A 4JYDA 5CZJA 2CZEA 1TPC1 5F2LA 4FB7A 1VYSX 3N9RA 3CC1A 1K3UA 3LHVA 5FF3A 4NJGA 4YLWA 2OX1A 1KTCA 4HPJA 1XFBA 4UMCA 3C2VA 1YTDA 3GR8A 1ZJIA 2CZ5A 4UIOA 1U83A 3E96A 5CPLA 2A21A 4M5PA 3TXVA 3W87A 5K9DA 3F03K 5D05A 3CWNA 3IIVA 1W3TA 4HSNA 1KTBA 3CB8A 4MYXA 1A5AA 2QR6A 5CPNA 3LXBA 1OFAA 5A8GA 3Q58A 3P80A 3NZ1A 3IVSA 3VNDA 3HG4A 2JGQA 3W1PA 3S42A 4NX0A 5EYWA 2R14A 3GVGA 5H2ZA 2YCEA 5AHEA 3W7KA 1XUUA 3HQ1A 3KHJA 1GVRA 3BK0A 1D9EA 3LCXA 3PUOA 1PCWA 1OYBA 4IMEA 3W23A 2Y63A 3BARA 4BI7A 3G0UA 5D2XA 4JIPA 4Q32A 2BSLA 3BO9A 1TMHA 4JN6A 2JBMA 4O12A 1GG0A 3BW3A 5J5DA 2HSAA 3LV6A 3MI3A 3HJZA 5HQEA 4FNSA 1KV8A 3W7MA 4JDBA 5K4ZA 1VZWA 5LGZA 3PM6A 3S1XA 2IQTA 3BW2A 2ZBTA 3A9IA 1GYNA 1DJNA 2WKJA 3CLMA 1ZAHA 3QW4B 4LT9A 5SWUA 5F4XA 1XUZA 5T26A 5D2WA 1AW5A 3M41A 3ZWSA 1OFQA 4MOZA 1FX6A 3KX6A 2VFEA 4Y96A 2V0TA 5U4NA 3KVLA 1RVGA 3F4WA 4LS0A 3QJAA 4AWUA 1KA9F 2WNZA 3THAA 3GKFA 1GEQA 2J27A 3G1VA 3M7WA 4JICA 1K03A 1QPRA 3P81A 3DKJA 2CLMA 1DOSA 2QCHA 1FUYA 1LTDA 2A5HA 3LTYA 4QQ3A 4TMBA 3CIWA 5CGQA 3NEVA 1QPOA 4PCFA 4JTFA 3NQ7A 4H6KA 3LHZA 3MI2A 4RX0A 5FF0A 2CZFA 1VS1A 1ZFJA 1R30A 3MUXA 1TSIA 4S2CA 2VEPA 3HG3A 4LTSA 2XN1A 4DELA 3TJXA 2ISSA 3HPXA 1KFCA 4UTHA 4ZQNA 1GG1A 3L21A 3DBPA 3GR7A 5KZEA 2YX0A 3N34A 5F4WA 1FDZA 4JX5A 2H90A 1BKSA 1XI3A 1DORA 5G4EA 1AG1O 2YZRA 4LRSA 1JCNA 1SUXA 3KAOA 3UPBA 2B7PA 3QEZA 1JJKA 1HFBA 1DKWA 1R2RA 3H54A 5DXYA 4WJEA 4EWND 1VPXA 2O7SA 2YW4A 1H7WA 1FCBA 3NG3A 3RU6A 3C2FA 1H1ZA 3QPZA 5F2MA 2V30A 3IIOA 3N9SA 2C13A 2Z6JA 3SJ3A 1T96A 1JUEA 5AN7A 1Z44A 4K7YA 5KINA 1YDOA 5TIMA 3N14A 4JYEA 4PL2A 1ME8A 3SGZA 2EKCA 3PY2A 3KVMA 2RDWA 1XKYA 1TPEA 4LVDA 4XQ6A 1AMKA 3UWZA 1X1ZA 3PBYA 3R12A 4WZHA 5KITA 2DZVA 3ATZA 3U6WA 1TRIA 4M6VA 4R33A 1XCFA 2QKFA 2V2CA 1JUKA 1OVDA 3LXCA 1PE1A 2C15A 2WSRA 3RMJA 3HG5A 2WO5A 2FJKA 4A29A 1H7OA 3PG8A 1FCUA 5AYXA 1PV8A 4HIBA 4EVZA 3PBWA 5FESA 2ZA2A 3E12A 1T8XA 1SO3A 4JNMA 1Y0EA 4WOZA 4Y9AA 3SY5A 5HMSA 3EWBX 2VKZG 4LVFA 4ZQCA 1SO4A 3UZJA 3VFLA 3LGEA 1EUAA 1W37A 2CLEA 1Q6QA 3GNNA 1EWEA 4X2RA 4JD4A 1UB3A 3I68A 1SSGA 3DFTA 4KFPA 4E2BA 4BI5A 1TQJA 4O19A 1EWDA 5F1VA 2H8XA 2OMAA 2Q8ZA 1AW1A 1JCLA 2RDTA 5F4SA 2JKPA 2PRHA 1PVNA 3DFSA 4K6AA 2NXHA 4RV8A 3R5EA 3WJXA 4LUJA 3IIZA 4TR9A 2F84A 3A5FA 4Z1AA 5I3HA 4IMDA 1SR9A 4FIQA 2KZHA 1VYRA 3W7IA 1WX0A 3R8RA 4AB4A 3S1WA 1F5ZA 5J5RA 2PURA 2QCGA 2C6QA 2GVJA 3PSVA 1ADOA 3EWYA 3W1QA 3ABOA 3O07A 4O54A 2E6DA 4NNBA 4PFMA 2CZDA 3P8JA 4I7UA 4W9TA 3C2OA 1JQXA 3BLIA 5D37A 3UWYA 3T4CA 1WYIA 1M7OA 2QJIA 4FX6M 3BW4A 5G2HA 3QPYA 4FNUA 1TPUA 1P0KA 5D03A 5MHBA 2X2GA 3GDTA 5AHIA 2VFIA 1TPH1 4UNLA 3FKRA 2NX1A 5BRBA 1JVNA 4AWTA 3P74A 5D33A 5E93A 3UPWA 4DO5A 1SFJA 3PSWA 1GT8A 3MBFA 3W1XA 1OX5A 4QAIA 1I2PA 3IVUA 3PF3A 4NJJA 5FEWA 1ME9A 1LROA 1QO5A 1H7PA 4C1LA 4DF2A 3W7GA 1NSJA 3UY8A 1C29A 2OJPA 2WSQA 2ABAA 4GUFA 3ANYA 4TX9A 5DBTA 4DF1A 5LKYA 3MYPA 3W1AA 3G1YA 1OJXA 4UC5A 2PRMA 4XUGA 3O8AA 2E5CA 2QUUA 2YW3A 5BMWA 1OX4B 3LBMA 4R34A 1ZY9A 5I3IA 1YYAA 1QNVA 3G0XA 3GLCA 1OYAA 2DORA 3Q94A 4IOTA 2X1UA 3P62A 3G1HA 1TJRA 1PS9A 1DHPA 3PULA 4IMCA 1UUMA 2ZZ3A 2V81A 4PH6A 2EPHA 2JGYA 1LOLA 3DKLA 2RHGA 3N3MA 1WV2A 1KFLA 5KTLA 5HR6A 5U7SA 3W2JA 3G8EA 4O10A 3NQCA 3W7HA 4XTDA 3TFCA 4TU1A 4QNWA 3EX4A 1FDYA 4Y8FA 4RCXA 3RK8A 1KBIA 3PUEA 4M6PA 1EPXA 2DZWA 2V2DA 1DJQA 2Q8LA 1LRTA 5H91A 1FCQA 3TSMA 4AF0B 5K7JA 3OBKA 3NPXA 4JXCA 4IGHA 4K39A 5G2IA 1JCXA 3T78A 2X30A 3BV4A 3NZRA 3HB9A 1EX5A 4YCPA 4S1FA 1OFOA 4O1DA 4FXRA 3U2OA 3TIMA 2E1DA 1A53A 3W1UA 1OFRA 5G5IA 2OCZA 1P5BA 4O28A 3A22A 3NA8A 1QAPA 1JULA 3VI2A 4K8EA 2AQWA 1GOXA 2QUVA 4JTIA 1B3OA 3CM4A 4IJBA 3P5YA 4XZ9A 3CIXA 5IM51 5F2IA 4MFEA 1LLWA 3H55A 3OG3A 4UUIA 5KSWA 3HIJA 4LVGA 3DI0A 3NPUA 1K8YA 1A5CA 1Z41A 3M0ZA 1K7EA 4JX4A 3CEUA 1L6YA 3EEGA 3EX1A 4FNTA 5DY3A 1OFBA 4JTKA 2A6NA 2Y89A 3Q2DA 3SW6A 3LB0A 4DPQA 1VCVA 1C9DA 1LLZA 2NWSA 4O13A 3TX9A 2YXGA 3TMLA 3EWXA 4JR5A 4A22A 1K7XA 1YXCA 3W72A 5LHFA 2G95A 4JEQA 2QCNA 3VKJA 4O4VA 3SZ8A 2BXVA 1XL9A 4OBTA 3W7CA 4K8HA 1O60A 3FEMA 4PTNA 1RQBA 4I7WA 1TYGA 3IEBA 2VC6A 2FTPA 1SW0A 3MBDA 4PC8A 3UNDA 3CPRA 3ABQA 3LBCA 3GAKA 4Y6GA 3G18A 2ZTJA 2FPTA 2XFWA 1WBJA 2H3BA 4NUWA 2WOQA 1EA0A 1KLZA 2FDSA 5HUPA 1YLVA 5EA9A 3S5NA 1VLWA 3NQMA 1QFEA 1I2RA 4N4PA 2G5WA 3W76A 4JY9A 2QAPA 4ALDA 4UFIA 3QZEA 1A50A 3ZWTA 2RFGA 8TIMA 1S3HA 3OVPA 1SZFA 3PB2A 4UNKA 1PHWA 4ML9A 3I65A 3O6CA 1CX9A 3W88A 3LHYA 1DQWA 3SR7A 3GKAA 1DQXA 3MP3A 2Q3OA 2QJHA 4O1AA 3WFAA 2LLEA 2NXGA 3EKLA 4AMAA 2ABBA 2E6FA 3EKZA 2ALDA 3TU9A 4GBUA 2ZYFA 2AAMA 4EF8A 3LCHA 4LVAA 1OHLA 4LS1A 3M1ZA 3QSTA 3SGUA 3QF0A 3KXQA 1AK5A 4IMGA 3MP4A 1OF6A 4HNUA 4JS3A 1CI1A 1SU5A 3PBVA 3WK0A 3EWUA 4GUIA 1JCYA 1NF0A 5LNUA 4YL2A 5CSRA 2PCQA 3LTSA 4UFMA 3S8HA 1H5YA 3S1UA 2J6XA 4RXFA 4A21A 4LC6A 3P67A 4PODA 3E9AA 4P2VA 3O06A 2DJLA 2CLLA 5EBUA 4ICNA 3C0JA 3JR2A 3O6DA 4UTTA 4MZ1A 5LNVA 1FBAA 4UTIA 4M7SA 3GXPA 3BLEA 1YDVA 3W85A 1G4SA 1J4EA 3FYPA 3L2IA 3OVQA 1B4EA 3L5MA 4U28A 1EUNA 1GPWA 5IBXA 2GJLA 2WV8A 5KZMA 3EXSA 4GUHA 4I9AA 2OT1A 2A4AA 3TSDA 4UCGA 4BWLC 4RZ5A 4NJKA 2A0NA 3B05A 4OV4A 3NAVA 4MIMA 2ZZ4A 1QOPA 1W54A 3KRZA 1B4KA 1O4UA 3OVRA 4Z08A 3S5YA 2Y85A 3W2KA 3W7OA 3W86A 4RK8A 1XXXA 2J9ZA 1SQ7A 3NVTA 3CU2A 3NGJA 1EB3A 1NF7A 4JGDA 3BPWA 3S6DA 4ZQOA 1X8FA 3GYEA 1XBYA 4DF0A 2JK2A 3FLUA 2GUUA 3LI1A 2ZZ6A 3TQKA 3L9CA 3I6RA 1N8FA 3NQ6A 2NX9A 4NQ1A 2QUTA 2X1RA 3NQ8A 1F6KA 3NL2A 1MO0A 3PWAA 5AC8A 5D2YA 1G6CA 2X1TA 3DFPA 1QDSA 1W3NA 5G1YA 1IXPA 3HO8A 2DZXA 4CCEA 4GC4A 2HMCA 4IXHA 3TE9A 1Q45A 1OABA 4RZ6A 5TQLA 1L6WA 1O95A 3ATYA 3N19B 3FKKA 3VE7A 1B57A 1SSDA 3LHWA 4LUIA 1ZAIA 1B9BA 1HO4A 2QAFA 5HR7A 3UZ5A 4O11A 3WJSA 4DO6A 1TREA 5E0KA 1IXNA 2I14A 4RZ4A 1R2SA 3YPIA 1ALDA 1TV5A 3PB0A 4UFHA 1TO3A 1HG3A 3LM7A 1RD5A 3DU0A 4HN4A 4A3UA 1GQNA 3HGRA 5LGXA 2ZRZA 4MZYA 3OEXA 1VJIA 1OFDA 3OA3A 1H61A 4UTJA 3GAYA 3W1LA 1LYXA 2E6YA 3G1AA 3L65A 1KM1A 2C1HA 3KVKA 3NL6A 4MY8A 3CHVA 1KM4A 1LBMA 2CLKA 4ORMA 3B06A 3M5VA 1XDMA 1VH7A 4NXKA 4CQ8A 3T55A 5IBXC 3C2RA 5FEPA 4N02A 3MI6A 3VE9A 1UBSA 2ZA3A 1IIGA 4B5NA 5C54A 4PEKA 2YPIA 3R2GA 2FPYA 5DBUA 2VENA 4DXVA 4XBSA 3TDFA 3PUDA 4DEFA 2RH9A 5K3VA 3TW7A 2VEKA 1H7XA 5AC7A 1H50A 4JTHA 3PS7A 4N6FA 3G0SA 1EP1A 2B0MA 4ZMGA 2NZLA 3KVJA 5D2TA 4YCOA 2X1SA 1EP3A 1P4CA 2EF9A 3C3NA 5BMXA 4JX6A
chains in the Genus database with same CATH superfamily
3BJFA 3GB6A 3RLVA 3TFXA 1XISA 3STGA 1WPCA 1PZ2A 1OADA 1P6CA 4D72A 3KDOA 5LIUX 2CU0A 1XIJA 5D02A 4JTLA 1CGTA 1XGZA 3A3HA 4PEEA 2CERA 5I06A 2WXDM 1NQ6A 4W84A 1ODUA 3RGTA 1YDYA 2YB1A 2C3ZA 1JUBA 3VZYA 4S3KA 3WJYA 4IXXA 3T7VA 1AQFA 4IPIA 3HF3A 4HNOA 1KXVA 1VFMA 2QV4A 5E09A 4ZENA 1MW0A 4S2BA 4Z1YA 7TAAA 1IT8A 1C93A 1UKOA 2CLOA 3KOFA 1MZHA 3SFWA 3G1RA 2JF6A 1TMQA 1BVNP 2NUYA 3CLWA 3CEPA 1E6NA 3LGDA 4PUEA 3U48A 3QC3A 4CNTA 2FYMA 3DGBA 1EP2A 1LJYA 3CV6A 4C6LA 5HJLA 3EWWA 2ISWA 4S23A 3QYQA 3IVTA 1W3HA 2ZUNA 2GOKA 3LCLA 3W70A 5CBIA 4HHLA 1Q4WA 4OOUA 1OX4A 4P7NA 3FVDA 2CLIA 3QY8A 5T91A 2YA0A 5HJXA 2BV9A 2WZHA 1KFEA 4GX8A 4BI6A 3W53A 1NWTA 4KERA 1YBQA 3CHCA 2PDUA 2ODOA 1QASA 2GYIA 1QATA 3TVAA 3FNDA 3MJYA 3WYZA 3BCJA 2WPGA 3QOMA 4UFKA 3EPNA 1KWKA 3NXLA 2BODX 1RR2A 5DLCA 1RXOB 2W27A 2WJEA 4L6DA 3QH2A 1GTHA 3MO7A 4QE5A 4PBEA 4UTFA 2VZTA 2A3HA 3QPEA 1PZ3A 3AS0A 3TV8A 3UWWA 4Z2LA 6TIMA 1E1CB 4AVOA 1HGWA 3CZGA 4WSJA 1H51A 1Z32X 1H0GA 1XH0A 4E2OA 4YVVA 2INZA 1H09A 4AY1A 3W3OA 3AHXA 1AW2A 3NQGA 1N8IA 3WH7A 4FO4A 5C5YA 1UUQA 1B30A 4UQAA 1P6WA 2WC4A 3IIPA 3HPSA 1E6QM 1PX8A 2NV9A 5TBOA 1RBLA 3BLFA 4MUZA 2XH4A 1H62A 3W07A 3URNA 3ARVA 3KRBA 3OB8A 2AOSA 1W2PA 4IQDA 3HOJA 3WNNA 3FJLA 3V0TA 4MVAA 4R3UA 2DIKA 4DI8A 1QI2A 2QXWA 5A8QA 1HP4A 2E09A 5CKSA 1B31A 4HNLA 2X05A 4NZ3A 3LTPA 3XISA 1Z42A 4U3AA 3E0IA 2XSXA 3UGRA 3AYSA 2YA1A 4PE8A 1PTDA 4O0QA 1EA9C 1JQVA 4QQUA 4TOQA 5A5WA 2E40A 5DMMA 1WKEA 4DUVA 4AU0A 2IQDA 4B4HA 4HU8A 3W2UA 4MDPA 3TYEA 2WQPA 1UKTA 3BLLA 1PSCA 5K9XA 4C6OA 3FV9A 1OCJA 2H9AB 1MFVA 5CC6A 4PSPA 5AYIA 3NDOA 3MMUA 3QMSA 1ONRA 2YZ5A 1I8JA 5HMDA 1C8VA 3OIHA 3CS2A 1J0ZA 1RSCA 4OTKA 5HQMA 2EJ1A 3WNMA 1EJWC 1VGAA 4LV9A 3S0CA 8RUCA 4X63A 3VIGA 1WDSA 2Z24A 2FZBA 1CB7B 5TNVA 2P88A 2VUNA 4IWWA 2Q09A 4MPQA 3B8TA 4EANA 1RA0A 2YGYA 4YJ5A 1E6RA 4ZTXA 3WEZA 3PR2A 4QAWA 5DCDA 1KKOA 1BF2A 3NPVA 5E9XA 3KCJA 2PSNA 3O6YX 2XIBA 2ZZ1A 1VCFA 5C71A 3WLMA 1XLJA 4KQNA 3U8GA 4KCUA 2IPGA 4O53A 3WF2A 1PTAA 4N9DA 2V2HA 3W7QA 4H4IA 4C6QA 2VI0A 3RXZA 2PDWA 2CXGA 4B5TA 3I7QA 1HUVA 1VHNA 3WNPA 1EJRC 2C91A 2VFHA 1YRRA 5GJMA 2BNJA 4PUDA 1JI1A 1RV8A 3NXFA 3B3DA 1HIZA 3W73A 1HZYA 3A6OA 4NNAA 1OFPA 4HHMA 2ATSA 4ZOAA 1KCKA 4NZJA 4LCSA 4WXYA 4DYKA 1F73A 5CH9A 5BNKA 2YOCA 4GO8A 3TH6A 3WBWA 3NM3A 4OV9A 4GVFA 5DY2A 5A8PA 2DT3A 2I16A 1WBHA 3ZLGA 4C6PA 4GH1A 3TYDA 2P0OA 4R9OA 4A2SA 4L56A 2FHFA 5ABGA 4JFTA 2X16A 4IGSA 4Z0SA 3DHFA 4Y2WA 1E43A 1JDCA 3CO8A 4J3VA 3NO5A 3KTCA 1MRQA 3N29A 4PCNA 3VGDA 3MZ2A 4D2JA 3AIWA 3LHUA 2HDJA 1A0EA 2VQTA 3F7JA 1EIXA 1F7BA 2XIOA 3MW7A 3DHDA 3UWEA 2XFFA 1Z89A 1LZOA 4BK9A 4V1XA 3USZA 3KWXA 2DSVA 1TTPA 3WD2A 2CLHA 4ZQPA 4PL1A 2QDGA 2OEJA 5JBFA 2VOTA 4WK9A 2WVVB 1MUCA 5HULA 4PUUA 2WC7A 4IHCA 1PBGA 4K36A 4N2YA 2J88A 3GU2A 2YDRA 2J7DA 1MEHA 1BFNA 4A3YA 3KLKA 1V6WA 3ITCA 3AIUA 4UFLA 1JZ2A 2CW6A 4PR4A 4NRRA 5EMMA 1S2WA 1XLDA 1QOQA 2A3BA 3L5AA 1W8SA 3G1SA 2AGTA 1WOBA 4HNNA 4B5XA 3VUSA 1X7FA 1EPVA 3P84A 5A6AA 2VEIA 4GNJA 2FKPA 4GC3A 3PWIA 4YYFA 4LS2A 2E6AA 3BDKA 1V02E 3QZAA 3DH7A 5DRCA 3VOGA 4GRSA 4FNPA 1KB3A 5BXRA 2PZ0A 2XINA 4G7EA 2V5KA 3KOYA 1W31A 4QDMA 3B8IA 3CL7A 4HHHA 1M65A 1NDYA 2FZ8A 1V3MA 1IEQA 2KX9A 3VZZA 1KO0A 1M7PA 1THFD 4IMAA 1OBAA 1XX1A 2WJDA 4V28A 1QPNA 3EWZA 2BZNA 1I0BA 1NDVA 4A4AA 2EKGA 4S3GA 4R53A 1V6YA 3NWRA 4XSMA 2VP8A 2ZUMA 1P48A 1IHIA 3LLXA 4J28A 3M43A 3ZR4A 3H53A 2NSXA 4WQ6A 4Q8UA 3DG7A 4GJIA 4UFJA 1S1RA 3UWQA 1E1EA 1MMFA 2GJXA 3K4WA 2QW5A 3AFBA 5JBDA 1YPXA 3C0SA 4EAYA 1WXYA 4J3SA 4PCTA 2PF0A 4OKDA 1E1FA 2O7QA 4B4FA 1FWNA 3GK0A 4RJEA 3R89A 4CCCA 3H2NA 1FFQA 1L9WA 3WLIA 3BAYA 1T40A 4QFUA 4GY7A 3GS6A 3J7HA 4DNHA 1UP0A 1SMDA 3QMTA 5JH2A 3CZKA 2BX7A 2ZUVA 5E1QA 4B92A 5CSSA 1UMYA 3DDMA 4ZR8A 3H2FA 4UTLA 1E4LA 4P5UA 4JY8A 3EXRA 1UJPA 4AZBA 2VJXA 1XLAA 5DRIA 4IH3A 1B9ZA 4O57A 3HMJG 1YTEA 2HWGA 3KLLA 2WMKA 2XN0A 1RQHA 3TQ0A 3AMCA 2AKMA 3NQAA 1QO2A 4W8BA 4FEZA 1YADA 3IGSA 4MWAC 1CW2A 3N15A 3REQA 4KGLA 4FALA 1A47A 3QC0A 4OU1A 4AIOA 3WQWA 1QPQA 1QW9A 4NY2A 2VURA 3LI0A 1YBQB 1KM5A 2ZXDA 4IMFA 4I3GA 4Z2HA 4BF9A 4PTMA 4WDXA 3CQJA 5DCBA 1XIMA 5LNSA 5AB3A 2R6OA 3F2DA 2ZUWA 4AEEA 3S6TA 4GINA 1G01A 3MKKA 1W9PA 3LSCA 3N04A 1QWGA 4O14A 6CGTA 2QJJA 1KXTA 2XIMA 3PPFA 4H9VA 2XGBA 1JAEA 1RP9A 3A5VA 1BWKA 3LCGA 3MYOA 3ZQ9A 4RDZA 1F6PA 4AZ5A 1NFGA 3W7LA 2R24A 4UZSA 2WPBA 1KNWA 4O16A 2EQDA 5HWMA 1SZNA 2PS2A 2HPMA 2J7HA 4ZO6A 5REQB 5F2GA 4EXQA 1A5KC 3TROA 1Q2RA 1XDLA 1A5BA 2WANA 4DZHA 1OK6A 3QV6A 5BYWA 3CV2A 1ZBWA 3SDOA 1FWHC 1P1MA 2POZA 1I45A 1RQEA 5JIPA 3H2EA 3VM5A 2VZOA 4LGXA 4E2VA 3QMRA 3EOEA 2I17A 3JZUA 3WQGA 1AQMA 4IP5A 2YR1A 1JYWA 3G1FA 1S2UA 3DI1A 3CT7A 1FQ0A 3O6AA 5K2ZA 3BOFA 1WDPA 1UCWA 5H8PA 4O15A 3W02A 2HVMA 4IICA 1PO9A 1SZEA 1DWGM 1PHQA 1LCOA 5HATA 1M03A 5FIPA 1U5HA 3PZMA 4E3TA 2FB2A 5A2AA 2NVDA 2PP3A 2XN2A 3BG5A 1WP6A 3TTEA 4XB3A 1F4HA 4U10A 4DWSD 2QJNA 1KFKA 3NL3A 2FH6A 5I3JA 1OX6A 3NYZA 2Z2BA 1O6IA 1VPYA 4QJ4B 4GVGA 2W92A 3FHAA 2WNNA 3EX3A 1H63A 3FGCA 2UZ9A 3NDYA 2X42A 2VEMA 1GVYA 1ZALA 4CNUA 3R8GA 1OGSA 2CHOA 1S5NA 4HKPA 1HTIA 5JH1A 1QNRA 2ZZ2A 4DBSA 1XW8A 1BEUA 1LP6A 2Y24A 4GA8A 1IXQA 3NM1A 4LAKA 1HT6A 2F2HA 4QDPA 5EL1A 2DZAA 3VABA 2OELA 2XH7A 4Z2KA 1PWLA 3BZGA 3TLQA 3N25A 3TWAA 3SIZA 4U2ZA 4FLSA 1UP3A 1ICPA 3O16A 3PPHA 4EPEC 4P8UA 1Q7ZA 4RDYA 1HP5A 4GOAA 3LCWA 4NRSA 3RDKA 3T0TA 1FWBC 2Z26A 1EO5A 4OHQA 4FLOA 4JQ3A 3UP8A 4HSOA 4F0MA 4DBEA 3WBXA 4U5KA 2A7RA 2J79A 3KS6A 4MY9A 4X2PA 3IV8A 2BGQA 3KFTA 1MXDA 2ANUA 3BURA 4MJ4A 1TTQA 1EF2A 3OYZA 1S3TC 1W5MA 4C7DA 4LCRA 2IQ0A 2ZVRA 1YPFA 4QSHA 5RUBA 4OECA 3GH4A 2V6AA 1NOUA 1GKRA 3TN3A 2OYMA 3VYLA 2Y61A 5AHMA 3UQNA 5I07A 4KFNA 1OCBA 3KL5A 4UWMA 1XRFA 2J9XA 1EX1A 1A3XA 1TZ7A 4G2DA 3IAPA 1LM1A 2OYLA 3AYVA 1EXPA 2DZTA 4M6QA 1MRAA 2QCDA 1CXHA 4X0VA 3GZ3A 1F8IA 4LUSB 5FOOA 3UG4A 1SW7A 4L9ZA 3UVIA 2H3DA 4XX6A 3B0PA 3HMCA 3DN5A 1FXQA 3VVGA 3N2CA 3CJPA 3O15A 3Q4DA 1Q2SA 3M5YA 1DE6A 4GHRA 3E38A 3GH5A 2XIQA 4WRHA 8XIMA 1OZMA 4W4QA 4H2CA 3GX9A 3L4UA 1D7FA 2GSEA 1E6XM 4FB7A 5T9BG 3WDRA 5BRQA 4MAZA 1LWIA 4J3UA 5I7GA 1GZ1A 4X0NA 3CAQA 1BG4A 4UMCA 3ZLFA 1EXBA 2V68A 1CEOA 1EYEA 4IQJA 3GTXA 4UR9A 3LEPA 1NWUA 1V0NA 3B9OA 2OR2A 2A21A 3TXVA 5K9DA 3UZZA 3IIVA 1XYCA 2PWVA 4HSNA 1KGWA 1KTBA 3UPMA 3NQBA 4HZ6A 4FXFA 4S3CA 1EGVA 1OFAA 4KGJA 3Q58A 3QFWA 3IVSA 3VNDA 3QZ6A 4BZYA 3RITA 3HG4A 2JGQA 3KBWA 3LMZA 5EU9A 5EYWA 3BSHA 2R14A 1P7TA 3W7KA 2ONEA 1XUUA 3DEQA 3SRHA 3KHJA 1GVRA 1D9EA 1V6VA 2HROA 1PUDA 2Y63A 3BARA 1XIFA 2IKIA 4Q32A 1TMHA 4JN6A 4ZTYA 3K8KA 1AD1A 5EGRA 3N6QA 5I00A 3BW3A 1S2TA 4J4KA 5HQEA 1KV8A 3W7MA 2D0GA 3PM6A 3OBAA 3MSRA 1US2A 3BW2A 2GJXB 2ZOXA 1BKHA 1GYNA 4F0RA 1DJNA 2VZUA 3P3BA 4DWDA 4LT9A 5SWUA 3SCWA 5H8MA 4AD3A 1OFQA 3UZWA 1OD0A 3HQNA 3QJAA 2WNZA 4Q8NA 3SQMA 3F5LA 3GKFA 1F6YA 2WW5A 4H8UA 1M04A 1XSJA 4TMBA 3LTYA 2IKJA 5CGQA 3WENA 2EG8A 3NEVA 4PCFA 1PX4A 2XVPA 2JQXA 3LHZA 4L64A 4H7ZA 5FF0A 1VS1A 1R30A 4YTSA 3MUXA 1K9DA 4U33A 4H9XA 3HPXA 1KFCA 4KEZA 4HPGA 3TN4A 3FN9A 1E4MM 3RM8A 2FZMA 3N34A 3MKVA 5F4WA 5C2GA 1RA5A 1BKSA 1A80A 1DORA 2GUYA 4KMQA 1JZ5A 5A1AA 4GIRA 5BU9A 4J2PA 1HJWA 3KAOA 4L1WA 1BD0A 2YCKX 2B7PA 2VZSA 1XQLA 4GNKB 1E9LA 3RU8X 5HBFA 1KRMA 4WJEA 2CBVA 4Q6JA 4NYUA 1H7WA 2PDNA 4ZB5A 4Q6XA 4MF4A 4LF1A 4M51A 2V30A 3IIOA 3RUBL 2W61A 1T96A 3LG3A 1RHCA 2XVGA 5B80A 1A0DA 1RBAA 1WE5A 1CIUA 3AMDA 3KVMA 1UR9A 3IRSA 1HKIA 4H9YA 3PBYA 3WEMA 4WDUA 4TQTA 1XRTA 1QTWA 3QR1A 1XLFA 4GZEA 4LBSA 3W25A 1XCFA 8XIAA 2V2CA 3VOFA 2VDIA 3S2LA 4LCQA 4MTVA 3GXIA 1Q6FA 4MGGA 4IFKA 2Y1HA 1JPIA 1QI5A 3R58A 1S46A 1XHGA 4A29A 2XJ7A 3AS1A 1H7OA 4A8NA 2MANA 2ZA2A 3CQIA 4MG4A 3E12A 1T8XA 1SO3A 3OGVA 1S2CA 1I6NA 3DG3A 3G77A 3BAKA 1R9ZA 4Q8TA 1SO4A 5FD0A 3LGEA 3MS8A 3M0YA 4JD4A 3DFTA 2Z1KA 4RNHA 3VGHA 4O19A 1IEIA 1E1CA 4F9JA 1O5RA 3AHZA 2JKPA 4K6AA 3LYEA 3VNZA 3R5EA 1U5VA 3AWOA 1RUSA 1YEYA 2BP1A 5DX7A 3A5FA 1J96A 4IMDA 3AS2A 3B4YA 2GQ3A 1RJRA 3R8RA 3EB3A 1XJBA 2QCGA 2J8TA 4QJ5B 4L80A 4DI9A 3PSVA 4D6HA 1R3TA 1RJQA 3EWYA 3NZPA 1UA3A 4HOZA 1V03A 4O54A 2CZDA 3R6IA 4I7UA 1N8WA 3VDHA 1U2YA 1WYIA 4WSKA 2QJIA 4HB7A 1GKQA 5G2HA 2GVEA 4FNUA 3WLNA 5D03A 4AIUA 1R3SA 2X2GA 3GDTA 5AHIA 1T5AA 3WDIA 3FKRA 2HE8A 1XG4A 4RDVA 1Z69A 3V0UA 5D33A 3UPWA 5IHSA 4GKLA 3MBFA 4C6BA 1OX5A 3AHTA 5M2FX 3M0KA 5FEWA 1ME9A 1MZRA 3N4AA 7PTDA 2OJPA 4GUFA 1SJBA 3OYXA 3T0CA 5DBTA 3R0UA 1JAKA 3MYPA 3W1AA 1C8YA 2PRMA 9XIAA 1PZ0A 3JVAA 1EH9A 3EMQA 1TR9A 2G4JA 4Q4QA 3LBMA 1H2JA 2D3LA 5IDIA 3AXMA 1OYAA 1F4AA 1R85A 3Q94A 1X39A 3RPMA 3P62A 4UZUA 1W17A 3MANA 1LOLA 3MUY1 3LS9A 3N3MA 1GQJA 4Q4PA 1VBHA 5M17A 5HR6A 1XYAA 5U7SA 2XG9A 3MB9A 4XTDA 3TFCA 4TU1A 3UA3A 3VAVA 2CNCA 4M6PA 1BSLA 3MT1A 2Q8LA 1JPHA 3GU9A 1FCQA 4AF0B 5K7JA 3NPXA 3WLPA 1V4YA 1SFTA 4IPPA 4AYSA 1JCXA 3LM3A 3T78A 3HB9A 1CXIA 4S1FA 3E2SA 2RJHA 3U2OA 3TIMA 1HKWA 3PWGA 3RR4A 2CXEA 2BOGX 3L2LA 1P5BA 1Z6KA 3JU2A 3NA8A 1H5VA 1ZBVA 2GJPA 1DXFA 1C3FA 1FRBA 4K8EA 2QUVA 1P0EA 4I9MA 3UG3A 3P5YA 3VIPA 2NQHA 5IM51 5F2IA 1LLWA 3IWPA 3NSMA 4UUIA 4AX7A 4LVGA 4XO7A 1Z41A 3M0ZA 2O55A 1L6YA 3EEGA 4MB3A 4BEUA 3IJ7A 1HKMA 2A6NA 4IGMA 2Y89A 2PDMA 5HANA 4AFYA 3KCOA 4MPKA 4PUNA 3UW6A 1XFCA 4I9TA 1E5NA 3LU2A 2NWSA 3TX9A 4WDWA 3TMLA 2Z1WA 4QS5A 3KBNA 1QXLA 4IJCA 4JEQA 4MWAB 2QCNA 2DSWA 2W63A 2O92A 4GI6A 2I5IA 4ZB0A 3SZ8A 1JG9A 2BXVA 1H41A 1UZ1A 2ZWYA 2BY1A 1O60A 4I7WA 4QTGA 3VD5A 1J10A 3EMZA 4PC8A 3FJNA 2JE8A 2RUSA 5T8GA 5ABFB 3GAKA 4QG8A 4CEXC 3DHPA 2FPTA 1U1UA 5HNTA 2EPOA 1WBJA 1FWGC 1J2BA 1EA0A 1UPPA 3S5NA 4AQLA 3NQMA 1NELA 1XCXA 4QS6A 1V0LA 1UQYA 1EHAA 1DPMA 3KOWA 4JY9A 1TV4A 2QAPA 1U1HA 4UFIA 3TQPA 3UETA 2RFGA 1C7SA 3LMYA 1SZFA 4UNKA 5BWAA 4ML9A 2FVKA 3ALGA 4C6CA 4JL1A 3TYBA 1JDFA 2XWEA 3GIPA 2D3NA 2R1LA 1IZKA 5MKGA 4O1AA 3EOLA 3PJWA 5EBAA 2ABBA 2HBVA 3R4IA 1CLKA 2XVLA 1JYNA 3TU9A 3IJIA 1PZ1A 4GBUA 2R1PA 1MDLA 3ITOA 4R5EA 1VFTA 1SFSA 4QE1A 4KPLA 4S3AA 1D3CA 4DRSA 3MP4A 2R9RA 2GGGA 1W3JA 3KBMA 1TV2A 3WK0A 4GUIA 2ZUUA 5LNUA 5HA7A 3LTSA 4XAYA 2J6XA 4OIFA 3E9AA 4B9YA 3O06A 3T1GA 1QNOA 5EBUA 4XAZA 5ECUA 4DX3A 3MSGA 3T4WA 1BGGA 3OOQA 3BANA 4NI3A 4AZCA 3GXPA 3DG6A 3L2IA 3WD4A 1S1PA 1B4EA 3L5MA 4MKSA 3CBWA 1DXEA 3OVQA 3EZ4A 1GPWA 3SCSA 1W9DM 2XZ7A 3EXSA 1NY1A 3U3HA 1UD6A 2A4AA 4GX9A 4RZ5A 5B7YA 3NAVA 5A8NA 4JN8A 3QGVA 3NDZA 2G3NA 4TX6A 5HNUA 3A4WA 3RO6A 3OVRA 3A64A 1TVPA 3DUGA 2ICSA 3W7OA 4AD5A 4XV0A 1K6WA 1MWOA 3CU2A 3W27A 4OUIA 3NGJA 1QI3A 4LBUA 4M29A 1EB3A 4JGDA 1XBYA 4LAMA 1GJUA 2PZNA 3FLUA 4PMOA 2G4FA 1XD1A 3WG6A 2JEPA 4KT2A 1IT0A 2QUTA 1F6KA 3GNOA 1UOZA 5A2CA 1PPIA 3DFPA 1NP0A 1GOOA 1QHZA 3E2QA 4JBRA 1ECQA 4JQ4A 3HQOA 4GC4A 2HMCA 2QUNA 4RZ6A 4GQGA 3VK5A 1I1WA 1WB0A 1G94A 5A6LA 5FJPA 1O95A 3QLLA 1C91A 3NURA 4LUIA 1ZAIA 4V33A 1HO4A 1WZLA 1N2VA 1MVYA 2XTKA 1UOKA 5HR7A 1XS2A 2YLAA 4O11A 4I9JA 1J5SA 4RZ4A 4NL1A 2XDFA 3PB0A 1TO3A 3LM7A 4O1FA 4HN4A 5A8OA 1V02A 2WWCA 1GORA 1KC7A 2PDBA 5FL0A 1LYXA 1U22A 2J7CA 2C1HA 3CHVA 1KM4A 4W85A 3TZNA 5HXMA 1FKXA 3MU7A 3CT2A 1H0IA 5IBXC 3C2RA 4N02A 5C54A 6PTDA 1RPKA 3S6OA 4JNYA 1ITXA 3TDFA 3PUDA 3TW7A 1FP9A 5AC7A 1SYTA 1PKLA 1EKOA 3PS7A 4N6FA 3G0SA 1OD8A 4YCOA 5EB8A 1LWJA 4B2DA 3T0BA 3SCPA 5J04A 1JZ4A 1UWTA 2GVLA 2VX5A 3L0GA 1UA7A 1W5QA 3V7PA 1FWRA 4JTCA 4DXKA 4PMQA 2I1OA 2V69A 1EFZA 2G97A 1XM3A 3ZYZA 4X61A 9XIMA 3IV3A 3NR0A 4FF5A 1D2KA 1EDQA 1F76A 4QEEA 2ZC1A 1FWTA 1W1ZA 3KRUA 1E15A 3F4NA 3QV7A 3B0XA 2CFFA 3NOEA 1XKJA 5DXXA 4CLMA 1SMAA 3SSZA 1HL9A 1Q6OA 3GZAA 1I4NA 1SO6A 2ACUA 4M3PA 3VC5A 1I2QA 3BWWA 1WQ5A 1ML1A 4OFCA 4EWJA 3DBNA 1EJTC 1PIGA 1KQZA 4GUGA 3LDVA 5KEZA 4WUIA 3LZ3A 3S5OA 7XIMA 4B5SA 1AQHA 3AMGA 3QY6A 4P7RA 4UTKA 3V5CA 1X6UA 2IKHA 2V63A 5BWFA 4DLFA 2RKXA 3EWDA 2A3CA 4FP1A 1JGMA 1WZKA 3RJXA 1LBFA 3E2RA 2PBGA 3W4RA 1PKNA 1C92A 4FMVA 5A6SA 4LANA 2X2YA 5DF0A 3EPOA 4XAFA 3C5QA 4UMAA 1GYLA 4QG6A 2NV2A 4P61A 3NCOA 2C1IA 1GNXA 2X7WA 3T9PA 3AWNA 1QCWA 2VM8A 3COTA 4Q8QA 1NFPA 4NILA 2REQB 4IFOA 4D6GA 2OYKA 4BFAA 1WKDA 4HZMA 2VCCA 2D2OA 2OOFA 3PAOA 1B3ZA 4JTUA 4MAVA 5GNYA 1KCLA 1E51A 1LUCB 1V3IA 3PG9A 4JYFA 4KWWA 2OQYA 1GTEA 5EPDA 1PKMA 3VNLA 4WJ8A 2ZZ5A 3I7SA 3UXIA 5BOFA 1EC9A 3DFYA 3P61A 2VRKA 1S2VA 4O52A 3I3BA 3UNTA 4BKNA 1VC4A 2ZRVA 3E6EA 1IEWA 4H00A 4LXFA 1W3IA 3RAOA 4O8RA 1O1HA 3IPWA 4DZ5A 4K1WA 4A8RA 4PMRA 3C52A 2ACQA 5C2XA 3N4FA 2WJZA 2ZC8A 4GZ7A 1CB2A 4L65A 1UIPA 2FQIA 4F0HA 2H6RA 3GVRA 3QQWA 1VJZA 3MVIA 3ZSSA 1OY0A 1WXJA 3VGEA 1V8EA 5FA5A 4FX8A 1Q3NA 1XRSA 3MUIA 3NUKA 3O7UA 1RCXB 2GSHA 9RUBA 3GFYA 3SUVA 1NQKA 4I8YA 1Q6LA 4AIEA 3NQVA 3OZOA 1H49A 3A21A 3GDLA 5BU6A 1XCWA 4Q8PA 1UD2A 3RILA 4JKLA 4Q8OA 4GISA 5C9ZA 4UMBA 3WQDA 3MHFA 4Q7IA 3LK6A 3N17A 5EY5A 2DW6A 1B2YA 1KFJA 1VEPA 1UR1A 2QPSA 1FWCC 5LIWX 4WX2A 3CUGA 3A24A 3BMVA 4GZIA 3ZT7A 2WKLA 1S5MA 4DJDC 1LT8A 4LU0A 1BQGA 3U7VA 2YL6A 2ZE0A 2VGBA 1UZDA 1VBRA 4A05A 2EBNA 1UD3A 3GFZA 3CQKA 4K1GA 3GUGA 2YYTA 2W66A 3AIVA 1TV8A 1BRLA 3GXTA 1OEPA 4IIEA 3M5ZA 3KEHA 2QCFA 2PDCA 1E70M 1A3HA 4JQAA 1DHKA 2TPSA 4JTSA 1MNSA 3M16A 1HGYA 2OWCA 1J5TA 3WFLA 4CQ9A 2E5DA 4H9MA 3TTQA 1YNYA 4E2DA 3GO2A 1AJZA 2WC3A 1T41A 5CGMA 1ONXA 4MLJA 1DIDA 5F7UA 3XIMA 2WQDA 1VD6A 1XG3A 1ZTVA 4DQWA 3UWUA 2ATMA 3VNYA 4MJMA 5FI8A 2DJXA 5I3KA 1WUFA 2OLHA 1W0MA 4JTEA 4J40A 3U5YA 1KM6A 1M1BA 2B4GA 3S9ZA 1TTJA 3ZJ6A 1NARA 4PUKA 3ALFA 4K7VA 3FXYA 4E5TA 3OIXA 1CGWA 3UEQA 2QGHA 4X9YA 3EX2A 3W7RA 3S2CA 1KD0A 3HPZA 1BWVA 2QF8A 2J7BA 3DCPA 2JKAA 1R5YA 2C18A 2QNEA 4QE4A 3KUMA 3HN3A 1ONWA 4ZXLA 4MLRA 5A2BA 3STFA 2NQLA 4QIUA 2FIQA 3HZ3A 5BROA 1UH4A 1SVDA 1W5PA 3LY0A 2C16A 1T8QA 3EB2A 2VFGA 2FPVA 1H60A 2H9AA 4RL3A 3T42A 1E6PA 2X1IA 3ABZA 4WJXA 4XZMX 2G3FA 3T81A 3D47A 4PMDA 2ZX9A 1ZENA 2IPFA 3IJDA 5FF4A 3ITXA 2PDKA 4AD0A 3UG8A 3FFSA 4MKNA 2RAGA 2B7OA 3W7PA 3TC6A 2Z28A 3V0SA 5FJOA 2Y7GA 4DJEC 3VIHA 3CYJA 2Z4GA 1KW1A 4K3ZA 2GDVA 3M47A 3LXAA 2A1YA 3NL5A 5I3GA 1IWPA 4RE0A 4B2DD 1TELA 3L12A 2WZEA 2ZX6A 2ISDA 3FYYA 4MY1A 2QT3A 2CETA 1ITCA 2NVAA 3GTFA 2A7NA 3TYUA 2FZDA 5BXSA 2VT0A 2QEZA 2V5BA 1QWKA 2ZQ0A 3ERPA 1KFBA 4H9ZA 4LWWA 5E6YA 1IGWA 2ZXAA 1LOQA 3GHUA 3QQ1A 2CLFA 3VFCA 1JF6A 3WLSA 1XBXA 2PP0A 3N2MA 3VC6A 1J79A 1VFSA 4Q8MA 3EX6A 2Q3RA 4HNVA 2EEXA 4OQVA 3TCSA 1NOWA 4IFKB 2DQXA 2GJRA 3PTMA 3AMLA 3MDWA 3B97A 3W74A 1XBZA 5DELA 7TIMA 4KEMA 2YFNA 4ZZ9A 1EBGA 1LQ0A 3HM7A 2BLEA 2POTA 2XSBA 4EOUA 3AQUA 3OLEA 3TR2A 3AXXA 3IUDA 4G9PA 2PWFA 2Q8XA 5IDZA 3WLTA 3KL0A 1EGMA 1FWJC 2SFPA 5FEZA 2E8YA 4ADSA 3WDJA 1MUWA 3TAOA 1EC8A 2ZTKA 3GIYA 3CH9A 1S5VA 2PRLA 3I10A 4XKYB 3HA1A 2OXNA 4I7VA 1V6UA 1SZGA 3HG2A 1E0WA 4CCDA 4S38A 1AH4A 3U7BA 3MCOA 1QK0A 4X22A 2VD9A 1E4IA 3BGGA 2G37A 3H23A 1GVQA 3TYCA 2ZRYA 3S9YA 1B5TA 1CXKA 1O66A 5DCEA 4L4LA 3ABRA 2QULA 4HSHA 2WLYA 4WXZA 2FLIA 1IE7C 3NEHA 4QLKA 3GDKA 1QNQA 1E56A 2OG9A 1NP2A 1AVAA 1ZAJA 2DDXA 4CQAA 3FA5A 4HNCA 1WAWA 2VWTA 2V67A 3KOXA 1SGJA 1M7JA 5A6MA 4TV6A 4LW7A 4R7WA 3K4AA 3PAJA 4QLJA 1V7YA 3ZJKA 3G8RA 3S4TA 1SPQA 1K7FA 4O50A 3I7RA 5EMJA 3IJ6A 2XHYA 2WB5A 3UJSA 4ADUA 4QJ1A 2Y4SA 4IL0A 2EHHA 1SJDA 2FFCA 3W6YA 5I5RA 1R87A 1OCNA 4NXSA 1VFLA 4EAMA 2CWNA 4AXNA 2G3JA 3UXDA 3GG0A 5I24A 1OG6A 1VFOA 2VR2A 1L6FA 1UD5A 4QM1A 2G96A 3PFRA 4HA1A 3M5XA 3STEA 3ZIZA 4WOQA 5FJIA 3VIFA 5AFDA 2VL4A 1OG0A 2OEMA 4PUJA 1XYFA 2GQAA 3GFXA 5BOOA 3GR4A 2NX3A 1VB9A 4EK7A 1TWWA 3WK1A 2O9TA 3EOSA 1NFBA 4DNMA 4HVXA 3GHRA 4M6UA 4WKHA 4EE9A 1LBLA 2OU4A 1JIBA 3OHMB 1ESWA 4HU4A 1V6XA 1PAMA 2VGFA 2OZ0A 2WBKA 4N6EA 1XGEA 2OZ3A 3Q67A 3JRKA 1TV3A 4F79A 3KTSA 4DXXA 2P53A 1YPIA 1P1XA 4GYJA 4WY0B 2AQOA 2ALRA 5C7VA 3SUSA 4XZIA 5JIWA 2TRSA 4ONVA 1ZRQA 2GGHA 3P8IA 1TIMA 3W1MA 1VFUA 3LLFA 3VKBA 3FS2A 1MXSA 4ERGA 3LX9A 4ORIA 4KBXA 3TC7A 3SQSA 3VMPA 3UWVA 3OO2A 1FFRA 2PLMA 5CPMA 4HZ8A 1LRQA 2ISFA 4DUWA 2XUCA 4WHBA 3FSUA 1FHUA 3L4TA 4XZNX 2NUXA 4Y90A 5JUVA 3V1HA 4HNTA 1L6SA 3GBDA 1O5XA 5LHEA 3VOHA 1G4PA 4FXJA 4N9EA 1XBVA 1V08A 3MC5A 1IF2A 4XAGA 3E0LA 2BHYA 3FSTA 3RPDA 1UASA 3TEVA 1BRLB 3LHTA 4GXPA 3CK5A 3L66A 4OT7A 4NU7A 1PEZA 3ITGA 4YVPA 3G24A 4M7TA 2RGMA 3PZNA 2YKKA 5EMLA 5CZTA 4W7UA 4H3DA 3OHIA 3BV7A 4AAJA 2ZIDA 1A5OC 2QDHA 1ZP3A 2I5GA 2OT0A 3BC9A 4BQ2A 3AU6A 3W7EA 3QM3A 2AGKA 3APYA 1RPXA 4KW2A 3SEPA 3TC3A 1BQCA 3IGUA 3TNOA 3WH9A 3N2OA 3GE7A 1W1A1 1I9CB 4DPPA 1PB0A 5EKYA 4MJ2A 2F38A 2VVNA 5TF0A 4HK5A 4K37A 3FAWA 3WJWA 1EYWA 1KWGA 4IP7A 2VCAA 3DC8A 3VD9A 1O68A 3WD1A 4Z42C 3FOKA 4JTAA 5HAOA 1D3HA 1TB3A 1J18A 1TWIA 5KMYA 2Z0IA 3BXWA 3G2GA 4JIIX 3ARSA 3WBEA 4TO8A 2PD5A 1JCTA 2DEPA 4JTTA 3PZUA 2CBUA 1GVSA 3W29A 3W1TA 3NGFA 4LOCA 1R0MA 3C8NA 4IL2A 3UJEA 4Q4OA 3ZS4A 3U0HA 1IYXA 3PP7A 2ZUTA 7ODCA 4RNIA 3LENA 2TMDA 5GNZA 3TA9A 5HUOA 3A23A 3TOPA 1HL2A 4F0SA 2I56A 3V36A 4DZAA 4K38A 3V16A 2BS9A 4WLCA 3HU7A 1R3WA 4TIMA 2J13A 4AZGA 1C8QA 1O5KA 6XIAA 2J74A 3S1VA 1ICQA 3POCA 3GDMA 4X9SA 4JYDA 2HNHA 1TPC1 5F2LA 2PAJA 1GCYA 4Q4SA 1W1B1 3LHVA 3REQB 2JFEX 4NJGA 3F5JA 1KTCA 4KCTA 3P2VA 1YNQA 1XFBA 4DN1A 2W5FA 3F2BA 4V15A 2PTDA 3E96A 2TAAA 1UP2A 3W87A 5D05A 4ZA0A 4LQ1A 1A3WA 3R0KA 1WNOA 1W3TA 3UXLA 4I6VA 3WQVA 5A8GA 1N82A 1F3XA 2Y5EA 3H7UA 4QR6A 3W1PA 3S42A 2WLZA 2V5JA 3URBA 4PUMA 3GVGA 1R8LA 2YCEA 5AHEA 3HQ1A 4H8HA 3PUOA 1GONA 5A95A 1YE4A 3FW6A 3PJUA 4JIPA 3BO9A 3PZTA 1GG0A 1ISZA 5J5DA 2HSAA 4D6FA 4CGTA 3MO4A 4JDBA 5K4ZA 1VZWA 1BYAA 1XLHA 2OSXA 3RN6A 1O7AA 3E5BA 5E5CA 2WKJA 1X98A 3S9IA 2ZE3A 3QW4B 3VMOA 5HPOA 5T26A 5D2WA 4E8CA 4MOZA 1FX6A 2VFEA 4HK7A 4Y96A 3MTWA 3R8HA 1C8XA 1HJUA 2HE5A 3F4WA 3KVLA 3UCDA 4AWUA 2YCJA 1KA9F 1XP3A 4F2UA 1E9ZB 1GEQA 2J27A 1WXZA 2F9RA 3M7WA 1K03A 3P81A 2CLMA 4B5WA 3NSXA 1REQA 1QPOA 3NQ7A 3JUGA 2CZFA 1ZFJA 3DYMA 3TTSA 1LG1A 4XO6A 2YCLB 3EDJA 1XSIA 4S2CA 4AYGA 3HG3A 4DELA 1KFWA 1GG1A 3L21A 3GR7A 2YX0A 4LUTB 1FDZA 4JX5A 4ENLA 2H90A 3GHTA 1AG1O 1UWAA 3S1GA 3KOZA 2HNEA 2Y0FA 1SUXA 1VIWA 1IV8A 4DWSB 3H22A 1ISXA 3QEZA 4C60A 1XV8A 2B81A 3H4WA 1HFBA 1TJ0A 2ZX7A 2P50A 1R2RA 4RPQA 5DXYA 1AD4A 1ZP4A 3VPLA 4KF1A 4JPGA 3GUWA 3SQLA 3RU6A 3WLQA 3XINA 1H1ZA 2XIJA 5F2MA 2YJQA 3N9SA 1W1PA 1JUEA 3IANA 2X40A 1ME8A 4UOJA 2PWGA 3PY2A 3FCPA 1E71M 2DIJA 2RDWA 1PWMA 1XKYA 3E5PA 5H8UA 1W1YA 4WZHA 3VDBA 3H70A 3PNUA 4IFRA 3LXCA 4HCHA 2E9BA 4FA3A 1FWDC 4MWAD 4GI9A 1QRQA 3BMWA 4G56A 3CUHA 1OQFA 5CGTA 3CGTA 3QTGA 4HPNA 4JNMA 3ZJ7A 4F0LA 3F5KA 5HMSA 2VKZG 3VGBA 1US0A 5KETA 2EPMX 3UZJA 6ENLA 4YTQA 2I7GA 1Q6QA 2E0PA 3GNNA 2PI6A 1Y5VA 4US6A 4KFPA 5LA0A 4E2BA 1TQJA 4R7OA 2PWDA 2FVLA 5IFPA 2H8XA 1L8NA 2OMAA 2Q8ZA 1JCLA 3CV1A 3UXKA 3MUAA 1AODA 4NYYA 3WN6A 1OC5A 3HQPA 3IIZA 4TR9A 1UR2A 3M64A 2F84A 2C7FA 1OIMA 4WF7A 1BGAA 2C6QA 2NQZA 1Q7MA 5PTDA 3WELA 4HA3A 3ABOA 2E6DA 1J6PA 1M01A 4W9TA 3SRDA 1HJQA 3AJ7A 3SCUA 2PMQA 4F9DA 4DVOA 3IJQA 2X09A 1HJSA 3PBMA 5I79A 4L6OA 2E9LA 1M7OA 3C3UA 4FX6M 3VD4A 1TA3B 4L9XA 4W87A 3QPYA 4CQDA 2A3EA 4C1NA 4YVXA 3O0FA 4C1NB 1AQ0A 1ZJBA 4ILSA 3GTHA 5E9AA 1HX0A 1EOKA 3Q65A 2NX1A 1E72M 1UR4A 2VNCA 3P74A 4DO5A 3PSWA 4CCZA 2OEKA 3QYSA 3W1XA 1JZ6A 3IVUA 1A5LC 1LROA 3WDPP 2VR5A 2D20A 3UT0A 4C1LA 4C5ZA 3NOYA 3UY8A 2ABAA 1W2VA 2XU2A 4DF1A 4LNCA 4J35A 3G1YA 4XD5A 2WJFA 1IR1A 2GUBA 2QUUA 2YW3A 4B9ZA 5H1WA 3MY9A 1EZWA 1ZY9A 3AZRA 1QNVA 1BXBA 2QIWA 1K77A 1H3GA 3WQEA 3RLHA 4IOTA 4ZOCA 1R6WA 1DHPA 1L0PA 1UUMA 3B9EA 2JGYA 1VKFA 5XINA 2R1NA 3OJGA 5KTLA 1AZ2A 3AIEA 3NQCA 1IEXA 4C6DA 2QUMA 4QNWA 3EX4A 3AIRA 4Y8FA 2JEQA 2UBPC 1KBIA 3PUEA 2PC8A 4N42A 2J8FA 2VEGA 4KWUA 1EPXA 4J7RA 1QJWA 2ZXBA 1A5MC 3TSMA 3VZXA 3UG5A 3ZT6A 4PMNA 5G2IA 1JZ7A 6REQA 1ADSA 3AXIA 4F2BA 3NZRA 1EX5A 4XSLA 4P8XA 1OFOA 4AUBA 3W1UA 2HBXA 5G5IA 3WL1A 2OVLA 4ZODA 5BRPA 5FSDC 4O28A 3WQOA 3A22A 1K9EA 2W62A 1W1VA 3VI2A 4DBWA 2D2GA 1FWEC 4JTIA 2ACSA 3ZO9A 5C7HA 2BVTA 4RW5A 3CM4A 2OZTA 1Z9AA 4Q7NA 4XAPA 4BJHA 3H55A 4HTBA 5EMKA 2UY3A 4ZE5A 3RM4A 5KSWA 3NPUA 3OLIA 3EA2A 3H8AA 4QG9A 3R79A 1K7EA 3PANA 3TJ4A 4HJFA 1EQPA 3RO8A 3EX1A 2EO7A 1VIZA 4FNTA 4PCSA 4C6FA 1NOFA 2V3GA 3Q2DA 1J93A 2FGZA 4S3FA 2V5CA 4ACZA 1C9DA 2QMJA 3VDAA 1LLZA 4O13A 4GQ0A 4YPJA 1D7KA 4JR5A 4MNMA 4QP0A 1YXCA 3K2GA 1QHPA 5E70A 5LHFA 1KQYA 3N18A 3MV01 4OBTA 3W7CA 4K8HA 3FEMA 2G3MA 4PTNA 1RQBA 3IEBA 5AZ1A 1SW0A 1MYRA 3QGKC 4AMCA 3MA8A 3ABQA 4KRZA 3M0LA 2XFRA 2XFWA 3OLGA 1E55A 3TWBA 4NUWA 3OA5A 2FDSA 5EA9A 4PB5A 3ITVA 3WQ8A 4AX6A 4LY4A 2J7FA 3TLLA 3K46A 4REQB 1R3YA 3QZEA 3ZWTA 8TIMA 1S3HA 1GVEA 3H12A 4HYVA 1KBLA 3O6CA 3LHYA 3MCMA 4WSHA 5CAHA 1JXKA 4C6KA 1DQXA 3MP3A 3AXKA 2NXGA 1CZ1A 4LF2A 3VIKA 2AAMA 3PPCA 5BZAA 4LS1A 1V51A 3M1ZA 1OF6A 3TN5A 2HJPA 4D1IA 2ZKMX 4J3ZA 1SU5A 2FTWA 4GY0A 3EWUA 3GNXA 5CSRA 2PCQA 4A21A 1J6OA 2DJLA 4JTRA 1TUFA 2CLLA 1WKYA 4I6KA 4ICNA 2Q6ZA 1FBAA 4UTIA 4M7SA 3BLEA 1YDVA 4NAEA 4XD4A 1EO7A 3NO3A 3B40A 5IBXA 3GBEA 1DXIA 1Y5WA 3KDNA 2OT1A 4FS9A 4UCGA 2GK1B 1XIBA 3B05A 3MSYA 3URAA 5AECA 4HP5A 5CCZA 1E6SM 3TW9A 4KETA 1W54A 5FAJA 1HW6A 3OP2A 4IPNB 1O4UA 4YHGA 4B3LA 3H7RA 1XXXA 3NVTA 2DT0A 1FA2A 2YCLA 1UZHA 5CEWA 4IPLA 1KXQA 3S6DA 3GYEA 2QMKA 4DF0A 3URQA 2FMNA 2PDGA 3VOIA 3CZLA 3WLHA 1S39A 2GUUA 4JIHA 3OBEA 4XKMA 1L8PA 3NQ8A 1MO0A 5AC8A 1I60A 1VRXA 5D2YA 1R9XA 2NSOA 2NT1A 5HMEA 1W3NA 1TE6A 1EL3A 1IXPA 2WVTA 4UQCA 3R43A 4IXHA 3DOPA 2PGRA 1OABA 4S3EA 3N19B 3FKKA 4JFUA 3VE7A 5HOSA 3GNPA 2INEA 5AKQA 3E2VA 2E4TA 3SGGA 1B3YA 3WJSA 4ZOEA 2VUYA 1TREA 3I3EA 3DIPA 4ZB2A 1R2SA 4DZIA 1TV5A 1XLMA 1DJZA 4GY1A 2ZRZA 4MZYA 3OEXA 4O1EA 4MNKA 3BICA 5BOEA 4UBPC 1KM1A 3CAKA 3KVKA 4YU1A 3NL6A 2CKRA 4MY8A 1LBMA 3AIQA 2GGIA 1XDMA 1ZJAA 4CQ8A 2ZX5A 5JBEA 5FEPA 5LIYX 2C8NA 1R38A 3ARZA 2IPJA 3RHGA 5E0FA 4PEKA 2VC5A 2FPYA 5TD4A 2VENA 4H01A 4DXVA 4XBSA 2PDXA 3MV11 3R10A 3FVMA 2B0MA 3KVJA 5D2TA 3VNKA 4OVXA 3LNPA 4GXWA 1EP3A 2CLPA 2EF9A 5BMXA 4JX6A 2PDHA 2GZXA 3USBA 3DFQA 4GYKA 1TVLA 4FX7A 3W83A 4UQBA 2CHNA 4DJFD 1GOMA 4XIMA 1ZJHA 4J3WA 1TA3A 1MW3A 1H7RA 3WMBA 1GZGA 4UTWC 2R91A 2ZVIA 3G3MA 3FY1A 2PTWA 1WDDA 1DJYA 2J9YA 3ARQA 5CSUA 3W1RA 1Q63A 3T40A 2DZUA 3EGJA 3B0UX 1R86A 2ZCGA 1KBJA 3B9AA 1IGSA 1XLGA 3C86A 1DYSA 5ECVA 1DJXA 1QMLA 1GOKA 3F4CA 3EDKA 3L0KA 1WAUA 2XH0A 3UXAA 2ZRUA 3ONCA 3FA4A 1VPQA 3BAWA 3CYVA 3LPOA 1OB0A 3TTOA 3BLKA 3GYCA 4MKVA 5HWJA 1ICSA 2GSJA 1UROA 1MUMA 3VNIA 3B0VC 4PCPA 1CGUA 3VCCA 4RDWA 1GHRA 1PKYA 4QISA 1CCWB 2Z1VA 4JAWA 4Z1CA 3RX2A 1JXJA 1X7IA 4W8LA 4N9CA 3IIXA 1JI2A 1P43A 3LOTA 3MJMA 2PWUA 3UCQA 4BA0A 2P1FA 3E3HA 4JTGA 2QVHA 1X1OA 3STPA 4NZ5A 7ENLA 1CLXA 4EIVA 1VCGA 4LBRA 3BQ5A 1KTNA 1VFHA 3L5LA 1JPMA 3AOFA 1H4PA 3ARRA 4BQ3A 3TKFA 4DYJA 3E0WA 3UJFA 4LNYA 5AHLA 4HYWA 1YIXA 1LOSA 3OGRA 3F1QA 3CIVA 1PDYA 5CPOA 1ZZMA 1XRVA 4X60A 5HINA 4FNRA 3D0CA 4I90A 1M6JA 3S5SA 3V5OA 5D32A 1XYZA 1LF1A 2Y7DA 3L4WA 4C6JA 3EOUA 3VNMA 3TQVA 1F2JA 3E02A 4IX2A 2W0UA 2HK0A 3ZFHA 1JR1A 1XIDA 4C91A 3CQ0A 3KW3A 1FH8A 3TJIA 2F8QA 2YDAA 3LPFA 3BCFA 2F6XA 1X6LA 1S5WA 3SFKA 3K8LA 4ROPA 3BGJA 4O17A 3QV8A 1ZQ5A 1GJWA 5L6UA 4BS0A 3BCDA 5G4HC 2FJUB 2R82A 4ROQA 1V0MA 1VBUA 1ZLPA 2DSZA 3VDGA 1B3WA 1NEYA 4Q4RA 2RDUA 4YTTA 3R94A 4GJ1A 3TUUA 2QCLA 2DW7A 2J6VA 3W71A 3M0IA 2D2HA 4QX4A 4UQ9A 3ARYA 4PMYA 4D6IA 1EQCA 3VCNA 3UR2A 4WY0F 4GKTA 4CNOA 4Q8VA 4UOZA 4M8UA 1UHVA 4JHZA 1X96A 5DQPA 4DWSC 3IJ9A 4GLEA 3N9KA 1YTKA 4HMEA 4AZIA 3ZM8A 3R0DA 2FMOA 3C4UA 4ZEPA 2E28A 3M4HA 3P0XA 3IGHX 3BE7A 3B9DA 4ZQRA 1HO1A 1QNSA 4QITA 4DAIA 3II1A 4H7VA 4AC7C 2WCAA 4DBDA 2CPUA 1R2TA 1G69A 1KLYA 1V3KA 3ABSA 2GPTA 1EJVC 3LRLA 5ABHA 3P14A 1YNPA 4IPJA 3ITYA 4L7ZA 4IISA 1HJVA 2WZMA 4TX8A 3TCEA 3G1DA 4FXSA 4HN8A 3PPGA 4RR4A 2CBIA 3T08A 2OWWA 6ALDA 1V93A 1TPVA 1XC6A 2ZA1A 1JZ3A 2I9EA 3QN3A 1JEZA 1HF6A 5FAGA 4DJDD 3W2LA 2H8ZA 4NT0A 1UJQA 1L2UA 4MZ8A 1ZNNA 3VKKA 3SN1A 4REQA 3CXOA 2VFFA 1I2OA 5CG7A 5LSMA 4RNFA 4Q3MA 2YBVA 2ZDRA 3H4GA 2BG5A 3KBVA 4Z2JA 5AYYA 4NI8A 2WSPA 3AO0A 4FPSA 4ZCWA 3JZEA 2D2JA 4NSBA 2RGLA 1TJPA 1UC5A 1A4MA 6A3HA 4NVTA 2V8ZA 3GY1A 3UD6A 2PE4A 4FNQA 1JNDA 4AEFA 2E7FA 3V1PA 3ES8A 1OCQA 2AMGA 1TFVA 2O9PA 3OTRA 3OG2A 5ABEA 2Y5JA 4LYKA 3F4DA 2W91A 3C61A 1WDWA 1G0CA 2ZX8A 2YL5A 2Q71A 2OKOA 1E0TA 4M80A 1O5QA 4OBSA 3H2CA 2P10A 4PBFA 1ZCOA 4C1KA 5AHFA 1O94A 1FXPA 4H04A 4GFIA 5DO8A 3ECQA 4UB9A 5FJUA 4QLLA 3L23A 2P76A 3DZ1A 2E9MA 1CDGA 3LCIA 2DH2A 3M0JA 2QV5A 4O18A 1POKA 4AISA 2E1WA 4JKMA 1NDWA 4GNVA 3TW6A 5FACA 1JRCA 1GW1A 2DV0A 1J0IA 4FOUA 1MSSA 5DN1A 3L67A 3MWAA 2PP1A 4F3HA 2UV8G 4ZL1A 4Q4KA 3VX1A 4V27A 2Z2UA 1BLIA 3WNLA 5FSEC 4CNSA 3VIOA 4AD1A 1Z7AA 1GOWA 3UU0A 1US3A 7A3HA 2WHKA 3TK7A 1ZL1A 2X0SA 3M0MA 5FJTA 5DFAA 2Y62A 4JNZA 1RCQA 5D04C 4WIWA 3MP5A 3PJXA 4GH3A 4AVNA 3RRXA 1E9IA 4D6JA 3VINA 2WKGA 3E0FA 4GCXA 5F1UA 2G50A 1YXDA 3RFAA 2NQ9A 3RG6A 5CPTA 4AZHA 4KEUA 3EDDA 2WNWA 4TTUA 2OLAA 3M6YA 3MSDA 4G1NA 1TPWA 3MUCA 1UR3M 4TVUA 1DL3A 5D38A 1WCGA 4GFSA 4JEJA 3PC0A 1TG7A 3GW3A 1OFEA 3M0XA 2NQ5A 3VIIA 4RW3A 3UESA 3EWCA 4WDTA 1E0UA 5AOUA 1TPFA 5KZ6A 3DENA 3TAKA 2VC7A 3FIGA 1DBTA 3UCCA 3TONA 1XSKA 1OF8A 1R7OA 1BVZA 2D1ZA 3G6LA 2DVUA 2NWRA 3GTNA 1QR7A 2Z1BA 3WZ0E 4MM1A 1G4TA 3ARPA 2YYUA 2VVSA 1BPLB 4W86A 3R13A 3QVQA 3SCVA 5A8MA 2J4GA 1NM9A 5C9XA 4F48A 2IW0A 5FF2A 5MF5A 4OE7A 4CVWA 3HBLA 3UR7A 3CHEA 1CXEA 3S47A 5HWNA 3N6HA 1XH2A 4G5DA 3L4VA 4CNPA 1VHCA 4AW7A 3SCNA 3THQA 3ONBA 1R46A 2P0IA 1PCKA 2F7FA 3STCA 3FEQA 3L4XA 2XM1A 2NLYA 5CJNA 3DFOA 4Y7EA 1KRBC 4F40A 4OBRA 3GC2A 4WY0A 3IK2A 5AC4A 4HD5A 2E68A 1ONEA 1DQUA 3NQFA 3A4AA 1LWHA 1M41A 3WMCA 2A2IA 3RLGA 4HTYA 5M03A 4A2RA 1FWWA 1W32A 3CMJA 2V38A 1NAL1 2NUWA 4HPHA 3VOJA 1IXOA 3MMTA 3N3TA 1RLCL 4QSFA 4C7FA 2CHRA 3B8WA 3SI9A 1RCOB 3IARA 4TVCA 1V5XA 4LB4A 3CQHA 3P0WA 4QJ3B 5BCAA 2DZSA 2YL9A 4BQ5A 4DJFA 3RNDA 4AHQA 4QBXA 5FCZA 1R47A 4E6MA 3W0KA 1CNVA 3WJZA 4FF7A 2B31A 1UPMB 1JDEA 1BF6A 1EBHA 3NQDA 1BYCA 4S3BA 4WD0A 4U4MA 1Q8AA 3PBGA 4H1ZA 1W6TA 2GLKA 5I6SA 1FKWA 1LT7A 3WH5A 4QRNA 4L1GA 1OT1A 2V82A 3EDEA 5D30A 1DV7A 4M81A 2YFOA 1XC4A 4L4MA 4DO7A 4QDWA 2OKTA 4F4RA 2DFAA 2X0YA 1MW1A 1W9XA 3AHVA 1H7NA 5FL1A 2P3ZA 3SRFA 3W7JA 2AMXA 2ZADA 2WHMA 3TYAA 1BXNA 1LORA 2C0AA 4G7FA 4UXDA 1J2WA 2A7PA 4DYEA 3QHNA 4IM4A 4PMXA 4CNNA 4NASA 1TV7A 1BTMA 5AZ0A 4DLMA 3W1NA 2ISVA 4ZSUA 4QNEA 4GGHA 1TTIA 3AU2A 3IGXA 2FTYA 2J24A 1QI4A 3G1XA 1IIHA 5AYZA 1FDJA 2WM0A 1E9YB 3W38A 2DT1A 2YA2A 4O1BA 4PRWA 4CUCA 2Y5SA 1SJAA 2P8BA 4EX4A 1I2NA 3KZPA 4AXKA 1CT5A 4XKYA 5KZDA 3QQ0A 2DSUA 3APGA 1R7AA 3GVWA 3T44A 2NLIA 3WX7A 2A3LA 4MWAA 3HGSA 5G1TA 2V5DA 1H11A 2Y8KA 1DWFM 1TR1A 3BSMA 1VJSA 1EJ7L 3LLDA 4BF7A 3ARTA 3W22A 5C55A 1CWYA 1VYPX 3Q45A 4IX0A 2V5LA 3HGOA 1FWSA 3I3DA 4FHAA 2JIWA 4F0KA 1EEXA 2VXNA 4GI8A 2J66A 3PTQA 2NXIA 4I5XA 4YWSA 4PN2A 3WK3A 4E0CA 4XBJA 4HMNA 4LYQA 3SN0A 4GUJA 3N2BA 4LPCA 2OZ8A 1DWHM 4JTQA 3WF1A 3RF9A 1NU5A 1R9YA 2VMFA 2BGNE 5G2WA 3CHFA 3RCNA 5CQ1A 2WMJA 4AHOA 4G1KA 3A47A 5LXXA 1VLIA 5LIXX 1JFXA 3AXHA 1VBGA 3SY8A 4JCLA 1K8CA 4ZFMA 2PLJA 1A5SA 2PDPA 3UZXA 4ERIA 1OYCA 4W7VA 3NNTA 3BOXA 3NZQA 3TA6A 4RE4A 3E74A 3W6MA 2PLCA 5H6HA 3W7DA 3RX3A 2W79A 2NT0A 3M44A 1SW3A 1QNPA 3S46A 3I4EA 4M24A 5A6TC 2DH3A