2VFIA

Crystal structure of the plasmodium falciparum triosephosphate isomerase in the loop closed state with 3-phosphoglycerate bound at the active site and interface
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Characterization of Residue 96 Mutants of Plasmodium Falciparum Triosephosphate Isomerase: Active-Site Loop Conformation, Hydration and Identification of a Dimer-Interface Ligand-Binding Site.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
total genus 93
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2007-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vfiA00
3O06A 2Z1BA 5DBUA 1W5MA 4UMAA 5C2XA 1YTEA 2QAFA 1G7UA 2TPSA 2C3ZA 3KRSA 2YW4A 4NNAA 4O19A 2A1YA 2AGKA 2ISWA 3B0PA 2X1RA 3IGSA 3WJZA 2GVJA 3TDFA 4ZQCA 2YFNA 1F2JA 5E93A 5F1VA 2QUUA 2ABAA 1IXPA 3LHYA 2O7QA 4MKNA 3GVGA 1JCJA 4FNTA 4RKAA 5DY3A 1OABA 2YSWA 4CNNA 1P5BA 5DCBA 5TIMA 4O1CA 3QPYA 2QJIA 2DZTA 2Y89A 3TV8A 4MY1A 1DORA 3LLFA 5I3GA 1ME8A 4N4QA 3W2UA 3BG9A 3MYPA 4QM1A 1EWEA 1IF2A 3TK7A 4OU1A 4MVAA 1BWKA 3G24A 3TSMA 2C1HA 4BI6A 1H5YA 3PC0A 1DL3A 1KM0A 5D2YA 4E2DA 3MHUA 3P81A 1VHCA 3NPVA 3ZFHA 1WOAA 2V30A 3EKZA 3TFCA 3NQMA 5T26A 4GJ1A 4OWGA 4ZQOA 5KMYA 3S9YA 2CLKA 4JTUA 4UFLA 2A85A 3HBLA 3V75A 3NQ2A 4PODA 3GB6A 4M6VA 3NPUA 1GVOA 5DLCA 1W3TA 3SECA 1J4EA 1KFBA 3GDLA 3P8JA 5J5DA 1VHNA 3EX6A 3S6DA 4TMCA 3GIYA 4JR5A 3E12A 4NNBA 1FDYA 2NX1A 4PL1A 1TTJA 3CM4A 5IBXC 1SO6A 3W73A 4LWWA 1H7RA 4NQ1A 2VEIA 4WY0B 2HSAA 3GR7A 3EB2A 1TQJA 2FPVA 3W1PA 4C1KA 4CQAA 3KVLA 4OT7A 3C56A 2H3BA 3OVQA 5DXXA 2I14A 4L4MA 3DFTA 2XFWA 1W37A 3A22A 1QPOA 1RQEA 3N9SA 3LCHA 5HULA 5F2LA 1F6KA 1IXQA 2V2DA 4JD4A 5I3FA 2VFDA 3N73A 3NEVA 1QNVA 2PURA 1TV7A 3MI6A 3TW6A 3SY5A 1XC4A 4R53A 1EP1A 1TJRA 4OE7A 1W3IA 1VYRA 2QKFA 4HN4A 5E0KA 2A7PA 3PSVA 2QEZA 2E6YA 4ZZ9A 3LV5A 1TPWA 1G67A 1V5XA 2WNQA 1WX0A 3GKAA 3CEUA 5CZJA 3EWBX 4UTKA 1LOQA 3GR8A 5AN7A 1OYBA 5H91A 1ZAJA 2FTPA 2Y61A 2ZZ4A 4M7SA 1MXSA 1FWSA 4NJHA 4AHPA 1H50A 3O6DA 1N7KA 2B7PA 1BKSA 3NZRA 4FNUA 3UD6A 3UQNA 3U6WA 2OT1A 4GUFA 4Z1DA 1LYXA 4GFSA 3LOTA 1A5AA 1A50A 2EGZA 1TB3A 1FWTA 1YADA 4EWND 4QQ3A 5HUPA 3CTLA 1UCWA 3WK0A 4WOZA 2TSYA 1G4PA 3LHWA 3W71A 3LRLA 1KFKA 3WK1A 1DBTA 1Z48A 3BVJA 3CLMA 3M5VA 3W7EA 3LRMA 1JJKA 1GVSA 1R2TA 2P10A 3IEBA 4NJJA 4AEOA 3IVSA 1GEQA 1EUNA 1SW0A 2ZQ0A 1UUMA 1TV8A 3BV4A 2NUXA 3DKLA 3MHFA 1LRTA 3TFXA 4HNTA 4AAJA 2C14A 4GUJA 4O57A 5J5RA 5AOUA 4O17A 3QMRA 1YDVA 3LTSA 4KFNA 4DPQA 1FCQA 3PG9A 3HG5A 4CLMA 1K3UA 5L6UA 2ZZ5A 2RHGA 2EHHA 3B8DA 3W23A 3L21A 3MJYA 3DHFA 1K8ZA 3D0CA 3Q58A 5C5YA 5FESA 3C61A 3VE7A 1MEHA 3HPXA 4XBKA 4IQLA 2QR6A 5F1UA 3W76A 4UFKA 3W3OA 3KVMA 1K7XA 3L65A 2XN1A 2Q8LA 3LDVA 1JCLA 3M44A 3NPXA 3THAA 2X2GA 3LRKA 4TO8A 3STEA 4DF0A 3QPZA 2H8ZA 3CWOX 3NQ6A 5AHFA 1TPVA 3NYZA 1SZNA 3WK2A 3LXBA 2YR1A 4O12A 4DBEA 1DVJA 2RFGA 4A2RA 7TIMA 4BF9A 3CHVA 1H51A 1T0OA 3E0IA 3GLCA 4ZMGA 3HGJA 4MFEA 2G97A 3S1UA 2A0NA 2QJGA 5D04C 5MHBA 1QO2A 1FCVA 1ZAIA 4LVAA 1LLZA 3NL6A 2WNZA 4HNUA 1RZMA 3NOEA 3GXNA 2R8WA 2V5LA 1EP2A 2Q8ZA 1JCYA 1EUAA 3R5EA 5FF0A 4R33A 2F84A 1JUBA 4JGDA 3MI2A 3W1AA 4K7YA 3NQ7A 4LC8A 4HKPA 4FNQA 1F74A 1XKYA 3EX1A 4LRTA 1B4EA 3IIXA 3CB8A 4NX0A 1Q6QA 4JIQA 4N6FA 3QF0A 2ZRUA 3S1XA 3W7JA 2J6XA 4K37A 1MEWA 2V8ZA 3P82A 2ZDRA 3HJZA 1DQXA 3T44A 3AJXA 1ONRA 2ZRZA 4MYXA 3TROA 5LGXA 4HPXA 1ZNNA 2GOUA 3A21A 1X1ZA 3E96A 3WFAA 4JDBA 4Q4KA 1SPQA 3O6YX 4POCA 3CEPA 4O1DA 3B06A 3PBWA 3LLDA 2BSLA 1VLWA 4RLIA 1NF0A 4FNSA 3NL2A 4AF0B 1H7PA 3NQAA 4LC6A 1WA3A 3BGJA 1H7NA 5HWNA 4D2JA 3OVPA 5K9DA 3W7QA 4XKYB 2Y85A 4K38A 1OYCA 3KRUA 3KVKA 1YDOA 3EXSA 2PC4A 1OFRA 3KHJA 3IV3A 1OFPA 2CW6A 1YXDA 2WO5A 4IPIA 3E9AA 1CI1A 4O11A 4BI7A 2JK2A 4KFOA 5F2IA 3TAOA 2Y7EA 1UJPA 1FXQA 4AVFA 1F73A 1KV5A 5LGZA 2D73A 1D3HA 2XN0A 1H60A 3DU0A 2VKZG 2YX0A 3KXQA 3EWZA 4I7UA 3I7QA 1SO4A 5EY5A 2J9XA 2YGYA 5AC6A 3M6YA 3GYEA 3P61A 5K4XA 1JULA 3S5YA 4JX6A 4AH7A 1P0KA 2X16A 5D33A 1WDWA 1JUKA 1NF7A 1TIMA 5BW6A 3DENA 3MP4A 3W88A 1VCGA 3N19B 1DQWA 4AHOA 2VFGA 4K8HA 2YCEA 1X1OA 3R8RA 4EOUA 4FX7A 1PHWA 2JKEA 3CIWA 3EXRA 3M9YA 1KFEA 2A2IA 2V9DA 1KFCA 5D30A 1HG3A 3W7HA 1VJIA 3OHIA 3BG3A 4WD0A 5EPDA 2ZA2A 3TMQA 3MP3A 1H1ZA 2WPBA 5AFDA 4GUIA 4TX9A 4FIQA 1TPH1 1N55A 1NVMA 4AF0A 2RKXA 2QF7A 2R94A 3UY7A 1OJXA 2YXGA 1RQHA 3IVTA 5FI8A 5AHEA 1AW2A 4FNRA 4RXFA 3PY2A 2C6QA 4YL2A 4CCEA 4X3ZA 3BW4A 2CLHA 3PBYA 4B5NA 3NQDA 1KTCA 2NX9A 1DJNA 4Y6GA 2FPTA 5F4XA 3LERA 4TIMA 1GYNA 2Q3RA 4JTTA 2JKPA 4JY8A 4JYFA 3S5NA 2XN2A 1OFQA 5HINA 1H61A 4LRSA 3CQ0A 4N6EA 2WV8A 3FS2A 4K39A 1SQ7A 1L2UA 2NXIA 3HGSA 3P84A 2QCDA 4IMDA 3QQ0A 5CZSA 1WOBA 3W2MA 4E2BA 3MBDA 1PIIA 2J9YA 2ZRWA 1CW2A 3UZ5A 2QCEA 3N34A 1KBIA 2PRMA 2ZRXA 2JGQA 3HF3A 5BMXA 2E1DA 1FBAA 5D2WA 3O15A 2FJKA 1LCOA 2RDWA 5AC7A 4AXKA 3M43A 3T4CA 4P2VA 4GWEA 1H7OA 2WKJA 3TKFA 3S1WA 3CWNA 1VZWA 1K7EA 3EWUA 4QITA 5AB3A 3W1XA 4FB7A 1C8VA 2E5BA 5HR6A 3W85A 1KTBA 1Q6RA 3H53A 2X1UA 3KRZA 1AK5A 2DZPA 3GXPA 1FWNA 4GNJA 1XBZA 5D02A 3O8AA 2QDGA 4AWTA 1W1ZA 2ALDA 3AO0A 3IGUA 3S5ZA 2GJLA 5LNSA 4O15A 5K9XA 3UWVA 4DELA 3W1NA 3IGXA 1U5JA 3BK0A 3LBMA 4Z0SA 2I1OA 1XI3A 4UTHA 2PRHA 3G1FA 1I2OA 1ME9A 4JY9A 5G1TA 3W7OA 1TPDA 1DOSA 3G0SA 4JTIA 3LCLA 1CX9A 4AHQA 3B0UX 3PF3A 5D2VA 5LNWA 2VENA 1F76A 4ZQNA 4MZ1A 1RD5A 1YTKA 5EMUA 4X9SA 3G8EA 1LROA 4JXCA 5HWMA 3SW6A 1ZY9A 3C2VA 2EF9A 3STGA 4LUJA 4M7TA 1QPQA 1GVQA 2V2HA 4PFMA 1C9DA 1GPWA 3IIPA 1ZFJA 3VFLA 1AG1O 4UTIA 5KTLA 3LB0A 4XKYA 3W84A 3M5ZA 3DFOA 3L68A 3NGJA 3B4UA 6TIMA 1FDZA 3GDTA 1GTEA 5HMSA 4JTSA 4IX0A 3ABSA 1A5CA 3HPSA 4AMAA 5G1YA 4S1FA 2E6AA 4Z0JA 4MIMA 4AB4A 1S5VA 1SFJA 3C2FA 1IIHA 4NNCA 4JYDA 1Z41A 3TCEA 4K8EA 2HMCA 2FPYA 4YMZA 5G4EA 4DXVA 4ORMA 4PA8A 4S2CA 1THFD 1FY6A 3PM6A 3QW4B 3W2NA 3A9IA 3JRKA 1OK6A 2ZTJA 1ADOA 4M19A 3G0UA 1VRDA 3G3MA 2QJHA 4O53A 2C18A 1PL9A 4CCDA 2G96A 3TR2A 4OV4A 3YPIA 3L66A 1S5WA 3PUDA 4HT3A 4JN6A 5F4SA 3TH6A 2CFFA 5D38A 4DEFA 1DHPA 1R2RA 1H7XA 1XM3A 4UMCA 1RVGA 2B4GA 2Y7DA 1R30A 5KSWA 3FIGA 3LCFA 3W7MA 2X1TA 1JVNA 3NM1A 5BMWA 4E0CA 4OV9A 3PB2A 1LP6A 3ABQA 3G0XA 4ONVA 2ZA3A 3P5YA 3P67A 2E6FA 3KFTA 4O13A 1VGAA 3R2GA 3MBFA 4QJ1A 3NL3A 1TPC1 3R13A 2CLFA 5BNKA 4O0KA 3FYPA 3L0NA 3ZWTA 3STFA 1PHQA 4UTWC 4AWSA 4O4WA 4WY0F 4GE8A 1LLWA 1LZOA 4PL2A 1JRBA 1WYIA 5K7JA 1LOSA 4OBTA 2ZZ2A 3KOFA 1JCMP 5C6MA 4N2YA 3G22A 3WJWA 1SW7A 3GDKA 3GDMA 1KM3A 4HIBA 3QEZA 1K03A 3CIXA 2HTMA 4H6KA 5D2TA 3Q37A 3KX6A 3TA6A 1B57A 3PAJA 2OT0A 3PBVA 3QMSA 4HPJA 4N9EA 4RK8A 3O16A 3E49A 3DKJA 4MYAA 1LOLA 4UFHA 3SJ3A 1OG0A 2PRLA 2Y70A 4UR7A 4RJEA 2AAMA 3QJAA 3W7DA 1A53A 1TCDA 3W87A 3DFQA 2GQ8A 3I6RA 4EVZA 2FFCA 3O05A 3C2EA 1TPB1 2FIQA 1GG1A 3C2RA 4LS0A 4UTLA 3W7KA 3W74A 1FQ0A 3V1PA 3HOJA 3IIVA 1EWDA 1SSGA 3I65A 3G18A 1K8YA 4MY8A 1XDLA 4TU1A 2TYSA 2CZFA 2ZZ7A 3PBUA 3TC7A 2G95A 1M6JA 1TRDA 3LM7A 3BG5A 3M5XA 2Y88A 1WV2A 3L2IA 2I9EA 4IJBA 3L0GA 5D05A 5CPLA 5AHMA 1YPIA 4KWWA 3VE9A 1K02A 1VCFA 2GQAA 3LX9A 4MY9A 1UBSA 2B7OA 1G69A 4W9TA 4Y96A 1L6SA 2W6RA 3LBCA 4YCPA 2EAWA 2VFFA 3DAQA 1J2WA 3W1RA 2QCGA 2VXNA 4ZQPA 3NG3A 5KITA 3NXFA 2CLEA 2NUWA 2DJXA 1GQNA 1B9BA 1YXYA 3UWYA 3LXAA 1JQVA 4FF7A 1U83A 1TMHA 2BX7A 3OEXA 4CCCA 1PCWA 1OYAA 3IVUA 3GKFA 2WSYA 3TXVA 1TQXA 4QIUA 3TW7A 3MUXA 3VCRA 4C1LA 3ZWSA 5AHNA 1JQXA 3F4WA 3ZS4A 5A5WA 3MHGA 3G1AA 2ZZ6A 3NNTA 2ZYFA 2KZHA 4JTJA 4ML9A 3A23A 1LM1A 3G1DA 5CPOA 4XTIA 1H1YA 2IQTA 1GT8A 4BR1A 4HSNA 4ADTA 1VQTA 1WAUA 4HNNA 3W07A 5FF3A 3W7RA 4ORIA 2V81A 1IIGA 2ABBA 1QPNA 4MLJA 4DPPA 5HR7A 4MOZA 1AL7A 5DY2A 3TMLA 1KBJA 5EL1A 2E77A 3LCXA 3PR2A 2EKCA 3B0VC 2WOQA 2J9ZA 1E51A 3FKRA 2Y63A 1QOPA 1X6UA 4O28A 1LBLA 4MPQA 1W54A 5KZEA 2BXVA 1GG0A 3GAYA 4O18A 5GVJA 2A7RA 3LHVA 1XDMA 3N14A 2ZTKA 1SR9A 4XBSA 1EPXA 1QOQA 4DQWA 2OCZA 1KM4A 1QMLA 2V82A 1DKWA 2E09A 2YPIA 1G4EA 3NM3A 3U2OA 2AQWA 1NEYA 2NWRA 2JKAA 4E38A 4LVBA 2X30A 4IX2A 4GC4A 1RQBA 3HGOA 5DXYA 4FXSA 3VKJA 2HS8A 1Q6LA 1KA9F 3W1UA 1T8XA 4NXSA 2NXHA 2J27A 3W83A 5G2IA 3THQA 3G1SA 4L4LA 4I7VA 3W22A 1GOXA 4CQ9A 1MZHA 3LXCA 2O7SA 1S5TA 1ICPA 1O4UA 2GJNA 3L5LA 1Q3NA 1LRQA 4LV9A 1G7VA 6ALDA 4UFIA 3CPRA 4R7JA 3E02A 3C8FA 3TNOA 1WXJA 2ZFAA 2YDAA 3DXIA 3DFSA 5AHLA 4O50A 1B4KA 2WQPA 1I8JA 4XQ6A 3HG3A 3O1NA 3HG2A 2QCDB 5CPMA 3H54A 4LVDA 4LVGA 4BWLA 3W6YA 1Q6OA 2ZZ1A 4WXZA 4FNPA 2B7QA 4MUZA 2Z6JA 2FQIA 1SZGA 4U28A 3ZR4A 3NL5A 3W1QA 1OX4B 3GNNA 1VR6A 4WX2A 2OZ0A 3SFKA 3RMJA 1NSJA 3OIXA 3LGEA 4IMFA 1KM2A 4DBDA 4LS1A 2P1FA 4Y9AA 4JTEA 3UNDA 3IRDA 3G1VA 4UNKA 3EX2A 3NO5A 2VEMA 3HGRA 3M0ZA 1OFBA 2CLLA 1TPUA 1I45A 3HB9A 1XUZA 5I3KA 2GUUA 4LOCA 1JCXA 5FF4A 3O07A 3HIJA 4O14A 4O8RA 4JTGA 2B0MA 3L5MA 3JS3A 5AYXA 4Z1AA 1P1XA 4NZFA 4RZ6A 2GVGA 1TYGA 4LTSA 4GXMA 1SO5A 4JS3A 1ICQA 4IXHA 4MJZA 5LSMA 3DFPA 4Q33A 5DBTA 1QWGA 1Z42A 4LU0A 1LORA 4UTMA 1IXNA 3B05A 3T78A 4GBUA 5FF7A 3M1ZA 4U4MA 2EPHA 4RR4A 4QISA 4EF8A 5LNVA 3FJ6A 4GUGA 4A3UA 5HNRA 1KW1A 1OFAA 2W79A 3HG4A 1FUYA 4JYEA 4LVFA 4J9JA 1OFOA 1W0MA 3NDOA 5EKYA 4K7VA 1YXCA 3MI3A 1TTPA 1L6WA 5A8GA 1SO3A 5LZLA 4K36A 4UTJA 5F2MA 4YWIA 3TC6A 3S1VA 1IGSA 4BK9A 2BWGA 4ZQMA 3W7GA 3LI1A 3S42A 4G1KA 1ZALA 2WJZA 1OF8A 4UNLA 3NQ8A 1XL9A 5D09A 1H7WA 3C0JA 4P61A 2YW3A 5HQEA 1T99A 2X1SA 3OA3A 1TO3A 2A7NA 3FA5A 5TQLA 1EEPA 2DZSA 1W56A 1O94A 3PWAA 4OQVA 1H63A 3B04A 4QAIA 1JRCA 2VEPA 5CZTA 1GTHA 1TTQA 2PE4A 2QCHA 3RF9A 2GQ9A 3SI9A 3ELFA 3VI2A 3M47A 4R34A 2BTMA 4HNVA 4S2BA 3NQFA 5IBXA 5F4WA 4YXGA 5SWUA 1KFJA 3QW3A 4KWVA 3A5VA 3BPWA 1DJQA 5C55A 4HSOA 3I68A 1TRIA 1O95A 1W5QA 3C52A 1PS9A 4MZ8A 4N9CA 8TIMA 1ZCOA 3EX4A 4DO5A 1GWJA 2YYTA 1F5ZA 4JNMA 3UWQA 4FX8A 5CGQA 4ALDA 1AL8A 4A22A 3C3NA 3G3DA 3W72A 2CWNA 4IWWA 2G5WA 1M7PA 1JCNA 4PH6A 2CZDA 3ABRA 3MMTA 4GRSA 3A24A 3LTYA 1D3GA 1VYSX 2DZVA 3LI0A 1LTDA 1KTNA 3M16A 4UFJA 4YCOA 1EIXA 3GNDA 3R12A 1ALDA 4DO4A 1W3NA 4MJMA 2QDHA 1K7FA 5KZMA 2Y7GA 3EWXA 1W5OA 3MO7A 4QNEA 2V0TA 3UWUA 5KINA 1ZHAA 3STCA 2C19A 5K3VA 3F1QA 4O16A 3EX3A 4JX4A 4X2RA 4NU7A 4ADSA 3BO9A 1AW5A 5IM51 3NQEA 1VLIA 4PEKA 5FEZA 1G4TA 1ME7A 1TREA 1UUOA 2ATSA 3N2XA 5C54A 3U8GA 4FHAA 4IMCA 3LCGA 2W0UA 5I3JA 1O60A 1QDSA 4PTNA 3MYOA 3RFAA 4QSHA 1XFBA 1WQ5A 1YPFA 3BGGA 3W7CA 3UPWA 3GAKA 3Q2DA 2QCFA 4YLWA 1I2QA 4IMEA 3BLIA 1W5PA 4M5PA 3HPZA 3PVFA 1JUEA 2DZWA 1QO5A 3FEMA 5D03A 2GPTA 4XTDA 1VS1A 2VEKA 1OF6A 3CT7A 3O6CA 1HL2A 4JX5A 2WNNA 1HO1A 3UPBA 3NQVA 1V7YA 2ISVA 3G1HA 1FWRA 1XUUA 2V5BA 4TR9A 3INPA 3P74A 4IXXA 4K6AA 1L9WA 1X7FA 5HWJA 3BW2A 3W7PA 3L9CA 4RZ5A 3H55A 4Z1CA 5LKYA 1P0NA 1XBYA 2NXGA 5U4NA 1GVFA 1SUXA 2A5HA 4UTUA 5CSSA 1QPRA 4CNPA 3F4NA 4O54A 3A5FA 1H62A 3SZ8A 2NX3A 1C29A 4LV4A 1TV5A 3ANYA 5FEPA 3FKKA 4CQ8A 2V2CA 3PUEA 1F7BA 4MLRA 5DCDA 1LBMA 4JIPA 2VC6A 3GK0A 5FF2A 2LLEA 1O5KA 5EBUA 4IUOA 2YYUA 3MW7A 1B3OA 5LNRA 4N9DA 1UASA 4NJIA 4I9AA 4RXGA 5KZDA 4IMGA 4JTFA 3B03A 2JBMA 3QYQA 1SFLA 3TQ0A 1QR7A 2QUVA 5BRBA 3PUOA 1FX6A 5LHFA 2ZA1A 1OFEA 3W1LA 3DGRA 2H6RA 4H4IA 1WBJA 1KLYA 2H8XA 3W7NA 1KV8A 4UFMA 4N9BA 4OGZA 1Q45A 3KAOA 1MEIA 1XBVA 5LHEA 3TE9A 3IIZA 3NZ1A 1K8XA 3I7SA 2OMAA 1PVNA 1M5WA 3TIMA 3G8RA 2OX1A 3SGZA 4DF1A 4PC8A 1J5TA 3QFEA 4M6PA 3LCWA 5AC8A 3QM3A 1RPXA 3SSJA 3DBPA 1I4NA 1EB3A 1ML1A 3BW3A 5K4ZA 4IPJA 3P80A 4WQ6A 4Z1BA 1RV8A 1XBXA 3GXTA 1G6CA 1NAL1 1HFBA 1KM6A 3HMJG 2C0AA 2CLOA 1TPEA 2VFEA 1SW3A 3FLUA 3GX9A 3FYOA 2E68A 2VELA 4EF9A 2P0OA 3JR2A 1FCUA 2RH9A 1XXXA 4ADUA 4UTTC 4ZL1A 1WBHA 3L67A 2HS6A 4UCGA 3N2MA 3L0KA 2DZUA 2E5CA 1XCFA 2E6DA 2Y62A 3RNDA 3S8HA 2CLIA 4WY0A 3RK8A 1EP3A 1W5NA 2RDUA 2C16A 2RDTA 3TXZA 3W7IA 2A6NA 3M41A 4UMBA 4KKXA 3S5OA 3TUUA 1Z44A 3EEGA 1R47A 3WJXA 3RU6A 4WOQA 1ZAHA 1KFLA 4JDYA 3QSRA 2F7FA 4UTWA 3PSWA 3PB0A 2PCQA 1L6YA 2A4AA 4DO6A 4IOTA 2QCNA 1I2RA 2NV2A 3UYCA 4Z08A 2DZXA 4UTTA 1SU5A 3W2KA 1GYLA 3MWAA 4LS2A 4N4PA 1I2NA 4O1BA 5HJLA 3FOKA 2ZCGA 2YZRA 4JICA 5BOOA 2CZEA 2CU0A 1KM5A 3LHZA 3W75A 4UXDA 3TJXA 3UXDA 3DZ1A 3G1YA 1OFDA 1R46A 2WSRA 1AMKA 5AYZA 1HO4A 2FDSA 1SSDA 1T96A 4BI5A 1QCWA 3KVJA 3W7LA 3LHTA 3M5YA 1RR2A 2A21A 5CKSA 3UY8A 3W1MA 1SZFA 4LNYA 4XZ9A 3O63A 1Y0EA 1UB3A 5I3HA 2OJPA 4O4VA 1EA0A 5AHIA 4DF2A 3TU9A 4ZQRA 2QAPA 1YLVA 4NUWA 3N3MA 3I7RA 3SR7A 2Q3OA 2ZRVA 5G2WA 4FEZA 4MFDA 3QH2A 2VOMA 4WXYA 2QUTA 4JTHA 5K9CA 2NLIA 4XWUA 4M6QA 1N8FA 1OHLA 5F2GA 2GVLA 1YTDA 1R2SA 3BLFA 1S3HA 4IGHA 1FWWA 3P7YA 4NJKA 4NVTA 5ABTA 1AW1A 4NX5A 3W1TA 1FXPA 5D2XA 1TPFA 3N9RA 5FEXA 1VPXA 4Q32A 3C4UA 2R14A 1OX4A 2TRSA 3C2OA 2C15A 3LTPA 3RLUA 3DH7A 1NFBA 4XUGA 1KLZA 5I3IA 4I7WA 4A29A 3HQ1A 3NAVA 4GUHA 4MZYA 1P4CA 4LW7A 3GZ3A 1VH7A 1M7OA 1LDCA 4FO4A 1GZGA 3QRHA 2Z0IA 2DP3A 3QSTA 2YFOA 3LCIA 4O0ZA 2H3DA 3P8IA 4LY8A 4QNWA 3M7WA 3VNDA 4RV8A 2JGYA 1QAPA 3EWWA 5L9FA 2TMDA 5G2HA 3DFNA 5DELA 1IXOA 4NJGA 3TQVA 1MSSA 1OX5A 3TSDA 3DHDA 4A21A 4JEQA 4N02A 4FIRA 2H90A 4NZJA 3T7VA 4TMBA 3LV6A 1TTIA 1OVDA 3WJSA 3P60A 1VC4A 4RCXA 2Z6IA 1TJPA 5D37A 4X22A 2R91A 2BZNA 3BARA 4FX6M 1A5BA 3TSBA 3PG8A 1ZENA 2DU2A 1JR1A 1DV7A 3UZJA 3QC3A 4HHPA 2ZBTA 1HTIA 2WSQA 3UXAA 3IIOA 2J24A 1D9EA 3TQKA 1EX5A 3QMTA 4NXKA 4WUIA 4FXRA 1VCVA 3NQGA 4RZ4A 1I2PA 5DCEA 1PCKA 3GDRA 1PE1A 3W2JA 3Q94A 4CNOA 1W8SA 3NVTA 2CLMA 4Y90A 3NPWA 2ZRYA 3HO8A 1OX6A 3EWYA 3P62A 4UUIA 2Y7FA 3CC1A 3OG3A 2NV1A 5AYYA 3C6CA 3UWZA 1YDNA 3OVRA 2C13A 1A5SA 3MP5A 1PV8A 3ATYA 3WJYA 3W70A 1G4SA 2QCCA 3PS7A 1YYAA 3R89A 5TBOA 3RLVA 4RX0A 3PULA 3W9ZA 1LBFA 2FB3A 2VFHA 3LHUA 4Y8FA 1TSIA 1KM1A 2QCLA 5H2ZA 2NWSA 3NR0A 3QZEA 1X8FA 3DI1A 1OK4A 4WJEA 3ATZA 2E5DA 5HUOA 2VFIA 4NT0A 4LUIA 3WK3A 2B7NA 4ZVJA 4JTLA 1LRNA 5CZ0A 2A6LA 3CU2A 5K2ZA 2ATMA 3DI0A 3G1XA 2ZZ3A 3NQCA 5FEWA 3BLEA 3TJLA 5U7SA 5D32A 1MO0A 2FLIA 5G4WA 3ABOA 1FCBA 2QCMA 4EIVA 2J88A 5LNUA 1ZJIA 3TX9A 1GJPA 3SGUA 2DORA 4PCFA 3TAKA 1VYPX 3FFSA 1GVRA 2ISSA 3F03K 4BWLC 3W86A 3USBA 1HUVA 3OBKA 1QFEA 1ICSA 4OHQA 1O5XA 4O10A 2BLEA 4BFAA 3T55A 3NA8A 3EKLA 3T40A 4WZHA 5CG7A 3K30A 4AWUA 2FB2A 1BEUA 4UC5A 3S0CA 2NUYA 1SZEA 2UV8G 4LT9A 5G5IA 4UR8A 1F6PA 5EA9A 3FJLA 4JTKA 5DN1A 4UIOA 3W2LA 4ICNA 3UWWA 4A2SA 1FDJA 2NZLA 1W31A 5EYWA 3P5ZA 2CZ5A 5CPNA 4H3DA 3SIZA 2DJLA 4KFPA 3L5AA 1F05A 5CSRA 2Y6ZA 4O1AA 3QQ1A 3EXTA 4O52A 1BWLA 5E1QA 1BTMA 2Z2UA
chains in the Genus database with same CATH superfamily
3O06A 3KTXA 1T7LA 2QAFA 4DX3A 2TPSA 4PUWA 2CHRA 3AWOA 3WQGA 2JEPA 3FK4A 2X1RA 3WJZA 3BXWA 1XIFA 4XZLX 1CTNA 5M3WA 3R0DA 5CSUA 2ABAA 1JCJA 4FNTA 3K4AA 4RKAA 5DY3A 4KIEA 3RCNA 4O1CA 4EPBC 3QPYA 2GWGA 2DZTA 2Y89A 1FOBA 1EJTC 3LLFA 3BG9A 5DMMA 2UBPC 3UU0A 4GABA 3AUJA 3TK7A 3AROA 2A79A 3V36A 4M56A 2QJNA 3ZJ6A 3PC0A 1E9LA 1BXBA 3WUBA 1KM0A 4E2DA 4Q8NA 2PWEA 2V30A 3H7VA 3TFCA 4Y9PA 3MC5A 3HBLA 5H1WA 4AXNA 4CNUA 2Z26A 4C5ZA 5BOEA 3SECA 2OX4A 4O0QA 1VHNA 4MNMA 4M8UA 4JR5A 3E12A 5E70A 1E1FA 4V27A 1FDYA 2NX1A 4XZIA 1TTJA 1US2A 1V3MA 4R7WA 3QC0A 1H7RA 2VEIA 4LEQA 5DANA 4EACA 2WVSA 3GR7A 5IHRA 4HVXA 1TQJA 3CHDA 3KVLA 4OT7A 4ES4A 2H3BA 3B0YA 3EDDA 1QOXA 2D69A 5AKQA 1ISWA 2PDGA 3WDPP 1IWBA 5HULA 1S1RA 1ODUA 3V1HA 4JD4A 5I3FA 2VFDA 3DC0A 1TV7A 5FIPA 3MI6A 4C90A 1A5UA 4FI4A 1XLMA 2E25A 1T6MA 3PUGA 1YRRA 1A49A 4LB4A 2A7PA 2ASHA 3E5PA 4F0KA 4ZZ9A 4GY1A 3LV5A 2VO5A 1V5XA 3CQKA 3CQHA 1MW1A 1J5SA 2I56A 1QK2A 4KS0A 2FTPA 3RCMA 1HXJA 3QZ6A 4HZ7A 4AU0A 3B8UA 4AHPA 1X7IA 4RE2A 1KC7A 1NELA 1QNOA 1A5AA 2QUNA 3UVAA 4ACYA 4V1XA 1YADA 2PU1A 4QQ3A 2OELA 1IZKA 3N2TA 3LRLA 3PTQA 3BVJA 2RUSA 3WQPA 4JZ5A 3M5VA 1JJKA 3LRMA 3WLHA 4AEOA 1GEQA 1BSLA 1EUNA 1SW0A 5TF0A 3BV4A 1FTXA 3DHUA 7CGTA 3MHFA 3TFXA 4GUJA 4QE1A 1DXEA 2YL5A 4O57A 3GO2A 5BROA 2SFPA 5AOUA 3JW7A 1J96A 4GZEA 5MKGB 2V3GA 4DJDC 3B8DA 3MV11 3D0CA 3Q58A 3GVRA 1M65A 3C61A 3VE7A 1W1A1 1XP3A 3W81A 5AZ0A 4XBKA 1OY0A 2PLMA 5F1UA 2QR6A 2A3HA 4FP1A 5DEZA 2Q8LA 3KBSA 1UKTA 3LDVA 3V18A 4DJFC 4RDZA 3THAA 3I4EA 2X2GA 3XINA 3QPZA 1H49A 1JAEA 3U0HA 2FVMA 1SZNA 3SURA 3GQYA 2Z27A 4JTRA 4A2RA 7TIMA 1VFLA 4H9UA 2OZTA 2PDHA 3CASA 3QOMA 3CHVA 3GLCA 3RX3A 4F2TA 1XKJA 4NI8A 5D4YA 1XGZA 5HOSA 5M03A 4L80A 1JGIA 2WNZA 4HNUA 1RZMA 3NOEA 2R8WA 1EP2A 1JCYA 1EUAA 1X98A 2ZUMA 6XIMA 2A3AA 5JH1A 3MI2A 3NQ7A 3ANVA 2GL5A 3ISIX 4LRTA 4QDMA 3H2EA 3AHYA 3S47A 3VZYA 3SO7A 4MGGA 1Q6QA 1UQZA 3EMQA 2PP3A 4QE4A 3S1XA 1NOFA 4DRSA 2J6XA 4K37A 1K6AA 4RDWA 3HJZA 4MADA 3FAXA 3TLQA 4U3AA 1GEHA 2PDQA 1FWHC 2GOUA 3A21A 1X1ZA 5J8LA 3WFAA 4JDBA 4POCA 3W25A 8CGTA 4JN8A 1WP6A 2REQB 4DBWA 2JQXA 4J5NA 2OODA 1UP3A 1VLWA 3SEPA 5A6JA 5CJ5A 1OD8A 4HZ6A 2YB1A 3AC0A 1KO0A 3UR7A 1IEQA 4B92A 5M5DA 3WO8A 3VD5A 1R8LA 4GXWA 5HWNA 1FWCC 3WLQA 1YDOA 2VQTA 2GGHA 1DE6A 4W84A 4YNGA 3SUUA 1UD8A 2VZTA 3WLMA 3W53A 1NTHA 9CGTA 3E9AA 4CD5A 1MUWA 1EFZA 2PDWA 3WEMA 2F6UA 1LL6A 5A8PA 1MXDA 1FHVA 1D3HA 1GVIA 5ENLA 1J0JA 3DU0A 1F9CA 5A8OA 2P8CA 4WF7A 3CK5A 4C6PA 3EAUA 2FMOA 3I7QA 4QLLA 3GYEA 3P61A 3S5YA 3P6LA 3RIKA 5C9UA 4M80A 2IPGA 2EG6A 5D33A 1NF7A 2POZA 4Q4RA 3VD7A 1S3TC 2DSKA 1X1OA 4JTDA 3R8RA 4EOUA 2JKEA 3CIWA 3MUIA 4DUWA 3M9YA 4IFRA 5A6BD 2V9DA 2ZADA 1KFCA 1MQRA 3B8TA 4GX9A 4WEVX 1HG3A 3MCOA 3OHIA 1PZ2A 3PZVA 4WD0A 2WLYA 3MP3A 1XGEA 4E8CA 3CZLA 3I6TA 1OGSA 5ABGA 1HX0A 3FV9A 4FIQA 1NVMA 4AF0A 2QF7A 2PDMA 3RRAA 4MNLA 4KEVA 4BF5A 4BKNA 3ALGA 1YE4A 4AD3A 4Y2WA 3NQDA 1ZJHA 2CEQA 5DFAA 1DJNA 5F4XA 1GYNA 4FPSA 2JKPA 1BHGA 1VIZA 2EXOA 2WV8A 4Q8TA 4GYPA 2Q71A 1SQ7A 3UJ2A 4XKMA 4KRTA 1C91A 2HXTA 1H3GA 3P84A 4KESA 2A3CA 3FHAA 3QQ0A 4E6MA 4DI9A 1SMDA 3EDEA 4Q8VA 1UPPA 3F5LA 3U9IA 1M68A 2QDEA 3BMWA 1E71M 3HM7A 3FDKA 2ZRXA 2JGQA 3HF3A 3T0AA 3CL7A 2E1DA 2OO0A 4D6JA 2FJKA 4AZGA 3W02A 1MWOA 1V6TA 4AXKA 1EJXC 1FWIC 1AQ0A 3V5OA 5B7ZA 4KF1A 4GWEA 1MQPA 1H09A 1EYWA 4GZJA 2OOFA 1KCKA 4K68A 5AB3A 3BJTA 3SUVA 3OZMA 2ZIDA 1Z8AA 1Q6RA 3OU8A 1FWJC 3H53A 3BAXA 3KRZA 2DZPA 1XYMA 1FWNA 1XG3A 4RDYA 2ALDA 3AO0A 1IZJA 4O15A 4CEXC 1RA5A 3LBMA 2ZWYA 2OEKA 3A4WA 1XI3A 5JBFA 3VDBA 1PDZA 4UTHA 1KR1A 2PRHA 4BF7A 5G1TA 3NEHA 4MUPA 3G0SA 2PI6A 3PF3A 1F76A 2DEPA 3W00A 3WLRA 1VKFA 3L4YA 1K6WA 5HWMA 3SCUA 1ZY9A 3C2VA 2EF9A 3OGSA 3ERPA 1PTAA 3TWBA 1GVQA 2OFJA 1R3WA 2FZNA 1OG6A 4WDWA 5KTLA 1HJXA 1UWTA 3LB0A 4KEMA 3IACA 3WIJA 3L68A 2PBGA 4HZMA 3L4TA 1UOKA 5HMSA 4G9PA 1FWAC 4QCFA 2PEVA 3ABSA 1A5CA 4DWSA 2JFEX 4S1FA 2E6AA 4EX4A 2A3EA 4AB4A 2IQ0A 1SFJA 4JFWA 1J10A 4K8EA 1UW9A 2FPYA 4YMZA 4A8RA 4DXVA 3GSMA 1QI5A 3VNIA 1THFD 1ISVA 4GMEA 3BOFA 2ADAA 1C92A 3W2NA 1NFGA 3A9IA 1OK6A 2ZTJA 3G0UA 1VRDA 4JNYA 4XZBA 5E0CA 1EC8A 3K5XA 1MRAA 4CCDA 3AFBA 4DLMA 1S5WA 4FLSA 1WZLA 3F2CA 2Y7DA 1R30A 5KSWA 3JUGA 4CNTA 4S3DA 4W8AA 5BMWA 1Z9AA 4OV9A 2E40A 4ICCX 5DT7A 2ZA3A 1W3KA 4AZCB 1EXPA 1KRBC 4H7VA 1FHUA 5BNKA 3FYPA 4ZB0A 3L0NA 3STFA 4UTWC 4AZIA 3VIKA 1V3JA 4PL2A 1VFSA 2ZC8A 1EHAA 4OBTA 1JCMP 2WXDM 1TX0A 1SW7A 3GDMA 4HIBA 3QEZA 3HU7A 1JD7A 3VA8A 1BPLB 4H6KA 4B5SA 3Q37A 1QI2A 4LGXA 1X1NA 4A35A 2AAAA 4NILA 1ECEA 3TYUA 1M7JA 2ISDA 3UYIA 3AICA 1ODZA 4N9EA 1PB0A 2D3NA 3DKJA 3GIQA 1MXGA 4RJEA 2J77A 2XHYA 2AAMA 1AZ1A 2PDUA 5CXPA 5I07A 1TCDA 1AH3A 3W87A 5GNZA 3GHSA 1TPB1 2OSXA 1TX2A 3MT1A 3W74A 2D0HA 2BVWA 5GNXA 1JPMA 2ZVRA 1CB2A 2TYSA 1AQHA 3PBUA 2QGYA 1YNQA 1LG1A 4V33A 1WV2A 2DW7A 1WXZA 2VGBA 2W61A 2WQDA 3G6MA 3USZA 4KWWA 3VE9A 1VCFA 3LX9A 1EIBA 4KWSA 4W9TA 1L6SA 1IT0A 3EKGA 2WANA 1V6WA 1BLIA 1HGWA 3KBVA 3W1RA 1T8QA 5HJXA 1CGVA 1QBBA 2CLEA 4H2CA 1GQNA 1KXQA 2VZVA 1JQVA 3OBAA 3WQVA 3MA8A 1TMHA 4FOKA 3TN6A 2D22A 3NO3A 1XH2A 2PS2A 3MUXA 3HURA 3ZWSA 3EEZA 1JQXA 1DJWA 5A5WA 2ZZ6A 3AS1A 4YTQA 4D6EA 3G1DA 1W3LA 1KQYA 2IQTA 1GT8A 4IF2A 1DHKA 4HNNA 5MKGA 4GH1A 3W7RA 3PZMA 1EJSC 2V81A 1IIGA 1ZUAX 1M1BA 4W87A 2Z1SA 4MOZA 3RLGA 4BQ5A 1VFTA 1AL7A 5EL1A 2WBGA 1K9FA 2E77A 3LCXA 2EKCA 3B0VC 3OO2A 3KCOA 3UNTA 1LBLA 4MPQA 4LJ3A 5HPCA 1W54A 1KKRA 2XIOA 4HMEA 3UA4A 5GVJA 3GE7A 2V5JA 1TWZA 2AL2A 3LHVA 1DQUA 3N14A 2ZTKA 4JL2A 4QS5A 5M1TA 4FR1A 2GVYA 2CBIA 1W1PA 2YPIA 1ZZMA 2AQWA 1NEYA 2IPJA 2JKAA 4E38A 4XD3A 1E0UA 4IQDA 3QQWA 2VURA 3OBEA 3VKJA 4LF1A 2NXHA 3W83A 5G2IA 3THQA 3W22A 2X8RA 4I3GA 3LXCA 2O7SA 4F9JA 1S5TA 4B4FA 4B9YA 6ALDA 4XZMX 4UFIA 4C6LA 1T5AA 3CH0A 3OLDA 4R7JA 4LAOA 3C8FA 2VD8A 3BLPX 2ZFAA 2V68A 1PBGA 3DFSA 2PLJA 3PJXA 2BB0A 9XIAA 1V3KA 3HG3A 3O1NA 3B40A 4KCUA 4LVDA 4LVGA 5EMMA 1TUFA 2VR5A 3FN9A 3ZR6A 2FQIA 1FVPA 2BGSA 1BYBA 1S2WA 1SZGA 4Z2GA 2X0SA 4U28A 4UQBA 3W1QA 1SFSA 1CLKA 4HU0A 1Y5XA 4MG4A 3E1F1 2C7FA 2P1FA 1SJBA 2YXOA 4Y9AA 5ECVA 2WMGA 3UNDA 1DJIA 4NP7A 1S2AA 3IRDA 3DG6A 4B91A 1MW3A 2VEMA 1OWQA 3HV9A 3WENA 4MHBA 4G7EB 1I45A 2GUUA 5ABEA 1JCXA 4GGHA 3A3HA 4O8RA 3GTHA 4NZFA 5C71A 4HCDA 2J13A 5DRCA 4JS3A 4EP8C 1KBKA 2E28A 4DI8A 6XIAA 4JL1A 3IANA 1IEIA 1QWGA 3H4GA 2ZUVA 3KDNA 2ACUA 4LPCA 1LORA 4P7LA 1HKKA 3PPFA 3IK4A 1ONWA 3R58A 4C6CA 3M1ZA 2AKMA 4JNZA 1G0CA 1SYTA 4RR4A 3OLEA 3AYTA 3KBWA 3OGVA 4HTBA 1UZHA 1ESWA 1YNYA 4J3UA 3FW6A 4UQAA 1FUYA 2ZDSA 3EOOA 3UETA 1IYXA 2ZOXA 3NDOA 3MI3A 2WCAA 1TTPA 5LA2A 5LZLA 1SO3A 4UTJA 2XVPA 4DM2A 4YWIA 2J8GA 1A47A 3TC6A 2GUYA 3BICA 6TAAA 1BGGA 3W7GA 3GVVA 2VCBA 5D09A 4JIEA 1H7WA 1QI3A 3LPGA 2X1SA 1V03A 5JBDA 1OGBA 2MANA 4GVFA 1GTHA 3C0SA 4S3FA 3H2NA 1DJGA 2GQ9A 3VI2A 3M47A 4D6CA 2BTMA 3ZLFA 5IBXA 2O9RA 5F4WA 1Z3NA 4IZGA 5SWUA 4HBKA 2OTDA 3HZ3A 1TA3B 5FKYA 1CXEA 1RJRA 3OYZA 3ITYA 3BPWA 1IHIA 4PRTA 3U7VA 3WELA 3OVGA 3I68A 3WF2A 3V35A 1EH9A 1PS9A 4J2MA 4MZ8A 4N9CA 1MDRA 1F5ZA 4FX8A 4RUBA 2ZUNA 3CL8A 3DX5A 2UY5A 4A22A 3C3NA 3G3DA 3SRFA 3SN1A 3VZZA 1RHCA 2O55A 3ABRA 5D9OA 3K4DA 2DQXA 1RH9A 2WM0A 1VYSX 4LSBA 4LBSA 1KTNA 2OO6A 2E67A 3R12A 3PN8A 5CPTA 4NRSA 3BSMA 4Z2KA 2IKJA 1EBHA 3VTRA 2G3IA 3KCJA 1ZHAA 2PDKA 5K3VA 1GQJA 4JX4A 4JAWA 4E8DA 4C1NB 3KLLA 2PLKA 1DIOA 4GH3A 4G7EA 3Q67A 1ME7A 1TREA 3LCGA 5I3JA 1QDSA 4AD0A 4GYPC 4QSHA 3F2DA 3T8QA 3AIQA 4CEUC 2PC8A 1R3YA 3W6MA 3IJ7A 1YPFA 3UPWA 3GAKA 1EJUC 4YLWA 1I2QA 4EPEC 4M5PA 1JUEA 2DZWA 3CZKA 2PZ0A 4Q4QA 1VS1A 1CGXA 2WNNA 2DIJA 3UPBA 4FLQA 1M01A 1Q7MA 1XUUA 4TR9A 3INPA 1H0GA 4IXXA 1X7FA 3BW2A 1XICA 4P8UA 4GI8A 3EMCA 4EKJA 1XBYA 3JZUA 5U4NA 3ZIZA 1SUXA 4GNVA 3SJNA 3WFLA 3O9NA 2VUYA 4O54A 3PHAA 3LZ3A 3QV7A 3RJXA 1TV5A 5CSYA 4FAMA 1XLDA 3ANYA 3FKKA 1F7BA 4CVUA 4MLRA 2V3DA 3GK0A 2Y8VA 1A5MC 2XPKA 4US5D 3ITVA 4IL0A 4AEFA 2Q02A 3SRKA 2Y1HA 5EBUA 4ZTXA 3MW7A 1UASA 4UNIA 5HANA 5FSDC 3QYQA 4AZBA 1QR7A 2E8YA 1FX6A 1JAKA 3W1LA 3DGRA 1KLYA 2GGJA 4NZ1A 4QAWA 4C6NA 3NGFA 4DXKA 5CGTA 1EX1A 2L5HA 4OGZA 3PBGA 4N0RA 3SGGA 3W01A 4OIFA 4LNCA 3TE9A 3NZ1A 3ARUA 3EWCA 5B7YA 2OQLA 1J93A 3TOPA 2CWXA 3T0BA 3WNPA 3TIMA 2IXVA 3OTRA 3SRDA 2Y0FA 2Z1XA 1J5TA 5FL0A 2F2HA 4HHLA 3V4BA 1U1UA 3LCWA 1GGOA 1JL8A 4UR9A 1Q66A 3SSJA 1R86A 4JHOA 1ML1A 1EB3A 1FFQA 4M6UA 1X96A 3BW3A 4ZE5A 5K4ZA 4WQ6A 4S39A 4PTXA 3GXTA 3U4FA 1JFXA 1HFBA 3MKKA 3HMJG 4CQBA 3MKVA 4PGLA 1VFUA 2CLOA 2PDXA 3OQ8A 3H21A 1BTCA 3FYOA 4S3GA 3QR0A 4EF9A 4J3WA 2PDBA 1IT8A 3M0VA 4HPNA 1TKKA 2WKLA 4L4OA 1OCNA 3GS6A 2HS6A 4UCGA 2DZUA 2E5CA 1XCFA 1JDFA 1WKYA 2C16A 3K8MA 4KKXA 3A4JA 5REQB 3RMEA 3WJXA 3RU6A 1KFLA 1QHZA 2HXUA 3QSRA 4JDYA 2A4AA 3EOEA 5FL1A 4L9ZA 1QTWA 4FF5A 2IKHA 2DZXA 4UTTA 1PX4A 1SU5A 4ZOCA 3W2KA 1GYLA 4N4PA 4HOZA 1I2NA 3BH4A 2VCAA 3UR8A 4WHBA 3SIMA 3IAQA 3GXDA 3OB8A 2WYSA 3LHZA 4UXDA 3W75A 1ITQA 2Z4GA 2BY2A 1QW8A 2NV9A 4XBJA 1GNXA 2VQUA 3BC9A 4DIAA 1HO4A 2FDSA 3VOHA 1SSDA 5CJMA 4XG1A 3EDJA 2GFTA 3WD2A 3AXKA 3UERA 4F79A 5CKSA 2WZHA 3ONCA 3W1MA 4YN5A 1SZFA 4NAEB 4LNYA 4XZ9A 4AW7A 3PP7A 1VBRA 2OJPA 4HQVA 1R3VA 5G2WA 3QH2A 2QUTA 1RCQA 2AL1A 2ZX8A 3R10A 4I6KA 1OHLA 2F38A 5IHSA 1NDYA 2BOGX 4IG2A 2GVLA 1R2SA 1OZMA 3T0TA 4QE5A 4IGHA 3U5UA 1AW1A 1JCTA 1FXPA 4G8TA 3GNOA 1UR8A 5FEXA 3C4UA 3FJ4A 2TRSA 4LUTA 2YCLA 2GOKA 2C15A 3LTPA 4DAIA 3RLUA 3MSRA 1TUXA 1TZ9A 4AIEA 2EPOA 3LLXA 1UIPA 4I7WA 1TJ0A 3GFXA 1R9YA 1UC5A 1FKXA 1P0BA 5CC3A 1M7OA 3QRHA 2DP3A 2XFYA 5HXMA 3S9ZA 4XB3A 4FALA 3WUEA 3R1ZA 3ORWA 1HJSA 3P8IA 3UPMA 4QNWA 3WMSA 4ROPA 4QDPA 3QTGA 3WQCA 1UWSA 2HNHA 4RV8A 2PDLA 2JGYA 1QAPA 3TNBA 1Q63A 4IIEA 4XISA 1OX5A 3DHDA 4JEQA 2Z1VA 3ZQ9A 1CGWA 4FIRA 2EBNA 3AISA 4OVXA 1OD0A 3GYCA 4B3KA 1HT6A 1VC4A 1X8CA 5BOFA 4PEEA 1W2PA 4TVCA 3WEZA 3E5BA 4X22A 1U2YA 3NWRA 3BARA 1A5BA 3TSBA 1ZENA 3HQNA 1DV7A 4Z2JA 3WF3A 1XPYA 2ZBTA 2OGJA 3ANUA 3IIOA 1YBQB 1D9EA 3PNZA 1EX5A 2IS7A 2OYLA 4HA3A 4FXRA 3P3BA 1I2PA 1DXIA 4HA4A 1PCKA 2WWCA 3GDRA 2XSAA 3TYAA 4AY7A 1W8SA 1A0DA 3CH9A 3RPDA 2EG7A 4UUIA 1S2TA 3OG3A 1TWIA 3C6CA 1MNZA 3UWZA 1KR0A 2J8TA 1GPFA 3WJYA 3W70A 3B97A 3ZZ1A 3PS7A 1XRFA 3RLVA 1ADDA 3VNLA 2P3EA 2DT0A 2FB3A 3VGGA 1TSIA 1KM1A 2QCLA 4C6BA 1QNRA 3CGTA 1X8FA 2HRWA 1OK4A 4WJEA 1VB9A 6PTDA 4RE0A 1E6ZA 1E3XA 5GJNA 4NT0A 2B7NA 4ZVJA 1BF6A 4GQRA 2DW6A 2A6LA 2VVSA 5K2ZA 2ATMA 3DI0A 1PEZA 3NQCA 4AYGA 2J66A 1VPQA 4IUGA 5D32A 3OP2A 3WMLA 4IIHA 4C5YA 5LNUA 1O68A 3F4DA 1K9TA 1XFCA 3SY8A 4ACZA 4H00A 2DORA 3OZPA 1UG6A 5ABFB 3LG3A 2B81A 3RR4A 2Z25A 1MVYA 3WKZA 3VXGA 3FFSA 5FJOA 1VEMA 4BWLC 3W86A 3USBA 1HUVA 3OBKA 1EC7A 3AIUA 3GU9A 2QLYA 2Y4SA 3VDAA 1FH8A 3EKLA 3T40A 4QJ5B 5CG7A 2PODA 2KAUC 3K30A 3KE0A 4UC5A 2J6VA 3S0CA 2NUYA 1SZEA 1NIUA 4LT9A 4E4FA 5G5IA 4UR8A 5IFTA 4JTKA 2VC5A 4ICNA 3UWWA 3O0FA 4A2SA 4HNCA 3ES8A 3QBUA 1HVXA 5EYWA 1EOMA 3ID7A 1KCZA 2VGGA 1YIXA 3ITOA 3FSUA 1RA0A 4HHHA 4O52A 1B3WA 1RPKA 2XDFA 1BTMA 2X0HA 1W5MA 3WYZA 3PAOA 3T6CA 4NNAA 3R8HA 2A1YA 2AGKA 4LXFA 2ISWA 3B0PA 3RM9A 2X41A 4ZQCA 2YIHA 3ARZA 3RU8X 5E93A 2DQWA 4BEQA 3RO6A 2O7QA 1EQPA 3GVGA 2YSWA 3GH4A 5DCBA 2VCCA 5TIMA 2QJJA 4JFSA 1UKQA 2PAJA 4B4HA 2VEFA 4N4QA 4H7ZA 3MYPA 1VBJA 1IF2A 4MVAA 4BQ3A 1Q6EA 1IEWA 2QXWA 2PDJA 4ZENA 1H5YA 3E0WA 1OBAA 5A2BA 1VHCA 3ZFHA 3WFZA 3NQMA 1ZQ5A 1XJBA 4GJ1A 2WCSA 4OWGA 1CGTA 2PP1A 4ROQA 4JTUA 1XISA 3AXHA 4M6VA 5EMJA 5DLCA 3KW3A 3GDLA 3P8JA 2HISA 1ISZA 3EX6A 3QTPA 4NNBA 4Z2HA 5REQA 4WKHA 3W73A 4LWWA 4P8WA 3ITTA 2OSYA 2G4JA 3V16A 1Q2SA 4CQAA 3I10A 4M82A 2OQYA 2DIKA 4L4MA 2OZ8A 3DFTA 1W37A 3A22A 3BUVA 1RQEA 3G2GA 3NEVA 4W93A 2PURA 3SY5A 2G8ZA 1JXJA 2DV0A 1XC4A 1PSCA 1EP1A 1TJRA 4OE7A 1W3IA 1VYRA 4HN4A 5E0KA 3BMVA 4L1GA 1TPWA 5DF0A 4GO8A 3OOQA 2XTKA 1C8YA 2XIQA 2W4XA 1WX0A 4JHZA 1KFWA 4UTKA 1LOQA 1KBLA 3BJFA 5FSEC 5AN7A 1OYBA 2G3MA 5H91A 4M7SA 1V8EA 3ARYA 4XAYA 4NJHA 2Q8XA 1UHVA 1H50A 2B7PA 3O6DA 1BKSA 3BDKA 4CN1A 1PO9A 3UD6A 2EPNA 3UQNA 2YZ5A 2OT1A 3T05A 4GUFA 1C8XA 1A50A 2CBUA 4M24A 5HUPA 4R3UA 2TSYA 4L1WA 4LAUA 1UWAA 3SCWA 4AVOA 3H2MA 3WK1A 1Z48A 3W7EA 2X42A 4NJJA 4QG8A 3WDRA 4DJDA 2VNCA 2ZQ0A 1BG4A 2D23A 3T9PA 1LRTA 3WUFA 4HNTA 2HVNA 2X7WA 2EPKX 2UWFA 2XIIA 5J5RA 5A6MA 1SVDA 4NIRA 4O17A 2OEJA 1OZQA 4KFNA 4DJFA 2PLCA 4L7ZA 3L21A 1RBOB 3DHFA 3MU7A 1W3JA 5MF5A 3THUA 4PUJA 3SCRA 4CNSA 4ZTYA 2FZBA 5FJIA 3VIFA 1OEPA 4IQLA 3SB0A 3GWQA 1RSCA 1SFTA 1K7XA 2CBVA 4D8LA 1R5YA 1F8MA 1WDDA 1E43A 3M44A 5D8ZA 1XSKA 3AXIA 5LA0A 4LCRA 1EBGA 5CG0A 1EA9C 1W1TA 4GQ0A 1H5VA 3WK2A 4KRZA 1FRBA 4DBEA 1NOUA 1DVJA 1V6UA 4MNJA 3OG2A 2XFRA 8XIMA 1T0OA 3E0IA 4ZMGA 4MFEA 2GSEA 3CUHA 3S1UA 3ARRA 2ZXBA 1ZAIA 3KWSA 4LANA 5HPOA 1KXVA 1ZBVA 4E8GA 2GQ3A 4CN4A 4EE9A 2F84A 5IXEA 2CESA 4ZXOA 1JUBA 4A8NA 4LC8A 4HKPA 4FNQA 4P7OA 3CB8A 1V3LA 4NX0A 3WX7A 4JIQA 3QF0A 4DVOA 1M53A 3W7JA 1DIEA 1FWBC 2V8ZA 3P82A 2ZDRA 2W9MA 1DQXA 3NZGA 5BRPA 2MUCA 4MYXA 3S6OA 5LGXA 2PDIA 1ZNNA 1YE6A 1G01A 2QVHA 3E96A 4HK6A 4DYEA 3CEPA 3GXIA 1JPHA 3KDOA 4QP0A 4IIBA 3V3WA 1RUSA 2BSLA 5LYRA 5JQ9A 4FNSA 4ZSTA 1SJCA 4AF0B 1H7PA 2JIEA 4PB4A 1WA3A 4H6RA 4EK7A 3B9OA 3QHNA 1EZWA 3OVPA 4XKYB 2Y85A 3KVKA 2PC4A 1IQ8A 3IV3A 1OFPA 5BXSA 1QHOA 1IV8A 3VCCA 2FZMA 5I79A 3EA2A 2BOFX 2Y7EA 3CHCA 4U5IA 2VOTA 3UCCA 4AVFA 4IIDA 3VIOA 1H60A 2XM1A 2YX0A 3KXQA 3EWZA 2PTZA 4I7UA 1SO4A 2J9XA 2YGYA 4WKFA 1L0PA 2VDGA 1WUEA 4LX4A 1P0KA 1TVPA 2X16A 4F0SA 3KBJA 1TIMA 1XV8A 4LUSA 4H2HA 4PB3A 5A69A 3DENA 1VCGA 1DQWA 1Q7QA 4AHOA 2VFGA 4AUBA 1XR2A 2YCEA 4BJHA 1RK5A 2CETA 4CGTA 2H9AB 2QUMA 4HOXA 2Z7GA 1PHWA 2PD5A 4C65A 4GJIA 3EXRA 2V5KA 3W38A 3GIPA 1W2VA 2F9RA 5D30A 2YJQA 3KP0A 3W7HA 2X09A 2WMIA 2GJXB 4D72A 3BG3A 5EPDA 2I5GA 1J11A 2WPBA 5AFDA 3D6NA 4GUIA 3R94A 3S5SA 4TX9A 1GW1A 2NVCA 1OGGA 4HU4A 3UY7A 3KL3A 1DTNA 3IVTA 5FI8A 2DZAA 5AHEA 1J0ZA 3MZ2A 2OKTA 3VAVA 1F6YA 4R9XA 3QOKA 4XK2A 3ABXA 7REQA 2CLHA 4B5NA 2OGYA 3AZTA 1KTCA 5A1AA 2AOSA 1H11A 4PB5A 3VIMA 2FPTA 3VNJA 2Q3RA 4GVHA 1OFQA 1H61A 2OEMA 4LRSA 1W3HA 4N6EA 2AKZA 2CYGA 3NDYA 4K39A 5BYWA 4A05A 1L2UA 3DHPA 5HNUA 2JALA 3HGSA 3IUIA 1JG9A 3SCQA 1B3VA 4R5EA 5F7UA 5CZSA 1J6OA 3CIVA 1C3FA 1WOBA 3W2MA 1UR4A 4E2BA 4B5UA 2CNCA 4NF7A 2ZRWA 5HMDA 1UMLA 5BMXA 4NYYA 1FBAA 1EJVC 5CZKA 2QS8A 4MAVA 3MVIA 3M43A 3ITXA 3S1WA 1A4MA 1K7EA 2PTYA 4KETA 4FB7A 1C8VA 2UY3A 5JBEA 3LGDA 3W85A 1PWMA 4HMCA 4GG9A 3GXPA 3TR9A 3VMNA 2IUZA 3E3HA 4AWTA 2QDGA 4Z42C 2OLAA 4XX6A 2I57A 3WF0A 5LNSA 3UWVA 1GK8A 4V1YA 3BAIA 1U5JA 4MDOA 2G41A 3K1DA 1K9DA 4AZ6A 4ZXLA 1ME9A 1MFVA 1DOSA 1FFRA 3LCLA 2Z28A 1UR0A 2W66A 5LNWA 4HU3A 4DZ5A 4BEUA 1UPMB 4J2PA 3GRIA 1Q4WA 1PX3A 3MWCA 4M7TA 5JIPA 1QNQA 1C9DA 1GPWA 3ZT7A 3BQ6A 3IIPA 3VUSA 1ZFJA 4NKCA 3DFOA 2I7GA 3NGJA 3B4UA 3BOXA 4KBXA 1FDZA 3GDTA 1A0EA 1GKQA 3HPSA 1V3HA 4AMAA 4Z0JA 4NNCA 5FD0A 3E2SA 3H24A 1Z41A 3TCEA 3ZJKA 1HNYA 5G4EA 4PA8A 3VUPA 3M4HA 1E0WA 1V08A 3JRKA 4M19A 1EO5A 2QHAA 3G3MA 1EEXA 4OV4A 4LFYA 1W8GA 3PUDA 2VZSA 4HT3A 5F4SA 1YHTA 1R2RA 3RM8A 4CQDA 4TVUA 4UTFA 1R0MA 1OB0A 2GDVA 2PGFA 4F0LA 3CPUA 1YQ2A 4CKQA 3W24A 3PB2A 3URAA 3ABQA 3IJLA 3P5YA 2OSWA 4FMVA 4GKLA 1TPC1 3R13A 2CLFA 3URNA 4ECLA 3TYZA 4AWSA 5A2CA 4CCZA 3TTYA 3O7UA 4QBXA 1WYIA 4RV3A 5BXTA 5AVNA 1LOSA 2WHKA 4U2ZA 3P2VA 1W1YA 1WDQA 3LD5A 1ADSA 4DO7A 1XSIA 2X2YA 2E9LA 4GBDA 1P6BA 4C7DA 3MSYA 5D2TA 2PBOA 3KX6A 3EA3A 3VX0A 2HK0A 1UWUA 4GKTA 1B57A 1F4HA 2OT0A 4YJ5A 2VUNA 3GTIA 3QMSA 4HPJA 3M7SA 5CEWA 4GIYA 1OADA 3QY7A 4I9TA 3G1RA 4MYAA 2PRLA 2Y70A 1LWJA 4WSHA 1A53A 3APTA 4PBEA 1WNOA 3UEQA 2GQ8A 3O05A 2HBVA 3G5EA 3SBFA 1BWVA 3HN3A 4JN7A 5JMUA 1GG1A 3LYEA 3MKCA 3E2RA 4LS0A 4XZNX 3HOJA 4CU6A 3IIVA 1MRQA 4HK5A 2VX6A 3G18A 4MY8A 4TU1A 1XDLA 4PUKA 4DZAA 5JXQA 3FAWA 4B16A 1PXGA 1A5LC 3H2OA 3TC7A 1DWIM 3LM7A 3BG5A 3M5XA 2I9EA 4IJBA 3L0GA 1R3QA 1H2JA 1V6VA 5CPLA 3OZOA 1QI4A 1YPIA 3WBXA 2CHOA 4GCAA 3H4XA 4Y9OA 3OHMB 2DDXA 3LBCA 3EB3A 3TTEA 4XD6A 1J2WA 2QCGA 5T8GA 4MKVA 2VXNA 4ZQPA 3QYSA 3NXFA 2WVVB 2DJXA 4QEEA 1U83A 1DIKA 5DO8A 3IJ8A 1ZU8A 1OYAA 3QY8A 3VCRA 4C1LA 1DIDA 3F4WA 4K1GA 3MHGA 3G1AA 4JKKA 3E0FA 2ZYFA 1AJ0A 3CUZA 4KCTA 2WMKA 3A23A 1GOMA 1H1YA 2CERA 5BCAA 4GI6A 2EJ1A 2XVKA 3AAMA 3RG6A 2BBFA 1UMYA 2FH8A 4XAFA 2ABBA 1HGYA 4DNHA 4IIFA 2GGIA 4Q8UA 4BHYA 4WLCA 5DY2A 5DT5A 5CQ1A 3UG3A 1D7KA 3VC6A 5PTDA 2J9ZA 1E51A 5HATA 2Y63A 1MUMA 3RLHA 3QZAA 4LAKA 5KZEA 1X6LA 3FNDA 3AS3A 4WGHA 4JCLA 1JI2A 2A7RA 2O4QA 1EHNA 1PX8A 4XBSA 3PPGA 4C6IA 4DQWA 1PAMA 1RLDA 2OCZA 3OW1A 1QMLA 2E09A 4L61A 1Q6FA 3IWPA 3TONA 1FWFC 4LVBA 4LB3A 4WSKA 1BVWA 4IX2A 4GC4A 4HA1A 3VOFA 1RQBA 4DXXA 3HGOA 5DXYA 1HJVA 1KA9F 4UQEA 3OQEA 3W1UA 4NXSA 3Q4DA 5CCZA 4JIHA 3I6EA 4IFOA 2YL8A 4I7VA 1A0CA 1GOXA 1V0LA 1O4UA 3L5LA 4DUOA 1UIOA 3KBNA 2J7DA 2V69A 3BAYA 2ESCA 3BL3A 3PZGA 4US5A 4P8VA 3VD4A 1SZRA 5HMFA 2HNEA 3CUFA 1ZRQA 4H8NA 1F07A 4LF2A 3E02A 1PYFA 3TNOA 5GJMA 3BJSA 3DXIA 1B4KA 5GJPA 2WQPA 4PTVA 1Q8AA 4BQ2A 4XQ6A 4UOZA 3CMFA 1U5VA 3UXIA 2D1ZA 5CPMA 5H8MA 3ZLGA 1KGXA 2PUZA 3PZTA 3WMCA 4GY0A 3VKDA 1Q6OA 2AQVA 2BS9A 4KW2A 1E9IA 4MUZA 2Z6JA 4FA3A 3UGRA 3LK6A 1XLHA 3AIRA 4RZBA 2EJAA 3NL5A 1C90A 3LNPA 1KWKA 2YLAA 3RMJA 3PFRA 3LGEA 4IMFA 1KM2A 4DBDA 4LEFA 3WLJA 1N2VA 3G1VA 1LQAA 3NO5A 4XO6A 3HGRA 2G0WA 1EOKA 2CLLA 3KOWA 1XUZA 3MB9A 2ONEA 4XVEA 5DMNA 5FF4A 3O07A 4FSAA 4EPKA 4JTGA 2B0MA 1OT2A 1PKNA 4Z1AA 3DESA 4J7RA 4RZ6A 2GVEA 1EYEA 3N3TA 3WL1A 1M03A 2YBUA 3NCOA 1ICQA 4IXHA 4MJZA 5LSMA 2F6XA 3EBVA 3HPFA 2D3LA 4S3AA 8RUCA 1Z42A 4LU0A 3VVGA 3VZXA 1REQB 3PBMA 4UTMA 3QGVA 4W8LA 3CTTA 3KCLA 2VHLA 4DB7A 5CJNA 4I9JA 3L2MA 1N8WA 5LNVA 3FJ6A 3WF1A 1EL3A 3TTQA 4J9JA 1O12A 3N6QA 4REQA 3HV8A 4K7VA 2ZUTA 3WQOA 1GQKA 5A8GA 2OXNA 3V7PA 1ZLPA 4MB1A 4IPLA 4B5VA 3D3AA 4H7CA 7PTDA 1TG7A 2F8QA 2BWGA 2XVGA 1UZ4A 4IJCA 1ZALA 1OF8A 1XL9A 4MAZA 1OC5A 3C0JA 4IICA 4P61A 5HQEA 1TO3A 2A7NA 4IL2A 3FA5A 2DZSA 1W56A 1O94A 2OYKA 4Z2LA 4OQVA 3B04A 4QAIA 3VABA 1JRCA 1V7AA 1WKEA 1UD4A 2PE4A 3ELFA 3GG7A 4HNVA 6A3HA 4H9VA 4YXGA 2G37A 4ERAA 2AMXA 3QW3A 4RPQA 1RP8A 2ZUSA 3CXOA 3A5VA 5E9AA 1DJQA 4OZOA 3SADA 4I8DA 3ZYZA 2J7EA 1TRIA 3LMZA 1Z89A 3C52A 2VI0A 8TIMA 1ZCOA 2QJMA 1GWJA 2NW0A 3DEQA 3VOGA 5CGQA 4ALDA 1JI1A 1AL8A 5I23A 3IK2A 3IRSA 2GYIA 3A24A 3LTYA 2PP0A 4BY3A 3LI0A 2D0GA 2RAGA 3M16A 1EIXA 4GXPA 1W3NA 1PTDA 2VRQA 4YYCA 2Y7GA 1W6TA 5CAKA 4QNEA 4GQQA 3STCA 2C19A 5LIYX 3F1QA 2GJPA 3EX3A 4ADSA 3LU2A 3R0KA 1TVNA 2PTDA 4LAMA 3AHZA 3B9NA 3WDJA 4FHAA 1FHLA 3G6LA 1M04A 1O60A 3QKZA 1XFBA 3NOYA 2B31A 4XD4A 1X38A 2DUAA 1W1VA 2VZOA 3I3EA 3HPZA 3TZNA 2YA0A 5HK4A 4Q8QA 3WD3A 1OF6A 4D6GA 1JYVA 2JIWA 3O6CA 1HL2A 4JX5A 1QI0A 7ODCA 1N82A 2ISVA 4C91A 1FWRA 4JPGA 4K6AA 3GDBA 4HNLA 2W3ZA 1GVFA 3H2FA 5CSSA 1QPRA 2NQJA 2G4FA 3UJFA 3SQMA 2PF0A 1E55A 1AA1B 1E1EA 2ACQA 3DG7A 3CPGA 1CNVA 3DECA 2VC6A 5A6SA 4G6CA 3EOLA 1XSJA 1S38A 3WBWA 3RPTA 2PTXA 3DN5A 1W9UA 1TV3A 3GC5A 2HQAA 3IS4A 1B30A 2CIPA 2XH2A 2YYUA 5LNRA 1B3OA 2CITA 4N9DA 4TXEA 1U30A 2PDYA 3MO4A 4PMZA 3WH6A 4JTFA 4QGCA 1SFLA 3MQTA 3VIHA 4IIGA 2J7HA 4Q8WA 2IW0A 4PSPA 2ZA1A 3A3XA 2H6RA 1WBJA 3L7RA 1BG9A 2WJEA 4N9BA 1Q45A 3VGDA 3IIZA 3I7SA 7ENLA 2W63A 3SN0A 1UUQA 2YCIX 1M5WA 3G8RA 2OX1A 2AGTA 2YCLB 1Q85A 4PUUA 4DF1A 1PDYA 2CC0A 3UJEA 3QFEA 1CLXA 2BMBA 1HF6A 2CPUA 1GOOA 5AYBA 5AC8A 3UWEA 3FHQA 3GR4A 1RPXA 2CZVA 1UZ1A 1I4NA 2G3JA 3P80A 4C6JA 4Z1BA 1HJUA 1RV8A 1NAL1 4I5RA 3KTSA 1J0KA 2VFEA 1SW3A 5DMLA 1JF6A 3SFWA 1JIBA 2QZRA 3AIEA 3JR2A 1HW6A 1FCUA 3N4AA 1TELA 1WBHA 3L67A 3L0KA 3RNDA 2CLIA 3RK8A 1B1YA 1W5NA 2RDUA 4B5XA 3TXZA 4JFVA 1IZCA 3DCPA 4H01A 1Z69A 2XUCA 4H1ZA 1LJYA 2F7FA 1XRTA 4J3ZA 4UWMA 1L6YA 4DO6A 3GY1A 4HMNA 1I2RA 2HJPA 2NV2A 4Z08A 2J7FA 1JZ6A 1AZ2A 3FOKA 2ZCGA 5T9CE 1HKIA 4JICA 2QIIA 1UR1A 1LL7A 3UXDA 3DZ1A 3L12A 3G1YA 1V79A 1B2YA 5ECUA 5AYZA 3U2CA 5LXEA 3BLDA 4BI5A 3KVJA 4QCEA 2YOCA 4AZ7A 1PUDA 1XD0A 3O63A 5I3HA 5AHIA 3T1GA 1PIGA 4IM4A 2ZRVA 3AYRA 4MFDA 2VOMA 2J62A 4W7WA 2NLIA 2WHJA 4M6QA 4F0MA 3LQGA 4KGLA 4H8HA 4A8IA 3BLFA 3VNZA 1Q6CA 2WNWA 3P7YA 4C6FA 3KOZA 4NX5A 2Q09A 2WC4A 4MWAB 5D2XA 3IV8A 1MDLA 1TPFA 3N9RA 3E74A 1VPXA 2BV9A 1OX4A 1WAWA 4WKAA 3FA4A 1E72M 1D8CA 4FOJA 5D9MA 3DH7A 7REQB 4HU8A 5LIXX 1JNEA 3NAVA 4GUHA 4MZYA 4XSLA 4WIWA 3A13A 3VX1A 1W17A 1VH7A 2O56A 1Q6DA 1OINA 4FO4A 3WD1A 4AVNA 1BVNP 1P48A 3SUWA 3AMDA 4A3YA 4EXQA 3BLLA 3IJ6A 1FWGC 3M7WA 3ITCA 2GLKA 3GNPA 4LY4A 5CGMA 5L9FA 5DELA 1IXOA 3TQVA 3WZ0E 5A6LA 4A21A 5RUBA 2G50A 4DBSA 1NWUA 5I24A 3GFYA 3T7VA 1F61A 1KRAC 1TTIA 1OVDA 3WJSA 4PUMA 3GH7A 1XYBA 4RCXA 2Z6IA 4L5ZA 1JDDA 4Q4SA 4FX6M 1J18A 1JR1A 4PZVA 2RDXA 3UZJA 5HBFA 3S46A 3QC3A 3M0JA 2WSQA 3VKBA 3QMTA 4NXKA 2DVTA 2ZX7A 5M2FX 1ZB5A 4L9XA 4QEHA 3Q94A 1XQKA 4PYSA 5GNYA 3HO8A 4KERA 3EWYA 4IP4A 1E4LA 2XZ9A 2Y7FA 4IQJA 2PPGA 5AYYA 1MFUA 3NVDA 1YDNA 2C13A 4QS6A 1A5SA 3ATYA 4PCTA 4E3VA 5TBOA 2DVXA 3PULA 4X0VA 3W9ZA 4WCJA 3BMXA 3LHUA 5BXRA 2CXGA 3NR0A 3QZEA 1CXFA 1R9XA 3ATZA 5I2UA 2VX5A 5CC5A 3AHVA 2VFIA 4M1BA 4HSHA 4X63A 4RPPA 1GZJA 1LRNA 5C9XA 3CU2A 4FR6A 5E6ZA 2ZZ3A 4PMOA 5FEWA 5D9NA 1YEYA 1YBQA 2GSJA 4H6QA 3OZYA 2I17A 4GOAA 2FLIA 3UFYA 5I03A 1J79A 3N04A 3AHXA 4DWSC 4LH8A 3TX9A 4JOMA 3LEPA 1REQA 1XLCA 3TAKA 4ZO7A 3ARTA 4W86A 5FJPA 3B8VA 4IMAA 5AECA 3CS2A 1EKOA 1JZ4A 4US6A 3CHEA 1O5XA 4CN6A 3T55A 4PMVA 2CKSA 2J4GA 4FS9A 4TX8A 2XGIA 2JF7A 1KKOA 1E0VA 4O8AA 4NYUA 2NQ5A 3M0LA 5JU6A 3TC3A 4K8GA 4KWOA 4UIOA 2QVNA 1ZJBA 1FDJA 2NZLA 3W82A 3FCPA 5A6AA 2CZ5A 3MCMA 1XC6A 5CPNA 4O1FA 4CD4A 2Y8KA 1S46A 1JZ7A 3ZJ7A 2Z2UA 1XX1A 2Y5EA 5BU9A 1BF2A 4UMAA 3VPLA 2BP1A 3TTSA 1YTEA 3VGEA 2CCRA 3KRSA 2VL4A 2DVUA 5E0FA 5FJJA 3ENLA 3U4AA 2ICSA 2V67A 3FJNA 2YFNA 3FXGA 1F2JA 5F1VA 3VKCA 4R7OA 4ATWA 1IXPA 3LM3A 2BDQA 3SCOA 1KNWA 4JQAA 2WJFA 3M0KA 3LS9A 3CAVA 3CYVA 3B3DA 4MY1A 3TV8A 1DORA 5I3GA 1ME8A 3W2UA 1E5NA 5A6BA 5JUVA 1V3IA 4LUYA 2C1HA 3SM0A 2WJDA 2HE5A 5J04A 5DMYA 1DL3A 3VIIA 4KT2A 3MHUA 4U2YA 1WOAA 3EKZA 2F61A 5LA1A 2BY0A 4D1JA 2V3EA 5KZ6A 4ZQOA 2CLKA 4UFLA 2A85A 5T9BG 3NQ2A 3NQBA 4PODA 2XM2A 1GVOA 3AMGA 3S6DA 3GIYA 3S2CA 5C70A 2DSUA 3CM4A 3CBWA 4PMQA 1WCGA 1GQIA 3N4EA 4NQ1A 1UR2A 3VMPA 4WY0B 4OBSA 1DJXA 2INFA 2HSAA 3TQPA 3EB2A 1MNSA 4C1KA 3W1PA 4LYPA 1GOQA 1XIMA 3C56A 4QXIA 3WQ4A 3OVQA 1GW9A 2R6OA 1AFSA 2WVUA 2I14A 3K1GA 1RD6A 4Q7NA 2P88A 3MY9A 4IJRA 3LCHA 5F2LA 1F6KA 1E4MM 1IXQA 2V2DA 5DX7A 1G1YA 1QNVA 2XZ7A 4ATDA 2HEJA 1CXLA 4ML4A 3TYCA 3URBA 5C8BB 1UR3M 3U3HA 2QKFA 4M51A 4ZO8A 3PSVA 1LUCA 4ICMA 2W67A 2WK2A 3CEUA 5CZJA 3A64A 2X1IA 4DZIA 1ZL1A 2NQZA 3WQWA 1UWRA 4J1OA 1MXSA 4GI4A 4LUSB 2EQDA 4QTGA 3UXLA 3CB3A 3II1A 2OYMA 3U5YA 1J01A 5IOBA 1H4PA 2VR2A 1N7KA 3PJUA 4PUNA 3NYDA 3VM7A 5EFDA 1B3XA 1CZ1A 3LPOA 5C7HA 1ELSA 3LOTA 1XIGA 3SQSA 2EGZA 1TB3A 4DN1A 3CT2A 1PZ0A 1XYAA 4J3SA 4ATLA 3CTLA 1UCWA 1XLLA 3WK0A 3W71A 3LHWA 3OJGA 1DBTA 3CLMA 1XW8A 3WD0A 1NDWA 4V2XA 4GVGA 3IVSA 1TV8A 1CPUA 1KD0A 1TWSA 4YVPA 2NUXA 3CAWA 4RW5A 3TZFA 5C0QA 2DFAA 3BCDA 4AAJA 2C14A 3BCJA 4D71A 4CU7A 3IJ9A 1YDVA 3LTSA 1FCQA 3PG9A 3HG5A 4CLMA 1K3UA 1TVLA 2J78A 2RHGA 4W8BA 1MUCA 3UG5A 2EHHA 2GJRA 4Q4PA 1K8ZA 1LL4A 1OCJA 3AXMA 5FESA 2BG5A 3VGBA 1MEHA 3HPXA 3A3WA 3THCA 4QHRA 3W76A 3W3OA 4RE4A 1EDQA 3KVMA 2FYMA 3L65A 2XN1A 2QGHA 1M3UA 4GK8A 3NPXA 3LRKA 3STEA 1VAHA 3I3DA 1BSIA 1XQLA 3LNMA 3NQ6A 1TPVA 3NYZA 3RM4A 1POKA 3LXBA 1SJAA 4O12A 2RFGA 2OLHA 2IMRA 1ZPTA 2DT3A 3HGJA 1KGUA 2G97A 3CHFA 2OQHA 1GZ1A 2V63A 3N18A 1QO2A 2IPWA 5D04C 4QG9A 1ZP4A 3GHTA 3NL6A 3S6TA 2V5LA 2Q8ZA 4S38A 3R5EA 1K4HA 4JKMA 4R33A 4J3TA 4JGDA 3W1AA 1NOWA 1JZ5A 1R9ZA 1XKYA 2EPLX 3OIHA 2ALRA 1B4EA 1RCXB 1TJ1A 3AMLA 3IIXA 5LIWX 1HKWA 3E2VA 4HNOA 3NIYA 1DWJM 4N6FA 2ZRUA 4L9YA 4GCXA 3M07A 1MEWA 4QJ3B 3WLSA 1ONRA 2ZRZA 4HJWA 3TROA 3WDIA 1AH4A 3P93A 4K3ZA 4F66A 3FGCA 4Q4KA 3O6YX 1S5NA 3V5CA 1S2CA 3B06A 3WDQA 3PBWA 4GY7A 3LLDA 4RLIA 1NF0A 3CUJA 2Q6ZA 2OG9A 5HNNA 3NL2A 2VDHA 4H9YA 3T08A 1EJRC 3BGJA 2QV5A 3O2LA 4MMWA 1CXIA 4YTUA 4D2JA 5K9DA 4XZWA 3W7QA 1NJJA 4K38A 1OYCA 3KRUA 4FOUA 4PMXA 4PUDA 3E0LA 1ISXA 1PZ3A 1US0A 4N42A 1YXDA 4YS1A 1NDZA 1TJ2A 3SY1A 2TAAA 4KCVA 3APGA 4KMQA 4O11A 2NQLA 4BI7A 2JK2A 9XIMA 1W9PA 2ZXDA 4J28A 4KFOA 1CYGA 2WLZA 3F4VA 3TAOA 4URIA 3HJEA 4P5UA 1FXQA 5LGZA 3R8GA 3AYVA 2VKZG 4CVWA 5CBBA 5K4XA 1JULA 3BGAA 2D24A 2R82A 4JX6A 4AH7A 3WH5A 4A8LA 4AD5A 3REQB 3MP4A 3W88A 3A6OA 3HPAA 3N19B 3KP1A 5E09A 3F2BA 2DSZA 4K8HA 4Q3MA 4MNKA 3VMOA 4FX7A 3R7MA 1I60A 3N17A 5XINA 3C86A 2YCJA 2A2IA 4F2BA 3DUGA 4RW3A 3AS0A 2ZC1A 1EC9A 2ZA2A 4Q22A 3TMQA 4BS0A 2C71A 3TOYA 4G56A 1XHGA 1UOZA 1E6SM 4F0RA 3W28A 4ZEPA 2RKXA 3T2QA 2R94A 3VGHA 1WXYA 5C9RA 4FNRA 1V93A 4YL2A 3BW4A 1V77A 4U5KA 3F4CA 3GNRA 1I9CB 2NX9A 1GOWA 4S3JA 1YMYA 4I90A 2YCKX 3AZRA 2XN2A 4HN8A 4AQLA 1Q5MA 3CQ0A 1WO2A 4NASA 5BWFA 1NQKA 4UQ9A 2XIBA 2NXIA 4L1XA 3CUXA 4IMDA 3C3UA 1NQ6A 6ENLA 3CV6A 2IKGA 2JEQA 3LZ5A 3GUGA 3MBDA 2J9YA 2PB1A 3UZ5A 1JZ3A 2QCEA 4D6HA 3H7UA 2DPEA 3GD6A 1KBIA 2PRMA 3RX4A 4AFYA 2VJXA 1TWDA 2OR2A 1G94A 1UKOA 3DOPA 1ZTVA 2FHBA 1I1WA 3T4CA 4C7FA 1H7OA 2VP8A 2OWCA 2OOGA 3CWNA 4X0NA 3EWUA 3W1XA 3E6EA 4QJ4B 5HR6A 1KTBA 2C1GA 2DUXA 4GNJA 3IGUA 3S5ZA 5EU9A 1QWKA 3ZVHA 2GJLA 1KGWA 3H23A 1R3SA 4DELA 5GQBA 4JTCA 3BK0A 1Z6KA 1KXTA 4OECA 4Z0SA 3CAQA 4IG2B 1RK6A 1I2OA 4JY9A 1FA2A 2P53A 4JTIA 3B8SA 1CX9A 9RUBA 4ZQNA 4X9YA 5H8PA 1YTKA 5CPQA 5EMUA 4X9SA 3G8EA 8XIAA 1DWFM 4JXCA 2MNRA 3STGA 1LUCB 1YDYA 4KCWA 1QPQA 4LUJA 1RLCL 4TV6A 3ZT6A 3ITLA 2BVTA 4DJEA 3VO0A 4UTIA 3NJ3A 3NURA 4XKYA 3W84A 3M5ZA 3T07A 1GTEA 4CQCA 3E38A 4IGSA 1S5VA 1A3HA 3C2FA 1IIHA 3KOXA 2XSXA 2VDIA 4S2CA 1AJ2A 1BRLB 3RHGA 3QW4B 1ADOA 2GUBA 4O53A 1QJWA 1E6RA 2G96A 3TR2A 3COTA 3L66A 2CFFA 5D38A 1DHPA 1E56A 1H7XA 1XM3A 4UMCA 1RVGA 1UBPC 3MMDA 2B4GA 4R85A 5TAOA 4U3CA 4YVXA 2R1NA 4QLJA 3EOUA 1JVNA 3IPWA 4AIBA 5EFFA 2OPJA 4E0CA 1BRLA 1LP6A 4B5WA 3G0XA 1E3ZA 2OU4A 2OWXA 1E1CB 2FTYA 4AWEA 3KFTA 1VGAA 3MBFA 4QJ1A 1V51A 1BQGA 4YTRA 3NL3A 4HA0A 1JDCA 2PWHA 2ZWZA 1AMYA 4O4WA 4WY0F 4MB5A 1RY8A 4O1EA 4B15A 1LLWA 3DERA 5K7JA 4GA8A 3WUGA 2ZZ2A 2NVAA 2P3ZA 4N2YA 3ME3A 3WJWA 3ZMRA 3GDKA 1KM3A 4C6OA 4Q8PA 2UZ9A 2YDQA 3CIXA 1O6IA 1B0IA 2HTMA 4ZB5A 3EPNA 3TA6A 1ITXA 1F4AA 3ZO9A 4MDPA 2PWDA 2V6AA 2ZE3A 1O5QA 3UXKA 2BXYA 1EDGA 3MPGA 4CU8A 4NY2A 4RK8A 1LOLA 1OG0A 1UWIA 1KWGA 1HJQA 2VC7A 3QJAA 4J35A 2PWGA 4EXBA 1WDSA 4EVZA 1LT7A 5A95A 1TFVA 2FFCA 4CD6A 3C2EA 2J7GA 4L4PA 4GPNA 4W89A 4UTLA 1FQ0A 5A3HA 1SSGA 2EEXA 3L4UA 6REQB 4FZIA 2CZFA 1M6JA 3BTNA 1TRDA 1MZRA 2Y88A 3L2IA 1SM9A 2BODX 2XYLA 3I3BA 4IP7A 5CBJA 1IWAA 3UR5A 1EPVA 3OPSA 4JKLA 2GQAA 1UBSA 3PZQA 2B7OA 4Y96A 3TCSA 1KXHA 3N2OA 2YLLA 2W6RA 1I0DA 4PMNA 3AU6A 4YCPA 2EAWA 4YTSA 3DAQA 2INEA 3NG3A 3SQLA 1B9BA 4TTGA 1OIFA 3UWYA 3LXAA 3RUBL 4OBRA 2BX7A 1XRSA 3S2NA 1B54A 4NI3A 3LSBA 1TIWA 2YB4A 4JQ3A 3TXVA 1TQXA 4QIUA 5FACA 3TW7A 4YU1A 3IUHA 1X6NA 1OCQA 2IPFA 3GW3A 4YYFA 7A3HA 1OC7A 3NNTA 2FHCA 2KZHA 4ML9A 1TA3A 1LM1A 4C6MA 4QRNA 1JPIA 4XTIA 1T40A 3WLPA 4HSNA 1H0IA 4ADTA 1WAUA