2VFIA

Crystal structure of the plasmodium falciparum triosephosphate isomerase in the loop closed state with 3-phosphoglycerate bound at the active site and interface
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
246
structure length
246
Chain Sequence
b'RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Biochemical and Structural Characterization of Residue 96 Mutants of Plasmodium Falciparum Triosephosphate Isomerase: Active-Site Loop Conformation, Hydration and Identification of a Dimer-Interface Ligand-Binding Site.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 93
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2007-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vfiA00
1FWNA 1ZFJA 5AYXA 2AGKA 3O63A 1K7XA 2J6XA 2CZEA 3W7EA 1EP3A 3PSWA 1O95A 3E02A 5LNUA 2GJNA 1A5BA 4R53A 1N8FA 2A7PA 3L5LA 2VFGA 2C15A 1R30A 3QEZA 1LRTA 2EGZA 2ZRUA 2JGYA 4FEZA 1W56A 1JCYA 2ZYFA 1DJQA 1TPB1 2ZZ4A 3JRKA 2FB3A 4UTHA 3L9CA 5D30A 4YXGA 2B7QA 1MO0A 1TJRA 4WJEA 2UV8G 4K7VA 4YCOA 4YMZA 2E5DA 3HIJA 3O07A 1ZAHA 5T26A 3O6YX 4JGDA 3W85A 4Z1DA 3W73A 2C13A 3IIOA 4O0ZA 1ZNNA 3PUOA 3LRKA 4IMDA 2J9ZA 5FI8A 3ZWSA 4JYDA 3BPWA 4O54A 1LLZA 4FIRA 1J2WA 1O94A 5F4XA 3W2LA 4C1LA 1JQVA 1Z42A 1S3HA 5DY2A 5BMXA 4UTJA 3WJZA 1O60A 3AJXA 1LLWA 3L67A 4MZ1A 4X9SA 4DPPA 8TIMA 2Y6ZA 1OF6A 1EIXA 1HTIA 4K37A 4OE7A 4N6FA 4GUJA 4PEKA 3C6CA 3W1MA 1H1YA 3M5VA 3P61A 1EP2A 4ADSA 5D33A 3V1PA 1GPWA 1RQEA 3CQ0A 3GZ3A 4WY0B 3M6YA 4HKPA 1QWGA 4G1KA 3QC3A 1W31A 3DU0A 1PHQA 3NEVA 1VCGA 5AC6A 2DJXA 4PL2A 1OVDA 4IPIA 3PBUA 3CWOX 3A23A 4RXFA 2X1UA 4XTIA 2CLIA 3EWWA 4NJGA 4TMCA 2J88A 5LNRA 3MUXA 3N14A 1W0MA 2NUXA 4K38A 4IOTA 3LCIA 1M7OA 3MP4A 1UCWA 3W7PA 1NEYA 1WOAA 1JUKA 3L0KA 1OFEA 4BI7A 4PCFA 1HFBA 1KTBA 3W22A 1NFBA 3M7WA 2PRLA 4S2BA 5IBXA 2A4AA 3TCEA 1W3TA 2BTMA 1WQ5A 3M43A 1F73A 5HWMA 3DFQA 4JX6A 2V9DA 3EX3A 5BRBA 1OX6A 2YYTA 1FDJA 4RLIA 1Z44A 1KFBA 4WXZA 3UWZA 2CLKA 1F76A 4IMFA 4TO8A 3UXDA 1GWJA 2CLLA 2V2HA 4FX7A 1FCBA 2RH9A 3WJSA 1R46A 2XN1A 4GRSA 5IM51 5HR6A 4QNWA 1TRIA 5G2HA 2PRHA 3CB8A 3QM3A 5EBUA 3HG2A 3TROA 1H7OA 4IMCA 2VFHA 2E5CA 3TV8A 4AWUA 3G18A 2E6YA 3BG5A 5FF3A 1EEPA 3TFCA 1K7EA 2GVGA 1S5TA 3UZJA 3B0UX 2P10A 3UY8A 4DPQA 2B7PA 3OEXA 1H51A 2CLHA 3BGJA 4WD0A 3W84A 3FFSA 3QSTA 3TJLA 1VR6A 3PSVA 3PBYA 3B04A 1FWSA 1XDLA 5CZJA 2Z6IA 3A5FA 4Z0JA 4AH7A 4MY1A 3LRMA 1TJPA 3FIGA 4QSHA 3NAVA 4IXHA 3B8DA 3W3OA 1GVRA 4LRTA 2HTMA 4N9CA 4KWWA 1FCVA 3EKLA 3G8RA 3EWXA 5L9FA 1CX9A 1H7XA 1YTDA 4NNCA 3W7OA 1FX6A 4RZ5A 4LVGA 1F05A 3RLVA 5I3JA 1PS9A 4QQ3A 1JJKA 1ZY9A 4A29A 3O1NA 3WK0A 3WJWA 4K8HA 3PWAA 4FNRA 3OVRA 3IV3A 3F4WA 2DZUA 4K8EA 1S5WA 1Q45A 3P8IA 1QCWA 1HG3A 4HN4A 5DBUA 4KWVA 1VPXA 3NVTA 2ATSA 3B4UA 3NL5A 1K8XA 1GTHA 3M1ZA 1KFEA 4JX5A 5KZDA 2HMCA 2BSLA 2E6AA 1KM1A 3OVQA 4NU7A 3RK8A 2V5BA 3L5MA 4LUIA 1H63A 4O12A 1C29A 4HNUA 4JTUA 3ATZA 3DFSA 1YDNA 1QNVA 3TSBA 1KTNA 2XN0A 3FA5A 3S5NA 1IGSA 3QJAA 4H6KA 3DFTA 2GOUA 3PBWA 1EPXA 5LZLA 1G6CA 2DP3A 1YYAA 3SW6A 1ALDA 2OZ0A 1VLIA 2Q3RA 4IXXA 5CZSA 3KRUA 4GE8A 1OFDA 3R5EA 4O57A 2NUYA 4OU1A 3W1PA 3LERA 4OBTA 5D2WA 5HQEA 3NPUA 5EPDA 3DZ1A 4ADUA 3MMTA 4JTKA 1XBXA 2OJPA 2Y63A 2QKFA 4ICNA 1ZAJA 1J5TA 2E5BA 3BVJA 1VCFA 1KV5A 4ZMGA 1JCMP 4JR5A 4DBDA 3S8HA 5DCDA 1F5ZA 5KITA 1GTEA 3N34A 3PM6A 1Z41A 1QFEA 4H4IA 4NXKA 2CFFA 3ABQA 2FDSA 1TQXA 4GUGA 4IMEA 4KFOA 4O4WA 3W1QA 1H62A 1WAUA 3IEBA 2G97A 1QR7A 1TPEA 2YX0A 2I1OA 5AN7A 2C14A 2E77A 2E68A 3L65A 5HJLA 3RLUA 4AWTA 3P81A 3A24A 1H1ZA 3HGRA 4BFAA 4O17A 5DY3A 3C2RA 3FLUA 5DCEA 4HNTA 1B4KA 3LTSA 1HO1A 4N2YA 4OV4A 1KM5A 3H53A 4IUOA 3F4NA 1G4PA 4ZQMA 4BF9A 4ZVJA 1AW5A 1G69A 2VOMA 4UMCA 4U28A 4UMAA 1LTDA 3NQMA 5K9XA 1YTKA 2Y62A 3C3NA 1UUMA 1TPWA 1GQNA 2DZVA 2PCQA 2FQIA 4E2DA 3R13A 3HMJG 1OFBA 4HPJA 2ZZ5A 4MOZA 1ZJIA 3W7IA 3TUUA 4Y96A 3TXZA 1KM4A 5J5RA 3O05A 5FF0A 1A50A 3T44A 3D0CA 3W7QA 5C55A 4NJKA 2A5HA 3QQ1A 1F7BA 3G1AA 1T99A 4IQLA 3LCFA 4NX5A 3G1VA 1Q3NA 1N55A 3HG4A 4XBSA 1Y0EA 3BV4A 4O1CA 1J4EA 3W87A 3W7GA 3S9YA 2BXVA 2ZRXA 3E0IA 5F4WA 2G5WA 4ZQPA 3TR2A 4AEOA 5H91A 4QISA 4O13A 4RK8A 3LRLA 4FXRA 1QO2A 2A0NA 4GC4A 3NYZA 2QUUA 4WQ6A 1N7KA 3W1AA 1T0OA 5HINA 3DH7A 3FS2A 3WFAA 5HMSA 2QDGA 3QQ0A 4MJZA 1VH7A 1WBJA 4RKAA 1OFQA 4S1FA 4JTEA 4FB7A 3DXIA 2O7QA 5K3VA 3CIXA 4JTJA 1YLVA 4DF0A 3GXTA 5FF4A 4DEFA 4AB4A 5K4XA 3M41A 3BW3A 5TIMA 5K9CA 1EB3A 2XN2A 2TPSA 4ORMA 1NVMA 3G24A 1OABA 2WNQA 5F4SA 4Y9AA 3ZWTA 4QM1A 4O8RA 3GDTA 2ZFAA 4M7TA 3W1UA 2A7NA 4A22A 1MXSA 2V5LA 2EHHA 3GVGA 3E9AA 1LBMA 1HUVA 2NXGA 2Q3OA 1FDYA 1SR9A 2YDAA 3T78A 3NPVA 4IMGA 1FXPA 1AW1A 2HS8A 5IBXC 3LOTA 5C54A 1AW2A 4UTIA 4Z1BA 1SSDA 3EEGA 4MVAA 1EX5A 3LCHA 4OWGA 4EOUA 1A5CA 4GNJA 1H7WA 1KM3A 1SZEA 3RFAA 4CQ8A 4UR7A 4NUWA 3UPBA 2ABAA 5HWJA 4FHAA 3U6WA 5KMYA 1RD5A 3S5ZA 1BTMA 1DV7A 2ZA3A 1ICQA 5CPLA 4I7WA 4WOQA 1R47A 3LI0A 3O8AA 4FX6M 1I45A 1FUYA 2AQWA 3MI6A 4MIMA 4A3UA 4C1KA 1K03A 3W6YA 3M5XA 4AXKA 3T4CA 4E0CA 2B4GA 4MLJA 4K7YA 4O16A 1KM0A 3PY2A 4FNPA 2B7NA 4PH6A 1VJIA 5I3FA 1ICPA 3FJ6A 4UUIA 4AHOA 1FCQA 4M7SA 1YXYA 1LDCA 1VHNA 2G96A 1DOSA 1H7RA 3TIMA 1M7PA 4HNNA 2Q8ZA 1GG0A 3UZ5A 4LT9A 3FJLA 3WK1A 2NX3A 4LS2A 3SZ8A 2CW6A 1MEWA 3BK0A 4DXVA 1LORA 1ONRA 3LX9A 2RDTA 5D03A 3HPSA 3GDKA 3STCA 2OMAA 1RVGA 1HO4A 1OFRA 2Y61A 3IGUA 2H3BA 3SGUA 4A2SA 5K7JA 1YXCA 5F2GA 3LXBA 1WDWA 4LUJA 1O5XA 1DHPA 3HF3A 3W1RA 1SW0A 4GBUA 1L2UA 3S5OA 1LBFA 3E49A 2NV1A 5AOUA 5LNWA 3W1LA 1TTPA 3ANYA 1KBJA 1P5BA 4GFSA 4XKYB 3W7MA 1GYLA 3C2FA 3TKFA 4P61A 1PHWA 1NAL1 3N19B 3G3DA 4MLRA 3TAOA 2GVJA 1B9BA 4NVTA 1G4EA 3L0NA 1P1XA 1TRDA 2X30A 4YL2A 2NZLA 2R91A 3C0JA 2QF7A 3A9IA 2FLIA 2C6QA 4O0KA 4ADTA 5D2XA 4N4PA 4LC8A 5K9DA 2NV2A 4XUGA 4PC8A 2QCDB 2D73A 2X1TA 1XXXA 3S1UA 4NXSA 2ZBTA 4J9JA 4EIVA 2ABBA 4IX2A 2JK2A 5AC8A 1JVNA 7TIMA 5CPOA 3V75A 5F2IA 1P4CA 1QAPA 4UXDA 3IVUA 2GUUA 4O18A 1X8FA 1VC4A 4ZQOA 2ZZ7A 3LXCA 4QNEA 3W7KA 3P84A 3P62A 2J9YA 5CGQA 3C2OA 4UNLA 3KRSA 2J27A 3M44A 3TXVA 4LS1A 3W72A 1X1ZA 4R7JA 4IPJA 2A2IA 2Y89A 4K36A 1HL2A 4HPXA 3CTLA 3NM3A 4XQ6A 1TCDA 4XKYA 4HNVA 3MI3A 1QOPA 1KBIA 3GKAA 3G1DA 1ZCOA 4DQWA 1TV7A 2QCFA 5FEPA 2WJZA 3VNDA 1XL9A 4KKXA 4O1DA 2ZZ2A 4BI5A 2NWRA 2Y7DA 2PRMA 5FEWA 4LWWA 1W3IA 5E0KA 2QCDA 1TYGA 1XBZA 4NNBA 2RFGA 4DBEA 1RQHA 3MW7A 4I7UA 2CZFA 4UC5A 4YCPA 1NF7A 2WV8A 3GXNA 4PL1A 2XFWA 4O19A 1B4EA 3ATYA 2R8WA 5G4EA 2DJLA 1F6KA 1Z48A 2RKXA 2Z6JA 3SSJA 5SWUA 3QW4B 1I2PA 5D2YA 2WNNA 4UMBA 3UWVA 2CLMA 2B0MA 1WV2A 1VQTA 4FIQA 5FEZA 3Q94A 2Y7FA 4FX8A 6TIMA 1VRDA 3N9SA 4JTGA 1KM6A 5J5DA 3A21A 2P0OA 3TMLA 2BLEA 3TFXA 3BG3A 1OG0A 1VHCA 4Q4KA 1SFJA 4L4MA 3W2KA 4LU0A 3L21A 1MSSA 2V2CA 4MUZA 3LBCA 3PB2A 3ABSA 1F6PA 3PUEA 4JTHA 2H6RA 5CPNA 4Z1CA 3OBKA 1GJPA 4LVFA 5LKYA 3MHGA 5F1VA 1W5MA 1P0NA 3GNDA 1TMHA 3T55A 1JULA 3WK2A 1XFBA 1YPFA 3EKZA 2QR6A 3QRHA 4BK9A 1EA0A 5AB3A 3PULA 4ML9A 4UTTA 4X3ZA 3EWBX 2VXNA 3SGZA 1XBVA 5CZ0A 2E6DA 4JDYA 2NX1A 3HO8A 3G1FA 2X1SA 4LOCA 3A22A 4NZFA 3GAKA 3C4UA 4WXYA 1B57A 3GDRA 5D04C 3O6CA 2YFNA 2QCLA 5KZMA 1SU5A 3I7SA 4MJMA 5BOOA 1PIIA 3NL2A 2PE4A 2YCEA 4IWWA 3PG9A 1IXOA 3TU9A 3JR2A 1G7UA 4JY9A 2A7RA 1W1ZA 1ICSA 1FWTA 1L6SA 2JKPA 3S0CA 2LLEA 1H60A 2CLOA 3LTYA 4AF0A 5I3IA 1ME8A 3M47A 3PC0A 3NQ8A 3CEPA 3DFPA 2V2DA 3QH2A 3S42A 1FCUA 1DKWA 5HWNA 3NOEA 4QITA 2CU0A 5LGXA 4OT7A 1DBTA 3FOKA 1JRBA 5BW6A 3QYQA 2ZTKA 4ZQRA 1P0KA 3PR2A 3TDFA 3YPIA 3DENA 3LHUA 3NZRA 3VE9A 4JIQA 1D9EA 2QCNA 1F74A 5MHBA 3RNDA 3DAQA 1FDZA 1TB3A 2V82A 1SUXA 1K8ZA 1TPDA 5HULA 4Y6GA 3LGEA 3F1QA 3Q58A 3HJZA 1GOXA 2VEIA 3NO5A 1D3HA 1XC4A 2YW4A 4YLWA 5G4WA 4DO4A 4O14A 1TO3A 3C52A 2RHGA 1JUEA 4JICA 3EXSA 4NJJA 3NPXA 3DKJA 2C1HA 1EP1A 3H55A 4WUIA 4GUHA 2FPYA 1LOQA 3GDMA 4DO5A 4N02A 1SFLA 3UWYA 1RPXA 3NQDA 3TX9A 4I9AA 5AC7A 2OCZA 4FF7A 1L6YA 1TV8A 4FO4A 2PURA 5DELA 3GK0A 2NLIA 4RR4A 2Y70A 3R89A 3DHDA 1XM3A 2DZTA 4ORIA 1WOBA 3EXRA 3P8JA 3M9YA 5FESA 2W79A 3LDVA 3LHWA 5EYWA 3BARA 1TSIA 4CLMA 4JYEA 3OG3A 3QSRA 4I7VA 3W1NA 3HBLA 3DI0A 1IF2A 5EA9A 1BKSA 4NNAA 1PVNA 3BW2A 1W5NA 2HS6A 2WSQA 3OIXA 3PS7A 3P5YA 3GLCA 3CU2A 3IVSA 3SFKA 3LHVA 5DBTA 2QJIA 1PL9A 2Y7GA 3W7DA 5CKSA 1T96A 4LY8A 3MP5A 4QIUA 3E12A 2ZDRA 1OYCA 4GXMA 3KOFA 3MYOA 5ABTA 3B0VC 1A5SA 3U8GA 3W1XA 3HGJA 3CEUA 3UQNA 2QEZA 3BO9A 2GQAA 3GKFA 3PVFA 3TH6A 3USBA 3C56A 3GX9A 3O6DA 3LI1A 3KRZA 3R2GA 3UWWA 3W2UA 1A5AA 5AHMA 1OK4A 3QZEA 1EUAA 1V7YA 1UBSA 3BG9A 1WYIA 1CW2A 1KFLA 1I4NA 2FPVA 1M5WA 1X6UA 1DL3A 3GB6A 3I68A 3MHFA 5U7SA 3SI9A 1OHLA 5C2XA 2QCGA 4UTUA 2YR1A 3LCGA 1KFCA 1OYBA 5F1UA 3NNTA 3P74A 3C2EA 1EUNA 4AVFA 3EXTA 1SW7A 4AAJA 3HPZA 4OV9A 1GZGA 1YXDA 2GQ8A 3M16A 2X1RA 2ZCGA 3KVLA 2ISVA 4JTTA 2A21A 5LNVA 3THAA 1KLYA 4UTMA 5D05A 3GR8A 3NPWA 2ZZ6A 2JKEA 3FKRA 3S6DA 3UWQA 4BI6A 3TQ0A 2ZA2A 5FF2A 1AK5A 4Y8FA 1Q6RA 1X7FA 1QO5A 1AG1O 4XBKA 2Q8LA 5HR7A 1TREA 4MZ8A 2ISWA 1TPVA 1F2JA 4M6PA 5DXYA 4RXGA 4NZJA 4A2RA 3M0ZA 3AO0A 1W3NA 6ALDA 1I2RA 3L5AA 1R2SA 2ISSA 4GJ1A 4LVAA 4TU1A 2PC4A 1A53A 3C2VA 4S2CA 5E93A 1SQ7A 4N9EA 3IIPA 4CQ9A 3GR7A 1WBHA 1V5XA 5HNRA 1UASA 2WKJA 4ONVA 1W8SA 1G4TA 2A6NA 3IIZA 2CZDA 4M19A 5DCBA 1YPIA 3G3MA 3SIZA 1YDVA 3OHIA 1TTIA 1U5JA 3LV5A 2YW3A 3HGOA 3W7LA 4H3DA 3UXAA 3LXAA 4O28A 4UNKA 4CCEA 3TJXA 1D3GA 3LTPA 4FXSA 3W2NA 5AHEA 3QPZA 3C61A 5LHEA 1RR2A 5CSSA 1SSGA 3LCLA 3GAYA 3OVPA 5G2IA 1BWLA 1H7NA 5FF7A 2QCMA 4JD4A 5D02A 1QOQA 3MHUA 1GT8A 3W70A 1QPOA 3NQCA 2G95A 4EVZA 2WSRA 4PFMA 3IGSA 1OFOA 3P60A 1YTEA 1G67A 4X22A 3ELFA 4RZ6A 4BWLA 4CNNA 4O11A 3VE7A 1H7PA 3NL6A 3W7NA 4UFKA 4HT3A 3NDOA 1ADOA 1RZMA 1W5QA 2HSAA 3KX6A 1IIHA 1GVSA 1VCVA 4FNQA 3CPRA 5AHLA 3NGJA 5H2ZA 3S1WA 2ZRVA 2QAPA 4UFLA 3FYPA 4O4VA 1TPUA 3P5ZA 2AAMA 3BLFA 3TQKA 1TPH1 3GIYA 2VEKA 1U83A 4NQ1A 1WX0A 3BLIA 3MO7A 4HHPA 4LTSA 4MYAA 4UTTC 2VFFA 3B05A 4O1AA 1I2QA 4UFMA 1T8XA 1XCFA 4AHPA 4EF9A 3FKKA 2GJLA 2VEPA 3B06A 4CNPA 4OHQA 3KXQA 2QJHA 2ZZ1A 4LW7A 3RU6A 1YDOA 5F2MA 1OX4B 1EWEA 5BMWA 3N9RA 2ATMA 1FWWA 2EPHA 1XDMA 3L68A 1VLWA 1XI3A 1AMKA 2GVLA 3VCRA 1Q6OA 3ABRA 2E09A 2JBMA 2CZ5A 3HOJA 3NZ1A 2BWGA 5I3HA 1SZFA 3THQA 2WPBA 3S1VA 1OF8A 2E6FA 1L6WA 5EY5A 4BR1A 1R2TA 2QCEA 5D2VA 4A21A 2TMDA 1W54A 2QJGA 4JIPA 3M5YA 2Z2UA 2EAWA 1ZENA 1XKYA 4N6EA 4DO6A 2ZZ3A 3LBMA 3Q37A 3E96A 3KVKA 1OK6A 3DI1A 3IIXA 3IGXA 5A8GA 3W86A 5C5YA 4CNOA 1C8VA 3NQFA 4FNSA 1B3OA 2CLFA 4UFJA 3GDLA 5CSRA 5KINA 3CIWA 3NG3A 4DF1A 4ZQNA 4HSOA 1E51A 2V0TA 4TMBA 4WX2A 2YFOA 2I9EA 3W75A 2YPIA 4JNMA 2DZSA 2WNZA 4LNYA 3NR0A 1OX4A 5AYYA 5K2ZA 2TSYA 2WQPA 3JS3A 4RX0A 4UCGA 1LOLA 1ZALA 1GG1A 3K30A 5KZEA 3QMRA 2W6RA 4NJIA 1ML1A 3L2IA 1IIGA 1MEIA 4UFIA 3EWUA 1X1OA 5LNSA 5A5WA 4FNTA 5TQLA 4QAIA 5LHFA 2OX1A 2H90A 5D37A 5AFDA 1VYSX 5CZTA 1LM1A 2JGQA 2Y85A 3N73A 4MKNA 2TRSA 3W1TA 4DELA 3QF0A 4L4LA 4MYXA 3L0GA 3UY7A 3DHFA 1MEHA 3MI2A 1C9DA 1KA9F 2NX9A 2OT1A 4UTWA 1NSJA 2CLEA 1I2OA 3C8FA 4JTSA 3W07A 2P1FA 3MJYA 2EKCA 5D09A 3EX1A 4MY8A 1MZHA 3LCWA 3TK7A 3PF3A 5EKYA 1QPRA 4P2VA 1K02A 1L9WA 3WJYA 4AF0B 3SECA 4MY9A 2DZWA 2CWNA 4Z08A 4AHQA 3CLMA 1W5OA 2QCCA 4JTIA 5E1QA 2GPTA 1W5PA 3LHTA 3TSDA 4PODA 2ZRZA 2VEMA 3G8EA 2FB2A 4LV9A 1SW3A 1GVFA 3QPYA 4WY0A 5EMUA 4Q32A 4CCCA 4Z0SA 2VFIA 3EB2A 4UTLA 3NQ7A 1LROA 2VELA 5FEXA 2QAFA 2WOQA 3FYOA 3EWYA 5HUOA 4N9DA 1GVOA 2QUVA 2QDHA 3F03K 4UIOA 4OQVA 5TBOA 3W9ZA 3DFNA 3G1XA 1DVJA 3TC6A 3IRDA 1M6JA 2FPTA 1S5VA 2Y7EA 1FQ0A 4YWIA 3N2XA 1CI1A 2BZNA 2A1YA 4LVBA 1SO6A 1KW1A 4PTNA 3DFOA 3UNDA 1SO4A 4HSNA 4D2JA 3O06A 1AL8A 2C19A 2W0UA 1LOSA 3KFTA 1RQBA 4N9BA 3QMSA 4AWSA 2C0AA 4ALDA 3TA6A 4CQAA 1QPQA 3G22A 3T40A 1JCXA 4KFPA 5AHNA 2Y88A 3QMTA 2YXGA 3CT7A 2KZHA 1SPQA 3NQVA 2R14A 2DZXA 3VKJA 5KTLA 2A85A 3W23A 3U2OA 3KAOA 4LRSA 3KVMA 1LYXA 3UYCA 1GEQA 1SO5A 3OA3A 3W83A 1H61A 1OX5A 4N4QA 2VKZG 3PAJA 2FTPA 2I14A 4IJBA 4O1BA 5EL1A 5HUPA 5G1YA 1UJPA 3NM1A 3R12A 2EF9A 5K4ZA 4MZYA 1SZGA 3EWZA 2YZRA 4XWUA 3BW4A 3UD6A 1TV5A 4TR9A 4EF8A 3NA8A 2H8ZA 3G1YA 3QFEA 2F84A 3LV6A 3W88A 4XTDA 3Q2DA 4JEQA 2DU2A 5CPMA 3ZR4A 2GQ9A 1TQJA 4U4MA 3LB0A 4IGHA 1H5YA 3HB9A 4JS3A 5DXXA 4MPQA 1NF0A 3KVJA 4WY0F 2TYSA 4ZL1A 3I7RA 3INPA 4M5PA 4JN6A 1DQWA 1KTCA 2Z0IA 2VENA 1K7FA 4RZ4A 2JKAA 2C16A 3TQVA 4LC6A 2OT0A 3CM4A 1LP6A 1SZNA 3NQGA 5F2LA 1UUOA 3W74A 2C3ZA 3B03A 3SR7A 3EX4A 4JDBA 4BWLC 5AYZA 3SJ3A 3P80A 3CWNA 3T7VA 4Q33A 3IIVA 1VYRA 1PCKA 3I6RA 2QCHA 3W7HA 2ZA1A 5KSWA 3MWAA 4LS0A 1KFJA 3G1HA 4R33A 3TMQA 5I3GA 4AMAA 3LHYA 4JY8A 1DQXA 4POCA 3MP3A 4HIBA 3O16A 3PUDA 5L6UA 3TNOA 2H3DA 3W76A 1JCNA 5D32A 1TIMA 1FXQA 3STEA 3VI2A 5D38A 1VS1A 3P7YA 3H54A 4OGZA 5LSMA 1I8JA 3ZS4A 2H8XA 4RCXA 1K3UA 1EWDA 3G0UA 1OYAA 4UFHA 5DLCA 1ZHAA 1JQXA 3W7JA 4ZQCA 4JX4A 2J9XA 1GYNA 1XBYA 1VYPX 4M6QA 4K6AA 3TSMA 3LLFA 1JRCA 3PBVA 2YGYA 2V30A 3CHVA 3QW3A 4O10A 1IXNA 3KHJA 3HG3A 1LRNA 4DF2A 3G0XA 5U4NA 1ZAIA 4KFNA 2X2GA 4RV8A 4WZHA 1DJNA 4O52A 1QDSA 1PE1A 5DN1A 1TPC1 3DGRA 3NQ2A 3A5VA 4LV4A 3HQ1A 3DKLA 1BEUA 3N3MA 2VFEA 1G7VA 1DORA 2B7OA 3HGSA 3W2JA 4ZZ9A 2X16A 3HPXA 5G5IA 4GWEA 2DORA 1G4SA 3TAKA 3W7CA 2YYUA 3RF9A 3L66A 2E1DA 3G1SA 3R8RA 1JCJA 1OJXA 1ME7A 3UPWA 4QJ1A 4GUIA 3HG5A 4FNUA 1FBAA 4MFEA 3WK3A 2WO5A 1LRQA 1QMLA 2V8ZA 3W7RA 4B5NA 4JYFA 3WJXA 4R34A 2DZPA 2ZRYA 4XZ9A 1Q6LA 3TW7A 3MBDA 2A6LA 1QPNA 1XUZA 1ME9A 4TX9A 2FIQA 1IXQA 3S5YA 3W2MA 1VGAA 3GNNA 1XUUA 1KM2A 4PA8A 1Q6QA 3NL3A 5G2WA 4Z1AA 2R94A 4EWND 4JTFA 3NQEA 4W9TA 5C6MA 2F7FA 4O50A 3GXPA 3P82A 1O4UA 2NWSA 1PCWA 3IVTA 3BGGA 3EX6A 1WA3A 4WOZA 1SO3A 1H50A 1TPFA 3STFA 5D2TA 3FEMA 1BWKA 3VFLA 2NXHA 4O15A 5GVJA 2NXIA 3GYEA 4NX0A 3STGA 3CC1A 1LBLA 1TTJA 3EX2A 4NT0A 2ZQ0A 5AHIA 3P67A 1O5KA 1AL7A 1R2RA 2ZRWA 3TE9A 2BX7A 1JR1A 5LGZA 4UR8A 1FWRA 1LZOA 3B0PA 3LM7A 1JCLA 4O53A 4JXCA 3PB0A 3LHZA 4K39A 2QUTA 2NUWA 3W71A 2Z1BA 2J24A 3MBFA 1IXPA 1VZWA 2VFDA 3UWUA 4E38A 3NQ6A 4GUFA 1I2NA 2YSWA 4NJHA 3RMJA 2V81A 5AHFA 3S1XA 2C18A 3N2MA 1UB3A 3NXFA 5BNKA 2ZTJA 1JUBA 4UTWC 1TTQA 3M5ZA 1KLZA 3G0SA 1FY6A 1K8YA 1KFKA 3O15A 1YADA 4IX0A 4JTLA 4RJEA 5G1TA 3SY5A 4MFDA 1LCOA 3TW6A 5CG7A 2VC6A 3PG8A 4TIMA 1THFD 2O7SA 4LVDA 4CCDA 4UTKA 3TC7A 3DBPA 1WXJA 1OFPA 3I65A 2WSYA 2ALDA 3LLDA 1W37A 2RDWA 2FJKA 1RV8A 4M6VA 4E2BA 3I7QA 3LCXA 2FFCA 3MYPA 3ABOA 1KV8A 4Y90A 5I3KA 4X2RA 3BLEA 1PV8A 2IQTA 2RDUA 3NQAA 1OFAA 3ZFHA 1GVQA
chains in the Genus database with same CATH superfamily
3HFYA 2AGKA 3WH9A 1FKXA 1K7XA 1Q85A 2R1MA 1BRLA 4I3GA 3W7EA 3FHQA 3G6LA 2DH2A 3GE7A 1NARA 2GJNA 4R53A 4MDPA 2W9MA 1US0A 3QEZA 3CTTA 3NTYA 2VR4A 2JGYA 1W56A 4KEVA 2J78A 1J0IA 3ZVHB 3K5XA 1J0ZA 3VIGA 2DIEA 4UTHA 2V63A 2VCCA 4WJEA 4GVIA 3V4BA 3VIJA 2QLYA 4YCOA 4YMZA 3HIJA 1JPMA 1ZAHA 1EGMA 3W85A 4ZOEA 1AQHA 3N2CA 2C13A 1ZNNA 3W00A 5GJMA 3PUOA 4MNLA 4LUSA 3NURA 3ZWSA 4HK5A 4S3FA 4FIRA 5F4XA 4C1LA 1EEXA 1JPDX 3AWOA 4UTJA 2ZOXA 3WJZA 3POCA 1XR2A 3KW3A 1LLWA 4WKHA 3T0DA 4MZ1A 4X9SA 1W1VA 4GXPA 1E6ZA 4L6HA 4H04A 1AJ2A 2Y6ZA 1OF6A 1XLBA 3CQIA 4GUJA 3C6CA 3P61A 5E9XA 4ADSA 5D33A 5JQ9A 3V1PA 1Q65A 2ACUA 1JD9A 5DMYA 5MF5A 1IT0A 2J7EA 4CD8A 1PHQA 5HA7A 1EF3A 3B0XA 3GTNA 1KFWA 4IPIA 4KMQA 4L56A 2G41A 4XTIA 4JIRA 3OG2A 1J96A 2ONEA 5LNRA 1GOIA 4LQ1A 4BEQA 1SJAA 3OLIA 4YPJA 5CG0A 3GHTA 3S9IA 1LT8A 1KB3A 4JKKA 4UOZA 5I5RA 3PAOA 3QXBA 4GVHA 1HKIA 1JUKA 3L0KA 4QQUA 1OFEA 4PCFA 1HFBA 3W22A 3OZMA 1W1TA 1QXLA 2OODA 3VIFA 2OWWA 2A4AA 5CCZA 4D6JA 3GHUA 3OQEA 1W3TA 3HPAA 4PMNA 1J18A 2W66A 4A8LA 1G9HA 1E0WA 4H9TA 5CXPA 3EX3A 5BRBA 4IL0A 4GLEA 4RLIA 1Z44A 3UWZA 3EPOA 1S39A 4WXZA 3S3GA 4IMFA 1VAHA 2L5HA 4ZO9A 1GWJA 2V2HA 3WJSA 4GRSA 4QNWA 5BXRA 4DAFA 5EBUA 2VC9A 2WW5A 4XISA 3VOFA 3PJUA 2VFHA 4ZE4A 1WAWA 3N15A 2VZOA 2Y8UA 1J9YA 3TV8A 4AWUA 5M1TA 2OXNA 4ILSA 3VNIA 3TQPA 3EOEA 5DT7A 4KCWA 2GVGA 5BU9A 1S5TA 3B0UX 2OU4A 3KDOA 3UY8A 4DPQA 4W89A 2E40A 3W84A 3FFSA 3QSTA 1JZ7A 3SCQA 4AH7A 3LRMA 3QKZA 2WZIA 3FIGA 4S3JA 3GW3A 4D8AA 1UKTA 2FTWA 2OLSA 4LRTA 2HTMA 3IACA 4KWWA 1OT1A 7REQA 5C9RA 3G8RA 3EWXA 4Z17A 3H24A 5EMLA 2J25A 2BMBA 4NNCA 4KIRA 3ZSTA 4OUEA 2Y0FA 3T0TA 1E0XA 2IPJA 4LANA 1XIEA 1F05A 1X98A 1OCNA 4ASTA 5H6HA 3VIKA 1E6XM 1JJKA 1ZY9A 5LA1A 1E9IA 3KBJA 4GACA 4FNRA 4L1WA 1E40A 3IV3A 2VM8A 3KZPA 4JN8A 4FMVA 2PWHA 1UWQA 1VIWA 3K8LA 5IRPA 3VIMA 3B4UA 1K8XA 4UOQA 1KFEA 3N4FA 1BVWA 4JX5A 4ERIA 2AGTA 3I4EA 2E6AA 1W3LA 2MANA 1KM1A 4B4FA 3RK8A 4LUIA 1PIGA 3MC5A 1EHAA 3W38A 4QFUA 1C29A 9CGTA 4JTUA 3SURA 1YDNA 2XN0A 1MNZA 1IGSA 1Q4WA 3DFTA 3ICJA 3PBWA 1G6CA 4C6QA 2Q3RA 1JYWA 4NILA 4TXEA 2R24A 3GXDA 2I9UA 5D2WA 1M7JA 4ADUA 4AZHA 1UR0A 3MMTA 1EC9A 1XBXA 2X09A 2QKFA 2E5BA 4J4KA 3UG8A 4LYQA 4ZMGA 3THUA 1K9TA 1WB0A 3E0WA 3S8HA 1PBGA 4Y9PA 3L4ZA 1JDFA 1GTEA 4J5NA 1BYCA 3PM6A 4M82A 1TR1A 1Z41A 1FFRA 4K2SA 4WSJA 4NXKA 5C0QA 4JQ4A 3TEVA 2C8NA 2P8CA 4KFOA 1PKMA 3W1QA 3ERPA 4F40A 2MNRA 2P0IA 4PEEA 2O92A 2G97A 1TPEA 1XX1A 1CGYA 4G7EA 3B8WA 1RY8A 3RLUA 2DSZA 3A24A 1H1ZA 3HGRA 2W5FA 2PGWA 5CBIA 4BF5A 1QUMA 5DY3A 1WE5A 2FJUB 3AALA 3ARRA 1HO1A 2OEJA 4PRRA 5FJPA 4MM1A 3NZGA 3H53A 3JW7A 3QHNA 1R9XA 1Y5WA 4YIWA 4YWSA 3EOUA 4DIAA 1S2AA 4DVOA 3NQMA 1D2KA 1Q6CA 1QU4A 4MADA 5E70A 2OQHA 1REQA 4E2DA 1J0JA 4YTRA 1L6FA 3W7IA 4Y96A 3TXZA 1KM4A 5D4YA 4XSMA 3BZGA 3OZPA 5FF0A 4JFVA 3TYAA 3T44A 3D0CA 1KXQA 4FS9A 5I03A 3QQ1A 3MKKA 3M64A 1UH2A 1TVLA 4L80A 1Y0EA 3W7GA 4JNZA 1LT7A 4IJCA 5F4WA 5DMLA 5H91A 5AC5A 3LPFA 5M5DA 3M0YA 3H2AA 4HHLA 3TW9A 1SMDA 2PTXA 2JEPA 4FI4A 1N7KA 2A3HA 3W1AA 5HINA 4A3RA 1E72M 1IE7C 2QDGA 2Y2WA 4MJZA 3WNOA 3NJ3A 4L9YA 4JTEA 1XYBA 3B9DA 1Z9AA 1R86A 1J01A 3LPOA 4DEFA 5FF4A 4ZSUA 1BRLB 4H7ZA 5K9CA 1EB3A 1IR2A 1DJGA 4LPCA 2VDIA 1ITXA 3LK6A 3ZWTA 3WH5A 4XD3A 2A7NA 2YCJA 3ITTA 4ZB5A 4IFRA 2VZTA 3QHMA 3WBAA 1WZLA 5DFAA 1HIZA 1HUVA 3SRFA 1SR9A 1FXPA 3LOTA 3I6EA 4MVAA 3AXKA 3BGAA 4OWGA 2GDQA 6A3HA 4I5UA 4GNJA 4CQ8A 4HMNA 1TELA 4PRTA 5HWJA 3HV9A 4KGJA 5CZKA 5KMYA 1RA0A 3S5ZA 2ZA3A 1NOUA 5D9NA 2PTWA 4I7WA 4LUSB 4FX6M 1FUYA 1H41A 4MNKA 3W6YA 2J7DA 4AXKA 4PTWA 2VI0A 4K7YA 1XH1A 3UZWA 1TG7A 4O16A 2HK1A 1O66A 3WLOA 3WQOA 1XLEA 1GHRA 1TWZA 4UUIA 3VCCA 4AHOA 4M7SA 1E4MM 1LDCA 1QWKA 1H7RA 3B8UA 5C70A 1XCWA 1ZCCA 4LT9A 2NX3A 1MEWA 4Q8NA 4IL2A 4DXVA 1ONRA 1TJ0A 2CLPA 3GDKA 2OMAA 1RVGA 4QE4A 3IGUA 4E2OA 4A2SA 3M46A 3LXBA 3WNNA 1DHPA 1OADA 3W1RA 4GBUA 3S5OA 3MO4A 2NV1A 1DEDA 4EAMA 3ANYA 1KBJA 2PWGA 4EPBC 3GG7A 1R87A 3RITA 3CPUA 4V27A 2R1LA 4X0VA 5CC3A 1DWHM 1PHWA 3ITOA 4EX4A 3CWHA 1G4EA 3L0NA 1J0YA 4IH3A 4YL2A 2NZLA 4J2PA 3C0JA 2QF7A 2BVWA 3A9IA 3DEQA 4XK2A 4HBKA 1A49A 4C65A 3OGVA 4Q22A 1CENA 1EFZA 5D2XA 1S5MA 5AC4A 4IJRA 4LC8A 2I5IA 2ACSA 2D73A 4EIVA 3UFYA 4E4FA 1HX0A 3LBOA 4S23A 3ITYA 4O18A 4AISA 3OA5A 3C0SA 1MQQA 3UU0A 3KRBA 2EPMX 4UNLA 1MUCA 3KRSA 5BRPA 4IPJA 2ZXQA 2WVUA 2V3FA 5JIPA 1AH3A 2OSYA 3CTLA 4XQ6A 3L23A 4XKYA 2WLYA 1TCMA 4GINA 4PSPA 1DJXA 2XIOA 5FEPA 2V3EA 3AROA 2OO0A 4O1DA 3S6TA 5I23A 3CAWA 2BGNE 7REQB 2D3NA 1Q7ZA 2PRMA 4ACYA 4D8LA 3VNJA 1W3IA 1GOMA 4NNBA 3S2LA 2NVAA 1BLIA 3IS4A 2R8WA 5G4EA 1F6KA 2IPGA 3WD4A 3SSJA 3QW4B 1I2PA 4DYJA 2XINA 5FJRA 3Q94A 4IQEA 1YEYA 4EP8C 1DP0A 4H00A 2R82A 1UWRA 1WDQA 2P0OA 3TMLA 2BLEA 3TFXA 1M65A 1RLCL 1SFJA 3CHEA 4MUZA 3LBCA 3PUEA 4JTHA 4KEMA 4H8UA 3OBKA 3IJDA 3H2MA 5JU6A 4RE0A 1EGZA 3GNDA 3QTPA 4ZE5A 1CGTA 2QR6A 4BK9A 3F2DA 1IEIA 1BG4A 5ABGA 4DAIA 1I1XA 2XZ7A 4FZIA 1XBVA 5CC7A 3FXGA 2E6DA 3V36A 4PUEA 5D9PA 1R3SA 2VRJA 4DNMA 1GVEA 5D04C 1OM0A 3GDRA 3AYTA 3O6CA 1YE4A 2FZDA 4R5EA 1SU5A 4UR9A 3WBWA 4B3KA 3CZJA 3NL2A 4EPDC 2YCEA 4G8TA 4IWWA 5D9MA 2DV0A 4JY9A 4LB4A 2GJPA 5HMFA 3S0CA 1EQPA 1H60A 3LTYA 4FR1A 1ME8A 3PC0A 3H4XA 3F5KA 2V2DA 4URIA 4YHGA 4AX6A 5HWNA 1UD4A 4MJ2A 4QITA 1V3KA 5LGXA 2QVNA 1DBTA 3SQLA 2OZTA 2V5CA 1EXBA 3VK5A 1NELA 3H21A 3W0KA 1P0KA 1RLDA 2WHKA 4G7EB 3LHUA 1K8CA 2J13A 3L4YA 4B5TA 2HWGA 3G5EA 4JIQA 2XVKA 3D3FA 3RNDA 4GISA 1PEZA 3O0FA 3TTYA 2EPKX 1V6UA 2HRWA 1V77A 3NO5A 2ZUMA 1D3HA 3WD2A 4V33A 4GIRA 5I24A 4O14A 5I0DA 2RHGA 3HQPA 5BU6A 2GSEA 4WR3A 2BY1A 3I3DA 1UIPA 2C1HA 3ZT7A 5E9AA 2D69A 3WUGA 2V5KA 4N02A 1REQB 3UG5A 3UWYA 3SDOA 1JPIA 3CO8A 4I9AA 3GFZA 2I5GA 3W37A 4LBRA 1E1CA 1XQLA 3GK0A 2ZX5A 2Y70A 5A6BA 4B5VA 3DHDA 4F0LA 4AVNA 4G5DA 1XLMA 4ORIA 1A80A 2W79A 5EYWA 1TSIA 4DLMA 2UZ9A 4JYEA 4I7VA 2PMQA 3W1NA 5EA9A 1KQYA 4AZCA 5KETA 1YHTA 1PVNA 1NQKA 1W5NA 3R11A 3PS7A 3P5YA 3LHVA 1JDEA 1RK6A 3N04A 3HFTA 3WEMA 1HJXA 1J11A 1IQ8A 4LY8A 1B3ZA 3E12A 5A6JA 1OYCA 4W5ZA 1YNYA 1A5SA 2NQLA 4GO9A 2QEZA 1KRAC 3GKFA 3USBA 4XKMA 3O6DA 3KRZA 3BLOA 3SN1A 2VQTA 3BOLA 3AMLA 1EUAA 4OZOA 1GK8A 2R9RA 2PAJA 3BG9A 2Z1SA 4B15A 3NDYA 2VZUA 3AZSA 4KF1A 2FPVA 4UQ9A 3VTRA 3I68A 2WMFA 1EJ7L 2PLJA 4UTUA 2YR1A 2DGAA 4AXNA 4AQLA 2QW5A 5I06A 3QFWA 5JH2A 1EUNA 1P0BA 4WSHA 4OV9A 2GQ8A 2X1RA 3QZAA 2ZCGA 1S5NA 3THAA 5D05A 1M01A 3NPWA 1GKRA 2DUXA 3E6EA 4BI6A 5FF2A 4XB3A 1UP3A 4BQ5A 2DQXA 2ISWA 3ITGA 3CXOA 4M6PA 4H9YA 3UCDA 4RXGA 1W3NA 2GYIA 1R2SA 2ISSA 1F3EA 5E93A 1SQ7A 4L4PA 1PO9A 4XAYA 3IIPA 4CQ9A 3EMZA 4FLSA 5HNRA 1UASA 4Q4OA 1G4TA 1Q63A 3KM8A 2OVLA 1BVNP 1YPIA 4KETA 4RE2A 3C2YA 4R27A 3LV5A 2CWXA 4DB7A 4BJHA 2CESA 3LXAA 3UXAA 4D6EA 1MVYA 3TJXA 1D3GA 3VINA 6XIAA 3LA4A 3THDA 1EC7A 2VVSA 3UPMA 3GS6A 4LAZA 4PCPA 4W93A 3C61A 1GQKA 1JF6A 4XG1A 1VEOA 1SSGA 1DWJM 1X8CA 3GU2A 1BWLA 1BAGA 2QCMA 2PC8A 1QOQA 4GVGA 4UTFA 1WKDA 4EVZA 1HKWA 1HT6A 4PFMA 2DT1A 3BJSA 1C7SA 1LL4A 3SN4A 4HB7A 3VU2A 4BWLA 4OVXA 4HNCA 3VE7A 3NL6A 4K68A 3NZPA 4PUUA 1DWIM 4AC7C 4PMJA 2GWGA 1ADOA 2VX5A 3GC5A 5I02A 3BSMA 2HSAA 4LJ3A 3S2CA 1C8QA 3KX6A 2E28A 1GVSA 4FNQA 4XD6A 5AHLA 4GNKB 4KH2A 2PTYA 2XUCA 4OIFA 2QAPA 1VBGA 3WLIA 4C60A 3FYPA 3CV1A 1S3TC 1CXKA 3BLFA 3VD3A 1XLHA 1TPH1 5BXPA 1RBLA 2VEKA 2W3ZA 4NQ1A 4W5UA 2HV5A 5LIKX 3WQWA 3W6MA 3MO7A 4HHPA 5T9BG 2HXUA 4LTSA 2J77A 4EK7A 2VFFA 1RAKA 2D23A 4O1AA 3W4RA 3HURA 1I2QA 1XCFA 2YBUA 4AHPA 4H19A 4ATLA 4RW5A 3B06A 6PTDA 2QJHA 3RU6A 2XWEA 5F2MA 3D6NA 4Z42C 1VEMA 3LMYA 1FWWA 4CKQA 1XI3A 4P7RA 5JBEA 3LLXA 5IHRA 4K3ZA 2CZ5A 1KRBC 4LX4A 1TWIA 4J40A 2XH0A 3OPSA 5I3HA 1SZFA 1XW8A 1OF8A 1OC6A 1L6WA 3GXIA 4BR1A 2J8GA 4X0NA 1RUSA 2PWVA 2FZBA 2F6XA 2YL9A 1O68A 3KVKA 4AZGA 3GBEA 1ZP3A 2YB1A 1OD8A 4XV0A 4QE1A 3EWDA 3U7BA 2Y5EA 2QGYA 2PDJA 1V93A 3TYDA 1JI1A 3CIWA 3NG3A 4ZQNA 2PP1A 4Q8PA 1FWCC 3ISIX 2V0TA 2J62A 4WX2A 3OGSA 2OR2A 3LSCA 5CPQA 1W9UA 2ZWYA 1EA9C 4WF7A 2WQPA 4YNGA 5J04A 1L0PA 3F4CA 5EBAA 3K30A 3R8HA 4AD0A 1AD1A 1ML1A 6CGTA 2B81A 1X1OA 2H9AA 5A5WA 5XIAA 1BSLA 1MQPA 4QAIA 4GFIA 5AFDA 5CZTA 1LM1A 4S3GA 3N73A 2TRSA 5KZ6A 1B31A 3L0GA 3MJMA 4AFYA 1M04A 4DUVA 2NX9A 2OT1A 4HGXA 2ANUA 3RX2A 2BY0A 1I2OA 4JTSA 3VIHA 5I3DA 3EX1A 2DT2A 3LCWA 1DQUA 1LG1A 3SCUA 4P2VA 1E73M 1E1EA 4HQVA 4EPEC 2CWNA 3PNUA 1NM9A 1C9WA 1GVIA 1W5OA 4HD5A 4XZLX 1W5PA 5E6ZA 1XYCA 3NSXA 2VYOA 1WKFA 4Q32A 1XLCA 2D2JA 2YA0A 3EB2A 4UTLA 5AY7A 5ABFA 2NQ5A 4ERGA 4W7VA 2UWFA 4P8XA 3FYOA 3EWYA 1L8NA 1UZHA 2GSHA 2OGYA 3QR3A 4XUYA 3SRKA 4MWAA 3R8GA 2ZX9A 1HL9A 3R43A 3QOKA 2NSOA 3ZJ7A 1S5VA 2Y7EA 3T0BA 5HXMA 1FQ0A 1CI1A 5E5CA 1A3HA 2WAGA 3DFOA 3UNDA 1SO4A 4HSNA 4D2JA 3IJ7A 4JIIX 2J7BA 1RQBA 1U30A 4AWSA 4ALDA 3MV01 4IFKB 1MDLA 2ODOA 5A8NA 1H5VA 1QK0A 4OKDA 1E1CB 4H7VA 4AEEA 1UPPA 2DT0A 2YXGA 3CT7A 2KZHA 6ENLA 1SPQA 1DWFM 3W23A 3U2OA 3WO8A 1LYXA 1OX5A 3MU7A 2VKZG 2XYLA 3ZQ9A 1MMFA 3PAJA 4KWSA 2FTPA 4IJBA 4P8UA 3RO6A 4QDPA 5DEZA 1UJPA 3NM1A 5CLTA 4MNMA 5K4ZA 4MZYA 3EWZA 3T4WA 2YZRA 4TR9A 3QQWA 3T8QA 7XIMA 4R9XA 3PTMA 3QFEA 1QI0A 3UP8A 4B2DA 5HDRA 3LB0A 3S2NA 4E8GA 2I57A 4IMAA 3HB9A 5DXXA 1OGBA 3UW6A 3LENA 1KTCA 2QULA 4B3ZA 4CCZA 5LYRA 2VENA 1K7FA 1BFNA 4DZAA 3TQVA 5F2LA 3ZZ1A 3CPGA 3EX4A 3CGTA 4OOUA 5B7ZA 2CHNA 3IAPA 4BWLC 3SJ3A 4Q33A 3KLKA 3M6DA 5EMKA 3WY1A 4C90A 3I6RA 3SQMA 1WUEA 3AS0A 3PZUA 4LS0A 1YPXA 4Q3MA 5I3GA 4AMAA 4POCA 3PWGA 1UA3A 3MP3A 3PUDA 1DXEA 2QT3A 5D32A 3ZYZA 1TIMA 1FXQA 1VS1A 2OG9A 4OGZA 1Q7MA 2Z1VA 2H8XA 3WQGA 1K3UA 2Q8XA 2SFPA 5DLCA 4PTMA 1ZHAA 4QX4A 5CJ5A 1PDZA 4JX4A 4Q4SA 1UD2A 2PDGA 2BB0A 3WQ8A 3HU7A 1VYPX 3N4EA 3V3WA 1Z89A 1CB2A 2YGYA 2FZNA 3RO8A 4DJDD 3VZYA 2QS8A 1XIDA 3HG3A 4WGHA 1FHDA 3NVDA 1R38A 2Z2AA 4O52A 3WYZA 1QDSA 5DN1A 3DGRA 3HQ1A 3DKLA 4YTQA 3KTXA 2B7OA 2CBIA 4ZZ9A 4LGXA 3SUUA 5IOBA 3TYCA 3W7CA 2KX9A 2E1DA 2YBVA 3SM0A 2CXEA 1ME7A 3FVMA 3HG5A 3QR1A 2VUNA 1FBAA 4MFEA 3BLDA 2CKSA 3W7RA 2BASA 4JYFA 1S2UA 4R34A 2DZPA 3VX0A 4A8IA 2YDRA 8CGTA 4HU8A 1XUZA 3UZXA 1IXQA 2P3ZA 3W2MA 3ZJ6A 1XUUA 1Q6QA 3NL3A 4C91A 2E8YA 4Z1AA 3FNDA 1EBHA 1JZ8A 5CC6A 2X7VA 5C6MA 3APTA 2AKZA 3AISA 2ZWZA 2WBKA 1XYAA 3S83A 4HYWA 4WOZA 3O6AA 3UT0A 4ZBCA 1MRQA 5I00A 3FEMA 1BWKA 2WBGA 1E6QM 3OHMB 3CC1A 4DY1A 4JFSA 3EX2A 1B3WA 1P43A 3P67A 5I79A 1E43A 1OIFA 2ZRWA 3EYPA 2BX7A 1LZOA 3IK4A 4O53A 1V03A 4K39A 3W71A 1ZBWA 2Z1BA 4HN8A 1NOFA 1IXPA 1VZWA 2VFDA 4F2TA 4AZ5A 4U5IA 3BOFA 2HCVA 2YSWA 4NJHA 3RMJA 3AU2A 2WMIA 1XYMA 3SO7A 3DN5A 5C2CA 1AH4A 3N2MA 3M5ZA 4GYKA 4L64A 3WMSA 1XIMA 3O15A 4PMVA 4RJEA 3WUBA 1LCOA 3GH7A 3TW6A 5EMJA 2WZEA 4LVDA 2O7SA 4CCDA 4UTKA 3MKCA 2WSYA 4M6VA 5H8PA 3ABOA 1X1NA 1CGVA 1DJHA 4X2RA 1QNRA 1VFUA 5CPTA 2IQTA 2RDUA 1CB7B 1GVQA 1FWNA 3QY7A 2PDHA 2IQDA 3OBAA 3PZOA 2J6XA 2CZEA 3BMVA 4XIMA 1EP3A 1GW9A 3P6LA 5LNUA 2HNEA 4MWAC 2FH6A 4AVOA 5BOFA 2PGRA 1BGAA 2C15A 1LL7A 3AIWA 2IKHA 3WMCA 1R30A 3UG3A 4GNVA 3OZYA 3TLQA 2ZRUA 1LQ0A 4DYKA 1TPB1 2ZZ4A 3AAMA 4XZMX 4LBSA 2X41A 4JPGA 4MB4A 2FB3A 1V6WA 1TJRA 2UV8G 3GTXA 4O0QA 1Z69A 4IIGA 5ECUA 2C91A 4JGDA 3VDGA 4NI3A 3N13A 4MB3A 3LRKA 4CD7A 4OFCA 5FI8A 3R0KA 2G3JA 3BPWA 1TE6A 1Z42A 2D2GA 3VGDA 1J0HA 1O60A 2J8FA 3U5UA 2PWEA 3UJFA 3L4VA 1EIXA 1CYGA 1BF2A 1P48A 2RJGA 4N6FA 4PEKA 3W1MA 3VD4A 1EP2A 1Q6GA 1HKJA 4GY1A 3QV8A 1RQEA 3CQ0A 3GIQA 3RCMA 2PSNA 4CQDA 3XINA 3ES8A 3QC3A 1CWYA 1IWBA 5AC6A 2DJXA 1OVDA 4CQBA 1PYMA 2J6VA 4GQBA 1CTNA 2X1UA 4MNJA 4NJGA 5T8GA 4CUCA 3AXXA 3N14A 2VC5A 1W0MA 1VENA 3AXMA 4K38A 3CAQA 3LCIA 3MP4A 1UCWA 4DO7A 3PK7A 4Y9OA 4ROPA 4GMEA 4M8UA 1NFBA 2EJ1A 2VRKA 4S2BA 3LMZA 1WQ5A 4U31A 4H7CA 2DW7A 2WMHA 5HWMA 3DFQA 4TUFA 4IIHA 4C6DA 2HQAA 2YYTA 4PMUA 4ECLA 1GYMA 1BKHA 4XVEA 3TONA 3QVQA 1F76A 2IXUA 4GQRA 3NSNA 2CLLA 4FX7A 1FCBA 3LQGA 3N6HA 3R10A 5G2HA 2WMGA 3TROA 3M0XA 1GOOA 2E6YA 2CHRA 3TYEA 1JIBA 4REQA 1PWMA 2CLHA 3N1AA 3TJLA 1VR6A 5IXEA 3B04A 1XDLA 5FJJA 2GJXA 1NDVA 3N2BA 2QPXA 3A5FA 1Z8AA 2VQUA 1TJPA 3H2NA 1HKKA 1AZ1A 3OIHA 3GU1A 2VX7A 4GOAA 4PMDA 3R94A 4PYSA 5L9FA 1CXEA 3W7OA 3VA8A 2Z7GA 1FX6A 2OYMA 1W17A 4RZ5A 4NYYA 1EJXC 2XZ9A 3PPHA 1PYFA 4LVGA 2WB5A 2Y5JA 3IJ9A 5E0CA 3RLVA 3LPPA 5GJPA 3UGRA 3BCJA 4A29A 3MUIA 2F6UA 3CL7A 3O1NA 3WK0A 4K8HA 4XVDA 3ENLA 1QCWA 3CQKA 1RP8A 2Z7KA 1VPXA 5CLWA 2JALA 3NL5A 4E4PA 1DHKA 3WLMA 2BBFA 2BSLA 3OVQA 2BOFX 2GUYA 2V5BA 1JGIA 2WVSA 1H63A 3U2ZA 3ATZA 1ONEA 3TSBA 4US5D 3S5NA 5DX7A 1TUFA 4LCQA 4K1GA 3RN6A 3CAVA 1WDDA 2O4QA 3T2OA 4LSBA 2BFGA 1ALDA 3QV7A 4IXXA 4ES4A 3U4FA 4LEFA 5T9CE 3O3RA 3R5EA 3LERA 2VL4A 3WBYA 1KR1A 4OBTA 2NQ9A 2BY3A 2JEQA 3MUZ1 3AUOA 5EPDA 3CYJA 4F0SA 4HPHA 1F8MA 4B90A 5A69A 1J5TA 3BVJA 4BHYA 1KV5A 3WBXA 1QASA 5I09A 5E0FA 4Y8EA 1F5ZA 2PA6A 1VEPA 1XLDA 4LXFA 3VUSA 5TNVA 2CFFA 3DYMA 3GNXA 1CGWA 2AOSA 1LQ2A 1NWSA 5C71A 1FOBA 3IEBA 1QR7A 4PBGA 4FA3A 1HJVA 2I1OA 3O0KA 2C14A 4LYKA 5AN7A 5LIYX 2E68A 3L65A 3AHYA 4G1NA 5HJLA 3OBEA 4MMWA 4Z2HA 2VRQA 4R88A 3WMLA 1ONXA 1POJA 3JVAA 2IQ0A 4OUIA 5PTDA 1A3XA 4N2YA 4MG4A 4OV4A 2HZGA 4D9PA 4ZQMA 4BF9A 4PMOA 1ZLPA 2VOMA 1GW1A 4U28A 1XLFA 1HZYA 1LTDA 5K9XA 1YTKA 3FVDA 3EA3A 1TJ1A 4HYVA 4XAPA 4WKAA 3WQVA 1PX8A 1ZU8A 1PAMA 3R13A 1FA2A 4K8GA 3GXFA 4DBSA 2VD9A 3MT1A 3TUUA 4H83A 4HA1A 5MKGB 3RYSA 4PZVA 1RJRA 1YIXA 3W27A 5C55A 2A5HA 4E4UA 3MUAA 3BQ5A 1QHZA 3LCFA 4NX5A 3KS6A 3ITVA 1WNOA 3HG4A 3IGHX 2ZRXA 4AEOA 2HVOA 1UYQA 3QTGA 1P6BA 4FSAA 2DSWA 3NYZA 5A8QA 2QUUA 4DI9A 3VNLA 2FYMA 5BRQA 1XLKA 1UZ4A 1T0OA 3ZLGA 3DH7A 1PKLA 3WFAA 3HQOA 1C3FA 3NSMA 1DWAM 4FLQA 5GPRA 4RKAA 1D7KA 5TAOA 2XGBA 1PSCA 1XIIA 1FP9A 3NIYA 1YLVA 1EIBA 3GXTA 4AB4A 4ZO7A 2XN2A 3ALFA 1IZJA 4ORMA 2WNQA 4Y9AA 4I6KA 4DWSA 3KBWA 3ORWA 4QM1A 2ZFAA 3W1UA 2PU0A 1MXSA 5JUVA 4HK7A 4B5XA 3K1GA 4GXWA 3T6CA 4US6A 1WXYA 4AYSA 2NXGA 2Q3OA 3TOPA 1A5OC 1F3WA 4IMGA 2DT3A 1AW1A 3W6LA 2HS8A 5C54A 4D1JA 1F3XA 2AKMA 1SSDA 4GI6A 1EH9A 1EX5A 3DESA 2EPNA 1UR2A 4EOUA 1H7WA 1TA3A 1KM3A 4W4QA 3UPBA 3U6WA 2AL1A 4ZENA 3MVIA 1DV7A 5CPLA 2PDCA 1R47A 3O8AA 4Q8WA 3TNBA 2INFA 3BSGA 4C1KA 1AFSA 3EB4A 1JL8A 3CMFA 4IHCA 5C9ZA 1Z3NA 4MLJA 4GA8A 1KM0A 3PY2A 4FNPA 2B7NA 3I4KA 3QLDA 1VJIA 1GEHA 3V5CA 1FCQA 3MCNA 3GXMA 3TIMA 1Q6DA 4HNNA 3UYIA 9XIMA 4ZCWA 1GG0A 3UZ5A 3FJLA 2CW6A 3FK4A 2WM0A 4QG8A 1E55A 1HO4A 3OYXA 1OFRA 2QV5A 2Y61A 1E71M 4JEJA 1H1NA 3SGUA 1YXCA 2A3BA 2OTDA 1WDWA 3HF3A 1ZBVA 1SW0A 3WLJA 1HJSA 3WH6A 1ISXA 3UWEA 3E49A 5AOUA 5LNWA 3S1GA 5A8OA 5CH9A 1P5BA 1AVAA 2YOCA 1EDGA 1GYLA 1W1IE 3D5HA 3PHAA 1YQ2A 1NAL1 1VRXA 1GKPA 2GVJA 1TRDA 2DEPA 2X30A 2WZTA 4AUBA 3JZUA 2R91A 2C6QA 1E5NA 4U2ZA 3DC0A 5K9DA 4XUGA 2DIKA 1NFPA 2QCDB 2X1TA 1ENUA 4J9JA 4XZWA 3QGAC 3R0UA 2ABBA 4IX2A 1WZMA 3S46A 2QJJA 7TIMA 5CPOA 3TYUA 1IV8A 3WFZA 2GUUA 4L9XA 1X8FA 4QS5A 1AJ0A 4QNEA 3H23A 3W7KA 3P84A 2V38A 1N8IA 1QI4A 2XM2A 3C2OA 4A3YA 3GH4A 4CEUC 1OGSA 4C6OA 1UKSA 1X1ZA 1LUCA 2A2IA 4S38A 4HPXA 4CN6A 2WLZA 3WX7A 4RDYA 3C0LA 4H8NA 4CU6A 1TCDA 1JI2A 1TR9A 5GNZA 1UIOA 3WLRA 2GJXB 1HP5A 1KBIA 1F3TA 3G1DA 4DQWA 3EPNA 1B54A 2D3LA 2WJZA 2BXZA 1OINA 3UESA 4KKXA 4QRNA 5A6LA 2ZZ2A 2CBUA 2DIJA 4BI5A 3ZMRA 2NWRA 1EZ2A 1V3MA 4E8CA 4E3VA 1J6OA 2ZVRA 3KOWA 2Q71A 3SBFA 1AQ0A 5E0KA 2DSUA 1KQZA 3MW7A 3AIUA 3D47A 2NW0A 2PI6A 4O19A 2XFWA 4DWDA 1Z48A 2PDKA 4DZ5A 5SWUA 1EF2A 1LL6A 2DY3A 2VCAA 4PUDA 5FEZA 1U1JA 1BSIA 3B0YA 2WYSA 1KM6A 2E9BA 2NQHA 1OG0A 4NF7A 5EB8A 3L21A 4WCJA 5CPNA 1GJPA 4LVFA 5LKYA 5F1VA 4HHMA 3T55A 3WK2A 1EA0A 5FOOA 2CCRA 3PULA 4X3ZA 3EWBX 2WHLA 1BQGA 3VDAA 3E5BA 3SGZA 4TX8A 3MPGA 1EHNA 2NV9A 1HNYA 4YJ5A 3LZ3A 4PCNA 3AHZA 2QCLA 2VMFA 3AIQA 1PIIA 1QI3A 4DNHA 4F79A 1ZS2A 1M03A 3UJRA 1IXOA 4HPNA 3TU9A 4BQ4A 1XH0A 2A7RA 3V0UA 1SYTA 1FWTA 1L6SA 3WDIA 4PB3A 2QGHA 2OO6A 3M47A 3AMDA 5J8LA 1JFHA 3QH2A 1FCUA 2Z4GA 4HA3A 1UKOA 3BDKA 5BW6A 3QYQA 1HJWA 1A47A 2ZTKA 1R8LA 4GH1A 3H6OA 4EAYA 3PR2A 3TDFA 4PMXA 3DENA 3YPIA 3SY8A 5M3WA 4H9XA 3VE9A 4MGGA 3DHPA 4GHRA 3RILA 3NOYA 3WSUA 4QSFA 2HEJA 4Q6JA 1AD4A 4UQCA 5HULA 5I2UA 4QLKA 1H0IA 3LGEA 4Y6GA 3SIMA 3Q58A 2J47A 1GOXA 2VD8A 5M17A 1R6WA 1V8EA 2YW4A 3ECQA 1GNXA 4YLWA 5G4WA 1L2QA 4L65A 2GGGA 1R0MA 4UQEA 3NPXA 1WZAA 2F38A 5CBJA 4WUIA 1XJBA 4GYJA 1KWGA 1XYZA 4GUHA 5FJUA 2ICSA 4DJEA 1Q13A 1TV3A 3A3WA 2BG5A 1SFLA 3UCCA 1OCJA 1RPXA 4OECA 4BY3A 3UR5A 3LY0A 2OCZA 4IP7A 3IUIA 1TV8A 2XIBA 3GFXA 5C7HA 3R89A 2ZE3A 2DZTA 1WOBA 3EXRA 3P8JA 1UP0A 3LDVA 2PFHA 3LHWA 3NQBA 2QNEA 2PDUA 3OG3A 3OLEA 3JUGA 3HBLA 4PBEA 1L6GA 1QBAA 3OIXA 2WSQA 3GLCA 3CU2A 3IVSA 3TYBA 5DBTA 3VD5A 1TZZA 5CKSA 3KWXA 4QIUA 2ZDRA 4GXMA 4JFWA 3C86A 1KKRA 4D6DA 1HJQA 4GX8A 3BO9A 3TH6A 2ACQA 3C56A 4M56A 2CBJA 3UWWA 5A2AA 2W4XA 3RXZA 3B40A 5AHMA 1V08A 1QNPA 3FJNA 4PB4A 4XAFA 1CW2A 3PWIA 4DWSB 4HZMA 1DL3A 3AFBA 3MHFA 1XISA 1CGXA 1FWHC 2QCGA 2EBNA 3LCGA 2BVTA 3B4YA 3N18A 3ZOAA 1OYBA 3NNTA 3P74A 3UERA 3R7MA 4AIBA 4EKJA 1MW1A 3FHAA 3M7SA 3HPZA 1EYEA 4IICA 1LG2A 3C0QA 8XIAA 4I8YA 2FTYA 4UTMA 1ADDA 1TA3B 3URQA 3WQDA 4FOJA 1JNDA 3FKRA 2FKPA 4AZ6A 3UWQA 1IT8A 3TQ0A 3PPGA 2ZA2A 2D20A 3VGFA 1JGMA 2XH7A 1AK5A 4Y8FA 3VABA 1Q6RA 1RK5A 1X7FA 4JCMA 1WDRA 1E6PA 3EAUA 4AIEA 3EA2A 1TPVA 5AYIA 4YHEA 1IHIA 3M0ZA 4EACA 1HQTA 4WJXA 3KTCA 3FAWA 2J66A 4ROQA 1ZP4A 4TU1A 4S2CA 1WBHA 2WKJA 1W8SA 2PS2A 3IIZA 4M19A 5DCBA 1YDVA 1U5JA 1U1UA 4HNLA 3BXWA 2YW3A 1EPVA 3EMQA 3W7LA 5FKYA 4UNKA 4UBPC 3QV9A 3LTPA 2EJAA 3HQNA 2PDIA 2GOKA 4FXSA 2IKGA 3AUJA 3K13A 2A3LA 5LHEA 3N2TA 3QY8A 3LCLA 3GAYA 3OVPA 3RAOA 4JD4A 5D02A 2WMJA 1Z32X 4MB5A 1GT8A 3P60A 1YTEA 4X22A 5GQBA 1ITUA 5D9OA 4F4RA 3ELFA 4CN1A 3B97A 4RZ6A 3THCA 1BXCA 2BOGX 2PEVA 3UNTA 3LNMA 3W7NA 4FK9A 4HT3A 2WXDM 4NZ4A 3SB0A 1UR8A 4UQBA 4NKCA 4RE3A 1IIHA 2ZVIA 3N11A 3RPDA 3PTKA 1DYSA 4F8XA 2O0TA 2ZRVA 1TX0A 2Z26A 3IJ6A 1M3UA 3M0IA 5FL1A 3ZXWA 1IEWA 1JXKA 3KLLA 3P5ZA 2AAMA 2Q01A 4AY8A 4DYEA 4R7OA 3TQKA 4PUWA 5E09A 4L5ZA 1U83A 3QV6A 4E8DA 4DRSA 1WX0A 3BLIA 5REQA 5HNNA 4A35A 4B5WA 1J79A 4RW3A 2WKGA 3CHDA 1BPLB 4DM2A 2XHYA 4CNTA 3FKKA 1BXNA 1LUCB 1M9HA 2VEPA 4CNPA 4HMEA 4OHQA 3AOFA 1G01A 2ZZ1A 3QPEA 1YDOA 3SCTA 3KP1A 1J6PA 3BQ6A 4O1FA 4DWSD 1FH9A 1P7TA 4IGMA 2DSKA 3WUEA 3PFMA 1KC7A 3S2MA 2JBMA 1C8YA 2BWGA 3BUVA 1IEQA 2WPBA 1EZWA 4B16A 4YTTA 3WIJA 1J8VA 2QJGA 2Z2UA 3VNYA 1XKYA 4DO6A 1C90A 3LBMA 3E96A 2DW6A 3IGXA 4BF7A 1XHGA 2GGHA 4CNOA 7ODCA 4ZO8A 3CMJA 4LFYA 3GDLA 3CBWA 2OYLA 5KINA 4HSOA 3PJXA 4TMBA 1W1B1 5CGMA 4G2DA 1EJUC 4JNMA 2F8QA 2DZSA 1EJWC 1A5NC 2WNZA 3NR0A 1OX4A 2TSYA 3UJSA 4W88A 3MQTA 1RY0A 4UCGA 4M51A 3FA4A 4U3CA 4NAEB 3R1ZA 1MUMA 3L2IA 4DJEC 4UFIA 3EWUA 2X05A 1P6CA 3T2QA 4B5SA 1E0TA 3QR0A 3APGA 1WPCA 2OX1A 3VX1A 4MKSA 4PBFA 3FX4A 1SM9A 2G37A 4J3XA 5HQMA 3QF0A 3UY7A 3DHFA 5A1AA 3MSGA 1KA9F 4AW7A 3GVVA 4PFHA 5FD0A 1FHUA 1W3HA 2P1FA 3MJYA 2E1WA 4MY8A 1VFFA 2J7CA 4RL3A 3PF3A 1FHLA 4YN5A 1QPRA 2QDDA 2Q09A 3WJYA 1LWHA 4MY9A 2FHFA 2G4JA 2PDMA 3BAYA 3LHTA 1R3RA 2FGZA 2ZRZA 4GABA 2FB2A 4TVUA 1SW3A 2CXGA 5A6TC 1GVFA 3QPYA 4KRZA 4WY0A 1PIFA 3JZEA 3E2SA 3ARUA 3RMEA 1LROA 1JPKA 3GVWA 2QAFA 5HJXA 3PJWA 3IUHA 4QG6A 2W61A 4WRHA 2QUVA 1Q6FA 2QDHA 5A8MA 2JIWA 4W7UA 2C1IA 3CV6A 1W1A1 1ZUAX 4HZ7A 1EL3A 2V3GA 3CHFA 1M6JA 2FPTA 3CH9A 2G4FA 5HK4A 4QAWA 1X96A 2A1YA 5CPSA 4LVBA 4RV3A 4AIOA 4PTNA 4H1ZA 2DVUA 2BV9A 4UQDA 4M6UA 3FA3A 2PDLA 2W0UA 2X7WA 3KFTA 4N9BA 3QMSA 1ZPTA 2C0AA 3O7UA 3SADA 3TA6A 2ON3A 1L8PA 2Y8KA 5FCZA 1BD0A 3G22A 1S2TA 2UBPC 3GR4A 2VCBA 1UZDA 2G3IA 4PUNA 2YLLA 2PTDA 3NQVA 3A4AA 2DZXA 1XFCA 3U2EA 3VKJA 5KTLA 3EBVA 1GEQA 1H61A 4N4QA 3E0LA 4F66A 2I14A 2Z27A 3RM4A 4D6FA 4D6CA 5HUPA 2G3FA 4Q8UA 2HPMA 3KZSA 3WD3A 3CMGA 1SZGA 4F9DA 4DHGA 2PCEA 2VX6A 4XWUA 4BQ3A 3GC2A 1ODZA 3CZEA 1K6WA 2E9MA 5JMUA 3W26A 2DU2A 2GQ9A 3RR1A 4U4MA 1JDDA 1PZ3A 1FWEC 3UXKA 3N25A 4YVPA 4PTVA 4C5ZA 1IWPA 4FOKA 4WY0F 1TVPA 2YKKA 2TYSA 1SJBA 4ZL1A 1TKKA 3INPA 1XQKA 3B8VA 4NIRA 3PANA 2JKAA 2PBOA 3M0MA 3RUBL 3CM4A 3PZ9A 1UUOA 3U5YA 2C3ZA 3IJLA 3VKDA 2WC4A 3VFCA 5AYZA 3VGEA 1MRAA 3IIVA 4LAOA 3VYLA 2ZA1A 3MWAA 3AICA 4TVDA 1KFJA 3G1HA 4R33A 4Q8VA 6REQA 1US3A 4HIBA 3ZVIA 3W76A 4P7QA 5BZAA 2VVNA 4JTQA 4V15A 2FZ8A 4GY7A 4GYPA 1RCXB 4RCXA 3WENA 3ARPA 3G0UA 1XGDA 1C8XA 3WEZA 3QYSA 3W7JA 1RBOB 3BL3A 1XBYA 1VP5A 1JRCA 3CHVA 3QW3A 4JHOA 3QHOA 2YDSA 1E6SM 2BGSA 1UQYA 4PR4A 4EPKA 1D8WA 4O10A 3BSHA 5U4NA 4PN2A 1ZAIA 3QGKC 3LZ5A 2C0HA 3GNPA 3IRSA 4WZHA 3B3DA 2XSXA 3GHRA 1OSEA 1TPC1 4WSKA 1W3KA 3NQ2A 3A5VA 5GNXA 3WMBA 1JDAA 7A3HA 2HDJA 3GNRA 2DORA 3CZLA 1G4SA 3A6OA 3L2LA 3TJ4A 3TAKA 4AZBA 2YYUA 3U0HA 1XIHA 3RF9A 2X40A 1OJXA 3TR9A 1U5HA 4QJ1A 4GUIA 3P0XA 3WK3A 4AD1A 1LRQA 3LSBA 4KS0A 1QMLA 1S2VA 1M1BA 1Q8AA 4B5NA 3TW7A 3MBDA 2GJRA 2PD5A 2W63A 4LB3A 5DANA 4V2XA 1QPNA 1ME9A 3A4WA 1VGAA 2IMRA 4WJ8A 4V1YA 4PA8A 3OYZA 4C6CA 5G2WA 3UBPC 4PUMA 1JD7A 1P0DA 4O50A 2Z29A 4IPPA 3GXPA 2FVMA 1O4UA 1NJJA 3IVTA 3WQEA 3BGGA 3EOLA 3ARVA 1RCOB 1H50A 4RNIA 2Z1WA 4B9YA 2QPUA 5D2TA 2NXHA 4NRRA 4O15A 5GVJA 3GYEA 4NX0A 1XSIA 3VDBA 3MMDA 1LBLA 4NT0A 4L1XA 1O5KA 1XLJA 3AMGA 1R2RA 2ZUWA 3TE9A 1JR1A 5LGZA 4LUTA 1EC8A 4WIWA 2NUWA 3NYDA 2VNCA 4ZOCA 5HQLA 1GHSA 1GORA 3WQ6A 3OOQA 4ACZA 2V81A 1P7TB 5BNKA 3NXFA 4OJYA 4J3SA 3HV8A 1TTQA 1E56A 3G0SA 1XRTA 1RSCA 3KCLA 3F7JA 3U3HA 3MMUA 4JTLA 5CG7A 3VUPA 3TC7A 1H3GA 2P5NA 1BHGA 4Y9MA 1I60A 1H09A 3I65A 2ALDA 4N0RA 2RDWA 3V5OA 1ZGDA 4E2BA 3LCXA 3MYPA 1KV8A 5I3KA 1RHCA 2W91A 1XGZA 1UMLA 2O55A 3CV2A 3NQAA 4HOXA 3ZFHA 5DRCA 4Z1YA 3WELA 1X97A 1O5QA 4DXXA 3E02A 4ZTYA 1A5BA 3L5LA 2VFGA 1A5MC 3EB3A 3W24A 2EGZA 4FEZA 4DBUA 2FHCA 1DJQA 3MZ2A 1P0EA 4I5XA 1AMYA 4PMZA 4HMCA 3PBMA 4Q4MA 3L9CA 5D30A 3DECA 4HZ6A 2B7QA 4WGXA 3VGBA 1MO0A 1KRMA 1KCXA 3EMCA 3KCOA 2E5DA 3AIBA 5T26A 5I6SA 2XG9A 4O0ZA 4IMDA 3RPTA 2Q02A 2DQWA 3PZTA 4O54A 4ZFMA 1LLZA 1J2WA 1IEXA 1O94A 3W2LA 2ZX7A 1JQVA 4PULA 5BMXA 4LCRA 3L67A 3KBVA 1HTIA 1UWUA 1W9DM 1Q7QA 1RJQA 4HZ8A 4H8HA 1GPWA 4WY0B 1QWGA 5G1MA 1ECEA 1YNPA 4G1KA 3WQCA 3UJEA 1W31A 3DU0A 1V3IA 1YE6A 4PL2A 4Y7EA 4Q6XA 3PBUA 5FJOA 4U3AA 3A23A 4RXFA 3TP4A 3RX3A 1FWIC 3CLWA 2J88A 1ZJAA 1DIDA 3LS9A 2YBTA 3AHXA 2NUXA 4MHBA 3XIMA 3CK5A 4IOTA 3H12A 3BURA 4PUJA 1NEYA 3VOJA 2XIIA 1WOAA 1EDTA 1V6YA 2ZUSA 4BI7A 3BAWA 3WQ4A 1E6NA 2PRLA 4P7LA 5JVLA 1I75A 2DVTA 3CQHA 4H2HA 2NSXA 2I56A 3M43A 1F73A 2O9TA 2OOFA 1QW9A 4JX6A 3BANA 3WZ0E 1DWGM 5B80A 4HA0A 4QS6A 2DUZA 2V5JA 1OX6A 4GYPC 1GQLA 1FDJA 3RR4A 2BXYA 1KFBA 2CLKA 1W2PA 4LAKA 4TO8A 4KT2A 5HNUA 2PTZA 3Q45A 3HM7A 2VJXA 3C5QA 4U10A 5BXTA 3VMOA 1R46A 2G50A 4BA0A 5HR6A 2OQYA 1SFTA 1TRIA 2FMOA 2PRHA 2HVNA 1H7OA 1V51A 4MWAE 4QXIA 1P1MA 5ENLA 1XS2A 3BG5A 1EEPA 5JXQA 3TFCA 3WLTA 2F2HA 1MXGA 4TX6A 2B7PA 3OEXA 3P2VA 1H51A 4WD0A 4GI4A 4IPLA 3PSVA 3PBYA 3OU8A 4YYCA 1FWSA 4HYRA 1GJUA 1W6TA 1ODUA 1E0UA 2FVLA 2Z6IA 4Z0JA 1TWDA 3GUGA 5HOSA 3NAVA 4NAFA 4IXHA 3W3OA 2Y1HA 4N9CA 1XRSA 1EX1A 1R3QA 1KXTA 3EKLA 4E5TA 1Q4NX 1YTDA 3F2CA 5DQPA 3MA8A 1B3YA 3BOXA 3NZQA 1O6IA 1EOMA 3Q4DA 4XZHA 3DG7A 5I3JA 2E7FA 1PS9A 3GU9A 3MSRA 4QQ3A 1MQRA 2DPEA 3QN3A 3WJWA 6REQB 3OVRA 2DZUA 2PZNA 1S5WA 3LQLA 3CL8A 3P8IA 1HG3A 5DBUA 2PDFA 2CETA 5FACA 3BCDA 4CNUA 2ATSA 1CCWB 1GKQA 1GTHA 3M1ZA 4GG9A 4L61A 3V0TA 2KAUC 1UZ1A 2E9LA 3H22A 4HNUA 3F4DA 3DFSA 1KTNA 3FA5A 2F61A 2PBGA 3MY9A 1A5KC 1GQJA 2RUSA 1EPXA 5LZLA 3AHVA 3R4IA 3SW6A 4O57A 2VTFA 4OU1A 1WKEA 4PMYA 3NXLA 2Y5SA 3OLGA 3NPUA 2X0YA 4HPGA 4D1IA 2OJPA 2Y63A 4ICNA 3UZYA 1ITQA 1ZAJA 3N17A 1JCMP 1ELSA 3UJ2A 4DBDA 2DH3A 4U33A 4I8DA 1HP4A 5KITA 2ZX8A 3ABQA 3AYRA 2FDSA 4GYFA 1TQXA 3ZR5A 4ATDA 4O8AA 2UY2A 3KE0A 2OELA 1JFXA 1NWUA 2C7FA 4I6VA 4JHMA 4O4WA 1H62A 2G3MA 1Z6KA 1WAUA 2EKGA 4W8AA 2OLAA 2BVYA 2ZUNA 3GY1A 3L4TA 5CJMA 2PU1A 1RH9A 5DF0A 4AWTA 4BFAA 2YCLA 1FP8A 4IUGA 1TWSA 4PCTA 4C5YA 4XO7A 2HBVA 4CU7A 4IM4A 3CYVA 3C2RA 3FLUA 2QIIA 4Q8QA 4OOZA 4HNTA 3IV8A 3ITXA 4CD5A 2VHLA 2PZ0A 3F4NA 5ABHA 2XVLA 1AW5A 1G69A 4UMCA 3SCNA 3WD0A 4UMAA 4A4AA 4NZ1A 2Y62A 1V02A 3O9NA 2PD9A 4WDWA 3BCFA 3CT2A 2DZVA 2FQIA 2GZXA 4LUTB 2CNCA 4HP5A 1SJDA 1OFBA 4HPJA 2ZZ5A 4MOZA 1POKA 4AD5A 5FSEC 3O05A 4HK6A 3DYPA 5FA5A 1A50A 2WQDA 3TWAA 4ACZB 4NJKA 1F7BA 1JYXA 3N3TA 1T99A 3G1VA 1Q3NA 4XBSA 3WNKA 3BV4A 3W87A 3S9YA 1QT1A 1VFLA 2G5WA 4ZXOA 1PZ2A 1BGGA 4QISA 1CEOA 4RK8A 2VGIA 4FXRA 1QO2A 2HPIA 4B3LA 4GC4A 4M0XA 3K46A 3WLSA 1IEVA 2Z1XA 5DT5A 5HMSA 1RXOB 3QQ0A 3EDKA 1VH7A 1WBJA 4NZCA 1NH6A 1KXVA 2FVKA 4J3TA 4G9PA 3DXIA 3K1DA 1DXIA 2O56A 3ZM8A 5K3VA 3WF4A 4DX3A 5K4XA 3BW3A 5TIMA 4JKMA 3MB9A 4JBRA 3PNZA 4Q8OA 1OQFA 3O2LA 3B9OA 3PZQA 2FH8A 4ZFCA 3GVGA 4N42A 1XLIA 2PGFA 2PODA 3T78A 4R85A 1UWAA 2P8BA 5IFPA 2QMKA 1R3WA 1AW2A 4UTIA 2ZXDA 1WDSA 1XYFA 1M7XA 3LCHA 4J27A 2O9PA 5A95A 4UR7A 4NUWA 3AIRA 2ABAA 4QLJA 3BLKA 3CASA 4FHAA 1F07A 4RUBA 3PTQA 4WDUA 3G77A 4WOQA 1VFSA 3WDHA 1I45A 4GI9A 3CHCA 2YL5A 4GVFA 1V0MA 4MIMA 4A3UA 1X7IA 2VUYA 3M5XA 4E0CA 3QOMA 3TLLA 4PH6A 2VURA 5I3FA 1ICPA 1UP2A 3UZZA 3FJ6A 4Q4PA 3TN5A 4AZIA 1YXYA 4HJWA 3GFYA 1M7PA 1H2JA 2OX4A 4LS2A 3SZ8A 1UH4A 3WF2A 1CLXA 2J8TA 1SMAA 3HPSA 3STCA 3KEHA 4M1RA 2PP0A 3TC3A 2CEQA 5K7JA 4LUJA 1O5XA 1VF8A 1L2UA 1QW7A 2WJEA 2XIMA 4F3HA 3GWQA 1LBFA 4W85A 3SUVA 3W1LA 1TTPA 4LYPA 4X63A 1HL8A 4XKYB 3W7MA 2ZICA 3C2FA 3PZMA 4P61A 3DCPA 1B9BA 4NVTA 1P1XA 3MCMA 4Q8MA 1BG9A 4H8VA 4WKFA 3E38A 4B91A 3LGDA 4TOQA 1JDCA 3M0KA 1XXXA 4EXBA 2ZBTA 4DI8A 1CXLA 3GTIA 2IPWA 5AC8A 1FWAC 2ZE0A 5F2IA 1VC4A 5AKQA 6TAAA 2Z28A 3LXCA 5C2GA 2X8RA 3CZGA 3B9EA 3RRXA 1JAEA 5CGQA 1O12A 5CBBA 5DRIA 4WDTA 2P50A 4R9OA 3A3XA 3ONCA 2J27A 3TXVA 3GC4A 3LGGA 4LS1A 4YS1A 1JZ6A 2X42A 2PDBA 4K36A 4L1GA 5XIMA 3A47A 3UA4A 4GGBA 1UG6A 2VEFA 1W2VA 4H6EA 3MI3A 3SUWA 3GKAA 1I9CB 1ZCOA 1W1PA 1TV7A 5XINA 2QCFA 3CQJA 4NY2A 4JNYA 1XL9A 8RUCA 4NAFB 3WF3A 4ERAA 2ZX6A 1CNVA 2VOTA 3TWBA 1R7OA 4QHRA 2YCKX 2RFGA 4DBEA 4I7UA 4V1XA 2CZFA 4YCPA 2WV8A 3GXNA 3NDZA 3NO3A 3USZA 3ATYA 2XISA 2ZDSA 2DJLA 2RKXA 1HJUA 3FGCA 5D2YA 4IIFA 2WNNA 4UMBA 3UWVA 4HTYA 2B0MA 1X6LA 1VQTA 4FIQA 4C6LA 4GD0A 1SVDA 3E3HA 2HISA 2GDVA 1YW1A 3POHA 3N9SA 4JTGA 4JQ3A 1EDQA 3PZIA 1OGGA 4LALA 3BG3A 3MDUA 4L4MA 3F2BA 3W2KA 4ZSTA 1QRQA 2V2CA 1QTWA 3PB2A 1RCQA 4RNHA 1NTHA 4Z1CA 1QNSA 3EDDA 1P0NA 1S2WA 1JULA 2D2OA 3EKZA 4MJ4A 3ARWA 5AB3A 4UTTA 5RUBA 5BOEA 1NP0A 1RD6A 5G4HC 1JZ2A 4PUKA 1V6XA 3MSYA 3WG6A 2NX1A 3IJQA 3G1FA 2WKLA 3S2JA 3EDEA 4NZFA 3GAKA 3C4UA 1ZBCA 1B57A 3GIPA 5KZMA 1U2YA 1SJCA 3TN3A 1F8IA 2BNJA 2PE4A 3RIKA 4EXAA 1LWIA 4F0KA 3W01A 3JR2A 1CXHA 3T9PA 1PJ9A 3RM8A 1W1ZA 1ICSA 4QBXA 2LLEA 1PTDA 4R3UA 3KOYA 3WBEA 1WP6A 2FMNA 3NQ8A 3DFPA 2FHBA 3S42A 1DKWA 5FL0A 5EMYA 1MFVA 1JRBA 4LCSA 3SCRA 3BAIA 4ZQRA 3URNA 4HSHA 2IKIA 4AZCB 4D8ZA 5FIPA 2QCNA 3DAQA 1TB3A 2YCLB 3AC0A 4ZA0A 4KQNA 4HU3A 1TPDA 3VCNA 4HMDA 3F1QA 3HJZA 1XC4A 2D2HA 4DO4A 1TO3A 3UCQA 4Y9NA 1F4HA 4JICA 3EXSA 3WLPA 4M29A 2XM1A 3H55A 1O7AA 2WSKA 3FV9A 1K9DA 1H4PA 2FPYA 1LOQA 4DO5A 2UY4A 3B8IA 3KOXA 1MDRA 5AC7A 2FZMA 1L6YA 3ARXA 4FO4A 2PURA 2GSJA 4GJIA 2NLIA 4RR4A 2A79A 2HXTA 4GH3A 4S3EA 1ZL1A 4OTKA 4CLMA 3WEOA 1DJZA 1KCZA 4NNAA 2ALRA</