2VG5B

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 97
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg5B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5B03
4F4YA 1RA7A 5F9NA 2BE2A 1N48A 4NYZA 3MEDB 3HHKA 4QWAA 3RB4A 5KG7A 3MR5A 3KK2A 5KG2A 5T14A 4KFBB 5EUHA 3EPIA 4Y2CA 2F8EX 5I42B 4ED8A 1TKZA 5DG8A 4IG3A 2C28A 2ZE2B 1N6QA 2YNGB 3BREA 4YR0A 1RT1B 3KK1B 1RYSA 3MECB 1HQUA 1VRTA 3KK3B 3V81B 2WK4A 5DQGA 3DOLB 3DI6A 3CDEA 2B5JA 1JLEA 1EP4B 3OHBA 3OL8A 3KLEA 3BSNA 1HYSB 5CYMB 3LP0A 5C5JA 1SV5A 3BQ0A 1RT5B 1VRUA 4IFYB 5FDLA 2VG6A 4HKQA 3QLHA 2OPRA 2HNYA 3JSMB 2IJFA 2XWYA 5KFUA 1HARA 1TL3A 4O4GA 1C1CB 1S1UA 4H4OA 5L1LA 3KNAA 4I2PB 5HP1B 4PUOA 1SUQA 2AX0A 4WXOA 3MFIA 4ECWA 3SI8A 1JLCA 2ZD1A 3ICLA 3DYAB 4RNMA 4ECTA 3QGIA 3BQ1A 3PW2A 3C6UA 5K14B 3IN5A 4IFVB 5KFBA 4ECSA 1S1TA 5D3GA 2FLNA 4H54A 5KFAA 2YKMA 4PQUA 4Y34A 5F9LA 3KJVB 2GIRA 3QYYA 4I2QA 2ALZA 4Q43A 3E01B 4MKBA 3C6TB 2FJXA 4X2BA 4ZVHA 1BQNA 3KLFA 4KHRA 3VQSA 4R8UB 3HVTB 4RW9A 4RW8B 1S49A 4ZPCA 3KMSA 4RW6A 4ED1A 1JLFA 1ZETA 4URQU 3D5MA 3GQCA 3CJ4A 3I0RA 5I3UB 3DLKB 5CYQA 4RNHA 5KFZA 4RNFA 2W8KA 4WFXA 1LWEB 2W9AA 3TQ1A 4O44B 1TV6A 5HBMA 1FKOA 3KHHA 1LW0B 1TVRB 2R2RA 4WFYA 4YP3A 3T5HA 5DLFA 4XPCA 1LWFA 2VA3A 2UUTA 4K4TA 3T5LA 1C0TB 4PWDB 1RTDB 1RTHB 4Y3CA 2C2EA 3V6DA 4KAIA 3OSNA 2HNDA 5KG1A 3G6VA 1S10A 3GV7B 2V9WA 1R0AB 3FFIB 3LAMA 3CJ5A 2VG7B 3T1AA 2UVUA 2B6AB 2BRLA 3DRSA 4K4SA 1DTQB 4RW7A 3CJ0A 2XC9A 4RW4B 2BE2B 3QO9B 1KHVA 2V4QA 3H5YA 1TL1A 3RBEA 1S0NA 3KK2B 3N6NA 4KE5A 4K4UA 3DLGB 4NRUA 2FJWA 2RDJA 1XR6A 1RT7A 1S6QA 4MFBA 5JUMA 5EDWA 3BSOA 2IM0A 4YR2A 3MR6A 2UVVA 1TKZB 3G86A 3H2LA 4NLYA 4Y2AA 2RF2A 1RAJA 5KFSA 4ED2A 3RAQA 3KLVA 2JEFA 2R2UA 2QV6A 3M9MB 4NZ0A 1VRTB 4MK7A 1QAIA 4TLRA 3CIZA 3DI6B 3HKWA 2ILZA 1JLEB 1C2PA 4TY9A 3LP1A 4KB7A 2AWZA 4ICLB 4G3IA 2W7OA 3PJXA 1TKXA 3LAKA 2UVWA 3PHEA 4WE1A 5FDLB 3Q8SB 2OPRB 1TKTA 2HNYB 3PW7A 4URSA 4MH8A 4RNNA 5J2MB 4O4GB 5C25A 1S1UB 4KKOA 3CO9A 1C0UB 2CJQA 3KOAA 4PUOB 4EEYA 1SUQB 2YNIA 4U6PA 1S97A 1T03B 1N4LA 1JLCB 2V0NA 4FS2A 1REVA 1LW2A 3OHAA 3DDKA 3TVKA 5KT2A 4KV8A 3CJ2A 3BR9A 2DPJA 4DL4A 3IS9B 4U7CA 3H4DA 3M8QA 5D3GB 1IKWA 3CVKA 4WFZA 2WONB 5DGAA 3RB6A 2YKMB 3FRZA 5KFRA 3M8PA 4YQWA 5F8MA 5EWGA 4IH5A 2R8GA 3GILA 3KLGA 4I2QB 3MEGB 2R8JA 1DLOA 3ITHA 4WZQA 3LP2A 2RDIA 3H98A 3KLFB 1RTIB 2IC3A 3KLIA 3BJYA 3OL9A 2AGQA 2WCXA 4WXWA 4RW6B 1BQMB 1JLFB 2YNFA 4LSNA 4MIBA 4IH7A 4TYAA 5KFHA 3I0RB 4IDKA 4ZP9A 4MKAA 4DL3A 5KG0A 1FKPB 3I0SA 1K1QA 1IKXB 1RDRA 3QGGA 1TV6B 2W9BA 3KMQA 4EBDA 2B43A 1HQEA 4DL5A 2R2TA 2C22A 2J6UA 5DQHA 4J9PA 3V6KA 3PVXA 2OPQA 3V6DB 1N5YA 4O3QA 4HYKA 1KLMA 1QE1B 1IKVB 4NLVA 3DRSB 4RW7B 4YMEA 2W9CB 4F4ZA 3PR5B 2JC0A 3G6YA 2JEJA 5KFEA 2VG5A 3CJ3A 4TQRA 1RT2A 3FSIA 1TL1B 1S9EA 2HNZA 1QUVA 2FVCA 3FQKA 5DLGA 4ZP7A 4J9RA 4ED3A 5J2NA 5KT5A 2BQRA 3NGDA 2FVSA 1RYRA 2YNHA 1S6QB 5KFTA 4JUZA 3H40A 2RKIB 1HNVA 3H5XA 2IAJA 5KFNA 1LWCA 5L9XA 3GIKA 4ECRA 4NLUA 4I7FA 2D41A 3LP1B 1FK9A 3G6XA 3OLBA 4ECXA 2BANB 1CSJA 5J1EA 4WE1B 3RAXA 1TKTB 3BGRA 3RBDA 2FJVA 2AU0A 4KKOB 2HAIA 4QPXA 5C42A 1S48A 1EETB 5DGBA 2ASLA 3PJWA 2BQUA 3QIPA 4KO0A 4J9KA 2AGOA 2J6TA 5L1JA 3MEEB 5DG9A 4IRDA 3PW5A 4R5PA 3JYTA 3N6LA 3UDLA 2D7SA 2WTFA 4EBEA 1JKHA 1UWBA 4WYLA 3KHLA 3HVWA 4J9SA 3M8QB 3UPFA 4RZRA 1HMVB 3KLGB 1JXLA 5C24A 1MMLA 2UUWA 4IH6A 5KFPA 5KFWA 5F8LA 4MK8A 1DLOB 3ITHB 2WOMA 4WZMA 2HMIA 4Q8EA 3MFHA 3DLEB 5F8JA 3KHGA 3V6JA 4J9LA 4Q0BA 4RU9A 2IC3B 3KLIB 1WNEA 3LANA 4NCGA 2OPSA 3IRXA 3QIDA 4DG1A 4O4RA 2YNFB 4LSLA 3TAMA 4B3OA 1NNDA 2B6AA 4IG0A 3KLHB 1IKYA 3DM2B 5J2QA 2XCAA 3RB3A 4FS1A 2E9TA 2HWHA 4KSEB 5F8NA 3DMJA 2GIQA 1T94A 5KFOA 3PR4A 2I5JA 5JXSA 2R8IA 4KBIA 1S9FA 2IJNA 2OPQB 3MEDA 2IM3A 4RUCA 1KLMB 3HVAA 1RT6A 4ZPAA 2C2RA 2ATLA 2FLPA 4IG3B 1KHWA 4F4XA 2ZKUA 4KFBA 1N6QB 5KFGA 2V4RA 4NLSA 3H4BA 1HQUB 3DRRA 3H59A 4LQ3A 3I5BA 4JV0A 2D3ZA 5I42A 2B5JB 4ZHRA 5DQIA 1RT2B 4NLTA 3KLEB 4Q45A 2ZE2A 3LP0B 1SV5B 2YNGA 2D3UA 4O3PA 2FVPA 3KK1A 5J2NB 3MECA 2XCPA 4NLGA 1VRUB 4G1QA 2YNHB 2VG6B 3QLHB 3T5KA 3NMAA 1EP4A 1TL3B 4IOBA 4H4OB 3RB0A 4ECZA 3IG1A 5CYMA 1HNVB 2IAJB 4ZPBA 5F8GA 3GV5B 1LWCB 1RT5A 4IKAA 1JLBA 2ZD1B 3JSMA 1JIHA 5KFMA 1S4FA 3NAIA 1XR5A 3DRPA 3KHRA 1QAJA 3SFUA 3NL0A 2DPIA 3C6UB 5KFYA 4I2PA 5HP1A 5KG5A 2BRKA 4DL7A 1RT3A 4IQXA 2UVRA 1S1TB 3BGRB 2VA2A 2FLLA 5KFVA 1J5OA 4PQUB 5K14A 4GC6A 4IFVA 3EZUA 4URGA 3QIPB 4KO0B 3Q8QB 3GYNA 1NHVA 4ZVGA 5DG7A 1BQNB 4NLXA 1K1SA 3KJVA 5EWEA 1T05A 1JKHB 1S1XA 4RW9B 2WRMA 4IR9A 4DEZA 3V4IA 3MF5A 1HNIA 5CYQB 1MU2A 5HBMB 3I5AA 1FKOB 4MIAA 4NLQA 4R0EA 2BR0A 2XI3A 5I3UA 1LWFB 2WOMB 4F50A 5KFDA 4GC7A 4O3SA 4O44A 4Q0BB 4ZVFA 4NCGB 5KG3A 4IRCA 4ECQA 4EO8A 1TVRA 4DG1B 4RUAA 2HNDB 2OPPA 4LSLB 1HPZA 3TAMB 5J2PA 4K4XA 3H5UA 1S6PA 2JEGA 1C0TA 4ZP6A 1IKYB 4ID5A 1RTHA 2R8KA 2BQ3A 1XR7A 4ED7A 3CWJA 5KFFA 4EO6A 3FFIA 1TQLA 3DMJB 3PW0A 3IGNA 1DTQA 4YR3A 3GV8B 1RT7B 4RW4A 3QO9A 4MFBB 4DL2A 1GX5A 2J6SA 4JV1A 1RT6B 3QGHA 2RF2B 3DLGA 1DTTA 3DRRB 3Q8RB 4J9OA 4TYBA 4ZHRB 1C1BA 1S1WA 5KFQA 2E9ZA 3E51A 1TKXB 1RT4A 2R2SA 2XGQA 5HROA 4G1QB 4FBUA 4K4YA 3NAHA 4O3NA 5C25B 1ZTTA 4WYWA 4O3RA 4ICLA 3IG1B 4ED0A 2YNIB 4J9QA 4TN2A 1JLBB 3Q8PB 5HLFA 3DRPB 3DOKA 1REVB 5J2MA 5KFCA 1LW2B 1C0UA 2FVQA 2R8HA 4Q8FA 1JLGA 1T03A 4KV8B 1RT3B 4ED6A 1W25A 1IKWB 1S9GA 2IMWP 1J5OB 4QWCA 3M8PB 2HWIA 1IM4A 3IS9A 2WB4A 4K4WA 4IRKA 1S1VA 2YKNA 2C2DA 1S0MA 2WONA 1Z4UA 4J9MA 4FBTA 3D28A 4IR1A 2XGPA 3LP2B 2IA6A 1SH2A 2ASJA 2QE5A 3OL6A 3UR0A 1T05B 1D1UA 2IM1A 1S1XB 3ISND 3UQSA 3MEGA 3M9NB 4EYIB 1ZTWA 4MK9A 4LSNB 3V4IB 1JLQA 2W8LA 4IDKB 1HNIB 1D0EA 1RTIA 1RTJA 5L1IA 3BSCA 2W9BB 3I0SB 1MU2B 4H4MA 2WHOA 4NLRA 4NLWA 1BQMA 3NBPA 3GIMA 1U09A 1HQEB 1NHUA 4K4ZA 1JLAA 4TY8A 1FKPA 4F4WA 1IKXA 4ZP8A 4QWDA 1N5YB 4ECYA 1I6JA 5KG6A 2OPPB 1GX6A 3CDWA 3N6MA 1HPZB 3I5CA 5J2PB 5KFJA 4ZPDA 2GC8A 1S6PB 4ECVA 4DL6A 4ID5B 3CDUA 4RNOA 4XPEA 2EC0A 2VG5B 1QE1A 1IKVA 2O5DA 3GIJA 2HNZB 1S9EB 2I1RA 4LQ9A 4QWEA 4NLDA 3OL7A 1RT1A 2AX1A 3PW4A 3KK3A 3V81A 2W9CA 3DOLA 4O3OA 3EPGA 4QWBA 5EWFA 3BQ2A 3FQLA 5KG4A 1N56A 1HYSA 4ZMMA 4Q44A 1SH3A 5KFIA 1DTTB 1S0OA 4IFYA 4TXSA 3M9OB 2RKIA 4M95A 4I7FB 4EBCA 1C1CA 4K4VA 1C1BB 1S1WB 4NLPA 1FK9B 3T19A 4NRTA 5F8IA 1OS5A 1TP7A 3BSAA 1RT4B 2AQ4A 2JLEA 5HROB 5J1EB 2XI2A 5KT6A 3DYAA 4ECUA 4NLOA 2JEIA 4QW9A 2JC1A 5C42B 2BANA 2E9RX 5HLFB 3DOKB 3IGVA 3MTKA 3NKYA 1JX4A 4R5PB 3MR3A 1EETA 3JYTB 2AGPA 1JLGB 3ISNC 2OH2A 4K50A 4QW8A 1UWBB 3E01A 3C6TA 2IM2A 3MEEA 2FVRA 1S9GB 3FDSA 3SFGA 4R8UA 4TQSA 2W7PA 5KFXA 5F8HA 4J9NA 3HVTA 4RW8A 5KT3A 3PZPA 5C24B 2ASDA 1T3NA 4JV2A 1S1VB 2YKNB 3H5SA 2CKWA 5L1KA 3DLKA 2HMIB 4EYHB 2ILYA 3OSPA 4OL8A 1LWEA 3QZ8A 1HMVA 5KFKA 1YVFA 4ZVEA 1SH0A 2OPSB 3IRXB 1LW0A 3LALA 5KFLA 1JLQB 4B3OB 5KT7A 3DLEA 4IG0B 3T5JA 1RTJB 4PWDA 5J2QB 1RTDA 3QZ7A 5KT4A 3GIIA 4M94A 4H4MB 3NBPB 1RA6A 3V6HA 3MR2A 3OLAA 1R0AA 1JLAB 4KHMA 2VG7A 3KLHA 4TY8B 2I5JB 4XO0A 3DM2A 2IBKA
chains in the Genus database with same CATH superfamily
1RA7A 2DNYA 5IT9U 2DITA 4JI4J 3W66A 2FHOB 2XMUA 1FI4A 1D09B 3W7BA 4X4VA 2CG8A 3MMAB 4I4BA 3GMGA 1PO6A 4K0KJ 3LP0A 1SV5A 2ACYA 5HJXA 4U67Q 2B4VA 5K8PA 3KNAA 4RNMA 4ECTA 2MB0B 3CF5Q 1FTRA 2FLNA 3W2VA 3H20A 2YKQA 4FYVB 4LREA 4Y2IA 4P52A 4MKBA 4JI2F 3KLFA 3D1QA 3JQJA 2BBEA 1S49A 1QVGR 3CO0P 2NQPA 2W9AA 2R2RA 3R5BA 1Y5NB 5DLFA 2QYGA 4WBFA 3LAMA 4J90A 1R7IA 3EGVA 3CJQA 4M5LA 1TL1A 4OHZA 1NJWA 1VLOA 3PYDA 2FJWA 4QJVA 2RDJA 2QRRA 2JEFA 1RAJA 2LEAA 5IV4A 1RSCA 4TLRA 4MK7A 1TR0A 3GFYA 4G3IA 3PJXA 4TU9A 3PHEA 5LSLA 3CPWR 4WE1A 2UU9J 4URSA 4RNNA 3OR1A 3FZ2A 4DBQA 2V2KA 1HBOB 5KT2A 2YXLA 1KFSA 1KD1T 2WONB 3FRZA 3RUBL 1VRQC 3M8RA 3UNGC 3LP2A 1VLYA 3OL9A 1FVQA 2JVOA 2EK6A 2VC0A 1JLFB 4M1KA 5I3PA 3F56A 2DGTA 4DL3A 3KMQA 4QCLA 2R2TA 3EWGA 3NWGA 4O3QA 2W25A 4JV5J 1RUSA 4B9VA 4NXMF 2L3MA 2W9CB 5J2NA 4MYUA 1P6TA 4LF6J 5KFNA 1SJFA 3MAQA 2DVIA 2JZ5A 1HWUA 2XLJA 3OVSA 1TKTB 5C42A 3NY0A 3DOMA 2BZ2A 1CPZA 1CJUB 2DRDA 1GH8A 3LO3A 1EQ0A 4PABA 2HMIA 3KHGA 4ZIWA 3R5GA 2R7XA 3MZIA 1URRA 1XEZA 4DR5J 1UPPA 4F25A 1RTZA 2MZSA 3HHNB 3CCVS 1WG5A 4JI3F 3EXYA 1QAXA 4JV0A 2WVEA 3OVBA 1KSPA 2VG6B 1M1KT 4IOBA 1DQAA 2VBYA 2Y1RI 3IG1A 2GJIA 3FEZA 1JLBA 4RPFA 2R7TA 4LVOP 3POTA 4ANEA 4I2PA 4W4MA 4DL7A 1A0OB 4URGA 4KO0B 4LFAJ 2VPWB 3KXDA 4MMOA 1Q4RA 2KXHA 3V4IA 3MF5A 4DPTA 2VBZA 2GS8A 2J0QD 1Q86T 4O3SA 5KG3A 4RUAA 4X65F 3PX4A 1YQHA 3FFIA 2HHWA 4GKKJ 4MJKA 1IXKA 1K0VA 2V4JB 2C42A 1CC8A 4KGKA 4F8RA 4NWBA 4UOFA 1TZ0A 3DRPB 2VU5A 1IKWB 3QWPA 5FLXY 1IM4A 1RWNB 4IRKA 4FBTA 1B3TA 3HO1A 3EZOA 4M5MA 4AXJA 2ACMA 4A8QA 1VQPS 4ZN1A 4NLWA 2XMAA 2DH7A 2HRUA 1NU4A 5A6WA 3ZO7A 2VFTA 2GHWA 2ZKTA 3CDUA 3GR0A 4M5DB 1VBZA 3MMBA 3VR1A 1SH3A 1ELOA 3R1LA 3M9OB 4LF9J 4M95A 4I7FB 4BS2A 1FK9B 5AXLA 4DDFA 5J1EB 2PDAA 1Q1KA 2GZOA 4DX6A 3DOKB 3IGVA 4HI1A 4R25A 3UDEA 3C6TA 3BBBA 1S9GB 2UUAJ 3SFGA 3DGVA 2LP4A 2HQ3A 3O8WA 5ETVA 1T3NA 4MIWA 2V8VA 4FVCA 5K8NA 3IRXB 3BR8A 4ENOA 1LW0A 3DLEA 3UDCA 1C4CA 1VHIA 5KT4A 4HH1A 3W8PA 1M5HA 3K5PA 2O3DA 3OXGA 2BM1A 4Y2CA 5LXYA 1CJTB 2NXJA 2PE8A 2ZH2A 1RT1B 1T9UA 3MCSA 3DI6A 3CJKA 1HYSB 4NEYA 2MHEA 1UFLA 9RUBA 4WFAQ 3SI8A 3PG9A 4YHHF 2H65B 2E5JA 4IFVB 1A6LA 1PC5A 2LLZA 3DLBA 2B7BB 3FMBA 5A8KA 1WORA 1X9MA 2IYIA 3FBCA 2QLFB 2I6WA 1IUJA 4B3RF 1RAAB 1U48A 2XS5A 2XC9A 2BE2B 3KK2B 3IWLA 2GGPA 1YJNS 2BXJA 3M2RB 5M2UA 4Y2AA 1CQMA 2DO4A 1CQNA 1L3TA 4MH8A 3MUTP 1IBMJ 2CJAA 2ZDPA 4EWTA 1ZAXA 2XYPB 3IS9B 2DGXA 5D3GB 4AFFA 2ZHBA 3RB6A 5KFRA 2R8GA 3I4HX 4ED4A 1TTHB 2VFVA 4U7UK 3ISZA 1VQYA 4ZP9A 1RDRA 4F0KA 3EGNA 1RB0A 2IRYA 3KNGA 2MGZA 3X1LB 1OPZA 1WC0A 5LMUJ 3WIUA 2DH8A 3N5FA 2BV3A 3MM8A 4EGLA 2VG5A 3D0IE 1BWVA 1HLWA 3FQKA 4I68A 1XK8A 3UFCX 2RKIB 2JNJA 3GIKA 3J81j 5LXRA 2MDAA 2AW0A 3KJFB 1FO1A 3TAPA 2B4PA 2MLZA 2KVIA 5FJ4A 4ANCA 1VK3A 2C2ZB 2NZCA 3J81U 4CNZA 2C2OB 4RWXA 4FPIA 2FC8A 3M8QB 1L3KA 3RW6A 2FDNA 4HI2A 5KAKA 2UUWA 1WKLA 3HSGA 2ZBPA 4B3OA 2YH0A 3M32B 1B99A 4FS1A 2HWHA 2F8MA 4B9UA 1O51A 4KBIA 2ATLA 3GFZA 3AB4B 1KOHA 2PIIA 5I42A 2HHQA 4FPRA 1FJEB 2FVPA 4G1QA 2YNHB 3HZGA 5F8GA 1MMDA 3KHRA 2RQCA 2BRKA 2HIQA 4IQXA 1NMEB 5D15A 3AOCA 4PQUB 1WELA 5K14A 2BA9A 2V6AA 1FX4A 4MYTA 3H25A 5DG7A 1FX2A 2VKRA 1JK9B 3C3LA 1JKHB 1ZZNA 5DDQC 4ZIVA 3ZZTA 3VF0B 4C48A 2PEBA 1AZSB 4OYPA 4FDFA 2WBMA 4GC7A 3TZYA 3OTBA 5SUHA 5DRKA 1SCJB 4C3LA 1H73A 1VQ4S 3SCLE 3IGNA 1GX5A 5JMNA 4DR3J 4LBIA 2VBXA 2XNQA 3CJTA 4CM2A 5D4OA 4F3OA 1U47A 5HVGA 4JI8F 2XY7A 2VJVA 3H2VE 1HW9A 4OYBA 1REVB 1PAEX 3BKUA 2CPIA 3QAUA 2A6MA 2MQLA 1ZBTA 3M8PB 2CJBA 3PXGa 4EYIB 1NSAA 2DISA 4QIFA 2FB0A 1FRLA 3MPWA 4EK2A 2ZITA 4LF8F 1IKXA 2Z2MA 2JSXA 1IBCB 1S4EA 4RNOA 3GIJA 3KYLA 3ZNJ1 4DV5J 3OL7A 2AX1A 1E6YB 1HHQA 4Q44A 2VUGA 2VQEJ 2LU2A 4NRTA 3T19A 1ULRA 2OJ3A 2H1YA 2HQDA 2GMLA 4FXVA 2YBVA 4M5IA 1QAYA 3MEEA 4KPYA 5K5MA 5H9EK 4ZCMA 3CMQA 4DR1F 4DS5A 1N33F 4RW8A 5CQGA 2DHSA 4AT1B 2CYYA 4OL8A 1YVFA 4LBPA 5ADZA 3Q86A 4NYOA 1RA6A 4QR2A 3MR2A 2C3UA 3UE2A 4TY8B 3KLHA 2I5JB 3NS6A 2WW8A 3HHKA 4W98A 2KB2A 3UCUP 3W63A 5K8MA 4IG3A 3ILLA 1N6QA 3V81B 2GMHA 2B5JA 4CYUB 3OHBA 4LIRA 4IFYB 4PCQA 4FP9A 2IRUA 3DYAB 1VQOS 4U96A 1B7FA 1NSKL 3M2VB 2FJXA 3P5TL 2HHUA 4R8UB 4RBTA 2D3OR 1VQKS 5KFZA 1RKIA 2CVIA 1TV6A 5HBMA 1T9VA 1U1KA 3G8QA 4PWDB 1TUVA 4I6WA 4GVBA 4DR2J 3J7Z5 2V4QA 3QO9B 2CFXA 4RBVA 3CCES 1AYEA 3IBFB 4ERDA 1AUDA 1OYDA 2EFQA 3J80U 2YH1A 2WSFC 2IVYA 1JLEB 4ES1A 4L6V3 2BVZA 1FJCA 3VGVA 2YPZA 2HNYB 1BD6A 5D4LA 4O4GB 2CJQA 3JSYA 4C8KA 2DR6A 4USWA 1DQ8A 2DNPA 2QL9B 4HH0A 2IVFB 4U7CA 4ZCLA 2XLIA 4MKVA 1EARA 2KL8A 3NNCA 5A6PA 3H98A 1RTIB 1T02A 2JLFA 3OTOJ 5DZ6A 1ZS6A 1IR1A 3CEDA 2W9BA 1XMQF 2YWHA 3LW5C 4ILMA 3T1HF 1KWMA 5IFMA 4DF4A 3DRSB 4Z7YA 1SB6A 3WDOA 4B3MJ 4TQRA 3FSIA 5DLGA 3NGRA 2BQRA 2QZ8A 3BN7A 5B0DA 4ZLLA 1R8AA 2QL7B 1KR4A 4UT4A 3W2WA 2FZGB 1VQ6S 3RAXA 3EICA 2O67A 3PEHA 1YK9A 2BACA 5DG9A 2D3O1 3IRWP 3HVWA 2ZH7A 4RZRA 3QATA 1V9OA 1A7GE 4IH6A 5KFPA 4NXNF 4A8MP 4B9TA 4N8NA 5ETMA 1SJ1A 5J2QA 3D6HB 3DMJA 2DCUB 1XBWA 2Z57B 2IJNA 2O1PA 4YEAA 1SQGA 2QFJA 1RT6A 4NLSA 4W90B 1UJ4A 3DRRA 3QJPA 1PG5B 3T9ZA 1MG7A 1M5SA 2ADBA 2XCPA 3QT6A 4H4OB 2G0IA 4X4PA 2ZD1B 3O5TB 1JIHA 4ETXA 2CWXA 4FF2A 1X5SA 3MM6B 2AYBA 1RWKB 4LFBF 3HHLB 2XTJP 3QWUA 3SCIE 2NXUA 3L9ZA 1KDNA 1OQ3A 3RW7A 2LEPA 2GMJA 4YB7A 3OR2B 1N0VC 1YGYA 3TUJC 4DLGA 3ENWA 1RKJA 5I3UA 3CCSS 2PD1A 3R5DA 5KFDA 2VHGA 4IRCA 3GP9A 1VK8A 5J2PA 1C0TA 2F9DA 4JYAF 3K5OA 3BM7A 3J7A1 3PX0A 1PJ6A 4JV1A 3NCRA 1HI8A 1YJTA 3QJJA 5LSOA 5DDOC 3E51A 2BW2A 2KXFA 3J7YU 4GMKA 1AA1B 1X7VA 2PEHA 3ZTSA 4ED0A 5ETTA 1GTHA 3UI3A 1KEKA 2V94A 4ZOSA 2IJRA 4KV8B 1FDBA 2CQ4A 3OFHA 3LTOA 2XMVA 4OZ3A 1NKCA 1Q0NA 3JTNA 1PC4A 1EKRA 9ATCB 2D9OA 1OJ4A 2B9WA 3KKFA 1VQLS 1BQMA 1ROFA 1U09A 3T1YJ 1GQEA 4F4WA 4CH0S 1HPZB 2KJWA 3W61A 1BLUA 2LA6A 5T7LA 4DQRA 2HFOA 3BQ2A 4DF8A 4LR9A 4TXSA 1C1CA 4K4VA 4DSJA 3GFXA 1SBRA 2E5GA 3O3LA 2BANA 1U8WA 4AE5A 2AGPA 3HCXA 4DR7F 3LWMA 2CAJA 2FY8A 2H48B 3HHDA 3HHLD 2YKNB 4CLSA 3THTA 2FHJD 3R7BB 1TFWA 3D1OA 1RTDA 4BHQA 5G4DA 2EEYA 2VOPA 1N36J 3PW2A 4OI4A 2BDPA 1VFJA 1FRJA 4ELTA 2DGOA 3I9V9 1LFWA 3KK1B 2WK4A 1CS4B 4FXWA 3AT1B 5HQMA 5C5JA 3FCHA 2GQQA 2WVDA 1RT5B 4ZVQB 4DV2F 3QLHA 1RCXB 3JSMB 2XSFA 2F4VJ 3ICLA 5ETNA 4RL1A 1FHTA 4X62F 2GIRA 4USVA 1VR6A 3C15B 2U1AA 4ED1A 4RNFA 1QLNA 5GAHU 5IT9Y 4O44B 3KHHA 6FD1A 4K4TA 1SC4B 1RTHB 3BGFA 2YY3A 5H9EJ 3B54A 3KG4A 1S10A 4DCOB 3CJ5A 4CZCA 2B6AB 1X0FA 2BM0A 3OXFA 4KE5A 5IC6B 1XR6A 4MFBA 4NLYA 5B0FA 1VMBA 4NZ0A 2CWKA 2MZTA 4C0BA 3QT7A 3RJMB 3V5RA 2QO3A 3W64A 2P8IA 2N7YA 1T03B 2XO7A 4H4KA 2QSWA 3R5JB 2QA2A 2A10A 4G1PA 5CYJA 5F8MA 5EWGA 2KRRA 5GAEI 3A8JA 3MEGB 2BKPA 1XMBA 3KLFB 4YDDB 3U7JA 3GONA 1CULA 5KFHA 1FJGJ 4DV4J 3FCWA 1FKPB 1PCAA 2RDDA 3ZZ0A 1AFJA 4KIAA 2LEBA 5DQHA 1EQMA 1EJ7L 2DY1A 4YS2A 1NK9A 2R7UA 2AJ2A 4ECUA 4B3TF 1TL1B 3Q8UA 5KT5A 2HS3A 1NJYA 1QTMA 3Q24A 4C8NA 1Y10A 2GX8A 4QIVA 4WE1B 4AUKA 3BGRA 4KY3A 1SIZA 2WVFA 5L1JA 4KHPF 1XNRF 2UXCJ 4R5PA 1HW8A 1MN9A 1P1LA 4DU8A 1WOSA 1F1BB 2QA1A 5F8LA 4J9LA 4ZITA 3CMES 3JQKA 1J5EJ 3M30B 1U26A 2KKHA 2FLPA 3QAEA 5GADI 3H4BA 4F67A 4Q45A 1PKUA 2DXFA 5J2NB 3RRGA 5BR8F 4ZPBA 1FD8A 4PXBA 1XR5A 5G0RA 1FRIA 2UVRA 5AJ3J 3WC2A 3DOMB 1KVKA 2OD6A 3AQPA 2RRAA 3EDQB 4IR9A 2ROPA 4E0DA 2V2VA 5THWA 1DAXA 2KFZA 3UO0A 4CO4A 1X9SA 1GFWB 1LNQA 2XY5A 1APSA 2ZOMA 5HVHA 3NS7B 2RF2B 4PG6A 2FZCB 4XDDA 1TKXB 4JI0J 3IG1B 4J9QA 2I9SA 1JLBB 3POTB 1LW2B 5D6GA 4OLOA 3RAMA 4ED6A 4Z2XA 1AFIA 2IMWP 4QWCA 2KG1A 4V1Ak 3RGIA 2WONA 2IA6A 3IMQJ 3K0JA 4QIEA 3D7SB 3V4IB 5L1IA 1DZ5A 1WJ9A 1VBYA 4AQYJ 5KG6A 3CDWA 3WC0A 2VBWA 3IM8A 4G6VB 4F4AA 2I1RA 4UW2A 4DMZA 4W92B 3KK3A 4GO7X 2W9CA 5E3CA 3L7PA 1T9YA 3N79A 3LGHA 5L46A 3TJ8A 1XMOJ 1NK4A 5F8IA 2JLEA 2XI2A 2XBPA 4QW9A 3PKYA 2G2OA 3NGSA 2VOOA 1ZA1B 3MTKA 1AT1B 2KFYA 1CJUA 2IM2A 2FD2A 1ZYQA 3PZPA 1TMJA 2DCLA 3OSPA 4F0HA 1TAQA 4ZVEA 1J27A 3HJVA 3K5MA 2ZH1A 2N4DA 3R8YA 4UUXA 3MDFA 1SC6A 1F9EB 2E1AA 1VRTA 2A18A 3OT9A 1EP4B 1BGXT 5FDLA 2VG6A 5SZTA 4LF7F 3A3NB 1SQFA 4Y28C 2AX0A 3MFIA 1Q53A 2HBZB 4LR7A 3U1MA 4ECSA 2C2MB 1K44A 1RJJA 1WG1A 4KJIA 1REGX 3C6TB 4C7QA 4OFZA 2O66A 2VFUA 4PWUA 1ZETA 3I0RA 4OHXA 3TP2A 4X66F 1LW0B 1TVRB 2QG9B 2L41A 2OP5A 1X4CA 1FT8A 3M8SA 2ZOGA 3JAMU 4WPAA 1DTQB 1T0TV 3VTIA 2OUGA 2W2OP 3DLGB 4LRDA 2DHHA 2IM0A 2DY9A 3H2LA 2U2FA 3M9MB 4DR4J 3DI6B 1N34F 3CJKB 1WC6A 1F60B 4KKOA 2D9PA 3KOAA 1SKUB 3WX4A 2E44A 1IKWA 3KDOA 5A8KB 1Q79A 4C3MA 3RRHA 2DR9A 1NDKA 4MAKA 2B9XA 1YX2A 2MLXA 3FMWA 1VQMS 2E7WA 2NLWA 3SQGB 7FD1A 3PVXA 1Z2LA 1H2TZ 2VIHA 5KFEA 1F5AA 1RT2A 4GKJJ 2GGPB 4ED3A 1RYRA 1KONA 2DEJA 5L9XA 5L38A 4CLLA 4L73A 4QOTA 4I7FA 2VASA 1FK9A 3CCLS 5DS7A 5J1EA 2XG8A 1EETB 2BE9B 1WC1A 3MOZA 2J6TA 2KT2A 5E5NA 4N76A 2WTFA 2Q6BA 2DRAA 3BPDA 4WP3A 1Q82T 2CPFA 4A8XA 2HHXA 4Q0BA 5IZHA 3W65A 3IRXA 4DG1A 3DM2B 2ZWPA 3JS9A 3GLJA 3MHYA 4OX7A 1UPMB 2J8AA 2EBEA 4KSEB 4NA1A 2P9CA 1N5QA 2MJNA 2Y1LB 4RUCA 4EFAC 3TVZA 1CJTA 2P2CB 3MM8B 2M5YA 1M1HA 2YX1A 3DHXA 3HFVA 4A46A 4YY3J 3MURP 5IWAF 3SCJE 3NMAA 3RB0A 3R27A 3MM7A 1T7PA 3ETOA 4I1TA 1HWIA 3VGUA 1D9DA 3C6UB 2PA3A 4DFMA 4QR0A 5IQQA 2KTQA 3TZZA 4IFVA 3HSJA 4OJ3A 4KH1B 4ZVGA 2DHXA 3IBWA 2AYMA 4HTIA 2QLJB 1FKOB 2JRSA 3K8VA 5I3QA 1IR0A 1R0CB 5IT4A 4D3HA 4S0MA 3ADAC 3BKFA 4DR6F 1NPKA 5KFFA 4YR3A 1RT7B 2M70A 3SQOP 4KTQA 1RBOB 2R9LA 3M2RA 1C1BA 2E9ZA 4CO5A 2R2SA 4G1QB 4EZ9A 1ZTTA 3HT3A 2OEMA 1DFDA 4DI6A 2QA4G 2QEXS 2RS8A 4DV0J 3IS9A 4WTOB 2PO4A 1BHNA 3BYPA 3IC1A 2ASYA 2W8LA 2I0XA 2HYIB 3BSCA 3AA9A 1Y4ZB 4H4MA 4PYAA 4M63A 5IV3A 3TA1A 4LFCF 1JLAA 2WAQD 3DU5A 2XM3A 2EC0A 2KO1A 3PO4A 2VPXB 3FC9A 2HFUA 2RKIA 4EBCA 3G87A 1HA1A 3US5A 1U1MA 3J7YI 2ADCA 1OYEA 1XQIA 1FEHA 2NR0A 1O6XA 1RAEB 2AMCB 4DPXA 4DV1F 4GO5X 2AP6A 2GO9A 3JQMA 1K9MT 2G4BA 5KT3A 3VGSA 1LWEA 3GYXB 5KFLA 4IO9Q 1HD0A 2M8DB 1OY6A 5BXIA 2Z0GA 3M32A 4F4YA 4JI2J 3MEDB 4KFBB 2ZVIA 1X5PA 2FJBB 3BREA 3MECB 4I64A 3D67A 1PYOB 5EHHA 4MT1A 1UVMA 4UZBA 1S1UA 4PUOA 3JTPA 2CQ3A 1KVIA 2YPYA 2HHHF 2EKYA 5KFAA 4PQUA 2KT5A 1N0UA 2UUCF 3P8BB 2OFHX 3SV4A 3PY8A 4ZVHA 1MSWD 4RW8B 3CCQS 4ELVA 1F9HA 3GQCA 4QZVB 4WU3A 4WFXA 3H7HB 3RBZA 2CPZA 4WFYA 4U8YA 3KUGA 4Y65A 2NYHA 4N8OA 2HKEA 4Y3CA 1R43A 3G6VA 4CRJA 3CJ0A 3B78A 2K1RA 2HGNA 3RBEA 4K4UA 1VIXA 4K5RA 4ED2A 1PJ7A 4ZCIA 5AXNA 2Y0SD 3PTWA 3Q8SB 3CO9A 4NXMJ 1N4LA 1Q8KA 1EZZB 4FS2A 1REVA 1O0PA 3O1LA 4OV6A 1P8GA 3MXHP 3M8PA 1H2UX 2RDIA 3TAQA 1WEXA 2AGQA 2Q79A 4LF9F 3BDEA 1TV6B 3G2XA 5GAHI 2ZH5A 1HNXF 4OI1A 4HYKA 1IBKF 1IKVB 4UUWA 1D3WA 2IDLA 4ZP7A 1WACA 1JNRB 1PYSB 3K8WA 1FJ7A 4X64F 1E6YA 1LWCA 4DL0C 1NJXA 2D41A 1ZOTA 2ZDOA 4JI3J 2FJAB 2RHQB 2ASLA 3QIPA 1R0BG 4OHVA 2Y9HA 3W1YC 4RWWA 3TO8A 3HI9A 4J9SA 2VB6A 3GR1A 4OJHA 4Z37A 4FVMA 3SDEB 4CLUA 2WVCA 5B0AA 4WZMA 1PBAA 3EJMA 2C2KB 4NCAA 5DZ7A 8RUCA 2XCAA 2MQPA 1MWQA 4CLFA 3MPYA 5KFOA 2I5JA 2M88A 3R6LB 5AE1A 2OI2A 3HLUA 1NK5A 3MMCA 3CCRS 4OJ1A 1KN6A 4X65J 4UZCA 5EGYA 3BH7B 3T5KA 4F7VA 1JJ4A 1WOOA 3C14B 2J0SD 5CH7B 3M2UA 4IKAA 3W2WB 2G1HA 5KG5A 4DFPA 3GJRB 2E5IA 2KN4A 3EZUA 3RRKA 3M2VA 2F1FA 2LDYA 2NXNA 1WF0A 3NOCA 1RAIB 2CADA 2HQFA 3AQOA 3ULHA 1TFYA 3J7AN 3Q83A 2W7AA 2HNDB 2Z56B 4USJC 3R5CA 1G3OA 4ID5A 2PN6A 1IBMF 1X4BA 3K7RA 1H7WA 3DMJB 3QO9A 3F41A 1RT6B 4ZPTR 4OX9F 5T41A 2L9WA 1RWOB 3DRRB 3Q8RB 3GJTB 1FWLA 1YWXA 4K4YA 4O3NA 1KVJA 2V8PA 4ZVTB 4OX8A 4RUBA 1W7WA 5ETLA 3Q8PB 2R8HA 3FBBA 2V8HA 2HQGA 1UMJA 3PDNA 2Z2ZA 3UCGA 2EKNA 2JHEA 4RU2A 1S0MA 1SH2A 1NB2A 3ISND 4MK9A 1RTIA 2J7WA 2FGCA 3HM9A 2GQ2A 1NLKL 1R8PA 2H5IB 4ECYA 1VBKA 5J2PB 2W1BA 2IYGA 2GC8A 5E0OA 4DL6A 3N4WA 3CD0A 2HVIA 4JI6F 2WZ1A 4F26A 2RS2A 2V8GA 2J7KA 5EWFA 2BJEA 1HBUA 1K8AT 1U4BA 3AHPA 3GSIA 4AD6A 1TP7A 3BSAA 5KT6A 3K57A 4NLOA 1UJ5A 2DJWA 4YN3B 4DLEA 1FFSB 1U8SA 3CJSA 1WF2A 1LXJA 5A0YB 4YHHJ 1WI6A 4EYHB 4HR2A 3TQEA 1XNQF 3CD6S 1S0VA 3T5JA 2W2NP 3L09A 4XO0A 2IBKA 2FHKA 4ZLNA 4CO3A 2Y8YA 1MW7A 2ZC4A 1QJHA 3K59A 1YITS 4OYAA 2ABYA 1KNZA 1LKZA 4B3RJ 2E66A 4DFKA 5CYMB 2YWKA 2ROGA 5JVGQ 4WTYA 2EVZA 2XWYA 2JFDA 4K5SA 5B0CA 1C1CB 4H4OA 1FFGB 2ZD1A 2HG4A 1SIWB 4OZJA 2KYZA 3IN5A 5KFBA 2J9CA 3MM6A 1PSDA 1S7HA 3HHLA 3QYYA 2AV5A 1LEOA 2FHJA 4DR3F 3VQSA 4F04B 3D5MA 2MY8A 3R6GB 1H0HB 2VA3A 1T9WA 1RTDB 2JLGA 4DQIA 4P9SA 4LR8A 2C3PA 4P72A 3F0NA 2UVUA 5B08A 1S0NA 4C8ZA 5HANA 4HACB 5KFSA 2EBGA 4MTPA 1WC4A 2DNQA 2ZFHA 3NNHA 3P6YC 2V34A 5CZVA 2QA4S 3HSDA 1X4DA 1NH8A 2L9NA 4KV8A 3QBCA 4F3MA 2IRXA 4YQWA 2G0CA 2RUGA 3KLIA 2HK2A 3K89A 4NI2B 2N7CA 4IH7A 2EFOA 3QQCD 2ZJRQ 1H74A 1LK5A 4KT0C 4AXIA 2CZVC 4HHHA 5CA5A 2CPXA 1QSYA 1MLAA 2BKNA 4DV7F 4F4ZA 1S6UA 3TEHB 1YLXA 2XHWA 1VS3A 2HHSA 3HP6A 4PRFA 1HNVA 2NXEA 3CDBA 2BUNA 2IVMA 3K5LA 4ECRA 4NLUA 3TWZA 3HFZB 3HHLC 3G6XA 4YB1P 4ILRA 2ZH6A 2D1CA 1YRXA 5DGBA 1U24A 1P27B 1WEYA 4DUTA 4KGMA 4UQGA 1MMLA 3TEGA 2NZ4A 3MFHA 4NPOA 2Q43A 3BBCA 4GVLA 1CULB 5AE2A 1OO0B 3VZIA 3OW2R 3MTJA 2OGUA 3TVYA 4DQQA 3SSQA 2V4RA 4CCHA 1HQUB 2GCFA 3I5BA 4O3PA 4CH7A 3KK1A 4NLGA 4EZ6A 1TL3B 1ZA2B 4G65A 3FVYA 1RT5A 3JSMA 3HSZA 1S4FA 1YG0A 5KFYA 1AUSL 1RWWB 3BGRB 1WSVA 2HK3A 4M5GA 3Q8QB 3I9ZA 4JI8J 1LWXA 2ZJPQ 4DEZA 5D0GA 5CYQB 3C15A 1U2FA 1NKBA 3ET6A 2HLUA 4O44A 2KHCA 4EO8A 1NAQA 1RTHA 2YWGA 3S1TA 3GZ7A 3RZAA 3EZ5A 3MPVA 1FTCA 1N5TA 2VF3A 1OMSA 4LF8J 1NO8A 4DX7A 3CNQP 2LXUA 4WP9A 5E3AA 4C8YA 3HD1A 2DHGA 5G0RB 1RLCL 4ZLJA 2FVQA 4Q8FA 1T03A 3OFFA 2Y3YA 5ETRA 3Q8VA 2B8QA 2XGPA 2ASJA 2QLXA 4JI5F 1D1UA 3MEGA 1ZTWA 3T6BA 1R27B 1JLQA 1D0EA 2RT3A 4CDIA 2DNGA 3CUNA 4FN5A 3UN2A 3HXMA 1VJWA 4K4ZA 1F2HA 1FKPA 4DR1J 5KFJA 2EK1A 1N33J 2JOQA 2HNZB 2CDRB 3DHWC 4O3OA 2NUUG 4C98A 4JI1F 2MKSA 3VALA 3W5XA 2CJYB 1BQXA 2YX4A 3QNWB 3DGPA 4DPYA 1U02A 1H7XA 3BGUA 3BBFA 3KDNA 1AW0A 2W7PA 3SMZA 5HJYA 1FKAF 2QLBB 4QR1A 1Q95G 2OPSB 1FESA 4HLBA 2E29A 3M30A 4QWAA 4XIUA 5KG2A 3EPIA 1M1GA 4DFJA 2XNRA 4ZS6A 4RBUA 3IR5B 4ED8A 2OTJS 5AE3A 1IBLF 1RYSA 3KK3B 5D77A 4OI3A 2MQ8A 2VDIA 2IJFA 4J7CA 4ECWA 2BMBA 1JLCA 3QGIA 3BQ1A 3O44A 4J91A 4I6YA 1G1XA 3M1VA 2EFVA 5E2QA 4CLKA 2WVBA 4FF1A 2H54B 2KRBA 3QRPA 3CJ4A 1V3RA 4RNHA 1NK7A 1U1LA 3T5HA 3OSNA 3GV7B 3ZTRA 3CCZA 4RW4B 4KGZB 3H5YA 3A3PB 1AB8A 1T8EA 1OSDA 2GJ2A 2DR7A 4B3SJ 3BSOA 1O5JA 2A2DA 1XMQJ 2RF2A 2KYXA 2QV6A 1VRTB 1QAIA 1MWYA 3T1HJ 1TKXA 5FDLB 1PGZA 4U6PA 4C97A 1LW2A 1OY8A 4ZKAA 2W4PA 5AXMA 3T41A 1R89A 4HT7A 4IH5A 1HNWF 2VDHA 3LPEA 4WZQA 3JAMY 2WCXA 2MSSA 4OIXA 3I0RB 1SQEA 3QJLA 3NS5A 2B43A 2MKIA 4JOUA 4DSLA 1S77D 1VIOA 4NXNJ 1JJ2R 4X4TA 3G6YA 1FFWB 4OYZA 4JUZA 1ACMB 3NCPA 1Q8LA 3SZ2A 4CT9A 4FYDA 3I96A 1UETA 4C2MA 4PPZA 3DLLQ 1JQGA 2FJVA 2AU0A 4KKOB 2CG4A 2AYGA 1VJQA 1Q7YT 4F3QA 4DSIA 4CIOA 3HDSA 2HZAA 5F3TA 1ZPVA 5J1PA 2RIJA 1KQGB 2Z8QA 1Q5VA 2OHDA 2RU3A 1JMTA 2QL5B 4RU9A 2CQ1A 2NREA 1RBLA 4LFBJ 3A3OB 4O4RA 2BX6A 3TAMA 3PV8A 1NK6A 3TUIC 4USMA 4YFUA 3VZHA 4I56A 5D0RA 3SXLA 4Q5VA 3PR4A 1UFWA 3L7OA 5JXSA 1VI7A 3K58A 4F4XA 1DRZA 2ZKUA 5A2QY 1Y0HA 4U9RA 1X4EA 4ZHRA 1RT2B 2CPHA 1VRUB 2Q3PA 3BYRA 4P7VA 4M5HA 1EP4A 4X4RA 2GHVC 3GV5B 4JYAJ 4KR0B 5KFMA 5LT5A 4IO1A 2HS4A 1UFKA 5CD4H 3U1LA 2NPIA 1YBUA 2V5HG 1UL3A 4KGXB 1J2VA 2ALYB 1WHVA 1HHTP 1RHRB 3PO5A 1MROA 4MIAA 2B56A 4L72B 4Q0BB 5H9FK 2VPYB 1TVRA 4DG1B 4TKTA 3UW1A 2R8KA 3CWJA 2KJVA 3QRRA 1DTQA 1H38A 4DL2A 1S59A 4L3KA 2MMYA 4FYWB 3DLGA 1MWZA 1DTTA 1M5KC 2FGOA 4QYZK 5KFQA 1RT4A 2CNLB 1WG4A 5C25B 3PCOB 4FF3A 3MM7B 4B02A 4M5KA 5HLFA 5JJBA 5LL6d 1L3UA 2CDQA 2XMJA 3EUNA 3HZEA 1FVSA 2W01A 1PBUA 2WB4A 1GMVA 4J9MA 5GAEU 2ZBRA 2CQHA 5HO4A 3NG8A 1K73T 4LSNB 1UAWA 1VQ9S 4C11A 3M6VA 1VOMA 1U2RA 4DR7J 2XWXA 4QWDA 1FXLA 2H4WB 2I8EA 4YB5A 1GX6A 3SQGA 4ZPDA 3AOAA 3F44A 1SL0A 3V4MA 1S9EB 1Z2ZA 4QWEA 3AJDA 2UXCF 1TU0B 4CNYA 3F73A 4ZMMA 1HR0F 3D3BJ 5KFIA 4LRFA 4NX9A 2GA7A 4RO0A 1UTAA 1F2GA 1C1BB 4NLPA 3SV3A 1NK8A 1OS5A 4X4SA 4ZVPB 2JC1A 4LRBA 2E9RX 4O0NA 4UY85 4KH0B 1EETA 3JYTB 1O8BA 1GMUA 1UWBB 4DV2J 5LMNF 2RRBA 1BUXA 4WFNQ 1UKUA 5C24B 2CKWA 1KQKA 2ILYA 4L3NA 4WWSA 1NRKA 1RWPB 4H4MB 1H98A 3CW2C 4X62J 3OLAA 3MCNA 1JLAB 3DM2A 5F9NA 4LF1A 5M2PA 4ES3A 2KVQE 5GMEA 3ZFVA 5GADU 1TKZA 2QSFA 2C28A 4B9LA 3CJ8A 3BSNA 1FDAA 1FNMA 2HRYA 5GMKa 2DH9A 1X0PA 5L1LA 4EI2A 5HP1B 1UEUA 4TNOA 3I56S 4DV6F 2CJ9A 3TJ9A 3C6UA 3I55S 1FE0A 5BYQA 5F9LA 2JFKA 3Q23A 2G0JA 1XC9A 1WC3A 3VHQA 3ZZUA 3SIPB 1LWEB 1FKOA 4YP3A 3N5BA 1P9YA 3DXBA 1OQ6A 5HI7A 4NL5A 3TI0A 2V9WA 2AD9A 1SL1A 3T1AA 3GFHA 1WF1A 3MM9A 4YOEA 3T3FA 2UXDF 1UZDA 2K3IA 1IJFB 2XY6A 1RT7A 2M9KA 3VQTA 5JUMA 5IS2A 2UZAA 2UVVA 4F02A 5ITHA 3DLJA 4TY9A 5ETPA 4A8FA 3KJNB 1S1UB 1HNZF 4PUOB 3SBMA 1FDDA 2M0GB 3UR3C 3TVKA 3BR9A 2UP1A 1HI0P 2EG1A 2IA0A 1RADB 1UVJA 1DLOA 2VFSA 2LQ8A 2MSTA 4TYAA 4DUZF 4KHPJ 3ILJA 1XNRJ 3FGVA 3VAGA 3KTQA 3BB5A 1R8BA 1RP5A 2K1RB 1LOUA 2JC0A 1ZAVA 5CAAA 2FVCA 2C3YA 2X1AA 4QIWD 5KFTA 1URNA 2DRBA 2IAJA 3KUEA 3SSSA 4F2SA 5JVHQ 4JP8A 1EX8A 2ZHAA 2ZOFA 3AOBA 4J9KA 2KI2A 3PW5A 4CP5A 5BR8J 3OJUA 3UDLA 4M5JA 3EE3A 1DJ0A 1WEZA 2YQ3A 1ZH5A 3OXLA 2CNNB 1DHMA 2ZHOA 1WNEA 4NCGA 3I87A 1OY9A 1NNDA 4QU6A 3RB3A 2HVDA 2GAGC 2E9TA 2H51B 4WP8A 1S9FA 3MEDA 4ZPAA 4BWJA 4KFBA 3M6WA 5IM0A 4LQ3A 1SJ3P 3MECA 4U8VA 2OD4A 3IP0A 2QT7A 1LWCB 3I82A 3B6BA 4K2XA 2XZWA 1Q5YA 1RT3A 2HFSA 2V9KA 4ZVOB 1TAUA 2HFVA 4J9VA 3QIPB 1FERA 3GYNA 1RABB 4DUYF 2CZ4A 2L08A 4BC9A 2PC6A 4F50A 2BJ8A 3JSBA 2FIUA 2OPPA 2XYHB 3SEOA 4K4XA 3R7SB 3B4MA 3PYFA 3ZNUA 2EPIA 4LF4F 2FPHX 1VQ7S 2N82B 2HQIA 1F9FA 2VV5A 1SKWA 3QGHA 1XIQA 3OD2A 4D3GA 5ETKA 1PJ5A 4J5OA 1FNXH 3ENVA 3MMCB 1V5IB 4XDCA 2A6OA 1S5ZA 2OELA 2P5VA 1IWAA 4Y00A 5DETA 3UNYA 3OUYA 3Q89A 7AT1B 3M2UB 2J8SA 3GB0A 5L8RC 4PG7A 2J0WA 5C2CA 4P2MA 1FA0A 4ZDNA 4BWMA 2CQGA 1HWLA 1L5UA 3SYZA 1JLGA 4OYOA 2VH7A 3A8EA 2XQCA 2DXDA 5BYSA 2ZBIA 3UQSA 5ETQA 2ZNYA 3NBPA 1Y3KA 3BH6B 1N5YB 2XEXA 4ID5B 1X4AA 2F7VA 1IKVA 4BC7A 4UOGA 4NYPA 2IHR1 1RAOA 3AJ1A 4AYBD 5H9FJ 2X1GA 4C0HA 2Z4PA 2HBRB 2ERRA 3M6XA 5CABA 1VHFA 1NZ8A 1CBKA 3R2CJ 1N88A 1JX4A 4QYZJ 3GU0A 3FDSA 3CCJS 2XMKA 3DFEA 3OTDA 1VQNS 2BJDA 1HI1A 5K8OA 1FD2A 4LF7J 4P74A 2ZH4A 3C8YA 4L76A 3DLKA 2J0XA 2OEJA 1SH0A 1U6FA 3SDEA 1KBRA 4USHA 2ZC3A 1D9FA 1U1PA 4LUBA 5F3ZA 5HMYA 2OLWA 4NYZA 1NPPA 5EUHA 2HSEB 2R7RA 2F8EX 5LSRA 1V3ZA 4X66J 4IYQA 3AH6A 2L48A 1QSLA 2CJXB 5DQGA 1U1OA 4ZK7M 2W2MP 2FJEB 1SKRA 1LV5A 1F5CA 1ZZFA 1HBUB 2EFGA 2OPRA 3UD4P 3C14A 7FDRA 2LXIA 3MR7A 4USUA 2FTRA 3VAMA 2FC9A 2VPZB 1SJQA 2B51A 5IT0A 1N34J 4I2QA 2MLYA 4KHRA 4Y2MA 2DD8S 2W4CA 4K7QA 2JL9A 2QTWA 3K5NA 1TUGB 4DQSA 2HNDA 2Z30B 2BRLA 4RW7A 5FIIA 3ZZZA 2Y1JA 4WFBQ 1KFDA 1DQ9A 4NRUA 5EDWA 2G13A 4PYDA 4DN0A 3MR6A 5GAGI 5DM6Q 1NM2A 1DURA 3HKWA 4KB7A 2LA4A 1FRMA 3TYTA 3PW7A 2ASDA 2NCKL 4A48A 4DPWA 3PNIA 2VZ9A 1RWMB 1FDNA 3QRQA 1BE4A 1YIJS 3KLGA 3GYGA 3I6PA 3ITHA 2YWFA 3W62A 2IC3A 1YJ9S 2YNFA 2JWNA 1P1TA 1B0VA 4IUFA 2F65A 2AJFE 2C22A 3ILIA 3V6KA 3IAS9 3FRYA 1MN7A 4Y6IA 2DNNA 1I1GA 2HVZA 2BKOA 2V67A 1KTVA 3P3DA 4DSFA 3EVWA 3OFGA 3H5XA 3G8SA 3W5ZA 4ETZA 2W24A 3VAFA 3CDAA 3AJ2A 3ILOA 2XYGB 4I67A 1UVIA 4JI7F 3PJWA 2ZH9A 2F3JA 3K2YA 5IWAJ 3CD7A 4EBEA 4WYLA 2N3LA 1VBXA 4QU7A 5DM7Q 2NYIA 5A0YA 2PI4A 1TELA 2HHVA 4MK8A 3Q22A 2EI5A 3LF0A 3KLIB 2CIMA 1QD1A 5DDPC 3P96A 2M2BA 1FWPA 2B8PA 2GHPA 3O6QA 3THPA 1QM9A 2AIRB 2FJDB 3U02A 3NLCA 3MAAA 2D3ZA 3A8IA 2XB2D 5DQIA 3TX0A 2RU9A 2ZJQQ 4DR6J 3DDNA 5CYMA 1HNVB 4WCEQ 2NUHA 1HWJA 3WHIA 1FNOA 2F63A 3IA0A 1S1TB 3DCAA 1RHQB 4FXDA 4UOHA 2A0FB 1NHVA 1BQNB 5EWEA 3M8WA 2HGMA 2ZM6J 3TUZC 2YKPA 4RR5A 2CPJA 1LWFB 2NXCA 1VC6A 3VAJA 4ER8A 3HPOA 1S6PA 4N77A 1XWLA 2BABA 4EO6A 2E5LF 1FCAA 2PI5A 1B0PA 2IPOB 1A9NB 5DJBA 4HACA 4J9OA 4LFCJ 3PYGA 1S1WA 4ZPWR 3C46A 5HROA 3TOQA 2LVWA 2YNIB 1UW4A 2DEIA 2BJ1A 3CE8A 3RBXA 1UZHA 1R6VA 1BXNA 2BYCA 1S1VA 3UR0A 2HHTA 2IM1A 1YJUA 4IDKB 2J9DE 2WHOA 4NLRA 4TU7A 4DV1J 4NI2A 3ET6B 3W9IA 3S01A 1K47A 2RUSA 1C4AA 1MMNA 3AY0A 1S6OA 1RGVA 4ELUA 4ANDA 5E41A 3RR7A 4ATNA 2BJ3A 3FSXA 1N56A 1NH7A 3PYEA 1S0OA 5CHCB 5D0HA 4ZJOA 3FZBA 2JEIA 1GTEA 3I4PA 4KYZA 4ZJQA 3LGNA 3NP5A 1DBDA 5L39A 3T9NA 4J37A 1WTFA 3WQPA 3MMJA 2E1CA 4K50A 2B3TB 3E01A 2MQOA 2XO6A 1ZM4A 2RRNA 2AEFA 5HAOA 2V2ZA 2COLA 3CULA 1T9TA 2I2YA 2H9ZA 2UXBF 3FSYA 1JLQB 1BMQB 2HHHJ 4IG0B 2JJ4D 3CSKA 3GIIA 1RK8A 6FDRA 2UUCJ 4KHMA 2VG7A 3BDPA 5MLCV 1N48A 1IWGA 3MOJB 2RE1A 5EX0A 1YKWA 1PYTA 1CVJA 4YDXA 5DG8A 1SC3B 5HN0A 4OYMA 2YNGB 3EGZA 1HQUA 3HKZD 1H2VZ 3QT5A 3IO1A 4P71A 1HARA 1TL3A 3EVMA 3PIOQ 3DRXA 1RWXB 3BPSP 1I94F 1U1QA 3CC7S 1K0TA 3DGPB 5CXTA 2A1BA 1X4GA 4LMZA 2GW8A 4ZCKA 4RW6A 4PKDB 2BEFA 5KOWA 4CO0A 5CYQA 4ID8A 4U7UD 5B0GA 1XN9A 2HQCA 2K8GA 2R7QA 1TL7B 3IM9A 3O2IA 2UUTA 2YKOA 2AJ0A 1Y3JA 4WK1A 2Q66A 3ETMA 3KUHA 2GFFA 1S6QA 2CPEA 2AJQA 4V19J 1M5VC 1U6BA 2P9EA 3CIZA 1HNXJ 1QUPA 4ICLB 2GVDA 2UVWA 4H4KC 1IBKJ 2V2QA 2VODA 3PFEA 5F0WA 4UTGA 5HQ8A 1S97A 2J5AA 1JLCB 4P10A 3MUMP 1EHWA 1HL6A 3DDKA 4X64J 3PM9A 2DPJA 2LQJA 4M5NA 3M1VB 4IQMA 2OMOA 3ZC4A 4WFZA 3LUYA 5D78A 3FKBA 2UUBF 2R8JA 3IR7B 4K59A 4YUDA 1QVFR 3LA0A 2MXYA 1YTYA 1CLFA 5KOXA 1F3FA 4EBDA 1RACB 3FNNA 4DL5A 3G4SS 1S72S 3CB4A 2IFXA 2OPQA 1KLMA 4PAAA 2L9DA 2B0GA 2JEJA 3R5AA 2HNZA 1LQ9A 3G96A 1N52B 2QX0A 4HDHA 4LF2A 1FXRA 2JVRA 1SC1B 2VL1A 4RKUC 4DOZA 3ZZYA 4G1IA 4PXDA 3KHLA 4QBUA 2EG2A 3UPFA 4F0MA 3EXCX 1HMVB 4DX8H 4PWWA 5KFWA 5F0UA 1LFPA 3IFEA 2BE7D 2XS7A 1N5VA 2OPSA 4RUHA 1U45A 4LSLA 2Y1IA 1IKYA 3OJSA 3GG1A 4B9NA 1WSRA 1RLDA 5M2RA 2GIQA 1T94A 3HVAA 1SJ4P 2VQFF 1GXUA 3H59A 2EFNA 3KLEB 2D3UA 5HVFA 3TARA 3D68A 1N32F 4I69A 3VV2B 1FWKA 4OX9J 3GWCA 3P5BP 2DBBA 3RYLA 2CZ9A 2KM8B 1U0HA 5I4MA 5LOQA 1K1SA 1S1XA 3M8YA 3MGJA 1HNIA 3KG1A 4DV3F 2N4CA 1MU2A 3C2PA 1Z1ZA 3H8YA 4CLYA 2XI3A 4C9DA 2M8HA 3M7VA 3TAMB 2OMLA 4KQZA 3TZWA 1XR7A 1SXLA 4P75A 1HBMA 4RW4A 4X4NA 3QMQA 2C2NA 1QSSA 4A8WA 1IM6A 3NGUA 4ZHRB 4UY8T 2DHAA 5K9FA 4O3RA 4JI6J 2CQIA 1G6BA 3A4TA 5B0EA 1D8YA 3GPAA 4DZDA 3BS9A 3VAKA 4CWBA 4CTAB 2WW4A 3G9CA 1WOPA 1MROB 1IJEB 1HQEB 1NHUA 1F0XA 1IQZA 3C16A 2DNZA 2MEWA 3VVTA 4LF5F 1YDLA 1XNQJ 2QYCA 3DOLA 2VD3A 1WKKA 1DTTB 2DGWA 2EC2A 1RT4B 2ZZMA 4UOCA 3CJRA 1OPIA 5HLFB 2GVZA 5A76A 3L4BC 2GO8A 1BWEA 2X1BA 1G4CA 5F8HA 3L95X 4JV2A 2VJUA 2IIHA 3QT8A 1G7CB 3VAIA 1V3SA 3D6FB 2MHNA 1NSQA 4C11B 5E3PA 1VQ8S 1R0AA 3FUYA 2CQDA 2SXLA 1UEKA 4NZ7A 1RWUA 5KG7A 2PFDA 4X4UA 4K2JA 1V5VA 4DQPA 4Z7CA 2DKOB 3OL8A 3BQ0A 1VRUA 1S79A 1SUQA 5B0BA 4A47A 3D2WA 4WU2A 1UEVA 2CVEA 1D8ZA 4JI4F 4HHUA 1ZAWA 1UCNA 2A3JA 2HBQB 4K0KF 2E5HA 4GRSA 4F2RA 2C2EA 3V6DA 4KAIA 2QMUB 3N01A 4K4SA 3C66A 3N6NA 3EM1A 1TKZB 3KLVA 5IOLA 4CLWA 1C2PA 2AF6A 2LU1A 1S7IA 5J2MB 5C25A 3R7NB 4DV7J 1EAYC 3J81Y 1ZM2A 4NEZA 1HHSA 4DL4A 4OI2A 3H4DA 4FKXA 2FUG9 2BJ9A 2MTLA 2B9EA 4CH1A 3HT0A 1WWHA 4N41A 3LQVA 3TR5A 4MIBA 4LSNA 2AJ4A 1TL5A 1K1QA 4A4JA 4BCAA 1X9WA 2J6UA 2F8HA 3ZTPA 1QY7A 5HL7Q 2UU9F 3KG0A 2GQCA 3MM9B 4K8RA 2RMLA 4AL7A 3CJ3A 4N47A 1S9EA 1X5TA 1F5BA 3CCMS 2Y8WA 3I31A 4OHWA 4A8OA 3NOGA 2EWHA 4TLQA 2EFPA 4EUVA 4OHYA 2APOA 1WD6A 2AGOA 3JYTA 4B9MA 1UWBA 4NA3A 1KC8T 1WUUA 2IMOA 3Q8YA 4KGVB 4JV5F 4ALZA 5C24A 1DLOB 2WOMA 1NPRA 2K7JA 3MWBA 4UF4A 4LF6F 4HEA9 1TKDA 5A8RA 2MPUA 5F8NA 3LGMA 4U95A 1M90T 3DN9A 5HK4A 3D3CJ 1S57A 2V63A 3HULA 2IAJB 1SKSA 3L7UA 1X4HA 3NAIA 3NL0A 2ZZTA 1QAJA 3HX9A 2DPIA 3D4JA 5HP1A 2WBRA 4F4KA 1E6VB 1DY3A 1NDPA 2KG0A 4GC6A 1U49A 1WHYA 2OSRA 4N7TA 4DR5F 4CLTA 3FCVA 1T05A 4RW9B 1VC5A 4B3SF 3TX8A 2VC1A 2M3DA 2KXNB 4R0EA 1FE4A 3J7ZT 1RI7A 4NCGB 5GMDA 1H72C 3A8KA 3RU0A 1PAUB 3H5UA 2GJFA 2BQ3A 3HVRA 4JI5J 3HJFA 3SCKE 3GV8B 4F36A 1RHJB 3BF4A 3MPDA 5IM0B 3PFOA 4LFAF 2DGVA 2QN6B 4CO1A 3NAHA 2J9EA 1OWXA 3NCQA 2XZDB 2PGCA 2E1PA 1RT3B 1W25A 3UN3A 4JI1J 3R2DJ 3IBCB 2HWIA 4LIWA 1GXTA 2CPDA 4IR1A 2QE5A 2LCWA 2MZQA 2PSZA 3TUPA 2X3GA 3MD3A 1EIYB 1MNEA 1RTJA 1TUWA 3I0SB 2LXFA 4GKKF 1GMWA 3B82A 2Q6CA 4ZP8A 1GT8A 1IVZA 2OPPB 3LH2S 2JDJA 3M6UA 4UQTA 4NLDA 3PIPQ 3EPGA 2POKA 4OZLA 3FQLA 8ATCB 3Q0AA 1X4FA 3AODA 4NE9C 4Y2KA 2RAQA 2QMXA 3OUYB 1CG2A 1IBLJ 4N5SA 3PX6A 1KOOA 1NKEA 1JLGB 4DU7A 4L74A 5J1NA 2FVRA 2GIFA 4OZ5A 3HVTA 1YJ7A 2DK2A 3H5SA 4B08A 3QZ8A 1W2IA 1R6YA 2K06A 2RSQA 2I38A 5HMWA 2HZVA 3NBPB 4CQ1A 2H3EB 5T14A 2C1EB 2BOAA 3J80Y 4OQJA 2ZE2B 3CMAS 1YHQS 2HEKA 4XK8C 4QYRA 2UUAF 4HKQA 2A2CA 1B7YB 2CJKA 3CCWA 1NJIT 1YSJA 1HBNA 2LDIA 2CQBA 2YKMA 2YQ0A 3KJVB 2QLWA 1M0SA 2KZMA 4PXCA 3CIMA 4ZVUB 3RTVA 1CJVA 3QSIA 5IC4B 3DLKB 2HRTA 3OVAA 2RJZA 4B17A 1HNWJ 3BEGB 1KHVA 2XSJA 1RU1A 3P4UB 3ZZPA 3G86A 1RAHB 1KP6A 3LP1A 2CRLA 2OPRB 1C0UB 5D4PA 2V0NA 4ZLPA 2BJ7A 5E33A 1CJKA 2KFNA 3MCMA 3ELHA 1WI8A 5IXUA 2DNHA 3GILA 2GNKA 4I2QB 1UVLA 2UV8G 3HHEA 1RAFB 2XULA 1UWAA 1RBAA 1XERA 2HWTA 4MKAA 2G2YA 4BDPA 3IWNC 1UA1A 4NCBA 1N5YA 5E3RA 1QE1B 4WIQA 2ZUAA 5RUBA 4RW7B 3AD8C 3NGDA 4DCJB 2HVEA 3H40A 4DWIA 1VQSA 4USKA 5C7PA 2MKKA 4N56A 3HFKA 1CSJA 4AL5A 2FLOA 2QC3A 2HAIA 4QPXA 1ITPA 2Z2YB 2ZUGA 3N6LA 5LMUF 4LBHA 3KLGB 1IN0A 3ITHB 2IC3B 3G82B 2VFRA 3QIDA 2YNFB 3NNAA 1NCLA 3UVJA 2YX7A 1N54B 3OTCA 2XMMA 3KWMA 1KS2A 3MPUB 2WB1D 5KFGA 1VC0A 4NLTA 3LP0B 1SV5B 2DNMA 1PIEA 4BLGA 3D0HE 2LFVA 1Q78A 3AXKA 4FYYB 3TRGA 4E98A 4EMDA 4DXLA 2QFIA 4FNHA 2VA2A 3W2VB 2FLLA 1J5OA 1RWVB 2AT1B 2VONA 1RU2A 5A8WA 2WRMA 4O23A 3M8ZA 4JBCA 2B9YA 2HW3A 4NLQA 2NSBA 2BR0A 3H42A 2IY5B 3GG0A 3NRBA 1JWWA 1RAGB 2Z58B 1XTZA 4C0OC 3MM5A 1UP1A 1B0TA 2NS1B 1TQLA 2XMWA 3WZ0A 4NMLA 1HWKA 3MAAB 6AT1B 4TYBA 2LYVA 3OPKA 3OR1B 1W2BR 5E7OB 1FRHA 1H6KX 1KQFB 2KDOA 3OBIA 1WDTA 5CCMA 1HR0J 4QPTA 4ES2A 5C2GA 2H5JB 5MAOA 4OYWA 2C2DA 3D28A 3LP2B 2X1FA 3M9NB 4PR6A 1FRXA 3A1YG 1B64A 2ZWOA 1RZMA 1H3DA 3WIVA 3VWSA 5LMNJ 2LECA 1X5OA 3MAHA 5KTQA 3I5CA 1S6PB 2LQBA 1F6TA 4IOAQ 3MMAA 3FK4A 1NDCA 2MKYA 4WK3A 1S1WB 3FEXB 3GE9A 5HROB 3UN5A 5C42B 1VDHA 3NKYA 1UVNA 1Q16B 3E2EA 1U6ZA 3N28A 4TQSA 4J9NA 3D54A 4USIA 1S1VB 5L1KA 2HMIB 4DV6J 4DV5F 1RE1B 3LALA 3GJSB 4ZPVR 2KU7A 2DNRA 4P6QA 3QZ7A 2VQEF 4M94A 1NDLA 2E1MC 3NGTA 3PJ9A 1KKHA 4C8MA 2V8DA 1X31C 2E1RA 4YR0A 2OSQA 2QMWA 1T11A 5K20B 2Q1LA 4RJVA 4I2PB 2UXDJ 4A8KA 1GNKA 1HFEL 1Y7PA 3CTRA 1HBOA 1RXOB 2OIHA 1S1TA 4Y34A 3S7RA 3W3SA 2ALZA 5D0EA 3E01B 2CXEA 1TK5A 4PXEA 1BQNA 2MKHA 1HNZJ 3KMSA 3GCWP 1JLFA 1SI9A 2HZCA 1F3VA 4WF9Q 1LWFA 2HBYB 3QPIA 4ZVSB 1RISA 3FFIB 1JNZB 4OZ2A 4PEOA 3WX8A 2VG7B 3AXMA 3IR6B 4OJGA 3TJAA 4DUZJ 4YR2A 2JX2A 3ENQA 5EX3A 2HIYA 3CC2S 1UA0A 3ZTQA 3FBEA 2OFGX 1S12A 1TKTA 2YNIA 1VCTA 3G71S 4NZ6A 1ZM3A 1HIYA 1FXDA 1SPBP 4HTJA 5ETSA 3OHAA 4WKRA 2X3DA 3CJ2A 2DYAA 3CVKA 2OAUA 4XTTA 1S99A 4DR2F 3D0GE 2X51A 4R0JA 4RW6B 4PZVA 1KTQA 4IDKA 5KG0A 3QGGA 3B4DA 3PACA 3D1HA 4QQBA 1I3OB 2MZRA 2OEKA 4YMEA 3LOUA 3MMBB 2R42A 2MQNA 1S6QB 2W4DA 2H5EA 2PT0A 3IXQA 3BKTA 3OLBA 2GVDB 4EU0A 4P2XA 3R9LA 3OTOF 1JB0C 1S48A 2V50A 1Q8IA 1YZ7A 2W2PP 4KO0A 4PG5A 1L3SA 3BGOP 4HHJA 1T9XA 2ZH8A 1JXLA 4Q8EA 4B3MF 3DLEB 5F8JA 3V6JA 3R3TA 4IG0A 4DZ6A 1JXEA 3T6JA 4DJBA 1WTBA 2D69A 1YJVA 1WKJA 4CM0A 2JH3A 4DUYJ 1Q81T 2OPQB 3NEKA 2IM3A 1KLMB 3D9BA 1KHWA 3DNCA 3V2UC 5D8HB 2V4JA 3I32A 5HMXA 2YNGA 2YKAA 1QTNB 3EYZA 1XJWB 4LF4J 2P9GA 1RHUB 3DRPA 3SFUA 2HLTA 3TNVA 1Y9OA 4L75A 2ROEA 3W9HA 5HMZA 5LJ3Y 1PILA 3D66A 2R7OA 2AEMA 5FLXU 4NASA 3PRVA 4ECQA 1TK0A 1TL7A 4LSLB 2JEGA 4P2FA 4ZP6A 1IKYB 2CPYA 3P45B 3DDIA 2M52A 4CLPA 2P6TA 2XS2A 4M5DA 3PRDA 2UV8A 2BW7A 3LWLA 5F41A 5GAGU 4I6AA 2LKZA 4OMFG 5A2QU 1LK7A 3R1HA 2J7UA 4Q2MA 4ICLA 1HQ2A 2RH3A 3AA8A 3DOKA 2KZZA 2PMWA 1FRKA 1S9GA 2MZ1A 1U0HB 2CNOB 4OI0A 2XZTB 2G1DA 2XHCA 2OKQA 2P6SA 1Z4UA 3ZTOA 3OL6A 1R8CA 1S1XB 3W60A 4X84A 2PFFB 4OZ1A 1HNIB 1Y5LB 2K3KA 1MU2B 2Y0BB 2QGFB 5B7WA 3MD1A 2CNKB 2MGZB 3HK2A 2YWWA 2DO0A 2YVSA 4MKYA 1U7LA 4CLZA 1I6JA 3N6MA 3N0VA 2VG5B 2O5DA 1HBMB 3U27A 3OQ2A 4HDGA 3VGTA 2NPFA 1RT1A 1HD1A 2FZKB 1QDUB 1SVDA 3DRYA 4QWBA 2CA9A 1HYSA 2BOPA 2MKJA 4ZA1A 3X3UA 3EGWB 1JJCB 4CO2A 2YWEA 3OTEA 3GIRA 2D74B 3T1YF 2OH2A 3OV7A 3CCUS 5HQLA 2DGUA 4TU8A 4ZJLA 3H2UB 1Y00A 1HMVA 2AZ1A 4B3OB 2EXUA 3K17A 4OZ0A 3DLHA 4YB6A 1CC7A 2AJ1A 3SSRA 4B9SA 2VICA 2V68A 3G8TA 3C16B 2BE2A 3KK2A 1I51B 3BGLA 5I42B 2RNEA 1UJ6A 3RR8A 3DOLB 3KLEA 4ITSA 1YBAA 2ZM6F 2OO4A 2WSCC 3UCZP 5KFUA 2KH9A 3HD2A 3BO4A 3CC4S 1GAOA 2XMTA 2AKWB 5K14B 5D3GA 4H54A 2GVZB 2G2ZA 4TVAB 1N36F 3ENAA 4X2BA 3EMTA 2RQKA 2MJUA 4ZPCA 3AFGA 1YI2S 2AYEA 1U1RA 4XPCA 2KHDA 4I0WA 5CD4A 3T5LA 3EX7B 5BYRA 2Z2LA 2E7XA 5KG1A 1NZAA 1R0AB 3NGKA 1TL4A 2F4VF 4DPUA 3NMRA 2RQMA 3BZQA 3D6MB 4OYIA 2CQ0A 2FHMA 3OFEA 1IQTA 1YJRA 2W7OA 3LAKA 1JXVA 3B8HA 3CCTA 2RD5C 1SUQB 1FF2A 2N3OA 5U47A 3S6EA 5L9NA 3TA2A 2M7SA 2RVJA 4WKYA 3H0PA 2DIVA 3M8QA 4CI0B 2VKZG 4CTAA 3U1NA 4WXWA 4FKYA 4JI7J 1FEEA 1NB7A 1IKXB 3BN4A 1HQEA 3CT9A 4X4QA 4J9PA 3V6DB 5LJ5Y 4NLVA 3PR5B 1TK8A 4J9RA 2FVSA 3MUVP 2YNHA 2MYFA 1M5OC 1W26A 2QIFA 4PG8A 2M4MA 2KM8C 5B09A 4ECXA 1NBEB 4ZN3A 1FJGF 1SJRA 4DV4F 2BQUA 3MEEB 3KFWX 3RG6A 5E3QA 3LPYA 1JKHA 1Q8BA 4C8LA 3GJQB 4RX6A 4Y0FA 2R7WA 2YQ1A 3MCOA 1AZSA 5LM7E 3R97A 3CXCR 4DN9A 3KLHB 4NMXA 1X60A 2C2RA 4PQAA 2B4OA 4IG3B 1N6QB 2HURA 3GSDA 2B5JB 1OIAA 3JTOA 1VQ5S 2F40A 4ECZA 5BJRA 2ZBQA 2E5LJ 3ZXWA 1CEZA 2FYXA 1UVKA 1TMMA 5KFVA 1WC5A 1J5EF 1T3OA 4E8UA 1T95A 2HS0A 2RB7A 5HBMB 4DX5A 3IWXA 2DR8A 2WOMB 1YRUA 4OZNA 3TZXA 1U1NA 4HT5A 3FEYB 4GVBB 4ED7A 5A8RB 4PPDA 2DR5A 1Q7LB 3PW0A 2B4UA 2O01C 4DHVA 2MQMA 2X7IA 2J6SA 1EB0A 3AD7C 5AJ3F 2KT3A 3QFHA 2LQ5A 1ICEB 4RLEA 3ZZRA 2CQ2A 4FBUA 1HKAA 4O0IA 4LRCA 4WYWA 3QSYB 2B7CB 4TN2A 5J2MA 1L3VA 5KFCA 4Q7AA 1D9AA 2DNOA 4ILLA 3UWTA 3S8SA 3N9UC 2J76E 1T05B 2ZH3A 4Q2LA 4PG4A 4OI6A 2DIUA 3NWRA 1SL2A 2ZBCA 2W9BB 1IR2A 4DCPB 2DGSA 1VYAA 3GIMA 3E8OA 2HFZA 4TY8A 1BY9A 4ECVA 3PHTA 4JI0F 4LQ9A 3PW4A 3V81A 2XLKA 2UXBJ 4CYUA 4IOCQ 3DKDA 3P49B 4IFYA 5FD1A 1RCOB 2ZNZA 2AQ4A 2HAFA 2G9OA 2HGLA 3DYAA 2DB1A 4HVZA 4DSEA 5HATA 4OV1A 1WHWA 5H1SV 2FQQB 3C19A 4B3TJ 4NOHA 2CUYA 4AQYF 1U2CA 3Q2TC 2H4YB 4R8UA 3CD5A 3ZZOA 3AD9C 4J9UE 3H90A 3JSRA 3G6ES 5KFKA 1I94J 1JJHA 1NSPA 5AT1B 1RTJB 4PWDA 5J2QB 3V6HA 3A13A 3AB2B 4DS4A 1XMOF 3WBZA 3A12A 2V69A 3RB4A 2HPUA 3MR5A 2LMIA 2RQ4A 4AL6A 2ZVSA 4M8LA 1EKSA 1RQ0A 2C3OA 3CDEA 1JLEA 4USTA 2K7KA 3EVOA 2F9JA 2HVHA 4LVNP 2HNYA 4O4GA 2J9DA 4WXOA 3MI7X 4ED5A 2OTLS 3NXZA 3PRBA 2RHSB 5DO2A 1E6VA 3MEKA 4LJMA 2ZZNA 4Q43A 2F5GA 3UD3P 3GCXP 2PMHA 1B70B 5CCLA 3HVTB 4RW9A 2NSCA 2LQ9A 4URQU 1UW9A 5I3UB 3FJ2A 2W8KA 3TQ1A 1LXNA 4ZVRB 3ONQA 2PMZD 1C0TB 2RILA 2DNLA 1GEHA 2HHPA 1DARA 2PA8D 2UUBJ 3DRSA 3QGPA 3AAWB 1WDDA 2R4FA 4A8YA 2ZEJA 3DC2A 4XAKA 1ZM9A 4KPCA 3TW0A 3RAQA 2R2UA 1VGYA 3PEJA 2ILZA 2AWZA 1ZPWX 4P73A 1NEEA 4EEYA 3JXOA 1RHMB 2FY1A 1HBNB 1N5SA 5DGAA 3DXSX 2YKMB 4WJBA 8AT1B 3L3CA 2CQCA 5AXKA 2HFNA 2W2QP 3BJYA 3BO2A 1BQMB 1CJVB 3W5YA 2F4FA 3QFWA 3I0SA 4DR4F 1YBTA 4WIIA 2DGQA 4C3KA 1GMWD 5T7LB 1BC6A 2XSJB 1QUVA 2DTJA 4FF4A 1G2EA 3UDVA 1R3NA 1NJZA 5DDRC 4LSZB 3LP1B 2AEJA 1KLNA 2BANB 1OSCA 1X8DA 2YTCA 2VQFJ 3RBDA 1P9QC 3E3XA 4KRWA 1U0SA 4QIGA 4IRDA 1CJKB 2D7SA 3OR2A 1N32J 4OYXA 3LANA 4GKJF 4OLPA 2QJ3A 1GXLA 1V6HA 2R8IA 3M4XA 4DV3J 3M05A 1M5PC 2MY7A 2ZE2A 5GVQA 3QLHB 3D6TB 5EN1A 3BV8A 4BBYA 4A8SA 1I5OB 1B4SA 1WHXA 5HSPA 1R31A 4NA2A 3CGIA 4CT8A 3W9JA 1N8RT 1KRPA 3IAM9 4NLXA 2IBOA 3KJVA 3Q2SC 4HL9A 1NK0A 3HF5A 2DT9A 3I5AA 2R7VA 1YJWS 1NXIA 4ZVFA 4YY3F 2WSEC 1HPZA 4JB8B 1VISA 3UD5A 3UVJB 1R8HA 1NHKL 4X4OA 4FYXB 4FZVA 4MFBB 4FNIA 3DU6A 4P7TA 1GK8A 3KJQB 1AROP 1S76D 2GV1A 2R7SA 2XGQA 1RHKB 4LT6A 2AHOB 2R3VA 2MQQA 2ATCB 4LF5J 4C4WA 2CQPA 3GTYX 3W8GA 3VCDA 5CZXA 4C8OA 1C0UA 4OX6A 3PKMA 2IDEA 3EDRB 4C6AA 1J5OB 1U25A 5D4NA 4DSKA 4K4WA 2EW9A 2C3MA 1YRTA 2YKNA 4DPOA 5A8WB 2AZ3A 2MKCA 4KC5A 2DXEA 2E7VA 3TANA 2K2PA 4LRAA 1Y11A 5ETOA 3THVA 3BO3A 3FBFA 1KQSR 3MM5B 4XPEA 4E2FB 1QE1A 3VVUA 1CS4A 5KG4A 4V19X 4DV0F 3TA0A 5IQ6A 4P2SA 4R5PB 3MR3A 3ISNC 4QW8A 2MZJA 3JB9k 5KFXA 1Y5IB 2GAHC 3HMJG 1NUEA 5KT7A 1YZ6A 3G82A 1AXQA 2DNKA 2B6AA 3VAHA
chains in the Genus database with same CATH topology
1RA7A 5F9NA 5M2PA 4ES3A 2DNYA 4UUXA 2DITA 5T14A 3MDFA 3ZFVA 2FHOB 2XMUA 3J80Y 1SC6A 5GADU 1TKZA 4OQJA 3W7BA 2QSFA 2C28A 2ZE2B 3CMAS 1YHQS 4X4VA 4B9LA 3MMAB 4I4BA 2E1AA 1VRTA 3GMGA 1PO6A 2A18A 1EP4B 1BGXT 3BSNA 4XK8C 3LP0A 1SV5A 2ACYA 4QYRA 1FDAA 1FNMA 5FDLA 2UUAF 2VG6A 4HKQA 2HRYA 5GMKa 2DH9A 4U67Q 2B4VA 5SZTA 1X0PA 5K8PA 3KNAA 4LF7F 5L1LA 5HP1B 4Y28C 1UEUA 2A2CA 2AX0A 1Q53A 4TNOA 3I56S 3MFIA 2CJKA 3CCWA 4RNMA 4ECTA 4DV6F 2MB0B 2CJ9A 3C6UA 1NJIT 3I55S 3CF5Q 1FE0A 1FTRA 1YSJA 1HBNA 3U1MA 2LDIA 4ECSA 2CQBA 5BYQA 1RJJA 2FLNA 1WG1A 3H20A 2YKMA 3W2VA 5F9LA 2JFKA 2YKQA 4KJIA 3KJVB 2QLWA 1M0SA 4Y2IA 3Q23A 4MKBA 3C6TB 4C7QA 4JI2F 2KZMA 3KLFA 1XC9A 4PXCA 3D1QA 3CIMA 4OFZA 2BBEA 1S49A 3ZZUA 2O66A 2VFUA 4PWUA 1ZETA 1QVGR 3RTVA 3I0RA 3DLKB 4OHXA 2NQPA 3TP2A 1LWEB 4X66F 2W9AA 3OVAA 1FKOA 2RJZA 1LW0B 1TVRB 2R2RA 3R5BA 4YP3A 3N5BA 1Y5NB 5DLFA 2L41A 2OP5A 1X4CA 3DXBA 1FT8A 3M8SA 1OQ6A 2ZOGA 4NL5A 5HI7A 4B17A 3TI0A 2V9WA 2AD9A 1SL1A 3LAMA 3T1AA 3GFHA 1WF1A 1R7IA 3MM9A 3BEGB 1DTQB 4YOEA 3T3FA 2UXDF 1KHVA 2XSJA 3VTIA 1TL1A 2K3IA 4OHZA 3ZZPA 1NJWA 1IJFB 3DLGB 2FJWA 4QJVA 2RDJA 2XY6A 1RT7A 2M9KA 3VQTA 5JUMA 2QRRA 5IS2A 2IM0A 2UZAA 2UVVA 3G86A 3H2LA 2U2FA 2JEFA 1RAJA 2LEAA 4F02A 3M9MB 4TLRA 4MK7A 5ITHA 1TR0A 3DLJA 3DI6B 1N34F 4TY9A 3LP1A 2CRLA 3GFYA 3CJKB 4G3IA 3PJXA 4TU9A 3PHEA 5LSLA 3CPWR 4WE1A 2OPRB 4URSA 4RNNA 4A8FA 1F60B 1S1UB 4KKOA 3OR1A 1C0UB 2D9PA 5D4PA 4PUOB 1HNZF 3KOAA 3FZ2A 3WX4A 2V0NA 1FDDA 4ZLPA 2M0GB 5E33A 2V2KA 4DBQA 3UR3C 2E44A 3TVKA 1HBOB 5KT2A 3BR9A 2KFNA 2UP1A 1KFSA 1IKWA 1HI0P 1KD1T 2WONB 1WI8A 3FRZA 2EG1A 5IXUA 2DNHA 5A8KB 2IA0A 1Q79A 2GNKA 4C3MA 3GILA 4I2QB 3M8RA 1UVLA 1UVJA 3RRHA 2UV8G 2DR9A 3HHEA 1DLOA 3UNGC 2XULA 4MAKA 3LP2A 2B9XA 2VFSA 1VLYA 3OL9A 1FVQA 2JVOA 2EK6A 2VC0A 3FMWA 1JLFB 2MSTA 4TYAA 4DUZF 4M1KA 1XERA 5I3PA 2HWTA 4MKAA 3F56A 2DGTA 4DL3A 3KMQA 1VQMS 3FGVA 4BDPA 4QCLA 2E7WA 2NLWA 3IWNC 2R2TA 3NWGA 3SQGB 1UA1A