2VGXA

Structure of the yersinia enterocolitica type iii secretion translocator chaperone sycd
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
134
structure length
128
Chain Sequence
GGGTIAMLNEISSDTLEQLYSLAFNQYQSGYEDAHVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIEPRFPFHAAECLLQGELAEAESGLFLAQELIANPEFELSTRVSSMLEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE SYCD
publication title Structure of the Yersinia Enterocolitica Type III Secretion Chaperone Sycd
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Chaperone
total genus 49
structure length 128
sequence length 134
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vgxA00
3CK9A 1KT0A 2XGMA 4Y6CA 5ARFA 1QQEA 3QWWA 3RO2A 4Y6WA 3GZ1A 4JHRA 3VTXA 2XGSA 3CV0A 2DBAA 4B94A 2XGOA 4N5CA 3NF1A 5KJMA 4HOQA 1HH8A 3UQ3A 4CGWA 4J8DA 3CK7A 2E2EA 4GA0A 3CKBA 4U04A 3ASHA 5ARGA 3MKRA 2KCVA 3UPVA 2P58C 3HYMB 3QWPA 4G26A 3ASGA 5A6CA 2GW1A 2Y4TA 1YA0A 3RJVA 4I17A 5FZSA 4HOTA 1NA0A 3OXLA 4RG9A 3LCAA 3MA5A 4LEUA 3MV2B 4GA2A 5FJYA 4IN3B 2PQRA 4UI9J 3AS4A 1W3BA 2AVPA 4UQYA 3EDTB 3KAEA 3ASFA 4HOSA 3BEEA 1NA3A 4JA7A 2HR2A 3FWVA 4UI9C 2KC7A 3S7BA 1P5QA 4H7XA 5A7DB 4WNEA 5HI7A 4CDRA 3FP3A 2Y4UA 2VSYA 3KS2A 3MV3B 4G24A 1FCHA 5G05J 4N2QA 4W9RA 3ULQA 4J8FA 3SZ7A 2XEVA 2JLBA 3RIBA 3Q4AB 1TJCA 5EX3A 4U0UA 1NZNA 4WUYA 5G05C 3GW4A 4GCNA 1KLXA 4GZ5A 2UWJG 3U4TA 4WNDA 4WNFA 4EQFA 2PZIA 2VQ2A 1WM5A 2ONDA 3PE3A 1ELWA 1HZ4A 3QOUA 3CEQA 4G2VA 1KT1A 2VGXA 4GCOA 1ZU2A 4I2ZA 4F3VA 4XI0A 3ASDA 4HOUA 1PC2A 4I1AA 4H7YA 5CCMA 4N39A 3S7FA 3VTYA 5C1DA 3Q49B 5KJLA 4G25A 2BUGA 4NRHB 2XPIA 3PE4A 2KCKA 3SF4A 2HYZA 4GYYA 4WNGA 2XCCA 2I6HA 3CK8A 5JJ7A 3Q5MA 2MHKA 5AYWD 5KJNA 4I9EA 5M72A 3ZHEB 4G1TA 4J0UA 5EX0A 2UY1B 4HORA 4YNDA 4KXKB 3TG5A 3LY9A 3QWVA 2C2LA 2Q7FA 2WPVA 4BWRA 3KD7A 5DBKA 2L6JA 4BT9A 4I9CA 2YQ8A 5DIZA 5CHEE 3URZA 5HQ8A 3CKCA 3CVLA 2KATA 1ZBPA 2VSNA 1HXIA 1XNFA 3GYZA 3ZFWA 3Q15A 4AM9A 4I2WA 4GA1A 1IHGA 4A1SA 4G23A 4YVOA 4BT8A 2OOEA 5BNWA 5LCWJ 3ZPJA 2PQNA 4O6FA 3MEKA 4GPKA 4GZ3A 1B89A 5KJKA 4GZ6A 3ZN3A 4AY6A 5LCWC 5D0QD 1Y8MA 4U0SA 2PL2A 4J8EA 3OXGA 2C0LA 4JL0A 1OUVA 2LNIA 3Q47B 3PDNA 4XIFA 5CCLA 3S7DA 3TAXA 4UQXA 2NC9A 5D0OD 2C0MA 3TGOA 3GZ2A 1ELRA 3OXFA 2YHCA 4U0ZA 2XCBA 2R5SA 3R9AB 5JJ6A 4XI9A 3RKVA 3ESKA 4U07A 4YVQC 2VYIA 5FZRA 4AY5A 3QDNA 3LPZA 4N3CA 3UUXA 4APOA 3IEGA 4KYOB 3N71A 3AS5A 3S7JA 3TG4A 1A17A 2KCLA 4RG6A 4N3AA 4BTAA 3LKUA 2IF4A 3CVPA 3LYAA 4BTBA 3E4BA 4NQ0A 4ME2A 3QKYA 3CVNA 3RO3A 2V5FA 3O48A 2FBNA 5FTPA 2FI7A 3K9IA 3WXXA 5EKQD 4GYOA 1WAO1 2VGXB 1IYGA 2HO1A 5FZQA 3U3WA 5G04J 4JA9A 2FF4A 3LY8A 5BT1A 4CGVA 2WQHA 4UI9K 2J9QA 3LY7A 4GYWA 3ZHEA 2VGYA 2UY1A 5BW8C 3AS8A 4N2SA 4ABNA 5G04C 2LSUA 2FEZA 1E96B 2QFCA 4KBQA 5FT9A 3FFLA 5JJTA 3RU0A 2IFUA 3JYSA 4N3BA 4UQZA 2LSVA 3ZGQA 3CVQA 2FO7A 4AIFA 1QZ2A
chains in the Genus database with same CATH superfamily
1MZCA 4CYMD 2DZOA 4HXIA 4LERA 4RSYA 1KT0A 2XGMA 3CVUA 1DC2A 3PUKA 3VTXA 4ANVA 2XGSA 2WB2A 4N5CA 2H6HA 1QBQA 5KJMA 1H0AA 4ILGA 3CK7A 3SQVA 2E2EA 2VSXE 1X81A 2J07A 3CKBA 1N0RA 5JHBA 5ARGA 3DXMG 1LD7A 3L08A 3MKRA 3I3NA 5J08A 3PZ2A 3UPVA 3Q78A 3HYMB 4ACLA 3NBNB 3IV0A 3SNXA 4ATZD 3APDA 3L54A 2R05A 1V54E 1Z5SC 1O1RA 2X6JA 4GA2A 1IHBA 4GMRA 4WWOA 4UI9J 3AS4A 3TWWA 5ENOD 4MKTA 1MYOA 2ZXWE 3DXKG 4KVMA 3LVQE 1NA3A 2IOLA 3RRMB 3PZ1A 1SA4A 3EHNA 2KC7A 3NQPA 3T5VA 2DWZA 3X2QE 5CEAA 4MRUA 1LTXA 4CCAA 1Q2ZA 3UM3A 5BXOA 3FUEA 4URKA 1IQUA 3MV3B 4G24A 1FCHA 5G05J 2R2LA 4P29A 3RIBA 5KBAA 4GPMA 4U0UA 3BU8A 1ZB1A 4BY6A 3GW4A 4GCNA 4Q69A 3ABLE 1KLXA 2XS8A 4WNFA 4ANXA 2PZIA 2L6BA 1WM5A 3TWRA 1OCZE 4I1OB 2VSOE 3PE3A 5AQAA 3QOUA 5JHAA 2YNQA 3CEQA 4F53A 2PM7A 4ATGA 4XI0A 3B95A 1BU9A 3UINC 2BF0X 4N39A 3S7FA 1RZ4A 3B13A 4TXQA 1TEZA 4I6GA 1BPOA 2F8XK 2BUGA 2WQ7A 3J5PA 4GZCA 4NRHB 4KZCA 3HVEA 2XRZA 3NAWA 5B1AE 2I6HA 3CK8A 3P1UA 5AYWD 4HNAD 1YCSB 5M72A 4JC8A 2A4ZA 5J90A 4A1GA 3Q79A 2UY1B 5D66A 4DUIA 2CHWA 2BEDA 2RG8A 4ILHB 3QWVA 1WG0A 3KD7A 5ITZF 1E90A 4WWPA 3CHQA 4I9CA 4G8LA 5DIZA 3V2OA 2R03A 2IJGX 3TWQA 4UWLA 2P9LG 3CKCA 3MGBA 2YINA 4U95D 3PZDA 2H6IA 1EYHA 3W9FA 2P9NG 4UWKA 3PRZA 1TN8A 4AM9A 3FU3A 2WXLA 4GA1A 4BT8A 4YVOA 1NP7A 2YHEA 4YDYA 3ZPJA 5AIJA 4O6FA 4DLQA 1E8ZA 5A23A 3PVLA 1N4PA 1EDUA 3SI5A 3ZXPA 2A5EA 5BXUA 5EIBE 3L17A 1FT2A 5LCWC 1TYQG 4JPSA 3CHSA 3PH0C 1Y8MA 2PL2A 1TN6A 3ONLA 3UM2A 2I1JA 1H19A 3UT8A 1N94A 2LNIA 4A3TA 3HIZA 4GTRA 2NC9A 3GZ2A 3OXFA 2CG2A 2L9BA 5LP0A 4PH4B 5CRUA 3PS6A 4F1PA 4WAFA 4PDXA 3G2TA 4CDMA 3QK0A 4XI9A 1DVPA 5JA4D 3T9KA 3FDHA 2KM4A 4U07A 4K0RA 2BKKB 3ML8A 2I2OA 3S2AA 1N4RA 1S63A 2DZNA 3AU4A 3CVYA 4JEUA 3IEGA 3N71A 1PAQA 4ANWA 3DEOA 2IF4A 3ZNGA 3FUDA 5CMWA 3FUHA 1SA5A 5LX8A 1Z3XA 4JZYA 3RO3A 2AXZA 2FI7A 2X6KA 4BETA 4HI8A 5ENRD 3MZLB 4AEZC 3ZYKA 3Q7FA 3QNKA 2WXMA 3L82A 1OWLA 3G2WA 2IU1A 4C9BB 4HFGA 5BT1A 3JQ0A 3FH5A 3ASOE 5ANRA 1U3DA 3ZHEA 4HLEA 5KNGA 3HVEB 4GMLA 1TNYA 3TWVA 3FFLA 4F1SA 5CBOA 3CQCB 2OCCE 3C3QA 4BFRA 5JJTA 2OVFA 5T3RA 2IFUA 4BERA 4BESA 2LXMA 3CVQA 2FO7A 4C48B 2P9KG 1QZ2A 3HG0D 4LRZA 1FVFA 1HO8A 4BX9A 5G55A 3QWWA 1Z3YA 3NOCD 4GTOA 5LOZA 3T8KA 3RO2A 4Y6WA 3GZ1A 3DSWA 4DPRA 5D2MC 4B94A 1PY1A 2NXPA 2QYJA 3I4GA 3JUIA 4HOQA 1HH8A 3UQ3A 4CGWA 4JHKA 4B93B 3FTVA 2Y1LE 3ISMC 4L9PA 5AQ9A 4U04A 4A63B 4U96D 3ASGA 5A6CA 3C3RA 1YA0A 4I17A 2WXRA 2X6FA 3EHRA 4HOTA 2KZTA 4JVSA 4RG9A 3LCAA 4K5AB 4LEUA 5FJYA 4OYSA 2WXFA 3NZSA 4O1PA 4AOFA 5T4YA 3EUVA 1FVHA 2KBXA 2IY0C 3BEEA 2F8YA 3T8MA 1N54A 3ABKE 4UI9C 3FU6A 1P5QA 5AN8A 5A7DB 2VSYA 1X5BA 3PNTB 1FT1A 3E34A 1LF8A 4N2QA 3EU5A 4GTSA 5FQ4A 2XEVA 1JWGA 2JLBA 2X6HA 2OV8A 2GRRB 3UMVA 1O5MA 1TJCA 1NZNA 5G05C 4DI3A 4LCTA 1UJKA 2UWJG 4GZ5A 4O60A 3U4TA 4WNDA 2JEKA 4MLPA 1E7VA 2V0PA 4DX7D 3MX3A 2ONDA 1HZ4A 4FULA 1TNBA 3L22A 2CFZA 4GCOA 1ZU2A 4F3VA 4V3IA 4MBGA 3ZRHA 5EDSA 1TJFA 1SVXA 3E37A 3FTWA 4HRNA 3FTSA 2WXJA 5C1DA 3ML9A 3NOGD 1OT8A 4HLLA 4L2LA 3V2XA 4XE0A 1N52A 3LVRE 4EZLA 4EECA 3PE4A 2KCKA 3SF4A 2B6CA 4UWFA 3G2SA 1S70B 3G2VA 4HB5A 5JJ7A 3Q5MA 2MHKA 3EHQA 2WMNA 3QARA 4I9EA 3ZHEB 2J09A 5AJDA 4G1TA 2QZAA 4FA6A 4YNDA 4Q94A 4KXKB 3LY9A 3L13A 3RRNB 2CHZA 2GGFA 3GZSA 5AQBA 1U3CA 3CQGB 5DBKA 2L6JA 1K1AA 4BT9A 1DCEA 4AXHA 3DBSA 2YQ8A 1OWOA 4I6EA 4ACKA 2PM6A 4JB8P 3URZA 5KCMA 3LJ3A 4J6IA 3JCKC 1KZOA 2GRQB 1WY6A 3GYZA 3Q15A 4LNUD 3D9JA 2DCPA 4HBDA 2CFUA 2J4DA 4I2WA 5AJLA 2I1KA 4G23A 1EF1C 3L6AA 3OTNA 3TL5A 4DI4A 1GW6A 1Y6IA 4EZJA 1TN7A 1TNUA 3F6QA 4AY6A 4IRUA 3ABME 2VJ8A 5D0QD 1AP7A 4A55A 4EPZA 2BKGA 3LJNA 1HX8A 4J8EA 3CVVA 2KZTB 2XPYA 2C0LA 1DCQA 3HDXA 3Q47B 3PDNA 3S7DA 3TAXA 1TR4A 5D0OD 2C0MA 2AW6A 3B7SA 3ZXSA 3AAAC 3ZUVB 3PUJA 2DYSE 3D9LA 3D9HA 4LUNU 4I1MA 2XCBA 4YDWA 2R5SA 1A5EA 1O1SA 5JJ6A 1OWMA 3L16A 3RKVA 4X8QA 5AENA 3UM1A 1RW2A 5ENPD 4OAUC 1U2VG 2KXPC 2L0TB 3MYVA 3UUXA 4APOA 1UOHA 2CHXA 2WMOA 3UI2A 3S7JA 4CT4A 1DNPA 2AXVA 1N4SA 1SQMA 1A17A 2LO6A 3LKUA 3CVPA 4U7EB 5ANLA 4K5BA 3E4BA 1S0PA 2Y3AA 4ME2A 3PEVB 4AP2A 3ONKA 2FO1E 3CVNA 1H2VC 2WM9A 5AARA 3O48A 5FTPA 2P9SG 2V4LA 4GYOA 3D9KA 1WAO1 1IYGA 3RAUA 1H6PA 2HO1A 3U3WA 3LY8A 3ZIMA 2RKKA 4UI9K 2J9QA 3RRUA 3WG7E 3AS8A 3D9PA 4ABNA 4EBAA 2FEZA 2QFCA 4UUCA 2XZDG 3G2UA 4JD2G 4GTVA 3JYSA 4N3BA 3JUEA 5EYPF 4UQZA 3UKRG 1UG3A 3O4ZA 1OCRE 3CLJA 2WXIA 1YMPA 3CK9A 4HRMB 2VGEA 4GZDA 4Y6CA 2XPZA 1FPPA 3CV0A 2Y0BG 2MRIA 5B3SE 2DIWA 1XGWA 3NF1A 1S64A 2NYJA 2GRMA 3FY4A 3SD5A 3ENEA 3E33A 5G2NA 1HE8A 2P9UG 1IQRA 4FLHA 1E8XA 3QWPA 4G26A 3DSVA 4TXPA 5E75A 2QC9A 1G3NB 4E6HA 2GROB 4KMOA 5FZSA 4GB9A 1NA0A 3OXLA 4ZHBA 1O1TA 5BPPA 3MV2B 4IN3B 3UXGA 1K3ZD 2PQRA 4FJYA 2HE0A 1JUQA 4O1OA 3C72A 4RQIA 3ASFA 4HOSA 2ETCA 2GRPB 2M63A 2X38A 3BG1B 3FWVA 2PNNA 2VTBA 1BLXB 3U9WA 4YDOA 3Q73A 5FQ8A 1E8YA 4U63A 1JCSA 3NZUA 4WNEA 4C0MA 3HRAA 3SBSA 2AWIA 4K5CA 4D10C 4DX1A 3DPDA 3Q9NC 3RK6A 4GAAA 3UTMA 4QQIA 4BSZB 4PS7A 4KVOA 2WXGA 3SZ7A 2LAIA 5CECB 3KSQA 4Q96A 4BX8A 4XEIG 1D8EA 2DYRE 5C2YA 3B7TA 5EX3A 4FHJA 3DSSA 4LSZE 3P2BA 4EQFA 3IKOB 4JEHA 2RD0A 1ELWA 3FU5A 3J5QB 4IYPA 2XQ0A 2VGXA 5T8IA 2J8SD 1H2TC 3ASDA 3HXFA 3FULA 4HOUA 4OVVA 3UIOC 4I1AA 4LNBA 1H6KA 5FQ7A 3T5XA 2J4BA 2ZISA 5FINA 4G25A 3QC1A 5BV0A 1MHQA 2HYZA 2XCCA 4B0ZA 4GU5A 1N0QA 5ENSD 3FEXA 5EX0A 3DEPA 4QFVA 3IBEA 2IO2C 1HG2A 1SZ9A 3TG5A 2B0OE 2Q7FA 4BWRA 2ZU6B 2NSZA 3RSEG 3R9MA 4ILIA 5CHEE 5HQ8A 3CVLA 1V55E 3PNLB 1JWFA 2KATA 2V8SE 1JPLA 1ZBPA 2VSNA 3D9NA 3VLDA 1HXIA 2ILRA 1IHGA 4LNGA 4Z68A 4A1SA 3E32A 4XKBA 3BUAA 3V31A 4AVXA 2XHEA 4BSXA 4RVBA 3CHOA 3UKUG 3FUNA 4GZ3A 3AG4E 4TUMA 1B89A 4FLBA 3ZN3A 2ZGDA 2BTDA 4DJAA 3TJPA 4K03A 2WXKA 2XEHA 1N11A 5EYLA 3ZYLA 4R7LA 4AJWA 2CG3A 1IKND 4J7WA 4WWNA 5JMND 4XIFA 2FULA 3JXIA 2I9CA 2L0IA 3TXMA 3TGOA 4XKCA 1KZPA 4G11A 4KT6B 2EILE 2RFMA 4GTPA 4OAVB 2R02A 2XEEA 4U0ZA 4G8KA 2LUHA 3FUMA 4GMJA 4BEPA 2WVIA 3L9TA 2VTBB 3VLFA 3HXDA 1IXVA 2AJAA 4I43A 3ESKA 4UWHA 3UIPC 2QYUA 3PZ3A 4YVQC 3BQOA 5FZRA 1HS6A 3UT4A 1EPUA 3QDNA 3APFA 3LDZA 4U8HA 2QY7A 2XS1A 3MCXA 4JW1A 4M7CA 3Q9UC 4KYOB 4FP7A 4JXTA 5BUZA 3MKQA 1OCOE 1H6OA 2WXHA 3TG4A 4RG6A 5CRVA 4BTAA 2R59A 3LYAA 2EIME 4BTBA 3EIJA 3DPYA 1TNOA 3KEZA 1K1BA 3IHYA 3FHEA 5HS0A 3EU9A 3E30A 1H2UA 4PUCA 1OWNA 2GRLA 3WXXA 2F0YA 3ZKJA 3CR3A 2VGXB 5FZQA 4HRLA 5G04J 4JA9A 3AJIA 3FH8A 2ETAA 3V79K 1SZAA 5ENNA 3APCA 3SBTB 4F6RD 3DWLG 4CRWA 2R17C 4N2SA 5EN5D 3V30A 4FJZA 3Q75A 3PREA 3RU0A 5AAOA 2LSVA 4F7AA 3ZGQA 3ASNE 3Q7AA 4L2YA 4HVBA 2IO3C 4L1BA 2F37A 4L7TA 5ARFA 1BI7B 1QQEA 4CZ2D 3LXUX 4DRXE 5CERB 4JHRA 4U8YD 2DBAA 4GTQA 4MS6A 2XGOA 1LD8A 1NFIE 4HI9A 4XZ4A 4J8DA 3AG2E 3FUIA 3IXEA 4GA0A 1MJ0A 1VDYA 3C98A 4CT0A 1E7UA 3ASHA 1KPSB 2KCVA 2P58C 2GW1A 3D9OA 1BI8B 4HS2A 2Y4TA 3RJVA 3UM0A 1L5JA 2DVWA 3QAQA 1NL4A 5H7PA 2X3MA 4FC8A 4GTTA 3HHMA 1HU3A 3MA5A 3R7QA 4B89A 4N5QA 3ZU7B 2EIJE 2JABA 4E85A 3D9IA 1MX2A 1W3BA 2AVPA 4UQYA 3EDTB 3KAEA 4PS8A 5HRYA 1Z6TA 4JA7A 1QNFA 2HR2A 3B7UX 2IOSA 3S7BA 4ANUA 1HG5A 2EINE 2MOWA 2LAHA 3FH7A 4H7XA 5HI7A 4CDRA 3CVXA 3FP3A 5FQ6A 2Y4UA 3FUJA 1N95A 3FU0A 1JCQA 3FEYA 3QB2A 2OEVA 5CBNA 3FUFA 3KS2A 2P2CP 3DRAA 1N4QA 2IQCA 4W9RA 3ULQA 4J8FA 4J8SA 2Y69E 3CHMA 3Q4AB 3PZ4A 4L23A 3AG1E 4WUYA 3HXCA 3QJZA 1MQSA 3MKQB 2IONA 3B7RL 3KEAA 4EBAG 4DX6D 2VQ2A 3B7BA 4LG6A 1UN9A 4J8YA 4IULA 5ENTD 1UN8A 4G2VA 3R7RA 1KT1A 4PS3A 4DK5A 4I2ZA 5BV1A 3TWSA 1PC2A 3UT7A 4XX5A 3SFXA 1AWCB 4H7YA 1HF8A 5CCMA 3TXNA 3VTYA 3FTUA 3Q49B 4EHMA 2ETBA 2XENA 3C5RA 3ZYMA 2HM8A 5KJLA 3U64A 2IEJA 3W9GA 2OEWA 2XPIA 3D3MA 3D9MA 4GYYA 5CEDB 4WNGA 5EIDA 2V4HC 1D8DA 4OVUA 3SGHA 2E0IA 2GRNB 2WQ6A 5AQ7A 5KJNA 3IHVA 4J0UA 4HQDA 4HORA 3ZVVA 1D9SA 3EIQC 3I4RB 1MX4A 2H6GA 2C2LA 2WPVA 3DSUA 4B8CB 2WXPA 2MYOA 3FUKA 2P9IG 3CGHA 4TV3A 4TXRA 3HXEA 1XNFA 3ZFWA 2V5QC 4NIKA 1OWPA 2OOEA 3LEWA 5BNWA 4EZKA 5LCWJ 2XZTG 2AXUA 2PQNA 2P9PG 2H6FA 3MEKA 4APFA 3ZYQA 3SY2A 1OY3D 3AG3E 4GPKA 3ZW3A 1JCRA 5KJKA 2WXNA 4GZ6A 3VLEA 3ESLA 1NI1A 3TWUA 1N9AA 1OCCE 3CSTA 4U0SA 5E76A 4KZ0A 3EHMA 3BG0B 3OXGA 2EQXA 3C3OA 3EJNA 3FTYA 3U66A 2A5UA 1BD8A 1YYHA 3NB2A 4JL0A 4ZFHA 1OUVA 5CMYA 5CCLA 4CEMA 3FTZA 4UQXA 3CVWA 3SFZA 4TUUA 1ELRA 2YHCA 2ZIRA 1WDYA 3SFYA 4U8VD 1K8KG 3FTXA 3R9AB 1QYMA 5B1BE 5KNHD 1ELKA 2VYIA 3OAWA 4AY5A 3JXJA 1HFAA 3LPZA 3ULYA 2XRYA 3DSTA 2J08A 4N3CA 4AV7A 4C0EA 1INZA 3AS5A 5HKPA 2EIKE 4DLOA 2KCLA 3HXBA 5IY5E 1SW6A 4N3AA 3CHRA 4TRQA 3PEUB 4DX5D 1TNZA 5KWDA 4A3VA 3TWTA 3AU5A 2WXQA 4NQ0A 1MX6A 3KSLA 5EILA 3QKYA 3UX4A 4NURA 1E8WA 2ZGGA 4YDEA 3SO8A 4DX2A 2V5FA 5LFAA 2FBNA 1OXJA 5FWQA 3K9IA 5EKQD 3DSXA 4GTMA 3SHFA 4B8AA 4UWGA 3ULEG 4CDNA 1UW4B 3JQ1A 2LXLA 4JHJA 2FF4A 3I5PA 2J49A 3LS8A 5FIOA 4CGVA 2WQHA 3LY7A 4GYWA 4FU3A 4FHKA 2VGYA 3MJWA 3CHPA 2UY1A 4NACA 1UJJA 5BW8C 3CSFA 3CIAA 4RLYA 3ZEFA 5G04C 2LSUA 1E96B 4KBQA 5FT9A 2X6IA 4M3OA 4FADA 4I6JA 2OVBA 2WXOA 5ENQD 3TWXA 4AIFA 2RFAA
chains in the Genus database with same CATH topology
4LRZA 2WXIA 4HXIA 3CK9A 4L7TA 1FVFA 4LERA 4RSYA 1KT0A 1HO8A 2XGMA 4GZDA 4Y6CA 5ARFA 5G55A 1QQEA 4BX9A 3QWWA 1Z3YA 3LXUX 3CVUA 5LOZA 2XPZA 3RO2A 4Y6WA 3GZ1A 3PUKA 4JHRA 4DPRA 3VTXA 4ANVA 2XGSA 3CV0A 2DBAA 4B94A 2MRIA 2WB2A 4MS6A 1PY1A 2XGOA 2DIWA 1XGWA 2NXPA 3NF1A 4N5CA 3I4GA 5KJMA 3JUIA 2GRMA 1HH8A 4HOQA 1H0AA 4ILGA 4XZ4A 3UQ3A 4CGWA 3FY4A 4J8DA 4JHKA 3CK7A 3FUIA 3SD5A 3FTVA 2E2EA 2VSXE 3ENEA 4GA0A 5G2NA 1HE8A 2J07A 3CKBA 1VDYA 3C98A 4U04A 4CT0A 5JHBA 1E7UA 3ASHA 5ARGA 1IQRA 3L08A 3MKRA 3I3NA 5J08A 4FLHA 2KCVA 1E8XA 3UPVA 2P58C 3HYMB 3QWPA 4G26A 3ASGA 5E75A 4ACLA 5A6CA 2GW1A 4E6HA 3D9OA 3IV0A 4HS2A 3SNXA 2Y4TA 3APDA 1YA0A 3RJVA 1L5JA 4I17A 4KMOA 5FZSA 4GB9A 2WXRA 3L54A 3QAQA 2X6FA 4HOTA 1NA0A 3OXLA 2KZTA 2X3MA 4FC8A 4JVSA 4RG9A 3LCAA 3HHMA 1HU3A 3MA5A 5BPPA 3R7QA 4LEUA 4B89A 3MV2B 2X6JA 4GA2A 5FJYA 4OYSA 4IN3B 2PQRA 4WWOA 4FJYA 2WXFA 4UI9J 3AS4A 3NZSA 4E85A 1JUQA 3D9IA 1W3BA 2AVPA 4UQYA 4AOFA 3EDTB 4MKTA 4KVMA 5T4YA 1FVHA 3KAEA 4PS8A 3ASFA 3LVQE 4HOSA 1Z6TA 3BEEA 1NA3A 2IOLA 2M63A 4JA7A 1QNFA 2HR2A 3RRMB 2X38A 3T8MA 1N54A 3BG1B 3FWVA 2VTBA 3EHNA 3B7UX 4UI9C 2KC7A 3NQPA 2IOSA 3FU6A 1P5QA 3S7BA 3U9WA 4ANUA 1HG5A 3T5VA 5FQ8A 1E8YA 2MOWA 2LAHA 3FH7A 4H7XA 4U63A 5A7DB 3NZUA 4MRUA 4WNEA 5HI7A 4C0MA 4CCAA 4CDRA 3SBSA 3CVXA 2AWIA 3FP3A 5FQ6A 2Y4UA 4D10C 3FUJA 2VSYA 3DPDA 3FU0A 3FUEA 4URKA 1X5BA 3FEYA 3PNTB 3RK6A 3QB2A 4GAAA 3FUFA 3KS2A 1IQUA 3MV3B 4G24A 1LF8A 1FCHA 5G05J 4N2QA 2IQCA 4PS7A 4W9RA 4KVOA 2WXGA 4J8FA 5FQ4A 3SZ7A 2LAIA 2XEVA 3ULQA 4Q96A 1JWGA 4J8SA 4P29A 4BX8A 2JLBA 3RIBA 2X6HA 2OV8A 5C2YA 3CHMA 3B7TA 3Q4AB 3UMVA 1TJCA 4L23A 5EX3A 4U0UA 4FHJA 1NZNA 4BY6A 4WUYA 3QJZA 5G05C 1MQSA 4DI3A 3GW4A 4GCNA 4Q69A 3MKQB 1KLXA 2IONA 1UJKA 2UWJG 3B7RL 4GZ5A 4LCTA 3U4TA 3P2BA 4EBAG 4WNDA 4WNFA 4EQFA 2JEKA 4ANXA 2PZIA 2VQ2A 4MLPA 1E7VA 2V0PA 3IKOB 1WM5A 4I1OB 3MX3A 2ONDA 4JEHA 2RD0A 1UN9A 2VSOE 3PE3A 1ELWA 3FU5A 4IULA 1HZ4A 4FULA 4IYPA 3L22A 3QOUA 5JHAA 2CFZA 2YNQA 3CEQA 1UN8A 4G2VA 2XQ0A 3R7RA 1KT1A 4F53A 2VGXA 2PM7A 4PS3A 4GCOA 4DK5A 1ZU2A 4I2ZA 4F3VA 5T8IA 4V3IA 4ATGA 1H2TC 4XI0A 3ZRHA 5EDSA 3ASDA 5BV1A 3FULA 1PC2A 4HOUA 4OVVA 1TJFA 3UT7A 3FTWA 4XX5A 4I1AA 4H7YA 1HF8A 5CCMA 3TXNA 3FTSA 2BF0X 2WXJA 4N39A 3S7FA 1H6KA 3VTYA 5C1DA 3ML9A 3FTUA 3Q49B 3B13A 5FQ7A 1TEZA 3ZYMA 4L2LA 3T5XA 2HM8A 5KJLA 4XE0A 2J4BA 4I6GA 1BPOA 3U64A 1N52A 4G25A 2BUGA 2WQ7A 3LVRE 4EZLA 4GZCA 3QC1A 4NRHB 4KZCA 5BV0A 2XPIA 3HVEA 3D3MA 2XRZA 4EECA 3PE4A 3D9MA 2KCKA 3SF4A 1MHQA 2HYZA 4GYYA 4UWFA 3G2SA 4WNGA 2XCCA 3G2VA 2I6HA 3CK8A 5JJ7A 3P1UA 4OVUA 3SGHA 4B0ZA 3Q5MA 4GU5A 2MHKA 2E0IA 2WQ6A 5AYWD 2WMNA 5KJNA 3QARA 4I9EA 3IHVA 3ZHEB 5M72A 3FEXA 4JC8A 2A4ZA 2J09A 5AJDA 4G1TA 4A1GA 5J90A 4J0UA 5EX0A 2UY1B 4HORA 3ZVVA 4QFVA 3IBEA 4FA6A 1HG2A 1SZ9A 4YNDA 4Q94A 3EIQC 3I4RB 2CHWA 4KXKB 2RG8A 3TG5A 3LY9A 3L13A 3QWVA 4ILHB 3RRNB 2GGFA 2CHZA 3GZSA 2C2LA 2Q7FA 2WPVA 4BWRA 1U3CA 2ZU6B 2NSZA 3CQGB 4B8CB 3KD7A 5DBKA 1E90A 4WWPA 2L6JA 4ILIA 4BT9A 3CHQA 2WXPA 4I9CA 3DBSA 2YQ8A 1OWOA 4I6EA 4AXHA 5DIZA 4ACKA 2PM6A 2IJGX 5CHEE 3FUKA 4UWLA 3URZA 5HQ8A 5KCMA 3CGHA 3CKCA 3LJ3A 3MGBA 4TV3A 3CVLA 3PNLB 2YINA 4J6IA 3JCKC 3PZDA 1JWFA 2KATA 1EYHA 1WY6A 2V8SE 1JPLA 1ZBPA 2VSNA 3D9NA 3VLDA 1HXIA 1XNFA 3GYZA 3ZFWA 3Q15A 4UWKA 3PRZA 3D9JA 4AM9A 2DCPA 3FU3A 2CFUA 2ILRA 2WXLA 2J4DA 4GA1A 4I2WA 1IHGA 5AJLA 4A1SA 2I1KA 1OWPA 4G23A 4YVOA 1NP7A 4BT8A 2YHEA 2OOEA 3LEWA 5BNWA 1EF1C 3L6AA 3OTNA 4XKBA 3TL5A 4EZKA 4DI4A 5LCWJ 2AXUA 3ZPJA 4AVXA 2XHEA 5AIJA 2PQNA 4O6FA 1GW6A 3MEKA 4BSXA 1Y6IA 4RVBA 4EZJA 4DLQA 4APFA 3ZYQA 1E8ZA 5A23A 3CHOA 3FUNA 3PVLA 1EDUA 4GPKA 4GZ3A 3ZW3A 1B89A 5KJKA 2WXNA 3SI5A 4GZ6A 3VLEA 3ESLA 4FLBA 3ZN3A 4AY6A 3L17A 4IRUA 5LCWC 2VJ8A 4JPSA 3CHSA 3CSTA 3PH0C 1Y8MA 5D0QD 4U0SA 4A55A 5E76A 2PL2A 4KZ0A 4EPZA 2BTDA 3ONLA 3EHMA 4DJAA 1HX8A 3BG0B 3TJPA 4J8EA 3OXGA 4K03A 2I1JA 2EQXA 3EJNA 3CVVA 3FTYA 3U66A 1H19A 2A5UA 2WXKA 2KZTB 3UT8A 2XPYA 2C0LA 3ZYLA 3HDXA 4R7LA 4AJWA 2CG3A 4JL0A 1OUVA 2LNIA 5CMYA 3Q47B 3PDNA 4WWNA 4XIFA 4A3TA 5CCLA 2FULA 4CEMA 3HIZA 3FTZA 3S7DA 4UQXA 3TAXA 3CVWA 3SFZA 2NC9A 2I9CA 5D0OD 2L0IA 2C0MA 3TXMA 4TUUA 3TGOA 2AW6A 4XKCA 4G11A 3B7SA 3ZXSA 3GZ2A 4KT6B 1ELRA 3OXFA 2CG2A 2YHCA 3PUJA 2L9BA 5LP0A 4PH4B 3D9LA 3PS6A 4LUNU 4I1MA 4WAFA 4U0ZA 3FUMA 2XCBA 4GMJA 3FTXA 2R5SA 4PDXA 3R9AB 2WVIA 3G2TA 4CDMA 3QK0A 5JJ6A 2VTBB 3VLFA 1OWMA 4XI9A 3L16A 3RKVA 1DVPA 4I43A 3ESKA 4UWHA 5AENA 3FDHA 2KM4A 4U07A 4YVQC 1ELKA 4K0RA 2VYIA 5FZRA 3ML8A 3OAWA 1HS6A 3UT4A 1EPUA 2I2OA 4AY5A 3QDNA 3S2AA 3APFA 1HFAA 3LPZA 3LDZA 4U8HA 2XRYA 2QY7A 3MCXA 2J08A 4JW1A 4N3CA 2L0TB 3MYVA 3AU4A 3UUXA 4AV7A 4APOA 3CVYA 4JEUA 3IEGA 4KYOB 4FP7A 4JXTA 3N71A 1PAQA 4C0EA 5BUZA 3MKQA 1INZA 2CHXA 2WMOA 3AS5A 3S7JA 4CT4A 2WXHA 1DNPA 2AXVA 4DLOA 1SQMA 3TG4A 1A17A 4ANWA 2KCLA 4RG6A 4N3AA 2LO6A 4BTAA 3CHRA 2R59A 3LKUA 2IF4A 3CVPA 3LYAA 4TRQA 3PEUB 5ANLA 4BTBA 3EIJA 3FUDA 5CMWA 3E4BA 1S0PA 4A3VA 3AU5A 2WXQA 2Y3AA 3FUHA 4ME2A 4NQ0A 5LX8A 3PEVB 3KEZA 4AP2A 3QKYA 3ONKA 3CVNA 1Z3XA 3IHYA 1H2VC 3UX4A 3FHEA 4NURA 1E8WA 2WM9A 4JZYA 3RO3A 2AXZA 2V5FA 5LFAA 3O48A 1H2UA 2FBNA 4PUCA 1OWNA 5FTPA 2FI7A 2GRLA 5FWQA 3K9IA 3WXXA 5EKQD 2V4LA 3CR3A 4GYOA 3SHFA 2X6KA 3D9KA 1WAO1 4B8AA 2VGXB 3MZLB 1IYGA 4UWGA 4AEZC 3ZYKA 3QNKA 2WXMA 4CDNA 1UW4B 2HO1A 3JQ1A 1OWLA 5FZQA 3U3WA 3G2WA 5G04J 4JA9A 4JHJA 2FF4A 3LY8A 3I5PA 2IU1A 2J49A 3ZIMA 4HFGA 4C9BB 5BT1A 3LS8A 3FH8A 4CGVA 2WQHA 1SZAA 3FH5A 3JQ0A 4UI9K 2J9QA 3LY7A 5ANRA 1U3DA 4GYWA 5ENNA 3APCA 4FU3A 3RRUA 3SBTB 3ZHEA 4FHKA 4HLEA 2VGYA 3MJWA 3CHPA 2UY1A 4NACA 4CRWA 1UJJA 5BW8C 3AS8A 2R17C 3D9PA 4ABNA 4EBAA 4N2SA 3CSFA 3CIAA 3ZEFA 3HVEB 5G04C 2LSUA 4GMLA 2FEZA 1E96B 2QFCA 4FJZA 4KBQA 5FT9A 3FFLA 4F1SA 3CQCB 3G2UA 2X6IA 4BFRA 3PREA 5JJTA 2OVFA 5T3RA 2IFUA 3JYSA 4N3BA 4M3OA 3RU0A 4UQZA 2LSVA 4FADA 4F7AA 3ZGQA 1UG3A 3CVQA 3O4ZA 2FO7A 2OVBA 4I6JA 4L2YA 4HVBA 2WXOA 4L1BA 4AIFA 3CLJA 1QZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK9 A;  1KT0 A;  2XGM A;  4Y6C A;  5ARF A;  1QQE A;  3QWW A;  3RO2 A;  4Y6W A;  3GZ1 A;  4JHR A;  3VTX A;  2XGS A;  3CV0 A;  2DBA A;  4B94 A;  2XGO A;  4N5C A;  3NF1 A;  5KJM A;  4HOQ A;  1HH8 A;  3UQ3 A;  4CGW A;  4J8D A;  3CK7 A;  2E2E A;  4GA0 A;  3CKB A;  4U04 A;  3ASH A;  5ARG A;  3MKR A;  2KCV A;  3UPV A;  2P58 C;  3HYM B;  3QWP A;  4G26 A;  3ASG A;  5A6C A;  2GW1 A;  2Y4T A;  1YA0 A;  3RJV A;  4I17 A;  5FZS A;  4HOT A;  1NA0 A;  3OXL A;  4RG9 A;  3LCA A;  3MA5 A;  4LEU A;  3MV2 B;  4GA2 A;  5FJY A;  4IN3 B;  2PQR A;  4UI9 J;  3AS4 A;  1W3B A;  2AVP A;  4UQY A;  3EDT B;  3KAE A;  3ASF A;  4HOS A;  3BEE A;  1NA3 A;  4JA7 A;  2HR2 A;  3FWV A;  4UI9 C;  2KC7 A;  3S7B A;  1P5Q A;  4H7X A;  5A7D B;  4WNE A;  5HI7 A;  4CDR A;  3FP3 A;  2Y4U A;  2VSY A;  3KS2 A;  3MV3 B;  4G24 A;  1FCH A;  5G05 J;  4N2Q A;  4W9R A;  3ULQ A;  4J8F A;  3SZ7 A;  2XEV A;  2JLB A;  3RIB A;  3Q4A B;  1TJC A;  5EX3 A;  4U0U A;  1NZN A;  4WUY A;  5G05 C;  3GW4 A;  4GCN A;  1KLX A;  4GZ5 A;  2UWJ G;  3U4T A;  4WND A;  4WNF A;  4EQF A;  2PZI A;  2VQ2 A;  1WM5 A;  2OND A;  3PE3 A;  1ELW A;  1HZ4 A;  3QOU A;  3CEQ A;  4G2V A;  1KT1 A;  2VGX A;  4GCO A;  1ZU2 A;  4I2Z A;  4F3V A;  4XI0 A;  3ASD A;  4HOU A;  1PC2 A;  4I1A A;  4H7Y A;  5CCM A;  4N39 A;  3S7F A;  3VTY A;  5C1D A;  3Q49 B;  5KJL A;  4G25 A;  2BUG A;  4NRH B;  2XPI A;  3PE4 A;  2KCK A;  3SF4 A;  2HYZ A;  4GYY A;  4WNG A;  2XCC A;  2I6H A;  3CK8 A;  5JJ7 A;  3Q5M A;  2MHK A;  5AYW D;  5KJN A;  4I9E A;  5M72 A;  3ZHE B;  4G1T A;  4J0U A;  5EX0 A;  2UY1 B;  4HOR A;  4YND A;  4KXK B;  3TG5 A;  3LY9 A;  3QWV A;  2C2L A;  2Q7F A;  2WPV A;  4BWR A;  3KD7 A;  5DBK A;  2L6J A;  4BT9 A;  4I9C A;  2YQ8 A;  5DIZ A;  5CHE E;  3URZ A;  5HQ8 A;  3CKC A;  3CVL A;  2KAT A;  1ZBP A;  2VSN A;  1HXI A;  1XNF A;  3GYZ A;  3ZFW A;  3Q15 A;  4AM9 A;  4I2W A;  4GA1 A;  1IHG A;  4A1S A;  4G23 A;  4YVO A;  4BT8 A;  2OOE A;  5BNW A;  5LCW J;  3ZPJ A;  2PQN A;  4O6F A;  3MEK A;  4GPK A;  4GZ3 A;  1B89 A;  5KJK A;  4GZ6 A;  3ZN3 A;  4AY6 A;  5LCW C;  5D0Q D;  1Y8M A;  4U0S A;  2PL2 A;  4J8E A;  3OXG A;  2C0L A;  4JL0 A;  1OUV A;  2LNI A;  3Q47 B;  3PDN A;  4XIF A;  5CCL A;  3S7D A;  3TAX A;  4UQX A;  2NC9 A;  5D0O D;  2C0M A;  3TGO A;  3GZ2 A;  1ELR A;  3OXF A;  2YHC A;  4U0Z A;  2XCB A;  2R5S A;  3R9A B;  5JJ6 A;  4XI9 A;  3RKV A;  3ESK A;  4U07 A;  4YVQ C;  2VYI A;  5FZR A;  4AY5 A;  3QDN A;  3LPZ A;  4N3C A;  3UUX A;  4APO A;  3IEG A;  4KYO B;  3N71 A;  3AS5 A;  3S7J A;  3TG4 A;  1A17 A;  2KCL A;  4RG6 A;  4N3A A;  4BTA A;  3LKU A;  2IF4 A;  3CVP A;  3LYA A;  4BTB A;  3E4B A;  4NQ0 A;  4ME2 A;  3QKY A;  3CVN A;  3RO3 A;  2V5F A;  3O48 A;  2FBN A;  5FTP A;  2FI7 A;  3K9I A;  3WXX A;  5EKQ D;  4GYO A;  1WAO 1;  2VGX B;  1IYG A;  2HO1 A;  5FZQ A;  3U3W A;  5G04 J;  4JA9 A;  2FF4 A;  3LY8 A;  5BT1 A;  4CGV A;  2WQH A;  4UI9 K;  2J9Q A;  3LY7 A;  4GYW A;  3ZHE A;  2VGY A;  2UY1 A;  5BW8 C;  3AS8 A;  4N2S A;  4ABN A;  5G04 C;  2LSU A;  2FEZ A;  1E96 B;  2QFC A;  4KBQ A;  5FT9 A;  3FFL A;  5JJT A;  3RU0 A;  2IFU A;  3JYS A;  4N3B A;  4UQZ A;  2LSV A;  3ZGQ A;  3CVQ A;  2FO7 A;  4AIF A;  1QZ2 A; 
#chains in the Genus database with same CATH topology
 1MZC A;  4CYM D;  2DZO A;  4HXI A;  4LER A;  4RSY A;  1KT0 A;  2XGM A;  3CVU A;  1DC2 A;  3PUK A;  3VTX A;  4ANV A;  2XGS A;  2WB2 A;  4N5C A;  2H6H A;  1QBQ A;  5KJM A;  1H0A A;  4ILG A;  3CK7 A;  3SQV A;  2E2E A;  2VSX E;  1X81 A;  2J07 A;  3CKB A;  1N0R A;  5JHB A;  5ARG A;  3DXM G;  1LD7 A;  3L08 A;  3MKR A;  3I3N A;  5J08 A;  3PZ2 A;  3UPV A;  3Q78 A;  3HYM B;  4ACL A;  3NBN B;  3IV0 A;  3SNX A;  4ATZ D;  3APD A;  3L54 A;  2R05 A;  1V54 E;  1Z5S C;  1O1R A;  2X6J A;  4GA2 A;  1IHB A;  4GMR A;  4WWO A;  4UI9 J;  3AS4 A;  3TWW A;  5ENO D;  4MKT A;  1MYO A;  2ZXW E;  3DXK G;  4KVM A;  3LVQ E;  1NA3 A;  2IOL A;  3RRM B;  3PZ1 A;  1SA4 A;  3EHN A;  2KC7 A;  3NQP A;  3T5V A;  2DWZ A;  3X2Q E;  5CEA A;  4MRU A;  1LTX A;  4CCA A;  1Q2Z A;  3UM3 A;  5BXO A;  3FUE A;  4URK A;  1IQU A;  3MV3 B;  4G24 A;  1FCH A;  5G05 J;  2R2L A;  4P29 A;  3RIB A;  5KBA A;  4GPM A;  4U0U A;  3BU8 A;  1ZB1 A;  4BY6 A;  3GW4 A;  4GCN A;  4Q69 A;  3ABL E;  1KLX A;  2XS8 A;  4WNF A;  4ANX A;  2PZI A;  2L6B A;  1WM5 A;  3TWR A;  1OCZ E;  4I1O B;  2VSO E;  3PE3 A;  5AQA A;  3QOU A;  5JHA A;  2YNQ A;  3CEQ A;  4F53 A;  2PM7 A;  4ATG A;  4XI0 A;  3B95 A;  1BU9 A;  3UIN C;  2BF0 X;  4N39 A;  3S7F A;  1RZ4 A;  3B13 A;  4TXQ A;  1TEZ A;  4I6G A;  1BPO A;  2F8X K;  2BUG A;  2WQ7 A;  3J5P A;  4GZC A;  4NRH B;  4KZC A;  3HVE A;  2XRZ A;  3NAW A;  5B1A E;  2I6H A;  3CK8 A;  3P1U A;  5AYW D;  4HNA D;  1YCS B;  5M72 A;  4JC8 A;  2A4Z A;  5J90 A;  4A1G A;  3Q79 A;  2UY1 B;  5D66 A;  4DUI A;  2CHW A;  2BED A;  2RG8 A;  4ILH B;  3QWV A;  1WG0 A;  3KD7 A;  5ITZ F;  1E90 A;  4WWP A;  3CHQ A;  4I9C A;  4G8L A;  5DIZ A;  3V2O A;  2R03 A;  2IJG X;  3TWQ A;  4UWL A;  2P9L G;  3CKC A;  3MGB A;  2YIN A;  4U95 D;  3PZD A;  2H6I A;  1EYH A;  3W9F A;  2P9N G;  4UWK A;  3PRZ A;  1TN8 A;  4AM9 A;  3FU3 A;  2WXL A;  4GA1 A;  4BT8 A;  4YVO A;  1NP7 A;  2YHE A;  4YDY A;  3ZPJ A;  5AIJ A;  4O6F A;  4DLQ A;  1E8Z A;  5A23 A;  3PVL A;  1N4P A;  1EDU A;  3SI5 A;  3ZXP A;  2A5E A;  5BXU A;  5EIB E;  3L17 A;  1FT2 A;  5LCW C;  1TYQ G;  4JPS A;  3CHS A;  3PH0 C;  1Y8M A;  2PL2 A;  1TN6 A;  3ONL A;  3UM2 A;  2I1J A;  1H19 A;  3UT8 A;  1N94 A;  2LNI A;  4A3T A;  3HIZ A;  4GTR A;  2NC9 A;  3GZ2 A;  3OXF A;  2CG2 A;  2L9B A;  5LP0 A;  4PH4 B;  5CRU A;  3PS6 A;  4F1P A;  4WAF A;  4PDX A;  3G2T A;  4CDM A;  3QK0 A;  4XI9 A;  1DVP A;  5JA4 D;  3T9K A;  3FDH A;  2KM4 A;  4U07 A;  4K0R A;  2BKK B;  3ML8 A;  2I2O A;  3S2A A;  1N4R A;  1S63 A;  2DZN A;  3AU4 A;  3CVY A;  4JEU A;  3IEG A;  3N71 A;  1PAQ A;  4ANW A;  3DEO A;  2IF4 A;  3ZNG A;  3FUD A;  5CMW A;  3FUH A;  1SA5 A;  5LX8 A;  1Z3X A;  4JZY A;  3RO3 A;  2AXZ A;  2FI7 A;  2X6K A;  4BET A;  4HI8 A;  5ENR D;  3MZL B;  4AEZ C;  3ZYK A;  3Q7F A;  3QNK A;  2WXM A;  3L82 A;  1OWL A;  3G2W A;  2IU1 A;  4C9B B;  4HFG A;  5BT1 A;  3JQ0 A;  3FH5 A;  3ASO E;  5ANR A;  1U3D A;  3ZHE A;  4HLE A;  5KNG A;  3HVE B;  4GML A;  1TNY A;  3TWV A;  3FFL A;  4F1S A;  5CBO A;  3CQC B;  2OCC E;  3C3Q A;  4BFR A;  5JJT A;  2OVF A;  5T3R A;  2IFU A;  4BER A;  4BES A;  2LXM A;  3CVQ A;  2FO7 A;  4C48 B;  2P9K G;  1QZ2 A;  3HG0 D;  4LRZ A;  1FVF A;  1HO8 A;  4BX9 A;  5G55 A;  3QWW A;  1Z3Y A;  3NOC D;  4GTO A;  5LOZ A;  3T8K A;  3RO2 A;  4Y6W A;  3GZ1 A;  3DSW A;  4DPR A;  5D2M C;  4B94 A;  1PY1 A;  2NXP A;  2QYJ A;  3I4G A;  3JUI A;  4HOQ A;  1HH8 A;  3UQ3 A;  4CGW A;  4JHK A;  4B93 B;  3FTV A;  2Y1L E;  3ISM C;  4L9P A;  5AQ9 A;  4U04 A;  4A63 B;  4U96 D;  3ASG A;  5A6C A;  3C3R A;  1YA0 A;  4I17 A;  2WXR A;  2X6F A;  3EHR A;  4HOT A;  2KZT A;  4JVS A;  4RG9 A;  3LCA A;  4K5A B;  4LEU A;  5FJY A;  4OYS A;  2WXF A;  3NZS A;  4O1P A;  4AOF A;  5T4Y A;  3EUV A;  1FVH A;  2KBX A;  2IY0 C;  3BEE A;  2F8Y A;  3T8M A;  1N54 A;  3ABK E;  4UI9 C;  3FU6 A;  1P5Q A;  5AN8 A;  5A7D B;  2VSY A;  1X5B A;  3PNT B;  1FT1 A;  3E34 A;  1LF8 A;  4N2Q A;  3EU5 A;  4GTS A;  5FQ4 A;  2XEV A;  1JWG A;  2JLB A;  2X6H A;  2OV8 A;  2GRR B;  3UMV A;  1O5M A;  1TJC A;  1NZN A;  5G05 C;  4DI3 A;  4LCT A;  1UJK A;  2UWJ G;  4GZ5 A;  4O60 A;  3U4T A;  4WND A;  2JEK A;  4MLP A;  1E7V A;  2V0P A;  4DX7 D;  3MX3 A;  2OND A;  1HZ4 A;  4FUL A;  1TNB A;  3L22 A;  2CFZ A;  4GCO A;  1ZU2 A;  4F3V A;  4V3I A;  4MBG A;  3ZRH A;  5EDS A;  1TJF A;  1SVX A;  3E37 A;  3FTW A;  4HRN A;  3FTS A;  2WXJ A;  5C1D A;  3ML9 A;  3NOG D;  1OT8 A;  4HLL A;  4L2L A;  3V2X A;  4XE0 A;  1N52 A;  3LVR E;  4EZL A;  4EEC A;  3PE4 A;  2KCK A;  3SF4 A;  2B6C A;  4UWF A;  3G2S A;  1S70 B;  3G2V A;  4HB5 A;  5JJ7 A;  3Q5M A;  2MHK A;  3EHQ A;  2WMN A;  3QAR A;  4I9E A;  3ZHE B;  2J09 A;  5AJD A;  4G1T A;  2QZA A;  4FA6 A;  4YND A;  4Q94 A;  4KXK B;  3LY9 A;  3L13 A;  3RRN B;  2CHZ A;  2GGF A;  3GZS A;  5AQB A;  1U3C A;  3CQG B;  5DBK A;  2L6J A;  1K1A A;  4BT9 A;  1DCE A;  4AXH A;  3DBS A;  2YQ8 A;  1OWO A;  4I6E A;  4ACK A;  2PM6 A;  4JB8 P;  3URZ A;  5KCM A;  3LJ3 A;  4J6I A;  3JCK C;  1KZO A;  2GRQ B;  1WY6 A;  3GYZ A;  3Q15 A;  4LNU D;  3D9J A;  2DCP A;  4HBD A;  2CFU A;  2J4D A;  4I2W A;  5AJL A;  2I1K A;  4G23 A;  1EF1 C;  3L6A A;  3OTN A;  3TL5 A;  4DI4 A;  1GW6 A;  1Y6I A;  4EZJ A;  1TN7 A;  1TNU A;  3F6Q A;  4AY6 A;  4IRU A;  3ABM E;  2VJ8 A;  5D0Q D;  1AP7 A;  4A55 A;  4EPZ A;  2BKG A;  3LJN A;  1HX8 A;  4J8E A;  3CVV A;  2KZT B;  2XPY A;  2C0L A;  1DCQ A;  3HDX A;  3Q47 B;  3PDN A;  3S7D A;  3TAX A;  1TR4 A;  5D0O D;  2C0M A;  2AW6 A;  3B7S A;  3ZXS A;  3AAA C;  3ZUV B;  3PUJ A;  2DYS E;  3D9L A;  3D9H A;  4LUN U;  4I1M A;  2XCB A;  4YDW A;  2R5S A;  1A5E A;  1O1S A;  5JJ6 A;  1OWM A;  3L16 A;  3RKV A;  4X8Q A;  5AEN A;  3UM1 A;  1RW2 A;  5ENP D;  4OAU C;  1U2V G;  2KXP C;  2L0T B;  3MYV A;  3UUX A;  4APO A;  1UOH A;  2CHX A;  2WMO A;  3UI2 A;  3S7J A;  4CT4 A;  1DNP A;  2AXV A;  1N4S A;  1SQM A;  1A17 A;  2LO6 A;  3LKU A;  3CVP A;  4U7E B;  5ANL A;  4K5B A;  3E4B A;  1S0P A;  2Y3A A;  4ME2 A;  3PEV B;  4AP2 A;  3ONK A;  2FO1 E;  3CVN A;  1H2V C;  2WM9 A;  5AAR A;  3O48 A;  5FTP A;  2P9S G;  2V4L A;  4GYO A;  3D9K A;  1WAO 1;  1IYG A;  3RAU A;  1H6P A;  2HO1 A;  3U3W A;  3LY8 A;  3ZIM A;  2RKK A;  4UI9 K;  2J9Q A;  3RRU A;  3WG7 E;  3AS8 A;  3D9P A;  4ABN A;  4EBA A;  2FEZ A;  2QFC A;  4UUC A;  2XZD G;  3G2U A;  4JD2 G;  4GTV A;  3JYS A;  4N3B A;  3JUE A;  5EYP F;  4UQZ A;  3UKR G;  1UG3 A;  3O4Z A;  1OCR E;  3CLJ A;  2WXI A;  1YMP A;  3CK9 A;  4HRM B;  2VGE A;  4GZD A;  4Y6C A;  2XPZ A;  1FPP A;  3CV0 A;  2Y0B G;  2MRI A;  5B3S E;  2DIW A;  1XGW A;  3NF1 A;  1S64 A;  2NYJ A;  2GRM A;  3FY4 A;  3SD5 A;  3ENE A;  3E33 A;  5G2N A;  1HE8 A;  2P9U G;  1IQR A;  4FLH A;  1E8X A;  3QWP A;  4G26 A;  3DSV A;  4TXP A;  5E75 A;  2QC9 A;  1G3N B;  4E6H A;  2GRO B;  4KMO A;  5FZS A;  4GB9 A;  1NA0 A;  3OXL A;  4ZHB A;  1O1T A;  5BPP A;  3MV2 B;  4IN3 B;  3UXG A;  1K3Z D;  2PQR A;  4FJY A;  2HE0 A;  1JUQ A;  4O1O A;  3C72 A;  4RQI A;  3ASF A;  4HOS A;  2ETC A;  2GRP B;  2M63 A;  2X38 A;  3BG1 B;  3FWV A;  2PNN A;  2VTB A;  1BLX B;  3U9W A;  4YDO A;  3Q73 A;  5FQ8 A;  1E8Y A;  4U63 A;  1JCS A;  3NZU A;  4WNE A;  4C0M A;  3HRA A;  3SBS A;  2AWI A;  4K5C A;  4D10 C;  4DX1 A;  3DPD A;  3Q9N C;  3RK6 A;  4GAA A;  3UTM A;  4QQI A;  4BSZ B;  4PS7 A;  4KVO A;  2WXG A;  3SZ7 A;  2LAI A;  5CEC B;  3KSQ A;  4Q96 A;  4BX8 A;  4XEI G;  1D8E A;  2DYR E;  5C2Y A;  3B7T A;  5EX3 A;  4FHJ A;  3DSS A;  4LSZ E;  3P2B A;  4EQF A;  3IKO B;  4JEH A;  2RD0 A;  1ELW A;  3FU5 A;  3J5Q B;  4IYP A;  2XQ0 A;  2VGX A;  5T8I A;  2J8S D;  1H2T C;  3ASD A;  3HXF A;  3FUL A;  4HOU A;  4OVV A;  3UIO C;  4I1A A;  4LNB A;  1H6K A;  5FQ7 A;  3T5X A;  2J4B A;  2ZIS A;  5FIN A;  4G25 A;  3QC1 A;  5BV0 A;  1MHQ A;  2HYZ A;  2XCC A;  4B0Z A;  4GU5 A;  1N0Q A;  5ENS D;  3FEX A;  5EX0 A;  3DEP A;  4QFV A;  3IBE A;  2IO2 C;  1HG2 A;  1SZ9 A;  3TG5 A;  2B0O E;  2Q7F A;  4BWR A;  2ZU6 B;  2NSZ A;  3RSE G;  3R9M A;  4ILI A;  5CHE E;  5HQ8 A;  3CVL A;  1V55 E;  3PNL B;  1JWF A;  2KAT A;  2V8S E;  1JPL A;  1ZBP A;  2VSN A;  3D9N A;  3VLD A;  1HXI A;  2ILR A;  1IHG A;  4LNG A;  4Z68 A;  4A1S A;  3E32 A;  4XKB A;  3BUA A;  3V31 A;  4AVX A;  2XHE A;  4BSX A;  4RVB A;  3CHO A;  3UKU G;  3FUN A;  4GZ3 A;  3AG4 E;  4TUM A;  1B89 A;  4FLB A;  3ZN3 A;  2ZGD A;  2BTD A;  4DJA A;  3TJP A;  4K03 A;  2WXK A;  2XEH A;  1N11 A;  5EYL A;  3ZYL A;  4R7L A;  4AJW A;  2CG3 A;  1IKN D;  4J7W A;  4WWN A;  5JMN D;  4XIF A;  2FUL A;  3JXI A;  2I9C A;  2L0I A;  3TXM A;  3TGO A;  4XKC A;  1KZP A;  4G11 A;  4KT6 B;  2EIL E;  2RFM A;  4GTP A;  4OAV B;  2R02 A;  2XEE A;  4U0Z A;  4G8K A;  2LUH A;  3FUM A;  4GMJ A;  4BEP A;  2WVI A;  3L9T A;  2VTB B;  3VLF A;  3HXD A;  1IXV A;  2AJA A;  4I43 A;  3ESK A;  4UWH A;  3UIP C;  2QYU A;  3PZ3 A;  4YVQ C;  3BQO A;  5FZR A;  1HS6 A;  3UT4 A;  1EPU A;  3QDN A;  3APF A;  3LDZ A;  4U8H A;  2QY7 A;  2XS1 A;  3MCX A;  4JW1 A;  4M7C A;  3Q9U C;  4KYO B;  4FP7 A;  4JXT A;  5BUZ A;  3MKQ A;  1OCO E;  1H6O A;  2WXH A;  3TG4 A;  4RG6 A;  5CRV A;  4BTA A;  2R59 A;  3LYA A;  2EIM E;  4BTB A;  3EIJ A;  3DPY A;  1TNO A;  3KEZ A;  1K1B A;  3IHY A;  3FHE A;  5HS0 A;  3EU9 A;  3E30 A;  1H2U A;  4PUC A;  1OWN A;  2GRL A;  3WXX A;  2F0Y A;  3ZKJ A;  3CR3 A;  2VGX B;  5FZQ A;  4HRL A;  5G04 J;  4JA9 A;  3AJI A;  3FH8 A;  2ETA A;  3V79 K;  1SZA A;  5ENN A;  3APC A;  3SBT B;  4F6R D;  3DWL G;  4CRW A;  2R17 C;  4N2S A;  5EN5 D;  3V30 A;  4FJZ A;  3Q75 A;  3PRE A;  3RU0 A;  5AAO A;  2LSV A;  4F7A A;  3ZGQ A;  3ASN E;  3Q7A A;  4L2Y A;  4HVB A;  2IO3 C;  4L1B A;  2F37 A;  4L7T A;  5ARF A;  1BI7 B;  1QQE A;  4CZ2 D;  3LXU X;  4DRX E;  5CER B;  4JHR A;  4U8Y D;  2DBA A;  4GTQ A;  4MS6 A;  2XGO A;  1LD8 A;  1NFI E;  4HI9 A;  4XZ4 A;  4J8D A;  3AG2 E;  3FUI A;  3IXE A;  4GA0 A;  1MJ0 A;  1VDY A;  3C98 A;  4CT0 A;  1E7U A;  3ASH A;  1KPS B;  2KCV A;  2P58 C;  2GW1 A;  3D9O A;  1BI8 B;  4HS2 A;  2Y4T A;  3RJV A;  3UM0 A;  1L5J A;  2DVW A;  3QAQ A;  1NL4 A;  5H7P A;  2X3M A;  4FC8 A;  4GTT A;  3HHM A;  1HU3 A;  3MA5 A;  3R7Q A;  4B89 A;  4N5Q A;  3ZU7 B;  2EIJ E;  2JAB A;  4E85 A;  3D9I A;  1MX2 A;  1W3B A;  2AVP A;  4UQY A;  3EDT B;  3KAE A;  4PS8 A;  5HRY A;  1Z6T A;  4JA7 A;  1QNF A;  2HR2 A;  3B7U X;  2IOS A;  3S7B A;  4ANU A;  1HG5 A;  2EIN E;  2MOW A;  2LAH A;  3FH7 A;  4H7X A;  5HI7 A;  4CDR A;  3CVX A;  3FP3 A;  5FQ6 A;  2Y4U A;  3FUJ A;  1N95 A;  3FU0 A;  1JCQ A;  3FEY A;  3QB2 A;  2OEV A;  5CBN A;  3FUF A;  3KS2 A;  2P2C P;  3DRA A;  1N4Q A;  2IQC A;  4W9R A;  3ULQ A;  4J8F A;  4J8S A;  2Y69 E;  3CHM A;  3Q4A B;  3PZ4 A;  4L23 A;  3AG1 E;  4WUY A;  3HXC A;  3QJZ A;  1MQS A;  3MKQ B;  2ION A;  3B7R L;  3KEA A;  4EBA G;  4DX6 D;  2VQ2 A;  3B7B A;  4LG6 A;  1UN9 A;  4J8Y A;  4IUL A;  5ENT D;  1UN8 A;  4G2V A;  3R7R A;  1KT1 A;  4PS3 A;  4DK5 A;  4I2Z A;  5BV1 A;  3TWS A;  1PC2 A;  3UT7 A;  4XX5 A;  3SFX A;  1AWC B;  4H7Y A;  1HF8 A;  5CCM A;  3TXN A;  3VTY A;  3FTU A;  3Q49 B;  4EHM A;  2ETB A;  2XEN A;  3C5R A;  3ZYM A;  2HM8 A;  5KJL A;  3U64 A;  2IEJ A;  3W9G A;  2OEW A;  2XPI A;  3D3M A;  3D9M A;  4GYY A;  5CED B;  4WNG A;  5EID A;  2V4H C;  1D8D A;  4OVU A;  3SGH A;  2E0I A;  2GRN B;  2WQ6 A;  5AQ7 A;  5KJN A;  3IHV A;  4J0U A;  4HQD A;  4HOR A;  3ZVV A;  1D9S A;  3EIQ C;  3I4R B;  1MX4 A;  2H6G A;  2C2L A;  2WPV A;  3DSU A;  4B8C B;  2WXP A;  2MYO A;  3FUK A;  2P9I G;  3CGH A;  4TV3 A;  4TXR A;  3HXE A;  1XNF A;  3ZFW A;  2V5Q C;  4NIK A;  1OWP A;  2OOE A;  3LEW A;  5BNW A;  4EZK A;  5LCW J;  2XZT G;  2AXU A;  2PQN A;  2P9P G;  2H6F A;  3MEK A;  4APF A;  3ZYQ A;  3SY2 A;  1OY3 D;  3AG3 E;  4GPK A;  3ZW3 A;  1JCR A;  5KJK A;  2WXN A;  4GZ6 A;  3VLE A;  3ESL A;  1NI1 A;  3TWU A;  1N9A A;  1OCC E;  3CST A;  4U0S A;  5E76 A;  4KZ0 A;  3EHM A;  3BG0 B;  3OXG A;  2EQX A;  3C3O A;  3EJN A;  3FTY A;  3U66 A;  2A5U A;  1BD8 A;  1YYH A;  3NB2 A;  4JL0 A;  4ZFH A;  1OUV A;  5CMY A;  5CCL A;  4CEM A;  3FTZ A;  4UQX A;  3CVW A;  3SFZ A;  4TUU A;  1ELR A;  2YHC A;  2ZIR A;  1WDY A;  3SFY A;  4U8V D;  1K8K G;  3FTX A;  3R9A B;  1QYM A;  5B1B E;  5KNH D;  1ELK A;  2VYI A;  3OAW A;  4AY5 A;  3JXJ A;  1HFA A;  3LPZ A;  3ULY A;  2XRY A;  3DST A;  2J08 A;  4N3C A;  4AV7 A;  4C0E A;  1INZ A;  3AS5 A;  5HKP A;  2EIK E;  4DLO A;  2KCL A;  3HXB A;  5IY5 E;  1SW6 A;  4N3A A;  3CHR A;  4TRQ A;  3PEU B;  4DX5 D;  1TNZ A;  5KWD A;  4A3V A;  3TWT A;  3AU5 A;  2WXQ A;  4NQ0 A;  1MX6 A;  3KSL A;  5EIL A;  3QKY A;  3UX4 A;  4NUR A;  1E8W A;  2ZGG A;  4YDE A;  3SO8 A;  4DX2 A;  2V5F A;  5LFA A;  2FBN A;  1OXJ A;  5FWQ A;  3K9I A;  5EKQ D;  3DSX A;  4GTM A;  3SHF A;  4B8A A;  4UWG A;  3ULE G;  4CDN A;  1UW4 B;  3JQ1 A;  2LXL A;  4JHJ A;  2FF4 A;  3I5P A;  2J49 A;  3LS8 A;  5FIO A;  4CGV A;  2WQH A;  3LY7 A;  4GYW A;  4FU3 A;  4FHK A;  2VGY A;  3MJW A;  3CHP A;  2UY1 A;  4NAC A;  1UJJ A;  5BW8 C;  3CSF A;  3CIA A;  4RLY A;  3ZEF A;  5G04 C;  2LSU A;  1E96 B;  4KBQ A;  5FT9 A;  2X6I A;  4M3O A;  4FAD A;  4I6J A;  2OVB A;  2WXO A;  5ENQ D;  3TWX A;  4AIF A;  2RFA A; 
#chains in the Genus database with same CATH homology
 4LRZ A;  2WXI A;  4HXI A;  3CK9 A;  4L7T A;  1FVF A;  4LER A;  4RSY A;  1KT0 A;  1HO8 A;  2XGM A;  4GZD A;  4Y6C A;  5ARF A;  5G55 A;  1QQE A;  4BX9 A;  3QWW A;  1Z3Y A;  3LXU X;  3CVU A;  5LOZ A;  2XPZ A;  3RO2 A;  4Y6W A;  3GZ1 A;  3PUK A;  4JHR A;  4DPR A;  3VTX A;  4ANV A;  2XGS A;  3CV0 A;  2DBA A;  4B94 A;  2MRI A;  2WB2 A;  4MS6 A;  1PY1 A;  2XGO A;  2DIW A;  1XGW A;  2NXP A;  3NF1 A;  4N5C A;  3I4G A;  5KJM A;  3JUI A;  2GRM A;  1HH8 A;  4HOQ A;  1H0A A;  4ILG A;  4XZ4 A;  3UQ3 A;  4CGW A;  3FY4 A;  4J8D A;  4JHK A;  3CK7 A;  3FUI A;  3SD5 A;  3FTV A;  2E2E A;  2VSX E;  3ENE A;  4GA0 A;  5G2N A;  1HE8 A;  2J07 A;  3CKB A;  1VDY A;  3C98 A;  4U04 A;  4CT0 A;  5JHB A;  1E7U A;  3ASH A;  5ARG A;  1IQR A;  3L08 A;  3MKR A;  3I3N A;  5J08 A;  4FLH A;  2KCV A;  1E8X A;  3UPV A;  2P58 C;  3HYM B;  3QWP A;  4G26 A;  3ASG A;  5E75 A;  4ACL A;  5A6C A;  2GW1 A;  4E6H A;  3D9O A;  3IV0 A;  4HS2 A;  3SNX A;  2Y4T A;  3APD A;  1YA0 A;  3RJV A;  1L5J A;  4I17 A;  4KMO A;  5FZS A;  4GB9 A;  2WXR A;  3L54 A;  3QAQ A;  2X6F A;  4HOT A;  1NA0 A;  3OXL A;  2KZT A;  2X3M A;  4FC8 A;  4JVS A;  4RG9 A;  3LCA A;  3HHM A;  1HU3 A;  3MA5 A;  5BPP A;  3R7Q A;  4LEU A;  4B89 A;  3MV2 B;  2X6J A;  4GA2 A;  5FJY A;  4OYS A;  4IN3 B;  2PQR A;  4WWO A;  4FJY A;  2WXF A;  4UI9 J;  3AS4 A;  3NZS A;  4E85 A;  1JUQ A;  3D9I A;  1W3B A;  2AVP A;  4UQY A;  4AOF A;  3EDT B;  4MKT A;  4KVM A;  5T4Y A;  1FVH A;  3KAE A;  4PS8 A;  3ASF A;  3LVQ E;  4HOS A;  1Z6T A;  3BEE A;  1NA3 A;  2IOL A;  2M63 A;  4JA7 A;  1QNF A;  2HR2 A;  3RRM B;  2X38 A;  3T8M A;  1N54 A;  3BG1 B;  3FWV A;  2VTB A;  3EHN A;  3B7U X;  4UI9 C;  2KC7 A;  3NQP A;  2IOS A;  3FU6 A;  1P5Q A;  3S7B A;  3U9W A;  4ANU A;  1HG5 A;  3T5V A;  5FQ8 A;  1E8Y A;  2MOW A;  2LAH A;  3FH7 A;  4H7X A;  4U63 A;  5A7D B;  3NZU A;  4MRU A;  4WNE A;  5HI7 A;  4C0M A;  4CCA A;  4CDR A;  3SBS A;  3CVX A;  2AWI A;  3FP3 A;  5FQ6 A;  2Y4U A;  4D10 C;  3FUJ A;  2VSY A;  3DPD A;  3FU0 A;  3FUE A;  4URK A;  1X5B A;  3FEY A;  3PNT B;  3RK6 A;  3QB2 A;  4GAA A;  3FUF A;  3KS2 A;  1IQU A;  3MV3 B;  4G24 A;  1LF8 A;  1FCH A;  5G05 J;  4N2Q A;  2IQC A;  4PS7 A;  4W9R A;  4KVO A;  2WXG A;  4J8F A;  5FQ4 A;  3SZ7 A;  2LAI A;  2XEV A;  3ULQ A;  4Q96 A;  1JWG A;  4J8S A;  4P29 A;  4BX8 A;  2JLB A;  3RIB A;  2X6H A;  2OV8 A;  5C2Y A;  3CHM A;  3B7T A;  3Q4A B;  3UMV A;  1TJC A;  4L23 A;  5EX3 A;  4U0U A;  4FHJ A;  1NZN A;  4BY6 A;  4WUY A;  3QJZ A;  5G05 C;  1MQS A;  4DI3 A;  3GW4 A;  4GCN A;  4Q69 A;  3MKQ B;  1KLX A;  2ION A;  1UJK A;  2UWJ G;  3B7R L;  4GZ5 A;  4LCT A;  3U4T A;  3P2B A;  4EBA G;  4WND A;  4WNF A;  4EQF A;  2JEK A;  4ANX A;  2PZI A;  2VQ2 A;  4MLP A;  1E7V A;  2V0P A;  3IKO B;  1WM5 A;  4I1O B;  3MX3 A;  2OND A;  4JEH A;  2RD0 A;  1UN9 A;  2VSO E;  3PE3 A;  1ELW A;  3FU5 A;  4IUL A;  1HZ4 A;  4FUL A;  4IYP A;  3L22 A;  3QOU A;  5JHA A;  2CFZ A;  2YNQ A;  3CEQ A;  1UN8 A;  4G2V A;  2XQ0 A;  3R7R A;  1KT1 A;  4F53 A;  2VGX A;  2PM7 A;  4PS3 A;  4GCO A;  4DK5 A;  1ZU2 A;  4I2Z A;  4F3V A;  5T8I A;  4V3I A;  4ATG A;  1H2T C;  4XI0 A;  3ZRH A;  5EDS A;  3ASD A;  5BV1 A;  3FUL A;  1PC2 A;  4HOU A;  4OVV A;  1TJF A;  3UT7 A;  3FTW A;  4XX5 A;  4I1A A;  4H7Y A;  1HF8 A;  5CCM A;  3TXN A;  3FTS A;  2BF0 X;  2WXJ A;  4N39 A;  3S7F A;  1H6K A;  3VTY A;  5C1D A;  3ML9 A;  3FTU A;  3Q49 B;  3B13 A;  5FQ7 A;  1TEZ A;  3ZYM A;  4L2L A;  3T5X A;  2HM8 A;  5KJL A;  4XE0 A;  2J4B A;  4I6G A;  1BPO A;  3U64 A;  1N52 A;  4G25 A;  2BUG A;  2WQ7 A;  3LVR E;  4EZL A;  4GZC A;  3QC1 A;  4NRH B;  4KZC A;  5BV0 A;  2XPI A;  3HVE A;  3D3M A;  2XRZ A;  4EEC A;  3PE4 A;  3D9M A;  2KCK A;  3SF4 A;  1MHQ A;  2HYZ A;  4GYY A;  4UWF A;  3G2S A;  4WNG A;  2XCC A;  3G2V A;  2I6H A;  3CK8 A;  5JJ7 A;  3P1U A;  4OVU A;  3SGH A;  4B0Z A;  3Q5M A;  4GU5 A;  2MHK A;  2E0I A;  2WQ6 A;  5AYW D;  2WMN A;  5KJN A;  3QAR A;  4I9E A;  3IHV A;  3ZHE B;  5M72 A;  3FEX A;  4JC8 A;  2A4Z A;  2J09 A;  5AJD A;  4G1T A;  4A1G A;  5J90 A;  4J0U A;  5EX0 A;  2UY1 B;  4HOR A;  3ZVV A;  4QFV A;  3IBE A;  4FA6 A;  1HG2 A;  1SZ9 A;  4YND A;  4Q94 A;  3EIQ C;  3I4R B;  2CHW A;  4KXK B;  2RG8 A;  3TG5 A;  3LY9 A;  3L13 A;  3QWV A;  4ILH B;  3RRN B;  2GGF A;  2CHZ A;  3GZS A;  2C2L A;  2Q7F A;  2WPV A;  4BWR A;  1U3C A;  2ZU6 B;  2NSZ A;  3CQG B;  4B8C B;  3KD7 A;  5DBK A;  1E90 A;  4WWP A;  2L6J A;  4ILI A;  4BT9 A;  3CHQ A;  2WXP A;  4I9C A;  3DBS A;  2YQ8 A;  1OWO A;  4I6E A;  4AXH A;  5DIZ A;  4ACK A;  2PM6 A;  2IJG X;  5CHE E;  3FUK A;  4UWL A;  3URZ A;  5HQ8 A;  5KCM A;  3CGH A;  3CKC A;  3LJ3 A;  3MGB A;  4TV3 A;  3CVL A;  3PNL B;  2YIN A;  4J6I A;  3JCK C;  3PZD A;  1JWF A;  2KAT A;  1EYH A;  1WY6 A;  2V8S E;  1JPL A;  1ZBP A;  2VSN A;  3D9N A;  3VLD A;  1HXI A;  1XNF A;  3GYZ A;  3ZFW A;  3Q15 A;  4UWK A;  3PRZ A;  3D9J A;  4AM9 A;  2DCP A;  3FU3 A;  2CFU A;  2ILR A;  2WXL A;  2J4D A;  4GA1 A;  4I2W A;  1IHG A;  5AJL A;  4A1S A;  2I1K A;  1OWP A;  4G23 A;  4YVO A;  1NP7 A;  4BT8 A;  2YHE A;  2OOE A;  3LEW A;  5BNW A;  1EF1 C;  3L6A A;  3OTN A;  4XKB A;  3TL5 A;  4EZK A;  4DI4 A;  5LCW J;  2AXU A;  3ZPJ A;  4AVX A;  2XHE A;  5AIJ A;  2PQN A;  4O6F A;  1GW6 A;  3MEK A;  4BSX A;  1Y6I A;  4RVB A;  4EZJ A;  4DLQ A;  4APF A;  3ZYQ A;  1E8Z A;  5A23 A;  3CHO A;  3FUN A;  3PVL A;  1EDU A;  4GPK A;  4GZ3 A;  3ZW3 A;  1B89 A;  5KJK A;  2WXN A;  3SI5 A;  4GZ6 A;  3VLE A;  3ESL A;  4FLB A;  3ZN3 A;  4AY6 A;  3L17 A;  4IRU A;  5LCW C;  2VJ8 A;  4JPS A;  3CHS A;  3CST A;  3PH0 C;  1Y8M A;  5D0Q D;  4U0S A;  4A55 A;  5E76 A;  2PL2 A;  4KZ0 A;  4EPZ A;  2BTD A;  3ONL A;  3EHM A;  4DJA A;  1HX8 A;  3BG0 B;  3TJP A;  4J8E A;  3OXG A;  4K03 A;  2I1J A;  2EQX A;  3EJN A;  3CVV A;  3FTY A;  3U66 A;  1H19 A;  2A5U A;  2WXK A;  2KZT B;  3UT8 A;  2XPY A;  2C0L A;  3ZYL A;  3HDX A;  4R7L A;  4AJW A;  2CG3 A;  4JL0 A;  1OUV A;  2LNI A;  5CMY A;  3Q47 B;  3PDN A;  4WWN A;  4XIF A;  4A3T A;  5CCL A;  2FUL A;  4CEM A;  3HIZ A;  3FTZ A;  3S7D A;  4UQX A;  3TAX A;  3CVW A;  3SFZ A;  2NC9 A;  2I9C A;  5D0O D;  2L0I A;  2C0M A;  3TXM A;  4TUU A;  3TGO A;  2AW6 A;  4XKC A;  4G11 A;  3B7S A;  3ZXS A;  3GZ2 A;  4KT6 B;  1ELR A;  3OXF A;  2CG2 A;  2YHC A;  3PUJ A;  2L9B A;  5LP0 A;  4PH4 B;  3D9L A;  3PS6 A;  4LUN U;  4I1M A;  4WAF A;  4U0Z A;  3FUM A;  2XCB A;  4GMJ A;  3FTX A;  2R5S A;  4PDX A;  3R9A B;  2WVI A;  3G2T A;  4CDM A;  3QK0 A;  5JJ6 A;  2VTB B;  3VLF A;  1OWM A;  4XI9 A;  3L16 A;  3RKV A;  1DVP A;  4I43 A;  3ESK A;  4UWH A;  5AEN A;  3FDH A;  2KM4 A;  4U07 A;  4YVQ C;  1ELK A;  4K0R A;  2VYI A;  5FZR A;  3ML8 A;  3OAW A;  1HS6 A;  3UT4 A;  1EPU A;  2I2O A;  4AY5 A;  3QDN A;  3S2A A;  3APF A;  1HFA A;  3LPZ A;  3LDZ A;  4U8H A;  2XRY A;  2QY7 A;  3MCX A;  2J08 A;  4JW1 A;  4N3C A;  2L0T B;  3MYV A;  3AU4 A;  3UUX A;  4AV7 A;  4APO A;  3CVY A;  4JEU A;  3IEG A;  4KYO B;  4FP7 A;  4JXT A;  3N71 A;  1PAQ A;  4C0E A;  5BUZ A;  3MKQ A;  1INZ A;  2CHX A;  2WMO A;  3AS5 A;  3S7J A;  4CT4 A;  2WXH A;  1DNP A;  2AXV A;  4DLO A;  1SQM A;  3TG4 A;  1A17 A;  4ANW A;  2KCL A;  4RG6 A;  4N3A A;  2LO6 A;  4BTA A;  3CHR A;  2R59 A;  3LKU A;  2IF4 A;  3CVP A;  3LYA A;  4TRQ A;  3PEU B;  5ANL A;  4BTB A;  3EIJ A;  3FUD A;  5CMW A;  3E4B A;  1S0P A;  4A3V A;  3AU5 A;  2WXQ A;  2Y3A A;  3FUH A;  4ME2 A;  4NQ0 A;  5LX8 A;  3PEV B;  3KEZ A;  4AP2 A;  3QKY A;  3ONK A;  3CVN A;  1Z3X A;  3IHY A;  1H2V C;  3UX4 A;  3FHE A;  4NUR A;  1E8W A;  2WM9 A;  4JZY A;  3RO3 A;  2AXZ A;  2V5F A;  5LFA A;  3O48 A;  1H2U A;  2FBN A;  4PUC A;  1OWN A;  5FTP A;  2FI7 A;  2GRL A;  5FWQ A;  3K9I A;  3WXX A;  5EKQ D;  2V4L A;  3CR3 A;  4GYO A;  3SHF A;  2X6K A;  3D9K A;  1WAO 1;  4B8A A;  2VGX B;  3MZL B;  1IYG A;  4UWG A;  4AEZ C;  3ZYK A;  3QNK A;  2WXM A;  4CDN A;  1UW4 B;  2HO1 A;  3JQ1 A;  1OWL A;  5FZQ A;  3U3W A;  3G2W A;  5G04 J;  4JA9 A;  4JHJ A;  2FF4 A;  3LY8 A;  3I5P A;  2IU1 A;  2J49 A;  3ZIM A;  4HFG A;  4C9B B;  5BT1 A;  3LS8 A;  3FH8 A;  4CGV A;  2WQH A;  1SZA A;  3FH5 A;  3JQ0 A;  4UI9 K;  2J9Q A;  3LY7 A;  5ANR A;  1U3D A;  4GYW A;  5ENN A;  3APC A;  4FU3 A;  3RRU A;  3SBT B;  3ZHE A;  4FHK A;  4HLE A;  2VGY A;  3MJW A;  3CHP A;  2UY1 A;  4NAC A;  4CRW A;  1UJJ A;  5BW8 C;  3AS8 A;  2R17 C;  3D9P A;  4ABN A;  4EBA A;  4N2S A;  3CSF A;  3CIA A;  3ZEF A;  3HVE B;  5G04 C;  2LSU A;  4GML A;  2FEZ A;  1E96 B;  2QFC A;  4FJZ A;  4KBQ A;  5FT9 A;  3FFL A;  4F1S A;  3CQC B;  3G2U A;  2X6I A;  4BFR A;  3PRE A;  5JJT A;  2OVF A;  5T3R A;  2IFU A;  3JYS A;  4N3B A;  4M3O A;  3RU0 A;  4UQZ A;  2LSV A;  4FAD A;  4F7A A;  3ZGQ A;  1UG3 A;  3CVQ A;  3O4Z A;  2FO7 A;  2OVB A;  4I6J A;  4L2Y A;  4HVB A;  2WXO A;  4L1B A;  4AIF A;  3CLJ A;  1QZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...