2VGXA

Structure of the yersinia enterocolitica type iii secretion translocator chaperone sycd
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
134
structure length
128
Chain Sequence
GGGTIAMLNEISSDTLEQLYSLAFNQYQSGYEDAHVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIEPRFPFHAAECLLQGELAEAESGLFLAQELIANPEFELSTRVSSMLEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Yersinia Enterocolitica Type III Secretion Chaperone Sycd
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Chaperone
molecule keywords CHAPERONE SYCD
total genus 49
structure length 128
sequence length 134
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vgxA00
4I17A 4EQFA 4KXKB 3URZA 1HXIA 5FT9A 3GZ2A 2V5FA 5FZQA 2Y4TA 1IHGA 4UQYA 3KD7A 3PE4A 3RU0A 5DBKA 4BTBA 5BT1A 3Q4AB 5EKQD 2VGXB 2VSYA 3LKUA 1TJCA 3K9IA 3Q15A 2FO7A 1ELWA 2J9QA 4N5CA 1WM5A 4U07A 5M72A 3BEEA 1A17A 5FZRA 3ULQA 3CV0A 2FBNA 1HH8A 3ASFA 4WNDA 1Y8MA 4H7XA 5CHEE 2FEZA 2C0MA 5FTPA 5G04J 2XGSA 1PC2A 5BNWA 2KATA 4F3VA 4YVQC 3OXFA 4RG9A 4UI9J 4G25A 3TGOA 3GYZA 5FZSA 5G04C 4G1TA 3O48A 1ZBPA 5D0QD 5LCWC 4XI0A 2LSUA 2XPIA 1B89A 1W3BA 3R9AB 3ASDA 2KC7A 3QWPA 5EX0A 4BT8A 3UUXA 4N3BA 3RO3A 4UI9C 3S7JA 4JA9A 1HZ4A 2HYZA 3FWVA 3ZHEA 2C2LA 2PQRA 4J8EA 3FP3A 3TG4A 2MHKA 3QDNA 3UPVA 4UI9K 3CVLA 3MKRA 4U0SA 4RG6A 1E96B 1NA3A 3CK9A 1XNFA 4XI9A 4B94A 5KJNA 2BUGA 4BWRA 1KT0A 1KLXA 4Y6CA 3PE3A 4G24A 4GYYA 4LEUA 1QZ2A 4U0ZA 3ZGQA 5AYWD 3LCAA 3ZN3A 2GW1A 2FI7A 2ONDA 3OXGA 2PQNA 2L6JA 3WXXA 4HOSA 2C0LA 2IF4A 1NZNA 5JJ6A 3NF1A 3ESKA 4GCNA 3RJVA 3ASHA 4N3AA 3U3WA 4HOTA 2UY1A 3RO2A 5ARFA 3CK7A 3QOUA 5JJ7A 3ASGA 5A7DB 3CK8A 3QWWA 4KBQA 3AS4A 2PL2A 1YA0A 2VQ2A 4GZ6A 4I2ZA 3MEKA 5ARGA 3Q47B 2VGXA 2FF4A 5C1DA 5KJMA 3LPZA 5FJYA 4O6FA 3TAXA 4UQZA 3QWVA 2DBAA 5LCWJ 4AIFA 2KCVA 2NC9A 2E2EA 1OUVA 3MA5A 2WQHA 4W9RA 5EX3A 2UWJG 2Y4UA 3Q49B 4HOUA 2OOEA 2VGYA 3EDTB 4I1AA 3CKCA 3HYMB 4G23A 2LNIA 1QQEA 4U04A 4ME2A 3CEQA 4I9CA 3AS5A 3GW4A 3MV2B 3E4BA 2XCCA 4NQ0A 4BTAA 2XCBA 4I9EA 4U0UA 5G05J 5HI7A 4GA0A 3CVQA 4NRHB 1ZU2A 2UY1B 4GCOA 4I2WA 3LY9A 4N3CA 3RIBA 4A1SA 2R5SA 3U4TA 2JLBA 1P5QA 3S7FA 2XGOA 5G05C 3KS2A 3N71A 5A6CA 1IYGA 2I6HA 4IN3B 2YHCA 5HQ8A 3PDNA 4Y6WA 3LY8A 4BT9A 3SF4A 5D0OD 4YNDA 5CCLA 3LY7A 2P58C 2WPVA 4GA1A 2XGMA 3CVPA 4WUYA 5DIZA 4GZ5A 4APOA 2KCLA 4UQXA 4JHRA 2LSVA 2XEVA 3SZ7A 4GPKA 1WAO1 4GYOA 2VYIA 2QFCA 4WNEA 3UQ3A 3ZHEB 4J8FA 2HO1A 2KCKA 4ABNA 3TG5A 4AY5A 4CDRA 5CCMA 3IEGA 4N2QA 4AY6A 2AVPA 3FFLA 4GZ3A 4G2VA 3S7DA 1ELRA 3OXLA 4GYWA 2HR2A 3AS8A 2Q7FA 4J0UA 2PZIA 4XIFA 3KAEA 3JYSA 4WNGA 4JA7A 3LYAA 4HORA 1FCHA 1NA0A 3CVNA 4G26A 4N39A 4YVOA 4J8DA 4CGVA 3VTYA 5JJTA 2IFUA 4N2SA 3ZFWA 4CGWA 3VTXA 3ZPJA 4AM9A 3RKVA 3S7BA 5KJKA 3MV3B 3CKBA 4WNFA 5KJLA 4JL0A 3QKYA 2VSNA 2YQ8A 3GZ1A 4HOQA 4KYOB 4GA2A 3Q5MA 5BW8C 1KT1A 4H7YA
chains in the Genus database with same CATH superfamily
4I17A 4LNUD 5FZQA 3D9HA 4A63B 4JPSA 2EILE 2J08A 4GMLA 3ZIMA 4EHMA 4YDOA 2KZTA 2F8XK 3PZ1A 2MHKA 2RFAA 5CMYA 2OEWA 3IHYA 3RK6A 4UWGA 3ASOE 4HS2A 4YDYA 5AQBA 4KVMA 3L17A 2WXOA 3DXKG 3RJVA 3ASHA 2YINA 3NOCD 2LUHA 3HXBA 4O60A 2X6IA 2H6HA 4O6FA 1SVXA 2KCVA 1NFIE 1OUVA 3MJWA 4WWOA 4NIKA 2WXNA 2J09A 2XCBA 1HFAA 3FUDA 4G11A 4JZYA 1E8ZA 3IBEA 4DI4A 3PDNA 2WXJA 2KCLA 4HFGA 3UM0A 2ZGGA 3FTUA 4BESA 4FP7A 4RQIA 3PVLA 3ZXPA 4N2QA 2I2OA 4A1GA 4UUCA 5KBAA 3DBSA 4XIFA 5BPPA 1S63A 3CVNA 1NA0A 1QBQA 4B8AA 4J8DA 4AP2A 2NYJA 1K1BA 5AJDA 3TJPA 2XS8A 1SZ9A 3S7BA 1PY1A 2AXZA 4U7EB 5EDSA 4J6IA 4ZFHA 3AJIA 3APFA 1KZOA 3ASFA 2C0MA 5C2YA 1L5JA 2JABA 2LO6A 2QYUA 3NAWA 5AAOA 3GYZA 4GU5A 3UUXA 1LF8A 4JC8A 4HI8A 4JHKA 3LVQE 4GPMA 2WXIA 1AP7A 4DI3A 4LEUA 4U0ZA 2C0LA 3AU4A 1TN8A 4HQDA 3BQOA 4N3AA 3L82A 1N4PA 4B8CB 4FU3A 4I2ZA 1TN6A 3AS4A 4RVBA 1SQMA 5BXUA 5HRYA 3ABKE 3DRAA 2WXLA 1AWCB 2B0OE 2E2EA 5G55A 4XKCA 2Y4UA 4F1SA 1TNUA 3E4BA 3FTVA 5HI7A 5G05J 4GCOA 3ZVVA 4A1SA 1UOHA 3L13A 1P5QA 5G05C 4I1OB 3L22A 3SF4A 5D0OD 4BFRA 3I3NA 2JEKA 4UQXA 2XEVA 2VYIA 2AXVA 3OXLA 3ZU7B 1LTXA 4U63A 4GTOA 1N0QA 1N54A 3FTWA 3CKBA 2CHWA 1S70B 2P9UG 3GZ1A 5T3RA 5HKPA 3DSWA 3D3MA 3UKRG 5KNGA 4ANVA 4U8YD 1UW4B 4HB5A 5D0QD 2XPIA 4UI9C 1QNFA 3B13A 1TN7A 4PS3A 3SD5A 4WWPA 4QQIA 2CHZA 3Q75A 3ZN3A 1ZB1A 3WXXA 4HOTA 2UY1A 5JHBA 3CK8A 4APFA 3VTYA 3ZYLA 4GTMA 4BSXA 2GRLA 3Q9UC 5EX3A 1OXJA 4I1AA 1EYHA 4BERA 1JCQA 3GW4A 4I2WA 3VLDA 4G8KA 3T8KA 2WM9A 3RSEG 2JLBA 4JD2G 4I6GA 4Y6WA 5CCLA 4APOA 3LXUX 4GYOA 4GTRA 1N52A 4TUUA 4F7AA 2YNQA 3S7DA 2H6GA 2R17C 2PZIA 3KAEA 4DX7D 2L6BA 3BUAA 4O1OA 3I5PA 3ZFWA 4PS7A 3KSQA 3ZYMA 1D8EA 3PH0C 4G8LA 4J8YA 3PS6A 4DRXE 3PNTB 3I4RB 3SFZA 3Q4AB 5JHAA 2KBXA 1EF1C 2FBNA 2MOWA 5CRUA 1H6PA 1H2TC 4M3OA 5ENOD 4G1TA 2OVFA 4U95D 5FINA 2OVBA 3TG4A 5KJNA 1NA3A 2NXPA 1KT0A 3U9WA 4OVUA 2J49A 3ZYKA 1DVPA 3ABLE 3FDHA 4UWFA 2VTBA 4HRMB 3PZ3A 1OWMA 3VLFA 3KSLA 2A4ZA 3MA5A 3J5PA 4WNGA 1E8YA 4ME2A 4BX8A 3MV2B 5CBOA 3AG2E 3G2VA 5H7PA 1BPOA 1OCRE 2VJ8A 2EINE 3D9JA 4K5BA 4EPZA 1N4QA 2EQXA 2RKKA 3LY8A 4GA1A 4BETA 2RFMA 4AY5A 5ENRD 3TG5A 1A5EA 1HG5A 1D8DA 1LD8A 1KZPA 5FQ7A 4CGVA 3LS8A 3VTXA 3EHRA 3G2WA 4GA2A 2LXLA 1E7UA 4RLYA 3FU0A 4LRZA 5EKQD 3LKUA 3NZUA 2HM8A 3PREA 4H7XA 5G04J 3NOGD 1OCCE 2DCPA 4JXTA 4YVQC 2F37A 2WXRA 5FQ4A 2QC9A 3B7UX 3FULA 2CFZA 2XPYA 1W3BA 5FQ8A 1U3CA 3D9LA 2WMNA 3FU6A 2ZGDA 5CMWA 2H6FA 4HRLA 1QZ2A 5AYWD 3OXGA 4GTVA 4UWLA 5JJ6A 5KNHD 3QOUA 4FULA 4B0ZA 4KBQA 1YA0A 2VGXA 3FUNA 3Q73A 4AIFA 4L7TA 2ZXWE 4FLBA 4ANXA 3HRAA 4N3CA 3R9MA 1E8WA 2GRMA 2V4LA 4AJWA 2E0IA 3EIQC 5DIZA 2I9CA 4GPKA 2ZU6B 4JVSA 3CSFA 2A5EA 3EU9A 1ELRA 3LDZA 5E76A 3T5XA 4BX9A 4CGWA 4CZ2D 3FUFA 3FEXA 3VLEA 4URKA 3ZW3A 4DX2A 3D9NA 5KWDA 2XEEA 4WNDA 3TWSA 5LX8A 5BNWA 3D9IA 4WWNA 2EIKE 4G25A 1JCSA 4DK5A 1S0PA 1HO8A 3ASDA 3PRZA 3FWVA 4J8EA 2Y69E 2XZDG 1K1AA 2QZAA 2VSOE 4ACKA 3E30A 4Y6CA 4G24A 3NQPA 4GYYA 2WXMA 3KEAA 1D9SA 2PQNA 4HLEA 4GCNA 3ESKA 5ANLA 2WXKA 3U3WA 5HS0A 3D9KA 5AN8A 5KJMA 3L6AA 2FF4A 5LCWJ 1Y6IA 3HYMB 2CHXA 4CYMD 4UWKA 1ZU2A 4XZ4A 1HF8A 4EBAA 3DEPA 4L2LA 3MKQB 3UIPC 3V30A 2IO2C 3X2QE 4ILIA 4ATGA 3TXNA 2X6FA 2AJAA 3LYAA 1YMPA 4EECA 5JJTA 3WG7E 4TUMA 4LERA 3TWUA 4AM9A 1HS6A 3MV3B 1MHQA 2YQ8A 4HXIA 4KYOB 3LJNA 1DCQA 1IHGA 2Y1LE 3PNLB 4FLHA 5LOZA 3PEUB 4N5CA 2LAIA 3TL5A 3HXDA 3ZNGA 2KATA 2AXUA 5FZSA 2FULA 3SHFA 2P2CP 4L23A 4Z68A 5EX0A 4BT8A 3O4ZA 3CLJA 2XENA 5A23A 1HZ4A 2HYZA 3HVEB 1FVFA 2GGFA 4CDMA 2A5UA 3ASNE 3S2AA 5EN5D 3LCAA 2Y3AA 1JPLA 5T4YA 3JXJA 1NZNA 3NZSA 4X8QA 2GRRB 4GZ6A 5ARGA 3Q47B 3OTNA 2X6JA 3L08A 4K03A 3IKOB 4NQ0A 3E33A 2IY0C 3CVWA 1Z3YA 4P29A 3N71A 3FH5A 2I6HA 3AG4E 1NI1A 4FHJA 5CERB 3E37A 3UIOC 4YNDA 1MQSA 3CVYA 3SZ7A 2V8SE 4J8FA 4HVBA 3UM1A 4R7LA 4GZ3A 4GMRA 3C98A 4I1MA 5EIDA 2KM4A 3DSVA 3HDXA 4KVOA 1WDYA 5D2MC 3PEVB 3U66A 4GAAA 3LVRE 5ITZF 3R7RA 1HXIA 4GTQA 3ML9A 3K9IA 1N4SA 2VGEA 2XGSA 3RRUA 2IU1A 3CIAA 5G04C 3RRNB 4I6JA 3R9AB 2LSUA 2GRNB 4XI0A 4ZHBA 2J8SD 4NACA 4EZKA 2L0IA 3PUJA 3S7JA 1SW6A 2HE0A 1XNFA 5D66A 3FH8A 3PE3A 1Z6TA 2ONDA 4E6HA 3P2BA 5FWQA 4W9RA 2WQHA 4HOUA 4XKBA 3EDTB 1TNYA 4U0UA 2XEHA 4EZLA 3G2SA 1TYQG 1BI7B 1MJ0A 1DNPA 2F8YA 1E7VA 3ONLA 1JWGA 3CR3A 4B93B 2P9SG 4BY6A 5JA4D 4KT6B 3FFLA 3CGHA 3AS8A 2BKGA 4OAVB 1FCHA 3HIZA 1HX8A 2GRPB 3FU3A 3AAAC 4KZCA 1MYOA 4TV3A 5FIOA 5BW8C 2IEJA 3Q5MA 4K0RA 1V55E 1WG0A 4UQYA 4C0EA 4M7CA 1ELKA 2YHEA 1WM5A 3FTYA 5E75A 2XZTG 3SFXA 3TGOA 1BU9A 1IQUA 3NBNB 4CEMA 3RO3A 2X38A 3SQVA 1TNZA 1H6OA 3CVLA 3ZXSA 3E34A 3CVVA 5AIJA 1DC2A 1JUQA 2ETAA 2XPZA 2BTDA 4JHJA 1H6KA 2V5QC 1H2VC 3ZYQA 4U96D 1N95A 4DLQA 3T5VA 3EUVA 4MLPA 3HVEA 2QY7A 4C48B 4U04A 1FVHA 3CEQA 2WXQA 3MX3A 4LSZE 4B89A 1NP7A 5EILA 1U3DA 4Q69A 1IYGA 3Q7AA 3MZLB 3D9OA 4IN3B 2WXPA 3EIJA 2WMOA 2WPVA 3D9MA 3CVPA 4O1PA 4ANUA 4F1PA 4JHRA 1LD7A 2QFCA 4CDRA 1OWOA 3FUHA 4AY6A 1UJKA 3B95A 2P9LG 1NL4A 4N39A 5LFAA 4K5CA 2P9NG 3W9FA 3APDA 2WVIA 3QC1A 2X3MA 3V79K 4BT9A 3DSUA 2WXFA 3URZA 3JXIA 3SBSA 5ENPD 4K5AB 1IHBA 2ILRA 3JQ1A 1A17A 3HXCA 1HH8A 5CHEE 4BEPA 4YDWA 3ZRHA 2MYOA 3FTSA 4A3TA 4XE0A 2PNNA 2J4DA 4MBGA 5ENSD 3UPVA 3CHSA 4U0SA 1S64A 4BWRA 2P9PG 3LEWA 3PZ4A 3LJ3A 2IOLA 4HOSA 4QFVA 4GZCA 5AQ9A 4WAFA 1QYMA 3TXMA 2XS1A 3UTMA 3BU8A 5DBKA 3EU5A 3QB2A 4BTAA 4I6EA 2P9KG 3LY9A 1JWFA 3U4TA 3HG0D 4F53A 2R03A 3FEYA 4Q94A 4DX5D 4DUIA 3QJZA 5FQ6A 1SA5A 1HE8A 4WNEA 4G2VA 3FHEA 3MCXA 4J0UA 3JYSA 4JA7A 4HORA 4G26A 3AG1E 3FU5A 4C0MA 5J08A 4LCTA 5KJKA 1TNBA 3F6QA 2AWIA 4H7YA 2DIWA 2Y4TA 3W9GA 2VGXB 2VSYA 4GTSA 2FO7A 1O1RA 4TXPA 4N5QA 3UXGA 1HU3A 4ILHB 3C3QA 4RG9A 2I1JA 2XRZA 1ZBPA 1OWPA 4RSYA 3CQGB 3SFYA 2WB2A 4PS8A 2IOSA 2C2LA 3MKRA 1E96B 3CVXA 4CRWA 1RZ4A 2EIJE 3NF1A 3ULEG 4JW1A 2J07A 5JJ7A 3GZSA 3Q79A 4KMOA 3IXEA 1N0RA 2V4HC 3UI2A 2NC9A 2CG3A 4HBDA 3FY4A 3DPYA 2X6KA 4HNAD 1TJFA 3CQCB 3UKUG 1TR4A 3FH7A 4I43A 5HQ8A 1H0AA 2P58C 3UX4A 1X81A 3UQ3A 3UINC 3IEGA 2F0YA 4GTPA 2H6IA 2X6HA 1N4RA 3ML8A 4A3VA 5ENQD 3HXEA 2QYJA 4JL0A 3QKYA 4HOQA 1FT2A 3UM2A 4EQFA 3V2XA 1V54E 3GZ2A 3MKQA 1MX6A 5BT1A 1ELWA 3BEEA 3ULQA 3CV0A 3HHMA 5FTPA 5EIBE 2DWZA 5CEDB 1N11A 1VDYA 3CHPA 1Z3XA 2CFUA 3OXFA 4FHKA 3FUIA 4V3IA 3B7RL 2KC7A 1MX4A 4N3BA 1OCZE 3JUEA 3CVUA 4GTTA 3ZHEA 2WXHA 3DEOA 4EZJA 2BUGA 3MGBA 4MS6A 4GMJA 1UN8A 3CK7A 2PL2A 2VQ2A 2M63A 2OEVA 3D9PA 3DPDA 2FO1E 4UQZA 4DX1A 3OAWA 2I1KA 3TWQA 3Q49B 3ABME 2LNIA 5AARA 2AW6A 3CVQA 3FUKA 3TWTA 3ESLA 3G2UA 3EJNA 3B7TA 2EIME 3C5RA 4ATZD 2DZNA 5CCMA 4JB8P 2Y0BG 4FJZA 4HRNA 5LP0A 1EPUA 4DLOA 3TWXA 3DSTA 2OCCE 2IO3C 2LXMA 4KXKB 3BG0B 3U64A 1GW6A 3UM3A 5CRVA 1UJJA 3UMVA 5BXOA 4A55A 4ACLA 3V31A 3BG1B 1O5MA 1N9AA 3FTZA 5ANRA 4JEUA 4F3VA 5LCWC 1RW2A 2LAHA 4OVVA 5EYLA 4UI9K 4LUNU 2KZTB 3SO8A 3CK9A 1SZAA 4B94A 1Q2ZA 5AJLA 4L2YA 2WQ6A 2R59A 4OYSA 4CT4A 3PUKA 2ETBA 1H2UA 2ETCA 4IRUA 3PZDA 4IYPA 3SY2A 2UWJG 3CKCA 1DCEA 2KXPC 4GA0A 1E8XA 3C3OA 3C3RA 3CSTA 1TEZA 4TXQA 4J7WA 4AEZC 2YHCA 3J5QB 4XX5A 1U2VG 3C72A 3EHMA 1YYHA 2ZIRA 4ABNA 3ZHEB 3IV0A 5G2NA 3CHQA 5ENTD 2Q7FA 1O1SA 3TWWA 5CBNA 2L0TB 2IFUA 2DVWA 3ZPJA 4CT0A 4AOFA 3B7SA 4C9BB 2J4BA 4GZDA 3CHRA 2VSXE 2V5FA 3KD7A 3RU0A 3ULYA 4BTBA 3IHVA 2J9QA 3TWRA 1UN9A 3ZEFA 1SA4A 4AV7A 3L9TA 3QARA 3QWPA 3TWVA 4JA9A 1IQRA 3AU5A 3FP3A 1IXVA 3NB2A 5IY5E 5BUZA 3MYVA 4XI9A 2VTBB 2CG2A 3E32A 2XHEA 2FI7A 5B1BE 5CECB 2GRQB 2IF4A 3RO2A 4TRQA 1TNOA 2IQCA 3Q78A 3QWWA 5KCMA 3MEKA 3LPZA 4EBAG 2DBAA 4D10C 1FPPA 4JEHA 3QNKA 4CCAA 4YDEA 3AS5A 4HLLA 3SNXA 2DYRE 2UY1B 3UT7A 4KZ0A 2R5SA 1HG2A 3T8MA 3S7FA 5BV1A 3KS2A 5A6CA 1JCRA 4ILGA 4IULA 2ZISA 3B7BA 2KCKA 3JQ0A 1G3NB 2AVPA 1XGWA 3UT4A 4HI9A 4DPRA 1BLXB 2RD0A 4YVOA 4F6RD 3CHMA 4N2SA 1K8KG 3DSXA 3I4GA 3DWLG 3Q9NC 1X5BA 5FT9A 3CHOA 1O1TA 3PE4A 2BF0X 1TJCA 3P1UA 4L9PA 5C1DA 3G2TA 4FA6A 1K3ZD 1MX2A 1N94A 4PDXA 1BI8B 2MRIA 4FJYA 5J90A 1B89A 3KEZA 1INZA 3FTXA 4OAUC 2PQRA 3SGHA 1OWNA 1KLXA 1OWLA 5T8IA 5B3SE 1BD8A 2V0PA 1IKND 4UWHA 3ASGA 5A7DB 2DZOA 2B6CA 1OCOE 2P9IG 3DSSA 2PM7A 3QWVA 1E90A 2VGYA 3PZ2A 4NURA 2OV8A 2WXGA 4G23A 2IJGX 2WQ7A 4I9CA 2XCCA 2IONA 1H19A 3EHNA 3R7QA 4DX6D 4WUYA 4GZ5A 3AG3E 2LSVA 2L9BA 5BV0A 5AQAA 1WAO1 3L16A 4GB9A 3QAQA 4J8SA 2HR2A 4LG6A 5B1AE 3FUEA 3RKVA 4BSZB 5KJLA 3RRMB 2VSNA 4FC8A 4DJAA 4FADA 3Q7FA 3Q15A 3JCKC 5ENNA 3T9KA 5M72A 4U07A 2R2LA 5FZRA 1Y8MA 2FEZA 1PAQA 1PC2A 3ZUVB 4ANWA 4U8VD 3APCA 4LNBA 2BEDA 4UI9J 3ISMC 3V2OA 3RAUA 3O48A 4PH4B 2PM6A 5JMND 4XEIG 2R02A 3QDNA 4RG6A 2DYSE 3HXFA 3ZGQA 3SI5A 2GW1A 1WY6A 2L6JA 2GROB 3ONKA 3FUJA 4LNGA 4Q96A 5ARFA 3ZKJA 3L54A 5FJYA 3TAXA 3FUMA 1FT1A 2OOEA 4AVXA 2XRYA 1QQEA 4I9EA 4CDNA 4NRHB 4L1BA 2NSZA 2BKKB 2RG8A 3JUIA 3RIBA 4PUCA 1Z5SC 3EHQA 1MZCA 2XQ0A 2XGOA 4E85A 2R05A 3LY7A 2XGMA 1EDUA 5AENA 3QK0A 4MRUA 3SBTB 4AXHA 2HO1A 3ENEA 1UG3A 3UT8A 4MKTA 4GYWA 3DXMG 1YCSB 4U8HA 1OY3D 5AQ7A 1KPSB 5CEAA 1OT8A 4TXRA 4WNFA 1KT1A 5EYPF
chains in the Genus database with same CATH topology
4I17A 1E7UA 4KXKB 3BG0B 3U64A 1GW6A 1UJJA 3UMVA 5FZQA 4UQYA 4A55A 4C0EA 3FU0A 4LRZA 5EKQD 3BG1B 1ELKA 3LKUA 3NZUA 4ACLA 2YHEA 1WM5A 3FTYA 5E75A 2HM8A 3PREA 3FTZA 4H7XA 4JPSA 5G04J 5ANRA 4JEUA 4F3VA 2DCPA 2J08A 4JXTA 4YVQC 4GMLA 2WXRA 5FQ4A 3TGOA 1IQUA 3ZIMA 3B7UX 3FULA 5LCWC 2CFZA 2XPYA 1W3BA 5FQ8A 4CEMA 1U3CA 3D9LA 2KZTA 3RO3A 2LAHA 2X38A 4OVVA 2WMNA 3FU6A 2MHKA 4UI9K 3CVLA 4LUNU 2KZTB 5CMYA 5CMWA 3CK9A 3ZXSA 3IHYA 1SZAA 4B94A 3RK6A 4UWGA 5AJLA 1QZ2A 5AYWD 3CVVA 3OXGA 4HS2A 1JUQA 5AIJA 4L2YA 4KVMA 3L17A 2WXOA 4UWLA 2XPZA 5JJ6A 2WQ6A 2BTDA 2R59A 4OYSA 3RJVA 3ASHA 2YINA 4JHJA 1H6KA 3QOUA 4CT4A 3PUKA 4FULA 4B0ZA 1H2UA 4KBQA 1H2VC 2X6IA 1YA0A 3ZYQA 2VGXA 3FUNA 4O6FA 4DLQA 3T5VA 4AIFA 2KCVA 4IRUA 4L7TA 3HVEA 3PZDA 4IYPA 4MLPA 1OUVA 2QY7A 2UWJG 3MJWA 3CKCA 4WWOA 4U04A 1FVHA 3CEQA 2WXQA 2WXNA 4FLBA 3MX3A 4ANXA 2J09A 2XCBA 4B89A 4GA0A 1E8XA 1HFAA 4N3CA 1NP7A 1U3DA 3CSTA 3FUDA 1E8WA 1TEZA 4G11A 4JZYA 1E8ZA 3IBEA 4Q69A 1IYGA 2GRMA 2V4LA 3MZLB 4AEZC 3D9OA 4IN3B 2YHCA 2WXPA 4DI4A 3PDNA 4AJWA 3EIJA 2WXJA 2E0IA 2WMOA 3EIQC 3EHMA 2WPVA 3D9MA 4XX5A 3CVPA 5DIZA 2I9CA 2KCLA 4HFGA 4ANUA 4JHRA 3FTUA 4GPKA 2ZU6B 4ABNA 2QFCA 4FP7A 3ZHEB 4CDRA 1OWOA 3FUHA 3PVLA 4JVSA 4AY6A 3IV0A 1UJKA 5G2NA 3CHQA 2I2OA 3CSFA 4A1GA 4N2QA 1ELRA 3DBSA 2Q7FA 4XIFA 5BPPA 3CVNA 1NA0A 3LDZA 4N39A 5E76A 3T5XA 4J8DA 4B8AA 5LFAA 4AP2A 2L0TB 2IFUA 3APDA 3ZPJA 4BX9A 4AOFA 4CT0A 4CGWA 3FUFA 5AJDA 3B7SA 3TJPA 4C9BB 3FEXA 2WVIA 3QC1A 2X3MA 1SZ9A 2J4BA 3S7BA 4BT9A 1PY1A 4GZDA 3VLEA 3CHRA 2WXFA 2AXZA 3URZA 4URKA 2VSXE 2V5FA 3ZW3A 3SBSA 5EDSA 3KD7A 4J6IA 3RU0A 4BTBA 3D9NA 3IHVA 2ILRA 2J9QA 3APFA 3JQ1A 1A17A 1HH8A 3ASFA 4WNDA 5CHEE 2C0MA 5LX8A 5BNWA 5C2YA 3ZRHA 1L5JA 1UN9A 2LO6A 3D9IA 4WWNA 4G25A 3ZEFA 4DK5A 3GYZA 3FTSA 4AV7A 3QARA 1S0PA 1HO8A 3ASDA 4GU5A 3QWPA 4A3TA 3UUXA 4XE0A 1LF8A 2J4DA 3PRZA 4JA9A 3FWVA 1IQRA 4JC8A 3AU5A 4J8EA 3FP3A 4JHKA 3CHSA 3UPVA 3LVQE 4U0SA 5BUZA 3MYVA 4XI9A 4ACKA 2VSOE 2VTBB 4BWRA 2WXIA 4Y6CA 4G24A 3NQPA 4GYYA 4DI3A 2CG2A 2WXMA 4LEUA 4U0ZA 3LEWA 2XHEA 2FI7A 2PQNA 3LJ3A 2IOLA 4HOSA 2C0LA 4QFVA 2IF4A 4HLEA 4GCNA 3ESKA 3AU4A 5ANLA 4N3AA 2WXKA 3U3WA 4GZCA 4TRQA 4FU3A 3RO2A 2IQCA 4B8CB 4WAFA 4I2ZA 3QWWA 3AS4A 3D9KA 5KCMA 4RVBA 1SQMA 3MEKA 3L6AA 3TXMA 2FF4A 5KJMA 3LPZA 4EBAG 2WXLA 2DBAA 5LCWJ 4D10C 2E2EA 1Y6IA 5G55A 4XKCA 2Y4UA 4JEHA 3QNKA 5DBKA 3HYMB 4CCAA 4F1SA 2CHXA 3AS5A 3E4BA 3QB2A 3FTVA 4UWKA 5G05J 5HI7A 3SNXA 4BTAA 4I6EA 1ZU2A 2UY1B 4GCOA 3UT7A 3LY9A 4KZ0A 3ZVVA 4XZ4A 1JWFA 4A1SA 2R5SA 3U4TA 1HG2A 3L13A 3T8MA 1P5QA 3S7FA 5BV1A 5G05C 3KS2A 5A6CA 4I1OB 4F53A 1HF8A 4EBAA 3FEYA 4Q94A 3L22A 4ILGA 3SF4A 3QJZA 5D0OD 3I3NA 4IULA 4BFRA 2JEKA 4L2LA 5FQ6A 4UQXA 2XEVA 1HE8A 4WNEA 2VYIA 3MKQB 2KCKA 3JQ0A 2AVPA 4G2VA 1XGWA 3FHEA 4ATGA 4ILIA 2AXVA 3OXLA 3TXNA 3UT4A 2X6FA 3MCXA 4J0UA 3JYSA 4JA7A 3LYAA 4HORA 4DPRA 2RD0A 4G26A 4EECA 4YVOA 4U63A 1N54A 3FTWA 5JJTA 3CHMA 3FU5A 4LERA 4N2SA 4C0MA 5J08A 4LCTA 4AM9A 5KJKA 1HS6A 3MV3B 3CKBA 2CHWA 1MHQA 3I4GA 3GZ1A 2YQ8A 4HXIA 4KYOB 2AWIA 4H7YA 1X5BA 2DIWA 5FT9A 3CHOA 2Y4TA 1IHGA 3PE4A 2BF0X 2VGXB 2VSYA 3PNLB 1TJCA 5T3RA 4FLHA 2FO7A 5LOZA 3PEUB 4N5CA 3D3MA 3P1UA 2LAIA 3TL5A 5C1DA 3G2TA 4ANVA 4FA6A 1HU3A 2KATA 4ILHB 4PDXA 2AXUA 4RG9A 2I1JA 2MRIA 1UW4B 5FZSA 2XRZA 2FULA 1ZBPA 4FJYA 1OWPA 4RSYA 5D0QD 3SHFA 2XPIA 1B89A 3CQGB 5J90A 3KEZA 4L23A 5EX0A 4BT8A 2WB2A 3O4ZA 2IOSA 3CLJA 4PS8A 4UI9C 1INZA 5A23A 1HZ4A 2HYZA 3FTXA 1QNFA 2C2LA 1FVFA 2PQRA 3HVEB 3B13A 3SGHA 3MKRA 1E96B 2GGFA 4CDMA 1OWNA 4PS3A 1KLXA 3SD5A 2A5UA 4WWPA 3S2AA 2CHZA 3CVXA 1OWLA 3LCAA 2Y3AA 3ZN3A 1JPLA 5T8IA 5T4YA 3WXXA 4CRWA 1NZNA 3NZSA 3NF1A 4HOTA 2V0PA 2UY1A 2J07A 4JW1A 5JJ7A 3GZSA 4UWHA 3ASGA 4KMOA 5A7DB 3CK8A 3VTYA 4APFA 5JHBA 4GZ6A 3ZYLA 5ARGA 3Q47B 2PM7A 3QWVA 2NC9A 4BSXA 2GRLA 3OTNA 5EX3A 2X6JA 2CG3A 3L08A 4I1AA 1E90A 1EYHA 2VGYA 3FY4A 3IKOB 4K03A 2OV8A 2WXGA 4G23A 4NURA 2IJGX 4NQ0A 4I9CA 2WQ7A 3GW4A 2XCCA 2IONA 2X6KA 4I2WA 3VLDA 1H19A 1TJFA 2WM9A 3CVWA 1Z3YA 2JLBA 3CQCB 4P29A 3N71A 3FH5A 3FH7A 2I6HA 4I43A 4FHJA 5HQ8A 4I6GA 4Y6WA 3EHNA 5CCLA 4YNDA 1H0AA 2P58C 3R7QA 3UX4A 4WUYA 4GZ5A 4APOA 1MQSA 3LXUX 3CVYA 2LSVA 2L9BA 3SZ7A 5BV0A 1WAO1 4GYOA 3UQ3A 3L16A 4GB9A 2V8SE 4J8FA 1N52A 4TUUA 4F7AA 4HVBA 3IEGA 4R7LA 2YNQA 4GZ3A 3QAQA 3S7DA 4I1MA 3C98A 2R17C 4J8SA 2HR2A 2X6HA 2PZIA 3KAEA 2KM4A 3ML8A 3HDXA 4A3VA 4KVOA 3FUEA 3I5PA 3ZFWA 4PS7A 3PEVB 3RKVA 3ZYMA 3PH0C 5KJLA 4JL0A 3QKYA 2VSNA 3PS6A 4FC8A 4HOQA 3RRMB 4GAAA 3U66A 3LVRE 4EQFA 4DJAA 3R7RA 1HXIA 3PNTB 3GZ2A 3I4RB 3MKQA 4FADA 3SFZA 5BT1A 3Q4AB 3Q15A 5JHAA 3ML9A 3K9IA 1ELWA 3JCKC 5ENNA 5M72A 4U07A 3BEEA 5FZRA 1EF1C 3ULQA 3CV0A 2FBNA 3HHMA 2MOWA 1Y8MA 5FTPA 2FEZA 1PAQA 2XGSA 1PC2A 3RRUA 2IU1A 1VDYA 3CHPA 4ANWA 3CIAA 1Z3XA 2CFUA 3APCA 3OXFA 4UI9J 1H2TC 3FUIA 4FHKA 4M3OA 5G04C 4G1TA 3O48A 4V3IA 2OVFA 3RRNB 4I6JA 2LSUA 4PH4B 4XI0A 2PM6A 3B7RL 3R9AB 2KC7A 4N3BA 2OVBA 4NACA 2L0IA 3PUJA 3S7JA 4EZKA 3CVUA 3ZHEA 2WXHA 3TG4A 3QDNA 4RG6A 5KJNA 1NA3A 1XNFA 4EZJA 2BUGA 2NXPA 3FH8A 1KT0A 3MGBA 3PE3A 1Z6TA 3U9WA 3ZGQA 4OVUA 3SI5A 2GW1A 2J49A 2ONDA 4MS6A 1DVPA 1WY6A 2L6JA 3ZYKA 4GMJA 1UN8A 3ONKA 3FUJA 4Q96A 3FDHA 5ARFA 3CK7A 4E6HA 4UWFA 3L54A 2PL2A 2VTBA 2VQ2A 3P2BA 2M63A 1OWMA 3D9PA 3DPDA 5FJYA 3VLFA 5FWQA 3TAXA 4UQZA 3OAWA 2A4ZA 3FUMA 2I1KA 4W9RA 3MA5A 2WQHA 3Q49B 4HOUA 4XKBA 4WNGA 2OOEA 3EDTB 4AVXA 2XRYA 2LNIA 1QQEA 1E8YA 4ME2A 4BX8A 2AW6A 3MV2B 4I9EA 4CDNA 4U0UA 3CVQA 4NRHB 4L1BA 2NSZA 3FUKA 2RG8A 3G2SA 3G2VA 3JUIA 3RIBA 4PUCA 4EZLA 3ESLA 1BPOA 3G2UA 2XQ0A 2VJ8A 2XGOA 3D9JA 4E85A 3EJNA 3B7TA 1DNPA 4EPZA 1E7VA 2EQXA 3LY8A 3LY7A 3ONLA 4GA1A 1JWGA 2XGMA 1EDUA 3CR3A 5AENA 3QK0A 4MRUA 3SBTB 4AXHA 2HO1A 4BY6A 4AY5A 3TG5A 5CCMA 4KT6B 1HG5A 3ENEA 3FFLA 1UG3A 3UT8A 4MKTA 3CGHA 4FJZA 4GYWA 3AS8A 5FQ7A 4U8HA 5LP0A 1FCHA 4CGVA 3HIZA 1EPUA 1HX8A 4DLOA 3LS8A 3FU3A 3VTXA 4KZCA 4WNFA 4TV3A 5BW8C 3G2WA 4GA2A 3Q5MA 1KT1A 4K0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I17 A;  4EQF A;  4KXK B;  3URZ A;  1HXI A;  5FT9 A;  3GZ2 A;  2V5F A;  5FZQ A;  2Y4T A;  1IHG A;  4UQY A;  3KD7 A;  3PE4 A;  3RU0 A;  5DBK A;  4BTB A;  5BT1 A;  3Q4A B;  5EKQ D;  2VGX B;  2VSY A;  3LKU A;  1TJC A;  3K9I A;  3Q15 A;  2FO7 A;  1ELW A;  2J9Q A;  4N5C A;  1WM5 A;  4U07 A;  5M72 A;  3BEE A;  1A17 A;  5FZR A;  3ULQ A;  3CV0 A;  2FBN A;  1HH8 A;  3ASF A;  4WND A;  1Y8M A;  4H7X A;  5CHE E;  2FEZ A;  2C0M A;  5FTP A;  5G04 J;  2XGS A;  1PC2 A;  5BNW A;  2KAT A;  4F3V A;  4YVQ C;  3OXF A;  4RG9 A;  4UI9 J;  4G25 A;  3TGO A;  3GYZ A;  5FZS A;  5G04 C;  4G1T A;  3O48 A;  1ZBP A;  5D0Q D;  5LCW C;  4XI0 A;  2LSU A;  2XPI A;  1B89 A;  1W3B A;  3R9A B;  3ASD A;  2KC7 A;  3QWP A;  5EX0 A;  4BT8 A;  3UUX A;  4N3B A;  3RO3 A;  4UI9 C;  3S7J A;  4JA9 A;  1HZ4 A;  2HYZ A;  3FWV A;  3ZHE A;  2C2L A;  2PQR A;  4J8E A;  3FP3 A;  3TG4 A;  2MHK A;  3QDN A;  3UPV A;  4UI9 K;  3CVL A;  3MKR A;  4U0S A;  4RG6 A;  1E96 B;  1NA3 A;  3CK9 A;  1XNF A;  4XI9 A;  4B94 A;  5KJN A;  2BUG A;  4BWR A;  1KT0 A;  1KLX A;  4Y6C A;  3PE3 A;  4G24 A;  4GYY A;  4LEU A;  1QZ2 A;  4U0Z A;  3ZGQ A;  5AYW D;  3LCA A;  3ZN3 A;  2GW1 A;  2FI7 A;  2OND A;  3OXG A;  2PQN A;  2L6J A;  3WXX A;  4HOS A;  2C0L A;  2IF4 A;  1NZN A;  5JJ6 A;  3NF1 A;  3ESK A;  4GCN A;  3RJV A;  3ASH A;  4N3A A;  3U3W A;  4HOT A;  2UY1 A;  3RO2 A;  5ARF A;  3CK7 A;  3QOU A;  5JJ7 A;  3ASG A;  5A7D B;  3CK8 A;  3QWW A;  4KBQ A;  3AS4 A;  2PL2 A;  1YA0 A;  2VQ2 A;  4GZ6 A;  4I2Z A;  3MEK A;  5ARG A;  3Q47 B;  2VGX A;  2FF4 A;  5C1D A;  5KJM A;  3LPZ A;  5FJY A;  4O6F A;  3TAX A;  4UQZ A;  3QWV A;  2DBA A;  5LCW J;  4AIF A;  2KCV A;  2NC9 A;  2E2E A;  1OUV A;  3MA5 A;  2WQH A;  4W9R A;  5EX3 A;  2UWJ G;  2Y4U A;  3Q49 B;  4HOU A;  2OOE A;  2VGY A;  3EDT B;  4I1A A;  3CKC A;  3HYM B;  4G23 A;  2LNI A;  1QQE A;  4U04 A;  4ME2 A;  3CEQ A;  4I9C A;  3AS5 A;  3GW4 A;  3MV2 B;  3E4B A;  2XCC A;  4NQ0 A;  4BTA A;  2XCB A;  4I9E A;  4U0U A;  5G05 J;  5HI7 A;  4GA0 A;  3CVQ A;  4NRH B;  1ZU2 A;  2UY1 B;  4GCO A;  4I2W A;  3LY9 A;  4N3C A;  3RIB A;  4A1S A;  2R5S A;  3U4T A;  2JLB A;  1P5Q A;  3S7F A;  2XGO A;  5G05 C;  3KS2 A;  3N71 A;  5A6C A;  1IYG A;  2I6H A;  4IN3 B;  2YHC A;  5HQ8 A;  3PDN A;  4Y6W A;  3LY8 A;  4BT9 A;  3SF4 A;  5D0O D;  4YND A;  5CCL A;  3LY7 A;  2P58 C;  2WPV A;  4GA1 A;  2XGM A;  3CVP A;  4WUY A;  5DIZ A;  4GZ5 A;  4APO A;  2KCL A;  4UQX A;  4JHR A;  2LSV A;  2XEV A;  3SZ7 A;  4GPK A;  1WAO 1;  4GYO A;  2VYI A;  2QFC A;  4WNE A;  3UQ3 A;  3ZHE B;  4J8F A;  2HO1 A;  2KCK A;  4ABN A;  3TG5 A;  4AY5 A;  4CDR A;  5CCM A;  3IEG A;  4N2Q A;  4AY6 A;  2AVP A;  3FFL A;  4GZ3 A;  4G2V A;  3S7D A;  1ELR A;  3OXL A;  4GYW A;  2HR2 A;  3AS8 A;  2Q7F A;  4J0U A;  2PZI A;  4XIF A;  3KAE A;  3JYS A;  4WNG A;  4JA7 A;  3LYA A;  4HOR A;  1FCH A;  1NA0 A;  3CVN A;  4G26 A;  4N39 A;  4YVO A;  4J8D A;  4CGV A;  3VTY A;  5JJT A;  2IFU A;  4N2S A;  3ZFW A;  4CGW A;  3VTX A;  3ZPJ A;  4AM9 A;  3RKV A;  3S7B A;  5KJK A;  3MV3 B;  3CKB A;  4WNF A;  5KJL A;  4JL0 A;  3QKY A;  2VSN A;  2YQ8 A;  3GZ1 A;  4HOQ A;  4KYO B;  4GA2 A;  3Q5M A;  5BW8 C;  1KT1 A;  4H7Y A; 
#chains in the Genus database with same CATH topology
 4I17 A;  4LNU D;  5FZQ A;  3D9H A;  4A63 B;  4JPS A;  2EIL E;  2J08 A;  4GML A;  3ZIM A;  4EHM A;  4YDO A;  2KZT A;  2F8X K;  3PZ1 A;  2MHK A;  2RFA A;  5CMY A;  2OEW A;  3IHY A;  3RK6 A;  4UWG A;  3ASO E;  4HS2 A;  4YDY A;  5AQB A;  4KVM A;  3L17 A;  2WXO A;  3DXK G;  3RJV A;  3ASH A;  2YIN A;  3NOC D;  2LUH A;  3HXB A;  4O60 A;  2X6I A;  2H6H A;  4O6F A;  1SVX A;  2KCV A;  1NFI E;  1OUV A;  3MJW A;  4WWO A;  4NIK A;  2WXN A;  2J09 A;  2XCB A;  1HFA A;  3FUD A;  4G11 A;  4JZY A;  1E8Z A;  3IBE A;  4DI4 A;  3PDN A;  2WXJ A;  2KCL A;  4HFG A;  3UM0 A;  2ZGG A;  3FTU A;  4BES A;  4FP7 A;  4RQI A;  3PVL A;  3ZXP A;  4N2Q A;  2I2O A;  4A1G A;  4UUC A;  5KBA A;  3DBS A;  4XIF A;  5BPP A;  1S63 A;  3CVN A;  1NA0 A;  1QBQ A;  4B8A A;  4J8D A;  4AP2 A;  2NYJ A;  1K1B A;  5AJD A;  3TJP A;  2XS8 A;  1SZ9 A;  3S7B A;  1PY1 A;  2AXZ A;  4U7E B;  5EDS A;  4J6I A;  4ZFH A;  3AJI A;  3APF A;  1KZO A;  3ASF A;  2C0M A;  5C2Y A;  1L5J A;  2JAB A;  2LO6 A;  2QYU A;  3NAW A;  5AAO A;  3GYZ A;  4GU5 A;  3UUX A;  1LF8 A;  4JC8 A;  4HI8 A;  4JHK A;  3LVQ E;  4GPM A;  2WXI A;  1AP7 A;  4DI3 A;  4LEU A;  4U0Z A;  2C0L A;  3AU4 A;  1TN8 A;  4HQD A;  3BQO A;  4N3A A;  3L82 A;  1N4P A;  4B8C B;  4FU3 A;  4I2Z A;  1TN6 A;  3AS4 A;  4RVB A;  1SQM A;  5BXU A;  5HRY A;  3ABK E;  3DRA A;  2WXL A;  1AWC B;  2B0O E;  2E2E A;  5G55 A;  4XKC A;  2Y4U A;  4F1S A;  1TNU A;  3E4B A;  3FTV A;  5HI7 A;  5G05 J;  4GCO A;  3ZVV A;  4A1S A;  1UOH A;  3L13 A;  1P5Q A;  5G05 C;  4I1O B;  3L22 A;  3SF4 A;  5D0O D;  4BFR A;  3I3N A;  2JEK A;  4UQX A;  2XEV A;  2VYI A;  2AXV A;  3OXL A;  3ZU7 B;  1LTX A;  4U63 A;  4GTO A;  1N0Q A;  1N54 A;  3FTW A;  3CKB A;  2CHW A;  1S70 B;  2P9U G;  3GZ1 A;  5T3R A;  5HKP A;  3DSW A;  3D3M A;  3UKR G;  5KNG A;  4ANV A;  4U8Y D;  1UW4 B;  4HB5 A;  5D0Q D;  2XPI A;  4UI9 C;  1QNF A;  3B13 A;  1TN7 A;  4PS3 A;  3SD5 A;  4WWP A;  4QQI A;  2CHZ A;  3Q75 A;  3ZN3 A;  1ZB1 A;  3WXX A;  4HOT A;  2UY1 A;  5JHB A;  3CK8 A;  4APF A;  3VTY A;  3ZYL A;  4GTM A;  4BSX A;  2GRL A;  3Q9U C;  5EX3 A;  1OXJ A;  4I1A A;  1EYH A;  4BER A;  1JCQ A;  3GW4 A;  4I2W A;  3VLD A;  4G8K A;  3T8K A;  2WM9 A;  3RSE G;  2JLB A;  4JD2 G;  4I6G A;  4Y6W A;  5CCL A;  4APO A;  3LXU X;  4GYO A;  4GTR A;  1N52 A;  4TUU A;  4F7A A;  2YNQ A;  3S7D A;  2H6G A;  2R17 C;  2PZI A;  3KAE A;  4DX7 D;  2L6B A;  3BUA A;  4O1O A;  3I5P A;  3ZFW A;  4PS7 A;  3KSQ A;  3ZYM A;  1D8E A;  3PH0 C;  4G8L A;  4J8Y A;  3PS6 A;  4DRX E;  3PNT B;  3I4R B;  3SFZ A;  3Q4A B;  5JHA A;  2KBX A;  1EF1 C;  2FBN A;  2MOW A;  5CRU A;  1H6P A;  1H2T C;  4M3O A;  5ENO D;  4G1T A;  2OVF A;  4U95 D;  5FIN A;  2OVB A;  3TG4 A;  5KJN A;  1NA3 A;  2NXP A;  1KT0 A;  3U9W A;  4OVU A;  2J49 A;  3ZYK A;  1DVP A;  3ABL E;  3FDH A;  4UWF A;  2VTB A;  4HRM B;  3PZ3 A;  1OWM A;  3VLF A;  3KSL A;  2A4Z A;  3MA5 A;  3J5P A;  4WNG A;  1E8Y A;  4ME2 A;  4BX8 A;  3MV2 B;  5CBO A;  3AG2 E;  3G2V A;  5H7P A;  1BPO A;  1OCR E;  2VJ8 A;  2EIN E;  3D9J A;  4K5B A;  4EPZ A;  1N4Q A;  2EQX A;  2RKK A;  3LY8 A;  4GA1 A;  4BET A;  2RFM A;  4AY5 A;  5ENR D;  3TG5 A;  1A5E A;  1HG5 A;  1D8D A;  1LD8 A;  1KZP A;  5FQ7 A;  4CGV A;  3LS8 A;  3VTX A;  3EHR A;  3G2W A;  4GA2 A;  2LXL A;  1E7U A;  4RLY A;  3FU0 A;  4LRZ A;  5EKQ D;  3LKU A;  3NZU A;  2HM8 A;  3PRE A;  4H7X A;  5G04 J;  3NOG D;  1OCC E;  2DCP A;  4JXT A;  4YVQ C;  2F37 A;  2WXR A;  5FQ4 A;  2QC9 A;  3B7U X;  3FUL A;  2CFZ A;  2XPY A;  1W3B A;  5FQ8 A;  1U3C A;  3D9L A;  2WMN A;  3FU6 A;  2ZGD A;  5CMW A;  2H6F A;  4HRL A;  1QZ2 A;  5AYW D;  3OXG A;  4GTV A;  4UWL A;  5JJ6 A;  5KNH D;  3QOU A;  4FUL A;  4B0Z A;  4KBQ A;  1YA0 A;  2VGX A;  3FUN A;  3Q73 A;  4AIF A;  4L7T A;  2ZXW E;  4FLB A;  4ANX A;  3HRA A;  4N3C A;  3R9M A;  1E8W A;  2GRM A;  2V4L A;  4AJW A;  2E0I A;  3EIQ C;  5DIZ A;  2I9C A;  4GPK A;  2ZU6 B;  4JVS A;  3CSF A;  2A5E A;  3EU9 A;  1ELR A;  3LDZ A;  5E76 A;  3T5X A;  4BX9 A;  4CGW A;  4CZ2 D;  3FUF A;  3FEX A;  3VLE A;  4URK A;  3ZW3 A;  4DX2 A;  3D9N A;  5KWD A;  2XEE A;  4WND A;  3TWS A;  5LX8 A;  5BNW A;  3D9I A;  4WWN A;  2EIK E;  4G25 A;  1JCS A;  4DK5 A;  1S0P A;  1HO8 A;  3ASD A;  3PRZ A;  3FWV A;  4J8E A;  2Y69 E;  2XZD G;  1K1A A;  2QZA A;  2VSO E;  4ACK A;  3E30 A;  4Y6C A;  4G24 A;  3NQP A;  4GYY A;  2WXM A;  3KEA A;  1D9S A;  2PQN A;  4HLE A;  4GCN A;  3ESK A;  5ANL A;  2WXK A;  3U3W A;  5HS0 A;  3D9K A;  5AN8 A;  5KJM A;  3L6A A;  2FF4 A;  5LCW J;  1Y6I A;  3HYM B;  2CHX A;  4CYM D;  4UWK A;  1ZU2 A;  4XZ4 A;  1HF8 A;  4EBA A;  3DEP A;  4L2L A;  3MKQ B;  3UIP C;  3V30 A;  2IO2 C;  3X2Q E;  4ILI A;  4ATG A;  3TXN A;  2X6F A;  2AJA A;  3LYA A;  1YMP A;  4EEC A;  5JJT A;  3WG7 E;  4TUM A;  4LER A;  3TWU A;  4AM9 A;  1HS6 A;  3MV3 B;  1MHQ A;  2YQ8 A;  4HXI A;  4KYO B;  3LJN A;  1DCQ A;  1IHG A;  2Y1L E;  3PNL B;  4FLH A;  5LOZ A;  3PEU B;  4N5C A;  2LAI A;  3TL5 A;  3HXD A;  3ZNG A;  2KAT A;  2AXU A;  5FZS A;  2FUL A;  3SHF A;  2P2C P;  4L23 A;  4Z68 A;  5EX0 A;  4BT8 A;  3O4Z A;  3CLJ A;  2XEN A;  5A23 A;  1HZ4 A;  2HYZ A;  3HVE B;  1FVF A;  2GGF A;  4CDM A;  2A5U A;  3ASN E;  3S2A A;  5EN5 D;  3LCA A;  2Y3A A;  1JPL A;  5T4Y A;  3JXJ A;  1NZN A;  3NZS A;  4X8Q A;  2GRR B;  4GZ6 A;  5ARG A;  3Q47 B;  3OTN A;  2X6J A;  3L08 A;  4K03 A;  3IKO B;  4NQ0 A;  3E33 A;  2IY0 C;  3CVW A;  1Z3Y A;  4P29 A;  3N71 A;  3FH5 A;  2I6H A;  3AG4 E;  1NI1 A;  4FHJ A;  5CER B;  3E37 A;  3UIO C;  4YND A;  1MQS A;  3CVY A;  3SZ7 A;  2V8S E;  4J8F A;  4HVB A;  3UM1 A;  4R7L A;  4GZ3 A;  4GMR A;  3C98 A;  4I1M A;  5EID A;  2KM4 A;  3DSV A;  3HDX A;  4KVO A;  1WDY A;  5D2M C;  3PEV B;  3U66 A;  4GAA A;  3LVR E;  5ITZ F;  3R7R A;  1HXI A;  4GTQ A;  3ML9 A;  3K9I A;  1N4S A;  2VGE A;  2XGS A;  3RRU A;  2IU1 A;  3CIA A;  5G04 C;  3RRN B;  4I6J A;  3R9A B;  2LSU A;  2GRN B;  4XI0 A;  4ZHB A;  2J8S D;  4NAC A;  4EZK A;  2L0I A;  3PUJ A;  3S7J A;  1SW6 A;  2HE0 A;  1XNF A;  5D66 A;  3FH8 A;  3PE3 A;  1Z6T A;  2OND A;  4E6H A;  3P2B A;  5FWQ A;  4W9R A;  2WQH A;  4HOU A;  4XKB A;  3EDT B;  1TNY A;  4U0U A;  2XEH A;  4EZL A;  3G2S A;  1TYQ G;  1BI7 B;  1MJ0 A;  1DNP A;  2F8Y A;  1E7V A;  3ONL A;  1JWG A;  3CR3 A;  4B93 B;  2P9S G;  4BY6 A;  5JA4 D;  4KT6 B;  3FFL A;  3CGH A;  3AS8 A;  2BKG A;  4OAV B;  1FCH A;  3HIZ A;  1HX8 A;  2GRP B;  3FU3 A;  3AAA C;  4KZC A;  1MYO A;  4TV3 A;  5FIO A;  5BW8 C;  2IEJ A;  3Q5M A;  4K0R A;  1V55 E;  1WG0 A;  4UQY A;  4C0E A;  4M7C A;  1ELK A;  2YHE A;  1WM5 A;  3FTY A;  5E75 A;  2XZT G;  3SFX A;  3TGO A;  1BU9 A;  1IQU A;  3NBN B;  4CEM A;  3RO3 A;  2X38 A;  3SQV A;  1TNZ A;  1H6O A;  3CVL A;  3ZXS A;  3E34 A;  3CVV A;  5AIJ A;  1DC2 A;  1JUQ A;  2ETA A;  2XPZ A;  2BTD A;  4JHJ A;  1H6K A;  2V5Q C;  1H2V C;  3ZYQ A;  4U96 D;  1N95 A;  4DLQ A;  3T5V A;  3EUV A;  4MLP A;  3HVE A;  2QY7 A;  4C48 B;  4U04 A;  1FVH A;  3CEQ A;  2WXQ A;  3MX3 A;  4LSZ E;  4B89 A;  1NP7 A;  5EIL A;  1U3D A;  4Q69 A;  1IYG A;  3Q7A A;  3MZL B;  3D9O A;  4IN3 B;  2WXP A;  3EIJ A;  2WMO A;  2WPV A;  3D9M A;  3CVP A;  4O1P A;  4ANU A;  4F1P A;  4JHR A;  1LD7 A;  2QFC A;  4CDR A;  1OWO A;  3FUH A;  4AY6 A;  1UJK A;  3B95 A;  2P9L G;  1NL4 A;  4N39 A;  5LFA A;  4K5C A;  2P9N G;  3W9F A;  3APD A;  2WVI A;  3QC1 A;  2X3M A;  3V79 K;  4BT9 A;  3DSU A;  2WXF A;  3URZ A;  3JXI A;  3SBS A;  5ENP D;  4K5A B;  1IHB A;  2ILR A;  3JQ1 A;  1A17 A;  3HXC A;  1HH8 A;  5CHE E;  4BEP A;  4YDW A;  3ZRH A;  2MYO A;  3FTS A;  4A3T A;  4XE0 A;  2PNN A;  2J4D A;  4MBG A;  5ENS D;  3UPV A;  3CHS A;  4U0S A;  1S64 A;  4BWR A;  2P9P G;  3LEW A;  3PZ4 A;  3LJ3 A;  2IOL A;  4HOS A;  4QFV A;  4GZC A;  5AQ9 A;  4WAF A;  1QYM A;  3TXM A;  2XS1 A;  3UTM A;  3BU8 A;  5DBK A;  3EU5 A;  3QB2 A;  4BTA A;  4I6E A;  2P9K G;  3LY9 A;  1JWF A;  3U4T A;  3HG0 D;  4F53 A;  2R03 A;  3FEY A;  4Q94 A;  4DX5 D;  4DUI A;  3QJZ A;  5FQ6 A;  1SA5 A;  1HE8 A;  4WNE A;  4G2V A;  3FHE A;  3MCX A;  4J0U A;  3JYS A;  4JA7 A;  4HOR A;  4G26 A;  3AG1 E;  3FU5 A;  4C0M A;  5J08 A;  4LCT A;  5KJK A;  1TNB A;  3F6Q A;  2AWI A;  4H7Y A;  2DIW A;  2Y4T A;  3W9G A;  2VGX B;  2VSY A;  4GTS A;  2FO7 A;  1O1R A;  4TXP A;  4N5Q A;  3UXG A;  1HU3 A;  4ILH B;  3C3Q A;  4RG9 A;  2I1J A;  2XRZ A;  1ZBP A;  1OWP A;  4RSY A;  3CQG B;  3SFY A;  2WB2 A;  4PS8 A;  2IOS A;  2C2L A;  3MKR A;  1E96 B;  3CVX A;  4CRW A;  1RZ4 A;  2EIJ E;  3NF1 A;  3ULE G;  4JW1 A;  2J07 A;  5JJ7 A;  3GZS A;  3Q79 A;  4KMO A;  3IXE A;  1N0R A;  2V4H C;  3UI2 A;  2NC9 A;  2CG3 A;  4HBD A;  3FY4 A;  3DPY A;  2X6K A;  4HNA D;  1TJF A;  3CQC B;  3UKU G;  1TR4 A;  3FH7 A;  4I43 A;  5HQ8 A;  1H0A A;  2P58 C;  3UX4 A;  1X81 A;  3UQ3 A;  3UIN C;  3IEG A;  2F0Y A;  4GTP A;  2H6I A;  2X6H A;  1N4R A;  3ML8 A;  4A3V A;  5ENQ D;  3HXE A;  2QYJ A;  4JL0 A;  3QKY A;  4HOQ A;  1FT2 A;  3UM2 A;  4EQF A;  3V2X A;  1V54 E;  3GZ2 A;  3MKQ A;  1MX6 A;  5BT1 A;  1ELW A;  3BEE A;  3ULQ A;  3CV0 A;  3HHM A;  5FTP A;  5EIB E;  2DWZ A;  5CED B;  1N11 A;  1VDY A;  3CHP A;  1Z3X A;  2CFU A;  3OXF A;  4FHK A;  3FUI A;  4V3I A;  3B7R L;  2KC7 A;  1MX4 A;  4N3B A;  1OCZ E;  3JUE A;  3CVU A;  4GTT A;  3ZHE A;  2WXH A;  3DEO A;  4EZJ A;  2BUG A;  3MGB A;  4MS6 A;  4GMJ A;  1UN8 A;  3CK7 A;  2PL2 A;  2VQ2 A;  2M63 A;  2OEV A;  3D9P A;  3DPD A;  2FO1 E;  4UQZ A;  4DX1 A;  3OAW A;  2I1K A;  3TWQ A;  3Q49 B;  3ABM E;  2LNI A;  5AAR A;  2AW6 A;  3CVQ A;  3FUK A;  3TWT A;  3ESL A;  3G2U A;  3EJN A;  3B7T A;  2EIM E;  3C5R A;  4ATZ D;  2DZN A;  5CCM A;  4JB8 P;  2Y0B G;  4FJZ A;  4HRN A;  5LP0 A;  1EPU A;  4DLO A;  3TWX A;  3DST A;  2OCC E;  2IO3 C;  2LXM A;  4KXK B;  3BG0 B;  3U64 A;  1GW6 A;  3UM3 A;  5CRV A;  1UJJ A;  3UMV A;  5BXO A;  4A55 A;  4ACL A;  3V31 A;  3BG1 B;  1O5M A;  1N9A A;  3FTZ A;  5ANR A;  4JEU A;  4F3V A;  5LCW C;  1RW2 A;  2LAH A;  4OVV A;  5EYL A;  4UI9 K;  4LUN U;  2KZT B;  3SO8 A;  3CK9 A;  1SZA A;  4B94 A;  1Q2Z A;  5AJL A;  4L2Y A;  2WQ6 A;  2R59 A;  4OYS A;  4CT4 A;  3PUK A;  2ETB A;  1H2U A;  2ETC A;  4IRU A;  3PZD A;  4IYP A;  3SY2 A;  2UWJ G;  3CKC A;  1DCE A;  2KXP C;  4GA0 A;  1E8X A;  3C3O A;  3C3R A;  3CST A;  1TEZ A;  4TXQ A;  4J7W A;  4AEZ C;  2YHC A;  3J5Q B;  4XX5 A;  1U2V G;  3C72 A;  3EHM A;  1YYH A;  2ZIR A;  4ABN A;  3ZHE B;  3IV0 A;  5G2N A;  3CHQ A;  5ENT D;  2Q7F A;  1O1S A;  3TWW A;  5CBN A;  2L0T B;  2IFU A;  2DVW A;  3ZPJ A;  4CT0 A;  4AOF A;  3B7S A;  4C9B B;  2J4B A;  4GZD A;  3CHR A;  2VSX E;  2V5F A;  3KD7 A;  3RU0 A;  3ULY A;  4BTB A;  3IHV A;  2J9Q A;  3TWR A;  1UN9 A;  3ZEF A;  1SA4 A;  4AV7 A;  3L9T A;  3QAR A;  3QWP A;  3TWV A;  4JA9 A;  1IQR A;  3AU5 A;  3FP3 A;  1IXV A;  3NB2 A;  5IY5 E;  5BUZ A;  3MYV A;  4XI9 A;  2VTB B;  2CG2 A;  3E32 A;  2XHE A;  2FI7 A;  5B1B E;  5CEC B;  2GRQ B;  2IF4 A;  3RO2 A;  4TRQ A;  1TNO A;  2IQC A;  3Q78 A;  3QWW A;  5KCM A;  3MEK A;  3LPZ A;  4EBA G;  2DBA A;  4D10 C;  1FPP A;  4JEH A;  3QNK A;  4CCA A;  4YDE A;  3AS5 A;  4HLL A;  3SNX A;  2DYR E;  2UY1 B;  3UT7 A;  4KZ0 A;  2R5S A;  1HG2 A;  3T8M A;  3S7F A;  5BV1 A;  3KS2 A;  5A6C A;  1JCR A;  4ILG A;  4IUL A;  2ZIS A;  3B7B A;  2KCK A;  3JQ0 A;  1G3N B;  2AVP A;  1XGW A;  3UT4 A;  4HI9 A;  4DPR A;  1BLX B;  2RD0 A;  4YVO A;  4F6R D;  3CHM A;  4N2S A;  1K8K G;  3DSX A;  3I4G A;  3DWL G;  3Q9N C;  1X5B A;  5FT9 A;  3CHO A;  1O1T A;  3PE4 A;  2BF0 X;  1TJC A;  3P1U A;  4L9P A;  5C1D A;  3G2T A;  4FA6 A;  1K3Z D;  1MX2 A;  1N94 A;  4PDX A;  1BI8 B;  2MRI A;  4FJY A;  5J90 A;  1B89 A;  3KEZ A;  1INZ A;  3FTX A;  4OAU C;  2PQR A;  3SGH A;  1OWN A;  1KLX A;  1OWL A;  5T8I A;  5B3S E;  1BD8 A;  2V0P A;  1IKN D;  4UWH A;  3ASG A;  5A7D B;  2DZO A;  2B6C A;  1OCO E;  2P9I G;  3DSS A;  2PM7 A;  3QWV A;  1E90 A;  2VGY A;  3PZ2 A;  4NUR A;  2OV8 A;  2WXG A;  4G23 A;  2IJG X;  2WQ7 A;  4I9C A;  2XCC A;  2ION A;  1H19 A;  3EHN A;  3R7Q A;  4DX6 D;  4WUY A;  4GZ5 A;  3AG3 E;  2LSV A;  2L9B A;  5BV0 A;  5AQA A;  1WAO 1;  3L16 A;  4GB9 A;  3QAQ A;  4J8S A;  2HR2 A;  4LG6 A;  5B1A E;  3FUE A;  3RKV A;  4BSZ B;  5KJL A;  3RRM B;  2VSN A;  4FC8 A;  4DJA A;  4FAD A;  3Q7F A;  3Q15 A;  3JCK C;  5ENN A;  3T9K A;  5M72 A;  4U07 A;  2R2L A;  5FZR A;  1Y8M A;  2FEZ A;  1PAQ A;  1PC2 A;  3ZUV B;  4ANW A;  4U8V D;  3APC A;  4LNB A;  2BED A;  4UI9 J;  3ISM C;  3V2O A;  3RAU A;  3O48 A;  4PH4 B;  2PM6 A;  5JMN D;  4XEI G;  2R02 A;  3QDN A;  4RG6 A;  2DYS E;  3HXF A;  3ZGQ A;  3SI5 A;  2GW1 A;  1WY6 A;  2L6J A;  2GRO B;  3ONK A;  3FUJ A;  4LNG A;  4Q96 A;  5ARF A;  3ZKJ A;  3L54 A;  5FJY A;  3TAX A;  3FUM A;  1FT1 A;  2OOE A;  4AVX A;  2XRY A;  1QQE A;  4I9E A;  4CDN A;  4NRH B;  4L1B A;  2NSZ A;  2BKK B;  2RG8 A;  3JUI A;  3RIB A;  4PUC A;  1Z5S C;  3EHQ A;  1MZC A;  2XQ0 A;  2XGO A;  4E85 A;  2R05 A;  3LY7 A;  2XGM A;  1EDU A;  5AEN A;  3QK0 A;  4MRU A;  3SBT B;  4AXH A;  2HO1 A;  3ENE A;  1UG3 A;  3UT8 A;  4MKT A;  4GYW A;  3DXM G;  1YCS B;  4U8H A;  1OY3 D;  5AQ7 A;  1KPS B;  5CEA A;  1OT8 A;  4TXR A;  4WNF A;  1KT1 A;  5EYP F; 
#chains in the Genus database with same CATH homology
 4I17 A;  1E7U A;  4KXK B;  3BG0 B;  3U64 A;  1GW6 A;  1UJJ A;  3UMV A;  5FZQ A;  4UQY A;  4A55 A;  4C0E A;  3FU0 A;  4LRZ A;  5EKQ D;  3BG1 B;  1ELK A;  3LKU A;  3NZU A;  4ACL A;  2YHE A;  1WM5 A;  3FTY A;  5E75 A;  2HM8 A;  3PRE A;  3FTZ A;  4H7X A;  4JPS A;  5G04 J;  5ANR A;  4JEU A;  4F3V A;  2DCP A;  2J08 A;  4JXT A;  4YVQ C;  4GML A;  2WXR A;  5FQ4 A;  3TGO A;  1IQU A;  3ZIM A;  3B7U X;  3FUL A;  5LCW C;  2CFZ A;  2XPY A;  1W3B A;  5FQ8 A;  4CEM A;  1U3C A;  3D9L A;  2KZT A;  3RO3 A;  2LAH A;  2X38 A;  4OVV A;  2WMN A;  3FU6 A;  2MHK A;  4UI9 K;  3CVL A;  4LUN U;  2KZT B;  5CMY A;  5CMW A;  3CK9 A;  3ZXS A;  3IHY A;  1SZA A;  4B94 A;  3RK6 A;  4UWG A;  5AJL A;  1QZ2 A;  5AYW D;  3CVV A;  3OXG A;  4HS2 A;  1JUQ A;  5AIJ A;  4L2Y A;  4KVM A;  3L17 A;  2WXO A;  4UWL A;  2XPZ A;  5JJ6 A;  2WQ6 A;  2BTD A;  2R59 A;  4OYS A;  3RJV A;  3ASH A;  2YIN A;  4JHJ A;  1H6K A;  3QOU A;  4CT4 A;  3PUK A;  4FUL A;  4B0Z A;  1H2U A;  4KBQ A;  1H2V C;  2X6I A;  1YA0 A;  3ZYQ A;  2VGX A;  3FUN A;  4O6F A;  4DLQ A;  3T5V A;  4AIF A;  2KCV A;  4IRU A;  4L7T A;  3HVE A;  3PZD A;  4IYP A;  4MLP A;  1OUV A;  2QY7 A;  2UWJ G;  3MJW A;  3CKC A;  4WWO A;  4U04 A;  1FVH A;  3CEQ A;  2WXQ A;  2WXN A;  4FLB A;  3MX3 A;  4ANX A;  2J09 A;  2XCB A;  4B89 A;  4GA0 A;  1E8X A;  1HFA A;  4N3C A;  1NP7 A;  1U3D A;  3CST A;  3FUD A;  1E8W A;  1TEZ A;  4G11 A;  4JZY A;  1E8Z A;  3IBE A;  4Q69 A;  1IYG A;  2GRM A;  2V4L A;  3MZL B;  4AEZ C;  3D9O A;  4IN3 B;  2YHC A;  2WXP A;  4DI4 A;  3PDN A;  4AJW A;  3EIJ A;  2WXJ A;  2E0I A;  2WMO A;  3EIQ C;  3EHM A;  2WPV A;  3D9M A;  4XX5 A;  3CVP A;  5DIZ A;  2I9C A;  2KCL A;  4HFG A;  4ANU A;  4JHR A;  3FTU A;  4GPK A;  2ZU6 B;  4ABN A;  2QFC A;  4FP7 A;  3ZHE B;  4CDR A;  1OWO A;  3FUH A;  3PVL A;  4JVS A;  4AY6 A;  3IV0 A;  1UJK A;  5G2N A;  3CHQ A;  2I2O A;  3CSF A;  4A1G A;  4N2Q A;  1ELR A;  3DBS A;  2Q7F A;  4XIF A;  5BPP A;  3CVN A;  1NA0 A;  3LDZ A;  4N39 A;  5E76 A;  3T5X A;  4J8D A;  4B8A A;  5LFA A;  4AP2 A;  2L0T B;  2IFU A;  3APD A;  3ZPJ A;  4BX9 A;  4AOF A;  4CT0 A;  4CGW A;  3FUF A;  5AJD A;  3B7S A;  3TJP A;  4C9B B;  3FEX A;  2WVI A;  3QC1 A;  2X3M A;  1SZ9 A;  2J4B A;  3S7B A;  4BT9 A;  1PY1 A;  4GZD A;  3VLE A;  3CHR A;  2WXF A;  2AXZ A;  3URZ A;  4URK A;  2VSX E;  2V5F A;  3ZW3 A;  3SBS A;  5EDS A;  3KD7 A;  4J6I A;  3RU0 A;  4BTB A;  3D9N A;  3IHV A;  2ILR A;  2J9Q A;  3APF A;  3JQ1 A;  1A17 A;  1HH8 A;  3ASF A;  4WND A;  5CHE E;  2C0M A;  5LX8 A;  5BNW A;  5C2Y A;  3ZRH A;  1L5J A;  1UN9 A;  2LO6 A;  3D9I A;  4WWN A;  4G25 A;  3ZEF A;  4DK5 A;  3GYZ A;  3FTS A;  4AV7 A;  3QAR A;  1S0P A;  1HO8 A;  3ASD A;  4GU5 A;  3QWP A;  4A3T A;  3UUX A;  4XE0 A;  1LF8 A;  2J4D A;  3PRZ A;  4JA9 A;  3FWV A;  1IQR A;  4JC8 A;  3AU5 A;  4J8E A;  3FP3 A;  4JHK A;  3CHS A;  3UPV A;  3LVQ E;  4U0S A;  5BUZ A;  3MYV A;  4XI9 A;  4ACK A;  2VSO E;  2VTB B;  4BWR A;  2WXI A;  4Y6C A;  4G24 A;  3NQP A;  4GYY A;  4DI3 A;  2CG2 A;  2WXM A;  4LEU A;  4U0Z A;  3LEW A;  2XHE A;  2FI7 A;  2PQN A;  3LJ3 A;  2IOL A;  4HOS A;  2C0L A;  4QFV A;  2IF4 A;  4HLE A;  4GCN A;  3ESK A;  3AU4 A;  5ANL A;  4N3A A;  2WXK A;  3U3W A;  4GZC A;  4TRQ A;  4FU3 A;  3RO2 A;  2IQC A;  4B8C B;  4WAF A;  4I2Z A;  3QWW A;  3AS4 A;  3D9K A;  5KCM A;  4RVB A;  1SQM A;  3MEK A;  3L6A A;  3TXM A;  2FF4 A;  5KJM A;  3LPZ A;  4EBA G;  2WXL A;  2DBA A;  5LCW J;  4D10 C;  2E2E A;  1Y6I A;  5G55 A;  4XKC A;  2Y4U A;  4JEH A;  3QNK A;  5DBK A;  3HYM B;  4CCA A;  4F1S A;  2CHX A;  3AS5 A;  3E4B A;  3QB2 A;  3FTV A;  4UWK A;  5G05 J;  5HI7 A;  3SNX A;  4BTA A;  4I6E A;  1ZU2 A;  2UY1 B;  4GCO A;  3UT7 A;  3LY9 A;  4KZ0 A;  3ZVV A;  4XZ4 A;  1JWF A;  4A1S A;  2R5S A;  3U4T A;  1HG2 A;  3L13 A;  3T8M A;  1P5Q A;  3S7F A;  5BV1 A;  5G05 C;  3KS2 A;  5A6C A;  4I1O B;  4F53 A;  1HF8 A;  4EBA A;  3FEY A;  4Q94 A;  3L22 A;  4ILG A;  3SF4 A;  3QJZ A;  5D0O D;  3I3N A;  4IUL A;  4BFR A;  2JEK A;  4L2L A;  5FQ6 A;  4UQX A;  2XEV A;  1HE8 A;  4WNE A;  2VYI A;  3MKQ B;  2KCK A;  3JQ0 A;  2AVP A;  4G2V A;  1XGW A;  3FHE A;  4ATG A;  4ILI A;  2AXV A;  3OXL A;  3TXN A;  3UT4 A;  2X6F A;  3MCX A;  4J0U A;  3JYS A;  4JA7 A;  3LYA A;  4HOR A;  4DPR A;  2RD0 A;  4G26 A;  4EEC A;  4YVO A;  4U63 A;  1N54 A;  3FTW A;  5JJT A;  3CHM A;  3FU5 A;  4LER A;  4N2S A;  4C0M A;  5J08 A;  4LCT A;  4AM9 A;  5KJK A;  1HS6 A;  3MV3 B;  3CKB A;  2CHW A;  1MHQ A;  3I4G A;  3GZ1 A;  2YQ8 A;  4HXI A;  4KYO B;  2AWI A;  4H7Y A;  1X5B A;  2DIW A;  5FT9 A;  3CHO A;  2Y4T A;  1IHG A;  3PE4 A;  2BF0 X;  2VGX B;  2VSY A;  3PNL B;  1TJC A;  5T3R A;  4FLH A;  2FO7 A;  5LOZ A;  3PEU B;  4N5C A;  3D3M A;  3P1U A;  2LAI A;  3TL5 A;  5C1D A;  3G2T A;  4ANV A;  4FA6 A;  1HU3 A;  2KAT A;  4ILH B;  4PDX A;  2AXU A;  4RG9 A;  2I1J A;  2MRI A;  1UW4 B;  5FZS A;  2XRZ A;  2FUL A;  1ZBP A;  4FJY A;  1OWP A;  4RSY A;  5D0Q D;  3SHF A;  2XPI A;  1B89 A;  3CQG B;  5J90 A;  3KEZ A;  4L23 A;  5EX0 A;  4BT8 A;  2WB2 A;  3O4Z A;  2IOS A;  3CLJ A;  4PS8 A;  4UI9 C;  1INZ A;  5A23 A;  1HZ4 A;  2HYZ A;  3FTX A;  1QNF A;  2C2L A;  1FVF A;  2PQR A;  3HVE B;  3B13 A;  3SGH A;  3MKR A;  1E96 B;  2GGF A;  4CDM A;  1OWN A;  4PS3 A;  1KLX A;  3SD5 A;  2A5U A;  4WWP A;  3S2A A;  2CHZ A;  3CVX A;  1OWL A;  3LCA A;  2Y3A A;  3ZN3 A;  1JPL A;  5T8I A;  5T4Y A;  3WXX A;  4CRW A;  1NZN A;  3NZS A;  3NF1 A;  4HOT A;  2V0P A;  2UY1 A;  2J07 A;  4JW1 A;  5JJ7 A;  3GZS A;  4UWH A;  3ASG A;  4KMO A;  5A7D B;  3CK8 A;  3VTY A;  4APF A;  5JHB A;  4GZ6 A;  3ZYL A;  5ARG A;  3Q47 B;  2PM7 A;  3QWV A;  2NC9 A;  4BSX A;  2GRL A;  3OTN A;  5EX3 A;  2X6J A;  2CG3 A;  3L08 A;  4I1A A;  1E90 A;  1EYH A;  2VGY A;  3FY4 A;  3IKO B;  4K03 A;  2OV8 A;  2WXG A;  4G23 A;  4NUR A;  2IJG X;  4NQ0 A;  4I9C A;  2WQ7 A;  3GW4 A;  2XCC A;  2ION A;  2X6K A;  4I2W A;  3VLD A;  1H19 A;  1TJF A;  2WM9 A;  3CVW A;  1Z3Y A;  2JLB A;  3CQC B;  4P29 A;  3N71 A;  3FH5 A;  3FH7 A;  2I6H A;  4I43 A;  4FHJ A;  5HQ8 A;  4I6G A;  4Y6W A;  3EHN A;  5CCL A;  4YND A;  1H0A A;  2P58 C;  3R7Q A;  3UX4 A;  4WUY A;  4GZ5 A;  4APO A;  1MQS A;  3LXU X;  3CVY A;  2LSV A;  2L9B A;  3SZ7 A;  5BV0 A;  1WAO 1;  4GYO A;  3UQ3 A;  3L16 A;  4GB9 A;  2V8S E;  4J8F A;  1N52 A;  4TUU A;  4F7A A;  4HVB A;  3IEG A;  4R7L A;  2YNQ A;  4GZ3 A;  3QAQ A;  3S7D A;  4I1M A;  3C98 A;  2R17 C;  4J8S A;  2HR2 A;  2X6H A;  2PZI A;  3KAE A;  2KM4 A;  3ML8 A;  3HDX A;  4A3V A;  4KVO A;  3FUE A;  3I5P A;  3ZFW A;  4PS7 A;  3PEV B;  3RKV A;  3ZYM A;  3PH0 C;  5KJL A;  4JL0 A;  3QKY A;  2VSN A;  3PS6 A;  4FC8 A;  4HOQ A;  3RRM B;  4GAA A;  3U66 A;  3LVR E;  4EQF A;  4DJA A;  3R7R A;  1HXI A;  3PNT B;  3GZ2 A;  3I4R B;  3MKQ A;  4FAD A;  3SFZ A;  5BT1 A;  3Q4A B;  3Q15 A;  5JHA A;  3ML9 A;  3K9I A;  1ELW A;  3JCK C;  5ENN A;  5M72 A;  4U07 A;  3BEE A;  5FZR A;  1EF1 C;  3ULQ A;  3CV0 A;  2FBN A;  3HHM A;  2MOW A;  1Y8M A;  5FTP A;  2FEZ A;  1PAQ A;  2XGS A;  1PC2 A;  3RRU A;  2IU1 A;  1VDY A;  3CHP A;  4ANW A;  3CIA A;  1Z3X A;  2CFU A;  3APC A;  3OXF A;  4UI9 J;  1H2T C;  3FUI A;  4FHK A;  4M3O A;  5G04 C;  4G1T A;  3O48 A;  4V3I A;  2OVF A;  3RRN B;  4I6J A;  2LSU A;  4PH4 B;  4XI0 A;  2PM6 A;  3B7R L;  3R9A B;  2KC7 A;  4N3B A;  2OVB A;  4NAC A;  2L0I A;  3PUJ A;  3S7J A;  4EZK A;  3CVU A;  3ZHE A;  2WXH A;  3TG4 A;  3QDN A;  4RG6 A;  5KJN A;  1NA3 A;  1XNF A;  4EZJ A;  2BUG A;  2NXP A;  3FH8 A;  1KT0 A;  3MGB A;  3PE3 A;  1Z6T A;  3U9W A;  3ZGQ A;  4OVU A;  3SI5 A;  2GW1 A;  2J49 A;  2OND A;  4MS6 A;  1DVP A;  1WY6 A;  2L6J A;  3ZYK A;  4GMJ A;  1UN8 A;  3ONK A;  3FUJ A;  4Q96 A;  3FDH A;  5ARF A;  3CK7 A;  4E6H A;  4UWF A;  3L54 A;  2PL2 A;  2VTB A;  2VQ2 A;  3P2B A;  2M63 A;  1OWM A;  3D9P A;  3DPD A;  5FJY A;  3VLF A;  5FWQ A;  3TAX A;  4UQZ A;  3OAW A;  2A4Z A;  3FUM A;  2I1K A;  4W9R A;  3MA5 A;  2WQH A;  3Q49 B;  4HOU A;  4XKB A;  4WNG A;  2OOE A;  3EDT B;  4AVX A;  2XRY A;  2LNI A;  1QQE A;  1E8Y A;  4ME2 A;  4BX8 A;  2AW6 A;  3MV2 B;  4I9E A;  4CDN A;  4U0U A;  3CVQ A;  4NRH B;  4L1B A;  2NSZ A;  3FUK A;  2RG8 A;  3G2S A;  3G2V A;  3JUI A;  3RIB A;  4PUC A;  4EZL A;  3ESL A;  1BPO A;  3G2U A;  2XQ0 A;  2VJ8 A;  2XGO A;  3D9J A;  4E85 A;  3EJN A;  3B7T A;  1DNP A;  4EPZ A;  1E7V A;  2EQX A;  3LY8 A;  3LY7 A;  3ONL A;  4GA1 A;  1JWG A;  2XGM A;  1EDU A;  3CR3 A;  5AEN A;  3QK0 A;  4MRU A;  3SBT B;  4AXH A;  2HO1 A;  4BY6 A;  4AY5 A;  3TG5 A;  5CCM A;  4KT6 B;  1HG5 A;  3ENE A;  3FFL A;  1UG3 A;  3UT8 A;  4MKT A;  3CGH A;  4FJZ A;  4GYW A;  3AS8 A;  5FQ7 A;  4U8H A;  5LP0 A;  1FCH A;  4CGV A;  3HIZ A;  1EPU A;  1HX8 A;  4DLO A;  3LS8 A;  3FU3 A;  3VTX A;  4KZC A;  4WNF A;  4TV3 A;  5BW8 C;  3G2W A;  4GA2 A;  3Q5M A;  1KT1 A;  4K0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...