2VGXA

Structure of the yersinia enterocolitica type iii secretion translocator chaperone sycd
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
134
structure length
128
Chain Sequence
GGGTIAMLNEISSDTLEQLYSLAFNQYQSGYEDAHVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIEPRFPFHAAECLLQGELAEAESGLFLAQELIANPEFELSTRVSSMLEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Yersinia Enterocolitica Type III Secretion Chaperone Sycd
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Chaperone
molecule keywords CHAPERONE SYCD
total genus 49
structure length 128
sequence length 134
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vgxA00
4GA2A 2XPIA 5ARGA 5AYWD 3ESKA 4I2ZA 3LKUA 4GPKA 1YA0A 3GW4A 3MKRA 4GYYA 5HQ8A 4UQXA 2C0MA 4BT9A 3ASHA 4BTAA 5KJNA 4WNDA 2NC9A 4H7YA 2R5SA 2WQHA 2XGSA 2KATA 4ME2A 4GYOA 5FJYA 2YHCA 4HOTA 3U4TA 4I2WA 2C2LA 2FF4A 5A6CA 4N2SA 3S7DA 2E2EA 4UI9C 2FO7A 2HR2A 4J8EA 5DBKA 4YVQC 4UQYA 4I17A 3MA5A 4N2QA 2HYZA 1B89A 3BEEA 3LPZA 5G05J 3MV2B 2Y4TA 2L6JA 5JJTA 3CV0A 4N3CA 4AM9A 3ZGQA 4G23A 3QWWA 4APOA 1W3BA 4B94A 4HOQA 2GW1A 1FCHA 3MEKA 4GZ6A 4G1TA 4N3AA 3UPVA 4W9RA 2UY1B 4H7XA 4U0UA 4GCNA 3E4BA 5EKQD 1NZNA 3TAXA 1NA3A 3QWVA 3FFLA 4J8FA 3KD7A 2UWJG 3LY9A 4KXKB 3LY8A 5G04J 3OXFA 5DIZA 3RO2A 3CK7A 3URZA 3QWPA 1ELWA 5C1DA 1ZU2A 3GYZA 3R9AB 4GA1A 4KBQA 3PE4A 4EQFA 2JLBA 3KAEA 4A1SA 3EDTB 3RO3A 5KJMA 4UQZA 3RJVA 3U3WA 3ZPJA 2PZIA 3OXGA 4NRHB 2XCBA 4U07A 3LYAA 2DBAA 2FEZA 2QFCA 5G04C 4J8DA 1TJCA 3KS2A 4U04A 2FBNA 4CDRA 4GZ3A 4BT8A 1HXIA 3CVLA 5LCWC 3CKBA 1IYGA 4XI9A 4CGWA 3LCAA 4AIFA 3PDNA 3PE3A 3CK9A 2VGYA 2MHKA 3N71A 5JJ6A 3TGOA 3SF4A 1HZ4A 4G24A 3VTXA 1XNFA 3S7FA 3ZN3A 4ABNA 5FZQA 3CVQA 3CVNA 4RG9A 2PQRA 2XEVA 2HO1A 1IHGA 2V5FA 4XI0A 5G05C 5BW8C 2LNIA 3QKYA 5CCMA 2LSVA 4Y6WA 5CCLA 4YNDA 5FTPA 3FP3A 5JJ7A 1Y8MA 4UI9J 5KJLA 5KJKA 4UI9K 1ELRA 4U0SA 4I9CA 5D0OD 5M72A 2C0LA 2YQ8A 3CEQA 4HOUA 5FZSA 3CVPA 2IF4A 4G25A 5D0QD 4N39A 4O6FA 3TG5A 4BWRA 4AY6A 4NQ0A 4G26A 2Q7FA 3ZHEA 2KCKA 3JYSA 1KT1A 2VGXA 4RG6A 5EX0A 3ZHEB 4GCOA 3S7BA 5LCWJ 2VQ2A 3QOUA 4JL0A 3CKCA 3AS8A 4JHRA 4JA7A 4XIFA 5EX3A 1KT0A 3TG4A 3VTYA 5BNWA 3RU0A 4HOSA 3QDNA 3RKVA 4WNGA 3Q49B 4G2VA 1A17A 3AS4A 2J9QA 3K9IA 2KC7A 2XCCA 1WAO1 3Q5MA 2BUGA 2OOEA 4LEUA 1OUVA 4WNEA 4CGVA 4YVOA 3S7JA 1HH8A 3ASDA 4I9EA 3FWVA 4GZ5A 3GZ2A 3Q47B 1PC2A 4N3BA 1QQEA 3ZFWA 2ONDA 2VSNA 2PL2A 1P5QA 2UY1A 3MV3B 2VSYA 3HYMB 4WUYA 3ULQA 4N5CA 3Q4AB 1QZ2A 3Q15A 4AY5A 4F3VA 2I6HA 3AS5A 3LY7A 2FI7A 2P58C 3O48A 4WNFA 2XGMA 3GZ1A 2KCVA 4J0UA 5FZRA 5HI7A 2VYIA 2LSUA 3IEGA 5A7DB 1WM5A 4I1AA 4GYWA 2PQNA 4IN3B 3RIBA 4BTBA 2IFUA 2KCLA 2XGOA 4GA0A 5ARFA 4HORA 5BT1A 1E96B 2VGXB 3NF1A 4Y6CA 3UUXA 3UQ3A 3WXXA 5FT9A 1NA0A 3ASFA 4JA9A 3SZ7A 4KYOB 3OXLA 1KLXA 1ZBPA 4U0ZA 2AVPA 2Y4UA 5CHEE 3ASGA 2WPVA 3CK8A
chains in the Genus database with same CATH superfamily
4JEHA 3CVVA 3PZ4A 4FHKA 3TXMA 4GMJA 2XPYA 5FJYA 3DPYA 1OWLA 3G2VA 3CVWA 2WXOA 2WVIA 4F7AA 5JJTA 4DLQA 4O1PA 3D9HA 4G23A 5G2NA 3UM3A 2V4LA 2WXNA 2CHXA 3TAXA 3L22A 2IO3C 4LG6A 3KD7A 3NAWA 4U7EB 4A1SA 3T8KA 4EZJA 4GB9A 1OT8A 3FTSA 5CEAA 1X5BA 1N94A 1IYGA 5KCMA 2F0YA 3HHMA 4F1SA 2GRRB 5G05C 5CCLA 1NFIE 5KJKA 4FHJA 3TWSA 1ELRA 3QB2A 1TEZA 3B7RL 2LXLA 1SQMA 2ETAA 1KT0A 1SZAA 3DXMG 3W9FA 5EDSA 3S7JA 4ANXA 3SFZA 3O4ZA 1YYHA 3UINC 1Z3XA 2DCPA 4RQIA 1N4SA 3HYMB 4F3VA 1N9AA 2LSUA 3W9GA 2IFUA 2XGOA 4GAAA 5EILA 4CEMA 2J49A 1TYQG 4MLPA 2P9NG 4GTRA 5AENA 3TWRA 2KATA 4P29A 4I2WA 1S63A 2FF4A 2OCCE 3TWWA 5EYPF 2DVWA 5AJDA 3MGBA 1UG3A 2GW1A 1DCEA 4KMOA 2GRPB 3G2UA 1TN8A 4GTTA 3I4RB 1U2VG 4YDWA 2BKGA 4OYSA 2WXQA 5CBNA 2Y0BG 4BEPA 4XKCA 1H2UA 1XNFA 3EHNA 1MX6A 3ZHEB 3CVNA 3ZKJA 3PUKA 2I1JA 4J6IA 4UI9K 5ENPD 5M72A 2YQ8A 5FZSA 4BETA 2ETBA 4FP7A 4I6GA 2VGXA 3C3OA 3CKCA 5EN5D 1N52A 1S70B 4G2VA 1A17A 3K9IA 3PNTB 2OVFA 4FULA 2ZXWE 3WG7E 3LDZA 1TJFA 3P2BA 3D9MA 3O48A 2MOWA 3FEYA 5A7DB 3L54A 4UWGA 4Y6CA 2WQ7A 3ZRHA 3UQ3A 3B13A 1ZBPA 3B7BA 1E8WA 4HLEA 3D9NA 4BT9A 4BTAA 3TWXA 4GYOA 3EUVA 3U4TA 2M63A 4Q94A 1TNBA 3DWLG 3DRAA 4UWLA 4KZCA 4GTPA 3QK0A 2ZGGA 4GZ6A 1FCHA 2DZOA 3L6AA 3PVLA 3LY9A 2OVBA 1N54A 2GROB 4KZ0A 3UTMA 3KAEA 4WWOA 3PZ1A 1KZPA 3AU5A 1OCZE 5JJ6A 3CSFA 4JHJA 3CVQA 2XEVA 3AG4E 3L08A 3EJNA 4JB8P 5CCMA 4YNDA 2WMNA 5ENOD 3HXBA 2IO2C 2ILRA 3LS8A 1HS6A 2J8SD 3AG2E 3CVPA 2GRQB 1RZ4A 3FUNA 5BPPA 5EX0A 2ZGDA 3FUIA 4G8LA 3QDNA 5FQ4A 2XCCA 4LEUA 4YVOA 3ASDA 3SFYA 2FULA 1JCRA 1QNFA 4EZKA 2EINE 3CHSA 1KPSB 1ELKA 5ITZF 3FHEA 4HFGA 1MZCA 1H6OA 1YCSB 1O1SA 2Y4UA 3UM0A 3D3MA 4OVVA 2A5UA 4H7YA 2XGSA 4ME2A 4ACLA 2VTBB 3IXEA 4J8EA 4LUNU 3FUDA 1IKND 2X38A 2R2LA 1INZA 4NIKA 5CMWA 3D9PA 3Q9UC 4N3AA 4B93B 4A3TA 1NA3A 1HE8A 3OTNA 1OCCE 2UWJG 5G04J 3URZA 4AP2A 2JLBA 4X8QA 4NRHB 2QYJA 4U07A 2FBNA 1EF1C 4U95D 2VGYA 4F1PA 3SF4A 1TN6A 4TV3A 1QYMA 4AJWA 4ABNA 3ZW3A 4Y6WA 5J08A 4IYPA 2C0LA 2WXMA 5CRUA 2Q7FA 4RG6A 2MRIA 1PAQA 4JL0A 4KT6B 1HG5A 4WNGA 4AXHA 3HVEB 1HX8A 2F8XK 2WXRA 3CHMA 2DYSE 3F6QA 3ISMC 4CCAA 2VYIA 3T8MA 3L16A 4MBGA 3E30A 2AJAA 2VGXB 2CG3A 3WXXA 4JA9A 2RD0A 5CHEE 3SO8A 1UJJA 1S64A 4YDYA 3GW4A 2KBXA 1HG2A 2C0MA 3AG1E 2IOLA 4UWHA 4WNDA 3UT8A 2C2LA 3E32A 4PS3A 3MA5A 1WDYA 2KZTA 4XZ4A 4GTSA 3RK6A 2E0IA 1U3DA 2UY1B 5AQ9A 5EKQD 2L0TB 4LERA 3Q7AA 3FU6A 1ZU2A 2FO1E 2F37A 2OV8A 3EDTB 2P9PG 2WXFA 2I1KA 4ANVA 5FQ6A 2I9CA 4XI9A 2WXKA 2NYJA 4ACKA 2YNQA 5FZQA 3QKYA 4EZLA 4I9CA 1V54E 3CEQA 4HOUA 3APFA 4G26A 2P9KG 4DUIA 4HBDA 3TG4A 5AQBA 4PUCA 1Q2ZA 3D9LA 4PS8A 1A5EA 3IBEA 1JWGA 3ZFWA 3IHYA 1IXVA 4N5CA 3Q15A 2I6HA 1QBQA 2P58C 3T5XA 3HXEA 2V4HC 4DJAA 4IN3B 3HXFA 5FQ7A 5T8IA 3ASFA 4CYMD 5J90A 1UOHA 3ESKA 3CQCB 3ASOE 2AXVA 4K5BA 1BU9A 1DCQA 3S7DA 1TR4A 4YDOA 4ILHB 4K5CA 1E7UA 3QJZA 2QC9A 3CVYA 1ZB1A 4HOQA 5E76A 3D9JA 4NURA 3EIJA 5BUZA 3LY8A 2BEDA 3C5RA 3QWPA 1H6PA 4DI3A 2GRNB 3RJVA 5BV1A 2PZIA 1BPOA 2FEZA 2QFCA 1OWNA 4ILIA 4KVMA 3L13A 4LRZA 3N71A 1HZ4A 4G24A 4PDXA 5IY5E 5BW8C 2LNIA 4Q96A 4U63A 5JJ7A 4I1MA 4U0SA 3DSSA 3UT7A 2GGFA 2B0OE 2IU1A 5EX3A 3UIOC 4RLYA 4FJYA 5ENNA 3FTXA 1P5QA 4EBAG 4GTOA 3NZSA 1VDYA 2FI7A 5HQ8A 5HI7A 2VSXE 4HORA 3SZ7A 2L9BA 1WY6A 2AVPA 2WXPA 1E8ZA 2XPIA 5ARGA 3LKUA 4GPKA 4UQXA 1LF8A 5G55A 3DBSA 3TXNA 5BXOA 4AV7A 3S2AA 2XEHA 2A5EA 1UJKA 2P2CP 2ZIRA 3VLDA 3SHFA 3DEOA 3RRUA 5AQ7A 4YVQC 4C0MA 4GTVA 2BTDA 3ONKA 1LD8A 4AM9A 3HRAA 4HXIA 3CVXA 2IY0C 3FU0A 3J5QB 4J8SA 1NZNA 1BD8A 2X6IA 2R05A 1N11A 4MKTA 4GMRA 4GTQA 4EHMA 1MQSA 3I5PA 5LCWC 2MYOA 2IQCA 4CGWA 3CK9A 3TGOA 3C3RA 4O1OA 3R7RA 3ULEG 3QC1A 2LSVA 4M7CA 4D10C 4G25A 4TXPA 3TG5A 3CHPA 1JUQA 4NQ0A 5LCWJ 4DI4A 4OVUA 5KWDA 4HOSA 1IHBA 3UT4A 1RW2A 2VGEA 5D2MC 1K3ZD 4CGVA 2CFUA 2Y1LE 3Q47B 2PL2A 3MV3B 2VSYA 1SA4A 3UXGA 3VLFA 4WNFA 2XZTG 3BG0B 2PNNA 1KLXA 4A55A 4JHKA 2EILE 4WWNA 5DBKA 4UQYA 3CIAA 2HYZA 3MKQA 3BEEA 4E85A 2LUHA 3CV0A 4JVSA 4ANWA 3MEKA 3UPVA 4U0UA 3PS6A 3PEVB 4LNUD 4L2LA 2WXGA 3CR3A 4IULA 1NL4A 3BG1B 3JUIA 3FH7A 3C98A 1EYHA 3QAQA 4CDMA 2X6JA 3HDXA 3CVLA 4A3VA 1SZ9A 2L6BA 3LVQE 4HRMB 2J09A 3UI2A 3FH5A 3ZXPA 5KJLA 4UI9J 5D0OD 2IF4A 4GPMA 4WWPA 2I2OA 5AN8A 3JQ0A 4AY6A 3FUKA 2DIWA 2RG8A 5BNWA 1MX4A 3V2XA 2WB2A 1O5MA 2LO6A 4E6HA 4IRUA 3V2OA 1D8EA 4BY6A 1MJ0A 2XS1A 4XX5A 4F6RD 2ONDA 2UY1A 3ULQA 4AY5A 1N4PA 2X3MA 4CZ2D 1JCSA 3AG3E 2WMOA 3U66A 5AYWD 4I2ZA 3FUHA 1E90A 3UKRG 4EECA 3KSQA 3JQ1A 3FH8A 4ILGA 3CHOA 3FUMA 2Y3AA 1E7VA 3LJNA 2P9SG 3ZGQA 1O1RA 3QWWA 4KVOA 3PREA 3P1UA 3LEWA 2J08A 4GA1A 4KBQA 2CFZA 2GRMA 1WG0A 3TWTA 4QQIA 2P9UG 1XGWA 2LXMA 1K1BA 2DBAA 3OAWA 5EYLA 1H2VC 2R59A 3CKBA 2IOSA 3LCAA 3MCXA 1MX2A 4JD2G 1X81A 4FLBA 4EBAA 3VTXA 1E8YA 3KEZA 4HRLA 3ONLA 4G11A 3ASNE 2EQXA 3CHQA 3G2WA 3NB2A 2F8YA 3DPDA 2XS8A 1TNZA 3L17A 4DLOA 1D9SA 4APFA 2XENA 5BV0A 3RKVA 3CVUA 4OAVB 3FWVA 1PC2A 4J7WA 4JEUA 5BXUA 2IONA 3AS5A 3LY7A 2R17C 1H0AA 3PEUB 1E96B 3NF1A 5CEDB 1JWFA 4CRWA 3I3NA 2R02A 4AEZC 2WPVA 3NBNB 3MZLB 3MKRA 4GYYA 5CMYA 5ANLA 3DSUA 2V0PA 1BI7B 2WQHA 2YHCA 1OCOE 1EPUA 3SGHA 2PM7A 2FO7A 3SNXA 3ZYKA 1N4QA 5G05J 4UWFA 1SVXA 3Q9NC 5EIDA 4GCNA 2RFAA 4RSYA 1O1TA 3CQGB 4XKBA 3GYZA 3PH0C 4LSZE 5KJMA 2KZTB 4CT0A 3HG0D 3EHMA 5ENQD 2QYUA 3ZYMA 5ENSD 4B8AA 4BT8A 3SI5A 4BSZB 1OXJA 3PZDA 4G8KA 2MHKA 2PQRA 1IHGA 4XI0A 3J5PA 3JCKC 1Y8MA 3EHQA 4N39A 4B0ZA 3JYSA 4RVBA 3QOUA 4JA7A 3IKOB 4XIFA 4A1GA 3RRNB 3FUFA 3Q49B 3TL5A 2H6HA 4DK5A 4WNEA 2OOEA 4N3BA 5FWQA 3FTYA 1UN8A 5FINA 2QZAA 3IHVA 4K5AB 3Q78A 3RAUA 2XGMA 4J0UA 3VLEA 4I1AA 5FQ8A 4U8HA 3CHRA 1FT1A 3R9MA 2V8SE 4KYOB 4TUMA 1BLXB 3T9KA 1YA0A 4HB5A 4HOTA 4J8YA 1N0RA 5KNHD 3FTZA 4XEIG 3BUAA 5A6CA 3SFXA 3LPZA 1HU3A 4FA6A 4ZFHA 3U9WA 4N3CA 4APOA 1OY3D 3V30A 3NOCD 3Q73A 5ENRD 3C72A 3QNKA 4CDNA 2B6CA 3OXGA 2GRLA 4JW1A 2Y69E 3LYAA 1EDUA 1H6KA 4GU5A 4C9BB 4DX5D 3DSWA 5AQAA 2XEEA 1E8XA 2V5FA 3R7QA 5FTPA 4JZYA 3FTVA 3QARA 3RSEG 3EHRA 3APDA 2KCKA 2VQ2A 3AS8A 3VTYA 1H19A 5D66A 2WXLA 1K1AA 4DRXE 3Q5MA 3ZYLA 4PS7A 4HRNA 4WUYA 5FIOA 3SD5A 4BTBA 1UN9A 4GA0A 4FLHA 2NXPA 3RRMB 3B7TA 3ZUVB 4K03A 3ULYA 1OWMA 5CBOA 1L5JA 3CSTA 3FY4A 4HVBA 3ASHA 3G2SA 5LOZA 2CHWA 3I4GA 4V3IA 5KNGA 2CG2A 4N2SA 3D9IA 1UW4B 4I17A 4N2QA 4LCTA 4A63B 2Y4TA 2XRZA 2V5QC 1W3BA 3ZYQA 3ENEA 4B94A 2YHEA 1DNPA 4H7XA 3E4BA 2VJ8A 5E75A 5ENTD 4U8VD 3FU3A 3ESLA 1ELWA 3UKUG 5LP0A 2ZU6B 3HVEA 3PE4A 3ZVVA 3RO3A 3DXKG 2DWZA 2YINA 3B7SA 2XCBA 4LNGA 5CRVA 1DVPA 1TJCA 4TXQA 1HXIA 3HXDA 4XE0A 3PDNA 5AARA 4TUUA 2KM4A 4TXRA 3S7FA 4BFRA 1TNOA 4HS2A 2AXUA 3PRZA 3ZHEA 1PY1A 4GCOA 3S7BA 4FADA 1LD7A 4BX9A 2J4BA 3RU0A 5LX8A 2J9QA 3ABKE 3BQOA 1OWPA 4GZ5A 4HLLA 4GTMA 3LXUX 1QZ2A 2KXPC 2AWIA 2RFMA 3ML8A 5FZRA 2KCVA 1BI8B 1WM5A 2H6IA 3E34A 4EPZA 5FT9A 1NA0A 3B7UX 5EIBE 2DYRE 3V31A 4W9RA 4O60A 1TN7A 3TWQA 1HF8A 1LTXA 1D8DA 4OAUC 2XQ0A 2WQ6A 2H6FA 2ETCA 2OEWA 2HR2A 4HI8A 2NSZA 4DX1A 5JA4D 1TNUA 3UM1A 3FTWA 3KEAA 3TWUA 4R7LA 2BKKB 5HRYA 5DIZA 2J07A 2X6HA 4GZCA 4AOFA 1G3NB 2VSOE 3JXIA 3LVRE 4UQZA 2CHZA 4J8DA 1KZOA 1SW6A 3TWVA 3SBTB 3HXCA 5AIJA 5B1AE 4BERA 1DC2A 4N5QA 4JC8A 2R03A 3MYVA 5HS0A 4GZDA 2WM9A 3NZUA 3Q75A 4ANUA 3FU5A 1KT1A 1SA5A 4LNBA 2BF0X 3T5VA 3PNLB 3AS4A 1MHQA 5LFAA 2KC7A 4FC8A 1N95A 2BUGA 5T3RA 4I9EA 3X2QE 1QQEA 2AW6A 4TRQA 4FU3A 4U96D 4AVXA 2P9IG 3IEGA 2PQNA 4BX8A 2P9LG 3KSLA 4BESA 2IEJA 3OXLA 3JXJA 3CK8A 3MX3A 2EIME 4GA2A 5AJLA 2XPZA 3L9TA 3DSXA 1N4RA 1FT2A 2R5SA 3NOGD 3MJWA 3C3QA 4UI9C 1AP7A 3UMVA 3TJPA 4HNAD 4UWKA 4L9PA 2AXZA 3G2TA 4Q69A 4G1TA 2EIJE 3FTUA 2PM6A 5HKPA 4UUCA 3FULA 2L0IA 5C1DA 3UM2A 2JEKA 3U3WA 4I6EA 4BSXA 4B89A 3ABME 4HQDA 3AU4A 4DX2A 2WXIA 2WXHA 3GZSA 4GMLA 3E37A 3UX4A 3ZN3A 4I43A 3IV0A 3SQVA 1NP7A 1OWOA 5D0QD 4I1OB 4O6FA 3CLJA 3Q79A 4JHRA 3U64A 4L2YA 1HH8A 3GZ2A 3FEXA 4ATZD 3PZ2A 3RIBA 2KCLA 3D9OA 4JXTA 5BT1A 3UUXA 3ZIMA 4DX7D 3ASGA 2X6FA 1FVFA 4FJZA 5KJNA 2HE0A 2NC9A 3PUJA 3HIZA 5JHBA 2ZISA 2E2EA 4PH4B 2XRYA 3MV2B 4HI9A 1IQUA 3SY2A 2EIKE 1H2TC 3QWVA 3FFLA 4L23A 1IQRA 3OXFA 3CK7A 3LJ3A 4CT4A 3R9AB 4EQFA 3DSVA 3ZU7B 3ZPJA 3B95A 4C48B 5G04C 1NI1A 4MRUA 4U04A 5B1BE 2VTBA 4DX6D 4GZ3A 5T4YA 1S0PA 4QFVA 3PE3A 3ZNGA 4RG9A 4ZHBA 2HO1A 1JPLA 3ZEFA 2OEVA 3FP3A 1JCQA 4BWRA 4URKA 1N0QA 2JABA 1YMPA 2J4DA 3L82A 5C2YA 2H6GA 3FDHA 2LAHA 3CGHA 4K0RA 5A23A 1Z5SC 2VSNA 4I6JA 3ABLE 1V55E 3Q4AB 2QY7A 2XZDG 3D9KA 4GYWA 3DSTA 4U8YD 3EU5A 3EU9A 1HO8A 3NQPA 3Q7FA 4DPRA 4U0ZA 1U3CA 3SBSA 5CECB 1HFAA 5AAOA 2DZNA 4JPSA 3PZ3A 3FUJA 4C0EA 1K8KG 3AAAC 1B89A 3AJIA 2L6JA 1GW6A 1Z3YA 2RKKA 4J8FA 4KXKB 3RO2A 1AWCB 3EIQC 3UIPC 4L1BA 4YDEA 4F53A 4CDRA 3KS2A 5H7PA 3ZXSA 3APCA 1FVHA 3V79K 5JMND 3DEPA 3JUEA 5KBAA 4ATGA 1MYOA 3ML9A 2WXJA 4MS6A 4L7TA 4B8CB 3E33A 4AIFA 4WAFA 5B3SE 1Y6IA 1TNYA 1WAO1 2X6KA 1OUVA 2IJGX 4NACA 4M3OA 2A4ZA 2LAIA 5JHAA 3FUEA 3GZ1A 5ANRA 1FPPA 2HM8A 5ARFA 3MKQB 1OCRE 1Z6TA 3BU8A 4Z68A 5CERB 2XHEA
chains in the Genus database with same CATH topology
1UJJA 4JEHA 5AYWD 3CVVA 4I2ZA 3GW4A 3FUHA 4FHKA 1E90A 3TXMA 4GMJA 1HG2A 2C0MA 4EECA 1HF8A 2XPYA 3JQ1A 2IOLA 4UWHA 4WNDA 3UT8A 5FJYA 2XQ0A 2WQ6A 2C2LA 1OWLA 3G2VA 3FH8A 3CVWA 4ILGA 2WXOA 2WVIA 3CHOA 4PS3A 2HR2A 3MA5A 2NSZA 3FUMA 2Y3AA 2KZTA 1E7VA 4F7AA 5JJTA 4DLQA 4XZ4A 3ZGQA 4G23A 3QWWA 5G2NA 3RK6A 4KVOA 2E0IA 2V4LA 1U3DA 3PREA 3FTWA 2UY1B 3P1UA 2WXNA 3LEWA 2CHXA 5EKQD 3TAXA 3L22A 4R7LA 2L0TB 3KD7A 4LERA 2J08A 5DIZA 2J07A 2X6HA 3FU6A 1ZU2A 4GA1A 4GZCA 2CFZA 2GRMA 4KBQA 2OV8A 2VSOE 3EDTB 3LVRE 4A1SA 4AOFA 4UQZA 2CHZA 4EZJA 2WXFA 4GB9A 1XGWA 2DBAA 3OAWA 3FTSA 2I1KA 4J8DA 4ANVA 1X5BA 5FQ6A 1H2VC 1IYGA 2R59A 2I9CA 3CKBA 3SBTB 4XI9A 5KCMA 2IOSA 3LCAA 2WXKA 3HHMA 3MCXA 5AIJA 4F1SA 4ACKA 4FLBA 4EBAA 3VTXA 2YNQA 1E8YA 5FZQA 3KEZA 5G05C 3QKYA 3ONLA 4G11A 4JC8A 5CCLA 3MYVA 5KJKA 2EQXA 4FHJA 4GZDA 3CHQA 3G2WA 4EZLA 1ELRA 4I9CA 3DPDA 3CEQA 4HOUA 3QB2A 2WM9A 3NZUA 3L17A 1TEZA 3APFA 3B7RL 4ANUA 4G26A 4DLOA 3FU5A 1KT1A 4APFA 1SQMA 2BF0X 3T5VA 1KT0A 3TG4A 1SZAA 5BV0A 3RKVA 3CVUA 4PUCA 3PNLB 3AS4A 1MHQA 5LFAA 3D9LA 2KC7A 4PS8A 4FC8A 5EDSA 3IBEA 2BUGA 5T3RA 3S7JA 4ANXA 4I9EA 3SFZA 3O4ZA 3FWVA 1JWGA 1Z3XA 1PC2A 1QQEA 2AW6A 2DCPA 4JEUA 3IHYA 4TRQA 3ZFWA 4FU3A 3HYMB 4N5CA 2IONA 3Q15A 4F3VA 4AVXA 2I6HA 3AS5A 3LY7A 2P58C 3T5XA 2LSUA 3IEGA 4DJAA 2R17C 2PQNA 4IN3B 4BX8A 2IFUA 2XGOA 4GAAA 1H0AA 4CEMA 3PEUB 1E96B 3NF1A 5FQ7A 2J49A 5T8IA 1JWFA 3ASFA 4CRWA 3I3NA 3OXLA 4AEZC 2WPVA 3CK8A 3MX3A 4GA2A 5J90A 3ESKA 4MLPA 5AJLA 3MZLB 3MKRA 2XPZA 4GYYA 5CMYA 5ANLA 3CQCB 5AENA 2R5SA 2V0PA 2AXVA 2KATA 2WQHA 2YHCA 3SGHA 1EPUA 4P29A 4I2WA 3MJWA 2FF4A 2PM7A 3S7DA 4ILHB 4UI9C 2FO7A 3SNXA 3UMVA 3ZYKA 1E7UA 3QJZA 5G05J 3TJPA 3CVYA 4UWFA 4UWKA 5AJDA 2AXZA 3G2TA 3MGBA 4HOQA 1UG3A 2GW1A 5E76A 4Q69A 4G1TA 3D9JA 4GCNA 4NURA 3EIJA 3FTUA 4RSYA 2PM6A 3CQGB 5BUZA 4XKBA 3LY8A 4KMOA 3FULA 2L0IA 3QWPA 5C1DA 3GYZA 3PH0C 4DI3A 3G2UA 2JEKA 5KJMA 2KZTB 4CT0A 3RJVA 5BV1A 3U3WA 4I6EA 4BSXA 2PZIA 4B89A 1BPOA 3I4RB 3EHMA 2FEZA 2QFCA 1OWNA 4ILIA 4KVMA 3AU4A 4OYSA 2WXQA 2WXIA 3ZYMA 4B8AA 4BT8A 3SI5A 3L13A 4XKCA 2WXHA 3GZSA 3PZDA 4GMLA 2MHKA 3N71A 4LRZA 1H2UA 1HZ4A 4G24A 1XNFA 3UX4A 4PDXA 3EHNA 3ZN3A 3ZHEB 3CVNA 4I43A 2PQRA 1IHGA 4XI0A 5BW8C 3PUKA 2LNIA 4Q96A 4U63A 3IV0A 5JJ7A 2I1JA 3JCKC 1Y8MA 1NP7A 1OWOA 4I1MA 4J6IA 4UI9K 4U0SA 5M72A 2YQ8A 5FZSA 3UT7A 5D0QD 4N39A 4I1OB 4O6FA 4FP7A 4I6GA 2GGFA 4B0ZA 3JYSA 2VGXA 3CLJA 2IU1A 4RVBA 5EX3A 3QOUA 3CKCA 4JHRA 4JA7A 3IKOB 4XIFA 4A1GA 1N52A 3RRNB 3FUFA 3Q49B 3TL5A 4G2VA 3U64A 1A17A 3K9IA 3PNTB 4FJYA 4L2YA 4DK5A 2OVFA 4WNEA 2OOEA 1HH8A 4FULA 5ENNA 4N3BA 5FWQA 3GZ2A 3FTXA 3FTYA 1P5QA 4EBAG 1UN8A 3LDZA 3NZSA 1TJFA 1VDYA 3FEXA 3IHVA 3P2BA 3D9MA 2FI7A 3O48A 2MOWA 2XGMA 4J0UA 3FEYA 5HI7A 5HQ8A 5A7DB 3VLEA 2VSXE 4I1AA 3RIBA 5FQ8A 3L54A 2KCLA 3D9OA 4UWGA 4U8HA 4HORA 4JXTA 5BT1A 4Y6CA 3UUXA 3ZRHA 2WQ7A 3CHRA 3UQ3A 2V8SE 3SZ7A 2L9BA 4KYOB 1WY6A 3B13A 1ZBPA 3ZIMA 2AVPA 2WXPA 3ASGA 1E8ZA 2XPIA 5ARGA 1E8WA 3LKUA 4GPKA 1YA0A 4HLEA 2X6FA 4UQXA 1FVFA 4FJZA 1LF8A 3D9NA 5G55A 4BT9A 4BTAA 5KJNA 2NC9A 3DBSA 3TXNA 4AV7A 4GYOA 4HOTA 3S2AA 3PUJA 3HIZA 1UJKA 3U4TA 3FTZA 3VLDA 5A6CA 5JHBA 3SHFA 3RRUA 2E2EA 2M63A 4PH4B 4Q94A 4YVQC 2XRYA 4C0MA 2BTDA 3ONKA 3LPZA 4UWLA 3MV2B 4KZCA 1HU3A 4FA6A 3QK0A 3U9WA 1IQUA 4N3CA 4AM9A 4APOA 4HXIA 4GZ6A 1FCHA 3CVXA 3FU0A 1H2TC 4J8SA 3L6AA 1NZNA 3PVLA 3QWVA 3FFLA 3LY9A 4L23A 2OVBA 1IQRA 2X6IA 3OXFA 1N54A 3CK7A 3LJ3A 4KZ0A 4CT4A 3R9AB 4EQFA 3KAEA 3QNKA 4MKTA 4WWOA 4CDNA 3ZPJA 3OXGA 2GRLA 4JW1A 3LYAA 5G04C 4MRUA 4U04A 1EDUA 1H6KA 3AU5A 4GZ3A 4GU5A 5T4YA 4C9BB 2VTBA 1MQSA 1S0PA 3I5PA 4QFVA 5LCWC 2IQCA 4CGWA 3PE3A 3CK9A 5JJ6A 3TGOA 3R7RA 3CSFA 4JHJA 1E8XA 3CVQA 4RG9A 2XEVA 2HO1A 2V5FA 1JPLA 3L08A 3EJNA 3R7QA 3ZEFA 5CCMA 3QC1A 2LSVA 4YNDA 5FTPA 3FP3A 2WMNA 4JZYA 2ILRA 3FTVA 1HS6A 3LS8A 4D10C 3QARA 3CVPA 4G25A 3TG5A 4BWRA 3CHPA 3APDA 1JUQA 4URKA 4NQ0A 3FUNA 2KCKA 5EX0A 5BPPA 4DI4A 5LCWJ 4OVUA 2J4DA 2VQ2A 3AS8A 3FUIA 3VTYA 5C2YA 4HOSA 1H19A 3QDNA 3FDHA 5FQ4A 3UT4A 2LAHA 2WXLA 3CGHA 2XCCA 3Q5MA 4LEUA 3ZYLA 4K0RA 4YVOA 5A23A 3ASDA 4CGVA 2CFUA 4PS7A 3Q47B 2FULA 2VSNA 1QNFA 2PL2A 3MV3B 2VSYA 4I6JA 4WUYA 3SD5A 3Q4AB 3VLFA 2QY7A 4EZKA 3D9KA 4WNFA 3CHSA 4BTBA 4GYWA 1UN9A 4GA0A 1ELKA 3BG0B 4FLHA 2NXPA 3RRMB 3FHEA 4HFGA 3NQPA 1HO8A 3B7TA 4DPRA 4U0ZA 1KLXA 4K03A 2Y4UA 1U3CA 3D3MA 1OWMA 4OVVA 1L5JA 3SBSA 3CSTA 1HFAA 3FY4A 4HVBA 4A55A 2A5UA 3ASHA 3G2SA 4JPSA 5LOZA 4H7YA 2CHWA 4JHKA 2XGSA 4ME2A 3FUJA 3I4GA 4C0EA 4V3IA 2CG2A 4N2SA 4WWNA 4ACLA 3D9IA 1UW4B 2VTBB 4J8EA 4LUNU 5DBKA 3FUDA 4UQYA 4I17A 4N2QA 3CIAA 2HYZA 1B89A 2X38A 3BEEA 3MKQA 4LCTA 4E85A 2Y4TA 2L6JA 2XRZA 1INZA 3CV0A 5CMWA 4JVSA 3D9PA 1W3BA 3ZYQA 3ENEA 4B94A 2YHEA 4ANWA 3MEKA 4N3AA 3UPVA 1DNPA 4A3TA 4H7XA 4U0UA 3PS6A 3PEVB 3E4BA 1GW6A 1Z3YA 4L2LA 2VJ8A 2WXGA 1NA3A 1HE8A 3OTNA 4J8FA 2UWJG 4KXKB 5E75A 5G04J 3RO2A 3URZA 3CR3A 3FU3A 4IULA 3ESLA 3BG1B 1ELWA 5LP0A 2ZU6B 3EIQC 3HVEA 3JUIA 3PE4A 2JLBA 4AP2A 3ZVVA 3RO3A 3FH7A 3C98A 1EYHA 2YINA 4L1BA 3QAQA 4NRHB 3B7SA 2XCBA 4U07A 4CDMA 2X6JA 1DVPA 4F53A 1TJCA 3KS2A 4CDRA 2FBNA 3HDXA 1HXIA 3CVLA 4A3VA 4XE0A 1EF1C 3PDNA 1SZ9A 3ZXSA 3LVQE 2VGYA 3APCA 4TUUA 2KM4A 3SF4A 4TV3A 3S7FA 4AJWA 4ABNA 4BFRA 1FVHA 2J09A 3ZW3A 3FH5A 4Y6WA 5J08A 5KJLA 4UI9J 4ATGA 3ML9A 4IYPA 5D0OD 2C0LA 2WXMA 2WXJA 2IF4A 4HS2A 4WWPA 2I2OA 2AXUA 3JQ0A 4MS6A 4AY6A 4L7TA 2Q7FA 3PRZA 4RG6A 1PY1A 3ZHEA 4B8CB 3FUKA 4GCOA 3S7BA 2MRIA 1PAQA 4JL0A 4AIFA 4FADA 2DIWA 2RG8A 4KT6B 5BNWA 4BX9A 2J4BA 4WAFA 3RU0A 2WB2A 1HG5A 4WNGA 4AXHA 3HVEB 2LO6A 5LX8A 2J9QA 1Y6IA 4IRUA 4E6HA 1WAO1 1HX8A 2X6KA 1OUVA 2IJGX 2WXRA 4BY6A 4NACA 3CHMA 1OWPA 4GZ5A 4M3OA 4XX5A 2ONDA 2UY1A 3ULQA 2A4ZA 2LAIA 3LXUX 1QZ2A 4AY5A 5JHAA 2AWIA 3FUEA 3ML8A 3GZ1A 5FZRA 2KCVA 5ANRA 2VYIA 3T8MA 3L16A 4CCAA 1WM5A 2X3MA 2HM8A 5ARFA 3MKQB 4EPZA 2VGXB 2CG3A 3WXXA 1Z6TA 5FT9A 1NA0A 2XHEA 2RD0A 2WMOA 3B7UX 4JA9A 3U66A 5CHEE 4W9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GA2 A;  2XPI A;  5ARG A;  5AYW D;  3ESK A;  4I2Z A;  3LKU A;  4GPK A;  1YA0 A;  3GW4 A;  3MKR A;  4GYY A;  5HQ8 A;  4UQX A;  2C0M A;  4BT9 A;  3ASH A;  4BTA A;  5KJN A;  4WND A;  2NC9 A;  4H7Y A;  2R5S A;  2WQH A;  2XGS A;  2KAT A;  4ME2 A;  4GYO A;  5FJY A;  2YHC A;  4HOT A;  3U4T A;  4I2W A;  2C2L A;  2FF4 A;  5A6C A;  4N2S A;  3S7D A;  2E2E A;  4UI9 C;  2FO7 A;  2HR2 A;  4J8E A;  5DBK A;  4YVQ C;  4UQY A;  4I17 A;  3MA5 A;  4N2Q A;  2HYZ A;  1B89 A;  3BEE A;  3LPZ A;  5G05 J;  3MV2 B;  2Y4T A;  2L6J A;  5JJT A;  3CV0 A;  4N3C A;  4AM9 A;  3ZGQ A;  4G23 A;  3QWW A;  4APO A;  1W3B A;  4B94 A;  4HOQ A;  2GW1 A;  1FCH A;  3MEK A;  4GZ6 A;  4G1T A;  4N3A A;  3UPV A;  4W9R A;  2UY1 B;  4H7X A;  4U0U A;  4GCN A;  3E4B A;  5EKQ D;  1NZN A;  3TAX A;  1NA3 A;  3QWV A;  3FFL A;  4J8F A;  3KD7 A;  2UWJ G;  3LY9 A;  4KXK B;  3LY8 A;  5G04 J;  3OXF A;  5DIZ A;  3RO2 A;  3CK7 A;  3URZ A;  3QWP A;  1ELW A;  5C1D A;  1ZU2 A;  3GYZ A;  3R9A B;  4GA1 A;  4KBQ A;  3PE4 A;  4EQF A;  2JLB A;  3KAE A;  4A1S A;  3EDT B;  3RO3 A;  5KJM A;  4UQZ A;  3RJV A;  3U3W A;  3ZPJ A;  2PZI A;  3OXG A;  4NRH B;  2XCB A;  4U07 A;  3LYA A;  2DBA A;  2FEZ A;  2QFC A;  5G04 C;  4J8D A;  1TJC A;  3KS2 A;  4U04 A;  2FBN A;  4CDR A;  4GZ3 A;  4BT8 A;  1HXI A;  3CVL A;  5LCW C;  3CKB A;  1IYG A;  4XI9 A;  4CGW A;  3LCA A;  4AIF A;  3PDN A;  3PE3 A;  3CK9 A;  2VGY A;  2MHK A;  3N71 A;  5JJ6 A;  3TGO A;  3SF4 A;  1HZ4 A;  4G24 A;  3VTX A;  1XNF A;  3S7F A;  3ZN3 A;  4ABN A;  5FZQ A;  3CVQ A;  3CVN A;  4RG9 A;  2PQR A;  2XEV A;  2HO1 A;  1IHG A;  2V5F A;  4XI0 A;  5G05 C;  5BW8 C;  2LNI A;  3QKY A;  5CCM A;  2LSV A;  4Y6W A;  5CCL A;  4YND A;  5FTP A;  3FP3 A;  5JJ7 A;  1Y8M A;  4UI9 J;  5KJL A;  5KJK A;  4UI9 K;  1ELR A;  4U0S A;  4I9C A;  5D0O D;  5M72 A;  2C0L A;  2YQ8 A;  3CEQ A;  4HOU A;  5FZS A;  3CVP A;  2IF4 A;  4G25 A;  5D0Q D;  4N39 A;  4O6F A;  3TG5 A;  4BWR A;  4AY6 A;  4NQ0 A;  4G26 A;  2Q7F A;  3ZHE A;  2KCK A;  3JYS A;  1KT1 A;  2VGX A;  4RG6 A;  5EX0 A;  3ZHE B;  4GCO A;  3S7B A;  5LCW J;  2VQ2 A;  3QOU A;  4JL0 A;  3CKC A;  3AS8 A;  4JHR A;  4JA7 A;  4XIF A;  5EX3 A;  1KT0 A;  3TG4 A;  3VTY A;  5BNW A;  3RU0 A;  4HOS A;  3QDN A;  3RKV A;  4WNG A;  3Q49 B;  4G2V A;  1A17 A;  3AS4 A;  2J9Q A;  3K9I A;  2KC7 A;  2XCC A;  1WAO 1;  3Q5M A;  2BUG A;  2OOE A;  4LEU A;  1OUV A;  4WNE A;  4CGV A;  4YVO A;  3S7J A;  1HH8 A;  3ASD A;  4I9E A;  3FWV A;  4GZ5 A;  3GZ2 A;  3Q47 B;  1PC2 A;  4N3B A;  1QQE A;  3ZFW A;  2OND A;  2VSN A;  2PL2 A;  1P5Q A;  2UY1 A;  3MV3 B;  2VSY A;  3HYM B;  4WUY A;  3ULQ A;  4N5C A;  3Q4A B;  1QZ2 A;  3Q15 A;  4AY5 A;  4F3V A;  2I6H A;  3AS5 A;  3LY7 A;  2FI7 A;  2P58 C;  3O48 A;  4WNF A;  2XGM A;  3GZ1 A;  2KCV A;  4J0U A;  5FZR A;  5HI7 A;  2VYI A;  2LSU A;  3IEG A;  5A7D B;  1WM5 A;  4I1A A;  4GYW A;  2PQN A;  4IN3 B;  3RIB A;  4BTB A;  2IFU A;  2KCL A;  2XGO A;  4GA0 A;  5ARF A;  4HOR A;  5BT1 A;  1E96 B;  2VGX B;  3NF1 A;  4Y6C A;  3UUX A;  3UQ3 A;  3WXX A;  5FT9 A;  1NA0 A;  3ASF A;  4JA9 A;  3SZ7 A;  4KYO B;  3OXL A;  1KLX A;  1ZBP A;  4U0Z A;  2AVP A;  2Y4U A;  5CHE E;  3ASG A;  2WPV A;  3CK8 A; 
#chains in the Genus database with same CATH topology
 4JEH A;  3CVV A;  3PZ4 A;  4FHK A;  3TXM A;  4GMJ A;  2XPY A;  5FJY A;  3DPY A;  1OWL A;  3G2V A;  3CVW A;  2WXO A;  2WVI A;  4F7A A;  5JJT A;  4DLQ A;  4O1P A;  3D9H A;  4G23 A;  5G2N A;  3UM3 A;  2V4L A;  2WXN A;  2CHX A;  3TAX A;  3L22 A;  2IO3 C;  4LG6 A;  3KD7 A;  3NAW A;  4U7E B;  4A1S A;  3T8K A;  4EZJ A;  4GB9 A;  1OT8 A;  3FTS A;  5CEA A;  1X5B A;  1N94 A;  1IYG A;  5KCM A;  2F0Y A;  3HHM A;  4F1S A;  2GRR B;  5G05 C;  5CCL A;  1NFI E;  5KJK A;  4FHJ A;  3TWS A;  1ELR A;  3QB2 A;  1TEZ A;  3B7R L;  2LXL A;  1SQM A;  2ETA A;  1KT0 A;  1SZA A;  3DXM G;  3W9F A;  5EDS A;  3S7J A;  4ANX A;  3SFZ A;  3O4Z A;  1YYH A;  3UIN C;  1Z3X A;  2DCP A;  4RQI A;  1N4S A;  3HYM B;  4F3V A;  1N9A A;  2LSU A;  3W9G A;  2IFU A;  2XGO A;  4GAA A;  5EIL A;  4CEM A;  2J49 A;  1TYQ G;  4MLP A;  2P9N G;  4GTR A;  5AEN A;  3TWR A;  2KAT A;  4P29 A;  4I2W A;  1S63 A;  2FF4 A;  2OCC E;  3TWW A;  5EYP F;  2DVW A;  5AJD A;  3MGB A;  1UG3 A;  2GW1 A;  1DCE A;  4KMO A;  2GRP B;  3G2U A;  1TN8 A;  4GTT A;  3I4R B;  1U2V G;  4YDW A;  2BKG A;  4OYS A;  2WXQ A;  5CBN A;  2Y0B G;  4BEP A;  4XKC A;  1H2U A;  1XNF A;  3EHN A;  1MX6 A;  3ZHE B;  3CVN A;  3ZKJ A;  3PUK A;  2I1J A;  4J6I A;  4UI9 K;  5ENP D;  5M72 A;  2YQ8 A;  5FZS A;  4BET A;  2ETB A;  4FP7 A;  4I6G A;  2VGX A;  3C3O A;  3CKC A;  5EN5 D;  1N52 A;  1S70 B;  4G2V A;  1A17 A;  3K9I A;  3PNT B;  2OVF A;  4FUL A;  2ZXW E;  3WG7 E;  3LDZ A;  1TJF A;  3P2B A;  3D9M A;  3O48 A;  2MOW A;  3FEY A;  5A7D B;  3L54 A;  4UWG A;  4Y6C A;  2WQ7 A;  3ZRH A;  3UQ3 A;  3B13 A;  1ZBP A;  3B7B A;  1E8W A;  4HLE A;  3D9N A;  4BT9 A;  4BTA A;  3TWX A;  4GYO A;  3EUV A;  3U4T A;  2M63 A;  4Q94 A;  1TNB A;  3DWL G;  3DRA A;  4UWL A;  4KZC A;  4GTP A;  3QK0 A;  2ZGG A;  4GZ6 A;  1FCH A;  2DZO A;  3L6A A;  3PVL A;  3LY9 A;  2OVB A;  1N54 A;  2GRO B;  4KZ0 A;  3UTM A;  3KAE A;  4WWO A;  3PZ1 A;  1KZP A;  3AU5 A;  1OCZ E;  5JJ6 A;  3CSF A;  4JHJ A;  3CVQ A;  2XEV A;  3AG4 E;  3L08 A;  3EJN A;  4JB8 P;  5CCM A;  4YND A;  2WMN A;  5ENO D;  3HXB A;  2IO2 C;  2ILR A;  3LS8 A;  1HS6 A;  2J8S D;  3AG2 E;  3CVP A;  2GRQ B;  1RZ4 A;  3FUN A;  5BPP A;  5EX0 A;  2ZGD A;  3FUI A;  4G8L A;  3QDN A;  5FQ4 A;  2XCC A;  4LEU A;  4YVO A;  3ASD A;  3SFY A;  2FUL A;  1JCR A;  1QNF A;  4EZK A;  2EIN E;  3CHS A;  1KPS B;  1ELK A;  5ITZ F;  3FHE A;  4HFG A;  1MZC A;  1H6O A;  1YCS B;  1O1S A;  2Y4U A;  3UM0 A;  3D3M A;  4OVV A;  2A5U A;  4H7Y A;  2XGS A;  4ME2 A;  4ACL A;  2VTB B;  3IXE A;  4J8E A;  4LUN U;  3FUD A;  1IKN D;  2X38 A;  2R2L A;  1INZ A;  4NIK A;  5CMW A;  3D9P A;  3Q9U C;  4N3A A;  4B93 B;  4A3T A;  1NA3 A;  1HE8 A;  3OTN A;  1OCC E;  2UWJ G;  5G04 J;  3URZ A;  4AP2 A;  2JLB A;  4X8Q A;  4NRH B;  2QYJ A;  4U07 A;  2FBN A;  1EF1 C;  4U95 D;  2VGY A;  4F1P A;  3SF4 A;  1TN6 A;  4TV3 A;  1QYM A;  4AJW A;  4ABN A;  3ZW3 A;  4Y6W A;  5J08 A;  4IYP A;  2C0L A;  2WXM A;  5CRU A;  2Q7F A;  4RG6 A;  2MRI A;  1PAQ A;  4JL0 A;  4KT6 B;  1HG5 A;  4WNG A;  4AXH A;  3HVE B;  1HX8 A;  2F8X K;  2WXR A;  3CHM A;  2DYS E;  3F6Q A;  3ISM C;  4CCA A;  2VYI A;  3T8M A;  3L16 A;  4MBG A;  3E30 A;  2AJA A;  2VGX B;  2CG3 A;  3WXX A;  4JA9 A;  2RD0 A;  5CHE E;  3SO8 A;  1UJJ A;  1S64 A;  4YDY A;  3GW4 A;  2KBX A;  1HG2 A;  2C0M A;  3AG1 E;  2IOL A;  4UWH A;  4WND A;  3UT8 A;  2C2L A;  3E32 A;  4PS3 A;  3MA5 A;  1WDY A;  2KZT A;  4XZ4 A;  4GTS A;  3RK6 A;  2E0I A;  1U3D A;  2UY1 B;  5AQ9 A;  5EKQ D;  2L0T B;  4LER A;  3Q7A A;  3FU6 A;  1ZU2 A;  2FO1 E;  2F37 A;  2OV8 A;  3EDT B;  2P9P G;  2WXF A;  2I1K A;  4ANV A;  5FQ6 A;  2I9C A;  4XI9 A;  2WXK A;  2NYJ A;  4ACK A;  2YNQ A;  5FZQ A;  3QKY A;  4EZL A;  4I9C A;  1V54 E;  3CEQ A;  4HOU A;  3APF A;  4G26 A;  2P9K G;  4DUI A;  4HBD A;  3TG4 A;  5AQB A;  4PUC A;  1Q2Z A;  3D9L A;  4PS8 A;  1A5E A;  3IBE A;  1JWG A;  3ZFW A;  3IHY A;  1IXV A;  4N5C A;  3Q15 A;  2I6H A;  1QBQ A;  2P58 C;  3T5X A;  3HXE A;  2V4H C;  4DJA A;  4IN3 B;  3HXF A;  5FQ7 A;  5T8I A;  3ASF A;  4CYM D;  5J90 A;  1UOH A;  3ESK A;  3CQC B;  3ASO E;  2AXV A;  4K5B A;  1BU9 A;  1DCQ A;  3S7D A;  1TR4 A;  4YDO A;  4ILH B;  4K5C A;  1E7U A;  3QJZ A;  2QC9 A;  3CVY A;  1ZB1 A;  4HOQ A;  5E76 A;  3D9J A;  4NUR A;  3EIJ A;  5BUZ A;  3LY8 A;  2BED A;  3C5R A;  3QWP A;  1H6P A;  4DI3 A;  2GRN B;  3RJV A;  5BV1 A;  2PZI A;  1BPO A;  2FEZ A;  2QFC A;  1OWN A;  4ILI A;  4KVM A;  3L13 A;  4LRZ A;  3N71 A;  1HZ4 A;  4G24 A;  4PDX A;  5IY5 E;  5BW8 C;  2LNI A;  4Q96 A;  4U63 A;  5JJ7 A;  4I1M A;  4U0S A;  3DSS A;  3UT7 A;  2GGF A;  2B0O E;  2IU1 A;  5EX3 A;  3UIO C;  4RLY A;  4FJY A;  5ENN A;  3FTX A;  1P5Q A;  4EBA G;  4GTO A;  3NZS A;  1VDY A;  2FI7 A;  5HQ8 A;  5HI7 A;  2VSX E;  4HOR A;  3SZ7 A;  2L9B A;  1WY6 A;  2AVP A;  2WXP A;  1E8Z A;  2XPI A;  5ARG A;  3LKU A;  4GPK A;  4UQX A;  1LF8 A;  5G55 A;  3DBS A;  3TXN A;  5BXO A;  4AV7 A;  3S2A A;  2XEH A;  2A5E A;  1UJK A;  2P2C P;  2ZIR A;  3VLD A;  3SHF A;  3DEO A;  3RRU A;  5AQ7 A;  4YVQ C;  4C0M A;  4GTV A;  2BTD A;  3ONK A;  1LD8 A;  4AM9 A;  3HRA A;  4HXI A;  3CVX A;  2IY0 C;  3FU0 A;  3J5Q B;  4J8S A;  1NZN A;  1BD8 A;  2X6I A;  2R05 A;  1N11 A;  4MKT A;  4GMR A;  4GTQ A;  4EHM A;  1MQS A;  3I5P A;  5LCW C;  2MYO A;  2IQC A;  4CGW A;  3CK9 A;  3TGO A;  3C3R A;  4O1O A;  3R7R A;  3ULE G;  3QC1 A;  2LSV A;  4M7C A;  4D10 C;  4G25 A;  4TXP A;  3TG5 A;  3CHP A;  1JUQ A;  4NQ0 A;  5LCW J;  4DI4 A;  4OVU A;  5KWD A;  4HOS A;  1IHB A;  3UT4 A;  1RW2 A;  2VGE A;  5D2M C;  1K3Z D;  4CGV A;  2CFU A;  2Y1L E;  3Q47 B;  2PL2 A;  3MV3 B;  2VSY A;  1SA4 A;  3UXG A;  3VLF A;  4WNF A;  2XZT G;  3BG0 B;  2PNN A;  1KLX A;  4A55 A;  4JHK A;  2EIL E;  4WWN A;  5DBK A;  4UQY A;  3CIA A;  2HYZ A;  3MKQ A;  3BEE A;  4E85 A;  2LUH A;  3CV0 A;  4JVS A;  4ANW A;  3MEK A;  3UPV A;  4U0U A;  3PS6 A;  3PEV B;  4LNU D;  4L2L A;  2WXG A;  3CR3 A;  4IUL A;  1NL4 A;  3BG1 B;  3JUI A;  3FH7 A;  3C98 A;  1EYH A;  3QAQ A;  4CDM A;  2X6J A;  3HDX A;  3CVL A;  4A3V A;  1SZ9 A;  2L6B A;  3LVQ E;  4HRM B;  2J09 A;  3UI2 A;  3FH5 A;  3ZXP A;  5KJL A;  4UI9 J;  5D0O D;  2IF4 A;  4GPM A;  4WWP A;  2I2O A;  5AN8 A;  3JQ0 A;  4AY6 A;  3FUK A;  2DIW A;  2RG8 A;  5BNW A;  1MX4 A;  3V2X A;  2WB2 A;  1O5M A;  2LO6 A;  4E6H A;  4IRU A;  3V2O A;  1D8E A;  4BY6 A;  1MJ0 A;  2XS1 A;  4XX5 A;  4F6R D;  2OND A;  2UY1 A;  3ULQ A;  4AY5 A;  1N4P A;  2X3M A;  4CZ2 D;  1JCS A;  3AG3 E;  2WMO A;  3U66 A;  5AYW D;  4I2Z A;  3FUH A;  1E90 A;  3UKR G;  4EEC A;  3KSQ A;  3JQ1 A;  3FH8 A;  4ILG A;  3CHO A;  3FUM A;  2Y3A A;  1E7V A;  3LJN A;  2P9S G;  3ZGQ A;  1O1R A;  3QWW A;  4KVO A;  3PRE A;  3P1U A;  3LEW A;  2J08 A;  4GA1 A;  4KBQ A;  2CFZ A;  2GRM A;  1WG0 A;  3TWT A;  4QQI A;  2P9U G;  1XGW A;  2LXM A;  1K1B A;  2DBA A;  3OAW A;  5EYL A;  1H2V C;  2R59 A;  3CKB A;  2IOS A;  3LCA A;  3MCX A;  1MX2 A;  4JD2 G;  1X81 A;  4FLB A;  4EBA A;  3VTX A;  1E8Y A;  3KEZ A;  4HRL A;  3ONL A;  4G11 A;  3ASN E;  2EQX A;  3CHQ A;  3G2W A;  3NB2 A;  2F8Y A;  3DPD A;  2XS8 A;  1TNZ A;  3L17 A;  4DLO A;  1D9S A;  4APF A;  2XEN A;  5BV0 A;  3RKV A;  3CVU A;  4OAV B;  3FWV A;  1PC2 A;  4J7W A;  4JEU A;  5BXU A;  2ION A;  3AS5 A;  3LY7 A;  2R17 C;  1H0A A;  3PEU B;  1E96 B;  3NF1 A;  5CED B;  1JWF A;  4CRW A;  3I3N A;  2R02 A;  4AEZ C;  2WPV A;  3NBN B;  3MZL B;  3MKR A;  4GYY A;  5CMY A;  5ANL A;  3DSU A;  2V0P A;  1BI7 B;  2WQH A;  2YHC A;  1OCO E;  1EPU A;  3SGH A;  2PM7 A;  2FO7 A;  3SNX A;  3ZYK A;  1N4Q A;  5G05 J;  4UWF A;  1SVX A;  3Q9N C;  5EID A;  4GCN A;  2RFA A;  4RSY A;  1O1T A;  3CQG B;  4XKB A;  3GYZ A;  3PH0 C;  4LSZ E;  5KJM A;  2KZT B;  4CT0 A;  3HG0 D;  3EHM A;  5ENQ D;  2QYU A;  3ZYM A;  5ENS D;  4B8A A;  4BT8 A;  3SI5 A;  4BSZ B;  1OXJ A;  3PZD A;  4G8K A;  2MHK A;  2PQR A;  1IHG A;  4XI0 A;  3J5P A;  3JCK C;  1Y8M A;  3EHQ A;  4N39 A;  4B0Z A;  3JYS A;  4RVB A;  3QOU A;  4JA7 A;  3IKO B;  4XIF A;  4A1G A;  3RRN B;  3FUF A;  3Q49 B;  3TL5 A;  2H6H A;  4DK5 A;  4WNE A;  2OOE A;  4N3B A;  5FWQ A;  3FTY A;  1UN8 A;  5FIN A;  2QZA A;  3IHV A;  4K5A B;  3Q78 A;  3RAU A;  2XGM A;  4J0U A;  3VLE A;  4I1A A;  5FQ8 A;  4U8H A;  3CHR A;  1FT1 A;  3R9M A;  2V8S E;  4KYO B;  4TUM A;  1BLX B;  3T9K A;  1YA0 A;  4HB5 A;  4HOT A;  4J8Y A;  1N0R A;  5KNH D;  3FTZ A;  4XEI G;  3BUA A;  5A6C A;  3SFX A;  3LPZ A;  1HU3 A;  4FA6 A;  4ZFH A;  3U9W A;  4N3C A;  4APO A;  1OY3 D;  3V30 A;  3NOC D;  3Q73 A;  5ENR D;  3C72 A;  3QNK A;  4CDN A;  2B6C A;  3OXG A;  2GRL A;  4JW1 A;  2Y69 E;  3LYA A;  1EDU A;  1H6K A;  4GU5 A;  4C9B B;  4DX5 D;  3DSW A;  5AQA A;  2XEE A;  1E8X A;  2V5F A;  3R7Q A;  5FTP A;  4JZY A;  3FTV A;  3QAR A;  3RSE G;  3EHR A;  3APD A;  2KCK A;  2VQ2 A;  3AS8 A;  3VTY A;  1H19 A;  5D66 A;  2WXL A;  1K1A A;  4DRX E;  3Q5M A;  3ZYL A;  4PS7 A;  4HRN A;  4WUY A;  5FIO A;  3SD5 A;  4BTB A;  1UN9 A;  4GA0 A;  4FLH A;  2NXP A;  3RRM B;  3B7T A;  3ZUV B;  4K03 A;  3ULY A;  1OWM A;  5CBO A;  1L5J A;  3CST A;  3FY4 A;  4HVB A;  3ASH A;  3G2S A;  5LOZ A;  2CHW A;  3I4G A;  4V3I A;  5KNG A;  2CG2 A;  4N2S A;  3D9I A;  1UW4 B;  4I17 A;  4N2Q A;  4LCT A;  4A63 B;  2Y4T A;  2XRZ A;  2V5Q C;  1W3B A;  3ZYQ A;  3ENE A;  4B94 A;  2YHE A;  1DNP A;  4H7X A;  3E4B A;  2VJ8 A;  5E75 A;  5ENT D;  4U8V D;  3FU3 A;  3ESL A;  1ELW A;  3UKU G;  5LP0 A;  2ZU6 B;  3HVE A;  3PE4 A;  3ZVV A;  3RO3 A;  3DXK G;  2DWZ A;  2YIN A;  3B7S A;  2XCB A;  4LNG A;  5CRV A;  1DVP A;  1TJC A;  4TXQ A;  1HXI A;  3HXD A;  4XE0 A;  3PDN A;  5AAR A;  4TUU A;  2KM4 A;  4TXR A;  3S7F A;  4BFR A;  1TNO A;  4HS2 A;  2AXU A;  3PRZ A;  3ZHE A;  1PY1 A;  4GCO A;  3S7B A;  4FAD A;  1LD7 A;  4BX9 A;  2J4B A;  3RU0 A;  5LX8 A;  2J9Q A;  3ABK E;  3BQO A;  1OWP A;  4GZ5 A;  4HLL A;  4GTM A;  3LXU X;  1QZ2 A;  2KXP C;  2AWI A;  2RFM A;  3ML8 A;  5FZR A;  2KCV A;  1BI8 B;  1WM5 A;  2H6I A;  3E34 A;  4EPZ A;  5FT9 A;  1NA0 A;  3B7U X;  5EIB E;  2DYR E;  3V31 A;  4W9R A;  4O60 A;  1TN7 A;  3TWQ A;  1HF8 A;  1LTX A;  1D8D A;  4OAU C;  2XQ0 A;  2WQ6 A;  2H6F A;  2ETC A;  2OEW A;  2HR2 A;  4HI8 A;  2NSZ A;  4DX1 A;  5JA4 D;  1TNU A;  3UM1 A;  3FTW A;  3KEA A;  3TWU A;  4R7L A;  2BKK B;  5HRY A;  5DIZ A;  2J07 A;  2X6H A;  4GZC A;  4AOF A;  1G3N B;  2VSO E;  3JXI A;  3LVR E;  4UQZ A;  2CHZ A;  4J8D A;  1KZO A;  1SW6 A;  3TWV A;  3SBT B;  3HXC A;  5AIJ A;  5B1A E;  4BER A;  1DC2 A;  4N5Q A;  4JC8 A;  2R03 A;  3MYV A;  5HS0 A;  4GZD A;  2WM9 A;  3NZU A;  3Q75 A;  4ANU A;  3FU5 A;  1KT1 A;  1SA5 A;  4LNB A;  2BF0 X;  3T5V A;  3PNL B;  3AS4 A;  1MHQ A;  5LFA A;  2KC7 A;  4FC8 A;  1N95 A;  2BUG A;  5T3R A;  4I9E A;  3X2Q E;  1QQE A;  2AW6 A;  4TRQ A;  4FU3 A;  4U96 D;  4AVX A;  2P9I G;  3IEG A;  2PQN A;  4BX8 A;  2P9L G;  3KSL A;  4BES A;  2IEJ A;  3OXL A;  3JXJ A;  3CK8 A;  3MX3 A;  2EIM E;  4GA2 A;  5AJL A;  2XPZ A;  3L9T A;  3DSX A;  1N4R A;  1FT2 A;  2R5S A;  3NOG D;  3MJW A;  3C3Q A;  4UI9 C;  1AP7 A;  3UMV A;  3TJP A;  4HNA D;  4UWK A;  4L9P A;  2AXZ A;  3G2T A;  4Q69 A;  4G1T A;  2EIJ E;  3FTU A;  2PM6 A;  5HKP A;  4UUC A;  3FUL A;  2L0I A;  5C1D A;  3UM2 A;  2JEK A;  3U3W A;  4I6E A;  4BSX A;  4B89 A;  3ABM E;  4HQD A;  3AU4 A;  4DX2 A;  2WXI A;  2WXH A;  3GZS A;  4GML A;  3E37 A;  3UX4 A;  3ZN3 A;  4I43 A;  3IV0 A;  3SQV A;  1NP7 A;  1OWO A;  5D0Q D;  4I1O B;  4O6F A;  3CLJ A;  3Q79 A;  4JHR A;  3U64 A;  4L2Y A;  1HH8 A;  3GZ2 A;  3FEX A;  4ATZ D;  3PZ2 A;  3RIB A;  2KCL A;  3D9O A;  4JXT A;  5BT1 A;  3UUX A;  3ZIM A;  4DX7 D;  3ASG A;  2X6F A;  1FVF A;  4FJZ A;  5KJN A;  2HE0 A;  2NC9 A;  3PUJ A;  3HIZ A;  5JHB A;  2ZIS A;  2E2E A;  4PH4 B;  2XRY A;  3MV2 B;  4HI9 A;  1IQU A;  3SY2 A;  2EIK E;  1H2T C;  3QWV A;  3FFL A;  4L23 A;  1IQR A;  3OXF A;  3CK7 A;  3LJ3 A;  4CT4 A;  3R9A B;  4EQF A;  3DSV A;  3ZU7 B;  3ZPJ A;  3B95 A;  4C48 B;  5G04 C;  1NI1 A;  4MRU A;  4U04 A;  5B1B E;  2VTB A;  4DX6 D;  4GZ3 A;  5T4Y A;  1S0P A;  4QFV A;  3PE3 A;  3ZNG A;  4RG9 A;  4ZHB A;  2HO1 A;  1JPL A;  3ZEF A;  2OEV A;  3FP3 A;  1JCQ A;  4BWR A;  4URK A;  1N0Q A;  2JAB A;  1YMP A;  2J4D A;  3L82 A;  5C2Y A;  2H6G A;  3FDH A;  2LAH A;  3CGH A;  4K0R A;  5A23 A;  1Z5S C;  2VSN A;  4I6J A;  3ABL E;  1V55 E;  3Q4A B;  2QY7 A;  2XZD G;  3D9K A;  4GYW A;  3DST A;  4U8Y D;  3EU5 A;  3EU9 A;  1HO8 A;  3NQP A;  3Q7F A;  4DPR A;  4U0Z A;  1U3C A;  3SBS A;  5CEC B;  1HFA A;  5AAO A;  2DZN A;  4JPS A;  3PZ3 A;  3FUJ A;  4C0E A;  1K8K G;  3AAA C;  1B89 A;  3AJI A;  2L6J A;  1GW6 A;  1Z3Y A;  2RKK A;  4J8F A;  4KXK B;  3RO2 A;  1AWC B;  3EIQ C;  3UIP C;  4L1B A;  4YDE A;  4F53 A;  4CDR A;  3KS2 A;  5H7P A;  3ZXS A;  3APC A;  1FVH A;  3V79 K;  5JMN D;  3DEP A;  3JUE A;  5KBA A;  4ATG A;  1MYO A;  3ML9 A;  2WXJ A;  4MS6 A;  4L7T A;  4B8C B;  3E33 A;  4AIF A;  4WAF A;  5B3S E;  1Y6I A;  1TNY A;  1WAO 1;  2X6K A;  1OUV A;  2IJG X;  4NAC A;  4M3O A;  2A4Z A;  2LAI A;  5JHA A;  3FUE A;  3GZ1 A;  5ANR A;  1FPP A;  2HM8 A;  5ARF A;  3MKQ B;  1OCR E;  1Z6T A;  3BU8 A;  4Z68 A;  5CER B;  2XHE A; 
#chains in the Genus database with same CATH homology
 1UJJ A;  4JEH A;  5AYW D;  3CVV A;  4I2Z A;  3GW4 A;  3FUH A;  4FHK A;  1E90 A;  3TXM A;  4GMJ A;  1HG2 A;  2C0M A;  4EEC A;  1HF8 A;  2XPY A;  3JQ1 A;  2IOL A;  4UWH A;  4WND A;  3UT8 A;  5FJY A;  2XQ0 A;  2WQ6 A;  2C2L A;  1OWL A;  3G2V A;  3FH8 A;  3CVW A;  4ILG A;  2WXO A;  2WVI A;  3CHO A;  4PS3 A;  2HR2 A;  3MA5 A;  2NSZ A;  3FUM A;  2Y3A A;  2KZT A;  1E7V A;  4F7A A;  5JJT A;  4DLQ A;  4XZ4 A;  3ZGQ A;  4G23 A;  3QWW A;  5G2N A;  3RK6 A;  4KVO A;  2E0I A;  2V4L A;  1U3D A;  3PRE A;  3FTW A;  2UY1 B;  3P1U A;  2WXN A;  3LEW A;  2CHX A;  5EKQ D;  3TAX A;  3L22 A;  4R7L A;  2L0T B;  3KD7 A;  4LER A;  2J08 A;  5DIZ A;  2J07 A;  2X6H A;  3FU6 A;  1ZU2 A;  4GA1 A;  4GZC A;  2CFZ A;  2GRM A;  4KBQ A;  2OV8 A;  2VSO E;  3EDT B;  3LVR E;  4A1S A;  4AOF A;  4UQZ A;  2CHZ A;  4EZJ A;  2WXF A;  4GB9 A;  1XGW A;  2DBA A;  3OAW A;  3FTS A;  2I1K A;  4J8D A;  4ANV A;  1X5B A;  5FQ6 A;  1H2V C;  1IYG A;  2R59 A;  2I9C A;  3CKB A;  3SBT B;  4XI9 A;  5KCM A;  2IOS A;  3LCA A;  2WXK A;  3HHM A;  3MCX A;  5AIJ A;  4F1S A;  4ACK A;  4FLB A;  4EBA A;  3VTX A;  2YNQ A;  1E8Y A;  5FZQ A;  3KEZ A;  5G05 C;  3QKY A;  3ONL A;  4G11 A;  4JC8 A;  5CCL A;  3MYV A;  5KJK A;  2EQX A;  4FHJ A;  4GZD A;  3CHQ A;  3G2W A;  4EZL A;  1ELR A;  4I9C A;  3DPD A;  3CEQ A;  4HOU A;  3QB2 A;  2WM9 A;  3NZU A;  3L17 A;  1TEZ A;  3APF A;  3B7R L;  4ANU A;  4G26 A;  4DLO A;  3FU5 A;  1KT1 A;  4APF A;  1SQM A;  2BF0 X;  3T5V A;  1KT0 A;  3TG4 A;  1SZA A;  5BV0 A;  3RKV A;  3CVU A;  4PUC A;  3PNL B;  3AS4 A;  1MHQ A;  5LFA A;  3D9L A;  2KC7 A;  4PS8 A;  4FC8 A;  5EDS A;  3IBE A;  2BUG A;  5T3R A;  3S7J A;  4ANX A;  4I9E A;  3SFZ A;  3O4Z A;  3FWV A;  1JWG A;  1Z3X A;  1PC2 A;  1QQE A;  2AW6 A;  2DCP A;  4JEU A;  3IHY A;  4TRQ A;  3ZFW A;  4FU3 A;  3HYM B;  4N5C A;  2ION A;  3Q15 A;  4F3V A;  4AVX A;  2I6H A;  3AS5 A;  3LY7 A;  2P58 C;  3T5X A;  2LSU A;  3IEG A;  4DJA A;  2R17 C;  2PQN A;  4IN3 B;  4BX8 A;  2IFU A;  2XGO A;  4GAA A;  1H0A A;  4CEM A;  3PEU B;  1E96 B;  3NF1 A;  5FQ7 A;  2J49 A;  5T8I A;  1JWF A;  3ASF A;  4CRW A;  3I3N A;  3OXL A;  4AEZ C;  2WPV A;  3CK8 A;  3MX3 A;  4GA2 A;  5J90 A;  3ESK A;  4MLP A;  5AJL A;  3MZL B;  3MKR A;  2XPZ A;  4GYY A;  5CMY A;  5ANL A;  3CQC B;  5AEN A;  2R5S A;  2V0P A;  2AXV A;  2KAT A;  2WQH A;  2YHC A;  3SGH A;  1EPU A;  4P29 A;  4I2W A;  3MJW A;  2FF4 A;  2PM7 A;  3S7D A;  4ILH B;  4UI9 C;  2FO7 A;  3SNX A;  3UMV A;  3ZYK A;  1E7U A;  3QJZ A;  5G05 J;  3TJP A;  3CVY A;  4UWF A;  4UWK A;  5AJD A;  2AXZ A;  3G2T A;  3MGB A;  4HOQ A;  1UG3 A;  2GW1 A;  5E76 A;  4Q69 A;  4G1T A;  3D9J A;  4GCN A;  4NUR A;  3EIJ A;  3FTU A;  4RSY A;  2PM6 A;  3CQG B;  5BUZ A;  4XKB A;  3LY8 A;  4KMO A;  3FUL A;  2L0I A;  3QWP A;  5C1D A;  3GYZ A;  3PH0 C;  4DI3 A;  3G2U A;  2JEK A;  5KJM A;  2KZT B;  4CT0 A;  3RJV A;  5BV1 A;  3U3W A;  4I6E A;  4BSX A;  2PZI A;  4B89 A;  1BPO A;  3I4R B;  3EHM A;  2FEZ A;  2QFC A;  1OWN A;  4ILI A;  4KVM A;  3AU4 A;  4OYS A;  2WXQ A;  2WXI A;  3ZYM A;  4B8A A;  4BT8 A;  3SI5 A;  3L13 A;  4XKC A;  2WXH A;  3GZS A;  3PZD A;  4GML A;  2MHK A;  3N71 A;  4LRZ A;  1H2U A;  1HZ4 A;  4G24 A;  1XNF A;  3UX4 A;  4PDX A;  3EHN A;  3ZN3 A;  3ZHE B;  3CVN A;  4I43 A;  2PQR A;  1IHG A;  4XI0 A;  5BW8 C;  3PUK A;  2LNI A;  4Q96 A;  4U63 A;  3IV0 A;  5JJ7 A;  2I1J A;  3JCK C;  1Y8M A;  1NP7 A;  1OWO A;  4I1M A;  4J6I A;  4UI9 K;  4U0S A;  5M72 A;  2YQ8 A;  5FZS A;  3UT7 A;  5D0Q D;  4N39 A;  4I1O B;  4O6F A;  4FP7 A;  4I6G A;  2GGF A;  4B0Z A;  3JYS A;  2VGX A;  3CLJ A;  2IU1 A;  4RVB A;  5EX3 A;  3QOU A;  3CKC A;  4JHR A;  4JA7 A;  3IKO B;  4XIF A;  4A1G A;  1N52 A;  3RRN B;  3FUF A;  3Q49 B;  3TL5 A;  4G2V A;  3U64 A;  1A17 A;  3K9I A;  3PNT B;  4FJY A;  4L2Y A;  4DK5 A;  2OVF A;  4WNE A;  2OOE A;  1HH8 A;  4FUL A;  5ENN A;  4N3B A;  5FWQ A;  3GZ2 A;  3FTX A;  3FTY A;  1P5Q A;  4EBA G;  1UN8 A;  3LDZ A;  3NZS A;  1TJF A;  1VDY A;  3FEX A;  3IHV A;  3P2B A;  3D9M A;  2FI7 A;  3O48 A;  2MOW A;  2XGM A;  4J0U A;  3FEY A;  5HI7 A;  5HQ8 A;  5A7D B;  3VLE A;  2VSX E;  4I1A A;  3RIB A;  5FQ8 A;  3L54 A;  2KCL A;  3D9O A;  4UWG A;  4U8H A;  4HOR A;  4JXT A;  5BT1 A;  4Y6C A;  3UUX A;  3ZRH A;  2WQ7 A;  3CHR A;  3UQ3 A;  2V8S E;  3SZ7 A;  2L9B A;  4KYO B;  1WY6 A;  3B13 A;  1ZBP A;  3ZIM A;  2AVP A;  2WXP A;  3ASG A;  1E8Z A;  2XPI A;  5ARG A;  1E8W A;  3LKU A;  4GPK A;  1YA0 A;  4HLE A;  2X6F A;  4UQX A;  1FVF A;  4FJZ A;  1LF8 A;  3D9N A;  5G55 A;  4BT9 A;  4BTA A;  5KJN A;  2NC9 A;  3DBS A;  3TXN A;  4AV7 A;  4GYO A;  4HOT A;  3S2A A;  3PUJ A;  3HIZ A;  1UJK A;  3U4T A;  3FTZ A;  3VLD A;  5A6C A;  5JHB A;  3SHF A;  3RRU A;  2E2E A;  2M63 A;  4PH4 B;  4Q94 A;  4YVQ C;  2XRY A;  4C0M A;  2BTD A;  3ONK A;  3LPZ A;  4UWL A;  3MV2 B;  4KZC A;  1HU3 A;  4FA6 A;  3QK0 A;  3U9W A;  1IQU A;  4N3C A;  4AM9 A;  4APO A;  4HXI A;  4GZ6 A;  1FCH A;  3CVX A;  3FU0 A;  1H2T C;  4J8S A;  3L6A A;  1NZN A;  3PVL A;  3QWV A;  3FFL A;  3LY9 A;  4L23 A;  2OVB A;  1IQR A;  2X6I A;  3OXF A;  1N54 A;  3CK7 A;  3LJ3 A;  4KZ0 A;  4CT4 A;  3R9A B;  4EQF A;  3KAE A;  3QNK A;  4MKT A;  4WWO A;  4CDN A;  3ZPJ A;  3OXG A;  2GRL A;  4JW1 A;  3LYA A;  5G04 C;  4MRU A;  4U04 A;  1EDU A;  1H6K A;  3AU5 A;  4GZ3 A;  4GU5 A;  5T4Y A;  4C9B B;  2VTB A;  1MQS A;  1S0P A;  3I5P A;  4QFV A;  5LCW C;  2IQC A;  4CGW A;  3PE3 A;  3CK9 A;  5JJ6 A;  3TGO A;  3R7R A;  3CSF A;  4JHJ A;  1E8X A;  3CVQ A;  4RG9 A;  2XEV A;  2HO1 A;  2V5F A;  1JPL A;  3L08 A;  3EJN A;  3R7Q A;  3ZEF A;  5CCM A;  3QC1 A;  2LSV A;  4YND A;  5FTP A;  3FP3 A;  2WMN A;  4JZY A;  2ILR A;  3FTV A;  1HS6 A;  3LS8 A;  4D10 C;  3QAR A;  3CVP A;  4G25 A;  3TG5 A;  4BWR A;  3CHP A;  3APD A;  1JUQ A;  4URK A;  4NQ0 A;  3FUN A;  2KCK A;  5EX0 A;  5BPP A;  4DI4 A;  5LCW J;  4OVU A;  2J4D A;  2VQ2 A;  3AS8 A;  3FUI A;  3VTY A;  5C2Y A;  4HOS A;  1H19 A;  3QDN A;  3FDH A;  5FQ4 A;  3UT4 A;  2LAH A;  2WXL A;  3CGH A;  2XCC A;  3Q5M A;  4LEU A;  3ZYL A;  4K0R A;  4YVO A;  5A23 A;  3ASD A;  4CGV A;  2CFU A;  4PS7 A;  3Q47 B;  2FUL A;  2VSN A;  1QNF A;  2PL2 A;  3MV3 B;  2VSY A;  4I6J A;  4WUY A;  3SD5 A;  3Q4A B;  3VLF A;  2QY7 A;  4EZK A;  3D9K A;  4WNF A;  3CHS A;  4BTB A;  4GYW A;  1UN9 A;  4GA0 A;  1ELK A;  3BG0 B;  4FLH A;  2NXP A;  3RRM B;  3FHE A;  4HFG A;  3NQP A;  1HO8 A;  3B7T A;  4DPR A;  4U0Z A;  1KLX A;  4K03 A;  2Y4U A;  1U3C A;  3D3M A;  1OWM A;  4OVV A;  1L5J A;  3SBS A;  3CST A;  1HFA A;  3FY4 A;  4HVB A;  4A55 A;  2A5U A;  3ASH A;  3G2S A;  4JPS A;  5LOZ A;  4H7Y A;  2CHW A;  4JHK A;  2XGS A;  4ME2 A;  3FUJ A;  3I4G A;  4C0E A;  4V3I A;  2CG2 A;  4N2S A;  4WWN A;  4ACL A;  3D9I A;  1UW4 B;  2VTB B;  4J8E A;  4LUN U;  5DBK A;  3FUD A;  4UQY A;  4I17 A;  4N2Q A;  3CIA A;  2HYZ A;  1B89 A;  2X38 A;  3BEE A;  3MKQ A;  4LCT A;  4E85 A;  2Y4T A;  2L6J A;  2XRZ A;  1INZ A;  3CV0 A;  5CMW A;  4JVS A;  3D9P A;  1W3B A;  3ZYQ A;  3ENE A;  4B94 A;  2YHE A;  4ANW A;  3MEK A;  4N3A A;  3UPV A;  1DNP A;  4A3T A;  4H7X A;  4U0U A;  3PS6 A;  3PEV B;  3E4B A;  1GW6 A;  1Z3Y A;  4L2L A;  2VJ8 A;  2WXG A;  1NA3 A;  1HE8 A;  3OTN A;  4J8F A;  2UWJ G;  4KXK B;  5E75 A;  5G04 J;  3RO2 A;  3URZ A;  3CR3 A;  3FU3 A;  4IUL A;  3ESL A;  3BG1 B;  1ELW A;  5LP0 A;  2ZU6 B;  3EIQ C;  3HVE A;  3JUI A;  3PE4 A;  2JLB A;  4AP2 A;  3ZVV A;  3RO3 A;  3FH7 A;  3C98 A;  1EYH A;  2YIN A;  4L1B A;  3QAQ A;  4NRH B;  3B7S A;  2XCB A;  4U07 A;  4CDM A;  2X6J A;  1DVP A;  4F53 A;  1TJC A;  3KS2 A;  4CDR A;  2FBN A;  3HDX A;  1HXI A;  3CVL A;  4A3V A;  4XE0 A;  1EF1 C;  3PDN A;  1SZ9 A;  3ZXS A;  3LVQ E;  2VGY A;  3APC A;  4TUU A;  2KM4 A;  3SF4 A;  4TV3 A;  3S7F A;  4AJW A;  4ABN A;  4BFR A;  1FVH A;  2J09 A;  3ZW3 A;  3FH5 A;  4Y6W A;  5J08 A;  5KJL A;  4UI9 J;  4ATG A;  3ML9 A;  4IYP A;  5D0O D;  2C0L A;  2WXM A;  2WXJ A;  2IF4 A;  4HS2 A;  4WWP A;  2I2O A;  2AXU A;  3JQ0 A;  4MS6 A;  4AY6 A;  4L7T A;  2Q7F A;  3PRZ A;  4RG6 A;  1PY1 A;  3ZHE A;  4B8C B;  3FUK A;  4GCO A;  3S7B A;  2MRI A;  1PAQ A;  4JL0 A;  4AIF A;  4FAD A;  2DIW A;  2RG8 A;  4KT6 B;  5BNW A;  4BX9 A;  2J4B A;  4WAF A;  3RU0 A;  2WB2 A;  1HG5 A;  4WNG A;  4AXH A;  3HVE B;  2LO6 A;  5LX8 A;  2J9Q A;  1Y6I A;  4IRU A;  4E6H A;  1WAO 1;  1HX8 A;  2X6K A;  1OUV A;  2IJG X;  2WXR A;  4BY6 A;  4NAC A;  3CHM A;  1OWP A;  4GZ5 A;  4M3O A;  4XX5 A;  2OND A;  2UY1 A;  3ULQ A;  2A4Z A;  2LAI A;  3LXU X;  1QZ2 A;  4AY5 A;  5JHA A;  2AWI A;  3FUE A;  3ML8 A;  3GZ1 A;  5FZR A;  2KCV A;  5ANR A;  2VYI A;  3T8M A;  3L16 A;  4CCA A;  1WM5 A;  2X3M A;  2HM8 A;  5ARF A;  3MKQ B;  4EPZ A;  2VGX B;  2CG3 A;  3WXX A;  1Z6T A;  5FT9 A;  1NA0 A;  2XHE A;  2RD0 A;  2WMO A;  3B7U X;  4JA9 A;  3U66 A;  5CHE E;  4W9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...