2VGYA

Crystal structure of the yersinia enterocolitica type iii secretion translocator chaperone sycd (alternative dimer)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
123
Chain Sequence
NEISSDTLEQLYSLAFNQYQSGYEDAHVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIEPRFPFHAAECLLQGELAEAESGLFLAQELIANPEFELSTRVSSMLEAILEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE SYCD
publication title Structure of the Yersinia Enterocolitica Type III Secretion Chaperone Sycd
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Chaperone
total genus 40
structure length 123
sequence length 132
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07720 TPR_3 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vgyA00
3PDNA 3Q5MA 5FTPA 2FF4A 3TGOA 3Q47B 2E2EA 2XCBA 1B89A 3ZHEB 1NA0A 4U0UA 4WNEA 1WAO1 2VGXB 5EX3A 4AIFA 3RKVA 2Y4TA 2UY1A 5KJMA 4WNDA 1ELRA 3CEQA 3OXGA 4Y6CA 4HOSA 4WNFA 2LSUA 4UQZA 2LSVA 2R5SA 5G05J 3ESKA 3ZGQA 1TJCA 5AYWD 5G05C 4G23A 2IFUA 3RIBA 2PL2A 2FI7A 3OXFA 4I9CA 2FEZA 1NA3A 2KCVA 3GYZA 2UY1B 3Q15A 3JYSA 3O48A 5JJ6A 1ZBPA 1FCHA 2XGSA 3GW4A 4G25A 4APOA 3KAEA 3GZ2A 4GCNA 3QWVA 4GZ6A 4GYWA 1YA0A 4H7YA 3R9AB 2VQ2A 5BT1A 2JLBA 4I1AA 4XIFA 3UUXA 3ZN3A 5KJNA 1KLXA 2QFCA 2FO7A 3SZ7A 3CK7A 1HH8A 3BEEA 4GPKA 4BTAA 2KCLA 4LEUA 5G04C 3LY8A 4BT8A 5LCWJ 4G1TA 5FJYA 4BT9A 5LCWC 3ASGA 4GCOA 3MKRA 3Q49B 3SF4A 4UQXA 1Y8MA 4RG6A 4I9EA 2XEVA 3LY9A 4JHRA 4A1SA 4XI9A 2VSYA 4N3CA 3QWPA 1KT0A 3ZFWA 4UI9C 4N39A 2XGMA 4NQ0A 4O6FA 1E96B 3AS5A 5FZSA 4YNDA 1IHGA 4H7XA 4BTBA 3QKYA 2PQRA 4AY5A 2MHKA 4WUYA 2VSNA 4B94A 1KT1A 5D0OD 3QDNA 2AVPA 4G26A 3MA5A 4XI0A 3PE4A 4N2SA 3VTYA 4CGVA 4J8FA 4ABNA 1ZU2A 2PZIA 3LPZA 4GA2A 2KC7A 4ME2A 1HXIA 2XCCA 3LYAA 4HOUA 3RO2A 3EDTB 1WM5A 1NZNA 4G24A 3ZPJA 1W3BA 5BNWA 2XGOA 4GYYA 2IF4A 3ASFA 2OOEA 3CVLA 3WXXA 2NC9A 4BWRA 4GZ5A 5CCLA 5ARGA 4G2VA 3MV2B 4JA9A 3S7DA 2Q7FA 3GZ1A 3MEKA 3MV3B 2FBNA 4J8EA 2HR2A 4U07A 2J9QA 4F3VA 4CGWA 4I2ZA 3S7JA 3TG5A 3AS8A 4JA7A 4AY6A 2VYIA 3CKBA 4I2WA 4HORA 4JL0A 4EQFA 1P5QA 5A7DB 5FZQA 2VGYA 3ULQA 5FT9A 3CVPA 2YHCA 2C0LA 4U04A 2UWJG 3KS2A 5A6CA 5HQ8A 3CKCA 4GYOA 5FZRA 3ASDA 2HYZA 2Y4UA 4YVQC 4HOTA 3ASHA 4KXKB 5KJLA 2L6JA 3LY7A 2PQNA 2C0MA 4Y6WA 4WNGA 3U3WA 3UQ3A 1HZ4A 4GA0A 4KYOB 4IN3B 5CHEE 3CV0A 3CVNA 5JJTA 5EX0A 3VTXA 5D0QD 5CCMA 3FWVA 3S7FA 2XPIA 1IYGA 3N71A 5C1DA 4I17A 2BUGA 3OXLA 4N3BA 3Q4AB 2C2LA 3LKUA 3KD7A 3K9IA 4UQYA 4AM9A 2WQHA 3PE3A 5KJKA 5EKQD 3FFLA 3S7BA 5JJ7A 3NF1A 4HOQA 3HYMB 4N2QA 2DBAA 3URZA 2KATA 4KBQA 5M72A 3UPVA 3CK9A 3RO3A 2P58C 3QWWA 3RU0A 4UI9K 4J8DA 4NRHB 1XNFA 5BW8C 4J0UA 2GW1A 4GA1A 4GZ3A 1PC2A 3LCAA 2LNIA 4N3AA 5DIZA 2WPVA 1OUVA 5G04J 4U0SA 5DBKA 3QOUA 2V5FA 3U4TA 4W9RA 4CDRA 4N5CA 3E4BA 3CVQA 1ELWA 4U0ZA 2ONDA 4YVOA 3TG4A 5HI7A 1QQEA 4UI9J 3ZHEA 2HO1A 5ARFA 2I6HA 4RG9A 1A17A 2YQ8A 2VGXA 3TAXA 3IEGA 3CK8A 3FP3A 1QZ2A 3RJVA 3AS4A 2KCKA
chains in the Genus database with same CATH superfamily
2XENA 2DYRE 3TGOA 3Q47B 5CRUA 1NA0A 1XGWA 4RQIA 4U0UA 3SNXA 1TNYA 2VGXB 2Y1LE 1O5MA 2X38A 4AIFA 2HM8A 1JCSA 3PZ2A 4GTMA 3FTWA 2A4ZA 3B7BA 1ELRA 2RFMA 3OXGA 3CVVA 4HOSA 4GTTA 2R5SA 2WXLA 3CSTA 4FJZA 4AP2A 1TJCA 4HXIA 5G05C 2PL2A 2R17C 3NAWA 5BXOA 4I9CA 3IV0A 2KCVA 4HFGA 5CBOA 2UY1B 3Q15A 3IBEA 3O48A 5JJ6A 3Q78A 4KZ0A 3C3RA 1N52A 5BPPA 4I1AA 2GRRB 4GMLA 2F37A 3APDA 1NL4A 2DZOA 1ZB1A 4A3TA 2RKKA 3RSEG 1MX6A 1HH8A 1V54E 4YDWA 4U8HA 4BTAA 3LY8A 1V55E 3HXCA 4G1TA 5FJYA 3IHYA 5ENTD 4ACKA 5LCWC 3ASGA 3UI2A 1JWFA 2WXKA 4GCOA 3SF4A 1K1AA 3PNLB 4F1PA 5ENSD 2XEVA 2V8SE 1S0PA 1E8ZA 2VSYA 2RFAA 4P29A 3UM2A 4U95D 4UUCA 1TNUA 3CHMA 3BUAA 2GRQB 1E7VA 2GROB 4O6FA 5FZSA 2CG3A 1SA5A 2F0YA 3MKQA 3UT8A 2NSZA 4UWLA 4AY5A 3BU8A 3SI5A 5EIBE 2KZTA 2VSNA 4B94A 3TWUA 1KT1A 4I6EA 3D9MA 2PNNA 2AXVA 3RRUA 1SZ9A 3VTYA 1OCOE 1U3CA 4CGVA 4ABNA 4GMRA 2X6IA 3LPZA 2P9IG 3C72A 3V30A 1HXIA 2OEVA 3RO2A 3CHSA 4HB5A 3EDTB 5EYLA 4RSYA 1U3DA 5FQ7A 2XGOA 1H6PA 3ONKA 1SZAA 3ZXSA 2NC9A 2XZDG 5CCLA 3S7DA 4WAFA 1A5EA 3SQVA 4ACLA 3MV3B 2H6HA 4L2YA 3ULEG 2HR2A 3PZDA 5KWDA 4CGWA 2WXMA 1OWPA 1H6OA 3S7JA 5HS0A 3DXMG 1FT2A 2WXQA 1DVPA 4EQFA 5B1AE 3L16A 1PAQA 4WWOA 1N11A 5E76A 1UG3A 3PUJA 1TYQG 1FVHA 5IY5E 4U04A 2OVFA 4BY6A 3QC1A 3KS2A 5A6CA 1OWLA 2HE0A 3EU5A 5AN8A 1H6KA 4GYOA 2J8SD 1NP7A 3ZKJA 1NI1A 1MX2A 4KMOA 2L6JA 2EQXA 3JXIA 2VTBA 2IOSA 3FU0A 1MYOA 2WQ7A 3QARA 3C3QA 4J8SA 2VSOE 1KZPA 3CSFA 4I43A 3I4GA 3U3WA 2KXPC 5LOZA 3NOCD 4GA0A 1INZA 5CHEE 3CV0A 2DWZA 2WVIA 3FUKA 5AENA 3JUIA 1HS6A 2P9NG 3VTXA 4UWKA 5D0QD 2GGFA 2B6CA 4IULA 2H6GA 2ETCA 5ENPD 4HLEA 2QYUA 2WXFA 2P9LG 4U8YD 2BKKB 4I17A 2GRLA 2BUGA 3ESLA 4TXRA 3NQPA 4O60A 4RLYA 2AWIA 2DIWA 2I2OA 4BEPA 3DRAA 2WQHA 1TN7A 2CG2A 4A63B 1DCQA 5ENQD 3CVUA 3NF1A 2WXIA 4HOQA 3C5RA 3KEZA 4BESA 4FHKA 5M72A 3HRAA 1N94A 4LUNU 3RO3A 2E0IA 3DSSA 3QWWA 4UI9K 3T5XA 1E8YA 1NFIE 1PY1A 2CHWA 3IXEA 1D8DA 5KNHD 3L17A 1XNFA 3HDXA 2FO1E 3MCXA 4JXTA 4GZ3A 4ANWA 1LD7A 1H2UA 1D9SA 2V4HC 2WPVA 4Q94A 3E32A 2MOWA 5DBKA 2V5FA 4ANVA 4E85A 3ZNGA 4FULA 5E75A 1X5BA 1OCRE 1ELWA 3LEWA 3DBSA 1EDUA 1BD8A 2L9BA 3FUNA 3TG4A 3AG4E 4UI9J 1JWGA 3HHMA 1TN6A 3D9NA 2EILE 5ENOD 4EPZA 4JEUA 2ZXWE 4QQIA 3VLFA 2J09A 2VGXA 3G2VA 3CK8A 3RJVA 5AAOA 3JQ0A 2KCKA 2LAIA 3PDNA 2XHEA 3AU5A 3DEOA 4XKCA 1JUQA 5T4YA 4F7AA 4JB8P 5FQ6A 3AJIA 3DEPA 3RKVA 3D3MA 2XQ0A 2UY1A 3ABKE 4Y6CA 4WNFA 2LSUA 4UQZA 2LSVA 3CVWA 1JCRA 3ISMC 3FU6A 4G23A 2NYJA 4JPSA 1LD8A 2FI7A 5LX8A 1NA3A 2DVWA 3V2OA 3L22A 1FCHA 2XGSA 3SBSA 4G11A 1TJFA 3L08A 4CT4A 1OWOA 4U7EB 4EZJA 4H7YA 3R9AB 3TWSA 5BT1A 1SVXA 4XIFA 4ILIA 4JHKA 4J8YA 3SZ7A 4BX8A 3GZSA 4PS7A 3R7QA 4LEUA 3SFYA 3L9TA 4DJAA 4U8VD 3ZYKA 4AEZC 4OVVA 3KSLA 4B8CB 1ELKA 3LY9A 1IKND 3CHRA 3HXDA 3QWPA 2V0PA 3SO8A 3OTNA 5A23A 5JA4D 1E96B 3AS5A 4JZYA 4YNDA 1IHGA 2R2LA 1MHQA 4BTBA 4K5AB 1RW2A 2VJ8A 4ATZD 3PS6A 4HI9A 5D0OD 5HKPA 4L2LA 5G55A 3CR3A 3MA5A 2X6HA 3R9MA 3PE4A 4F1SA 3FH8A 3X2QE 3P2BA 5KNGA 4J7WA 4G24A 3PEUB 5FINA 3L82A 3BQOA 1U2VG 3V2XA 5KBAA 1YCSB 3ASFA 2DYSE 3CVLA 5EYPF 4U96D 3NZSA 5D2MC 1BU9A 4GZ5A 4BERA 3Q73A 2V4LA 3CVXA 4G2VA 1AP7A 2FBNA 3CGHA 4J8EA 4XX5A 1SQMA 5AQAA 5ENNA 4I6GA 4FP7A 2XRZA 4L9PA 4WWNA 1Y6IA 3AS8A 3SBTB 4JA7A 4AY6A 4JL0A 1Q2ZA 1P5QA 4KT6B 3D9HA 2VGYA 3Q79A 5EIDA 3J5PA 3I3NA 3MZLB 4HI8A 4LSZE 5AJLA 5HQ8A 1N4PA 4EZLA 4DX7D 3PZ1A 3ASDA 2HYZA 4DLQA 1KPSB 4YVQC 3ASHA 2IO2C 4I6JA 4AV7A 3APFA 1WDYA 1S63A 4KXKB 5JHBA 3LY7A 3B95A 1X81A 4EZKA 5JHAA 2VGEA 4PH4B 4CZ2D 3DXKG 2L6BA 3ZYLA 1H0AA 4JW1A 2AXUA 4WNGA 1MQSA 2IONA 4TV3A 5AIJA 3UQ3A 1HZ4A 3VLEA 1N4SA 4HQDA 3CVNA 1SW6A 1JPLA 3EHRA 4HS2A 4GTPA 4IYPA 3HVEB 2RD0A 3DSTA 3EHQA 2YINA 4KVOA 1IYGA 3FUMA 3LVQE 4LERA 3G2WA 4M3OA 4O1OA 2IY0C 5C1DA 2OVBA 3UX4A 3G2UA 3NOGD 3OXLA 2WB2A 4JC8A 2WXOA 3LKUA 3SHFA 2A5UA 1DCEA 1QYMA 3PE3A 3F6QA 2ZGDA 1S70B 5EKQD 2BKGA 3FFLA 3FHEA 5JJ7A 1TNBA 3OAWA 5EN5D 3HYMB 3B7RL 4K0RA 4KBQA 4HRMB 3ASOE 3UKUG 3CK9A 4J8DA 3SY2A 5FWQA 4FLBA 4A3VA 1TR4A 4B0ZA 1G3NB 5BW8C 3PREA 4GA1A 1PC2A 2R02A 3FH5A 1BI7B 5BV0A 1EPUA 2I1JA 3RAUA 1YYHA 4GTVA 5DIZA 1WY6A 1OUVA 3DSWA 4Q69A 3QOUA 5C2YA 2A5EA 3U4TA 3CQGB 4W9RA 4N5CA 1MJ0A 3CHPA 3E4BA 4CEMA 4RVBA 2CHZA 3EIJA 3FULA 2X6JA 2HO1A 1QBQA 2AXZA 2WXGA 5ARFA 3LJNA 4DX2A 1IQRA 4RG9A 1A17A 2YQ8A 1BI8B 4DX1A 4JHJA 3KEAA 1HU3A 1K1BA 4AVXA 1HG5A 5AQ7A 4GTQA 4JEHA 1B89A 2WM9A 4DI3A 3ZHEB 3Q9UC 4KVMA 1UN8A 4GTRA 4FHJA 4HRNA 5T8IA 5EX3A 4ZFHA 1OWMA 2LXLA 4JD2G 4LG6A 4MKTA 3CEQA 5G2NA 2JEKA 4PS3A 4LRZA 2XPYA 3LVRE 3MJWA 1MZCA 5EDSA 1FPPA 3CHOA 3ESKA 3ZIMA 3AG3E 3HXFA 4APFA 2LXMA 1OWNA 2X6FA 2FEZA 3GYZA 2F8XK 1Z3XA 1ZBPA 4G25A 3ML9A 3UM3A 3KAEA 3GZ2A 4DLOA 3R7RA 4C48B 4XZ4A 3QWVA 4GZ6A 1YA0A 3D9LA 2VQ2A 4NURA 3O4ZA 2WMOA 2JLBA 2I1KA 3PH0C 3QB2A 2J07A 3TXNA 3ZN3A 4DK5A 2R05A 1KLXA 1Z6TA 4DX5D 3SFXA 2NXPA 3WG7E 4C0MA 2ZGGA 2X3MA 3CK7A 1IHBA 1WG0A 4NIKA 4L23A 4GPKA 4LNGA 3I4RB 4NACA 4WWPA 2KCLA 4I1OB 5J08A 5G04C 2ILRA 4BT9A 2L0IA 2CFZA 3ZU7B 3DPDA 3Q49B 4U63A 1UW4B 4HLLA 4JHRA 4A1SA 4FC8A 3V79K 3MGBA 1KT0A 4HBDA 2ETBA 2XGMA 3AG2E 1OCCE 3B7SA 4H7XA 5B3SE 2EIME 3FTYA 2MHKA 1O1RA 4WUYA 4C9BB 4BFRA 4EBAA 4EHMA 3CIAA 3TXMA 4UWHA 2IOLA 2AVPA 4G26A 5ITZF 4XI0A 3LDZA 3AU4A 2EINE 4HRLA 4X8QA 2VTBB 3UKRG 5FQ4A 2GRNB 5H7PA 2KC7A 4ME2A 3LYAA 1KZOA 1NZNA 2P9KG 4ATGA 1N54A 4OAUC 4GYYA 1BPOA 2OOEA 3WXXA 3FU3A 4BWRA 2B0OE 1HO8A 1S64A 5ARGA 1IXVA 1HG2A 2F8YA 2H6IA 5AQBA 1UOHA 3P1UA 4GB9A 4PS8A 1AWCB 4HNAD 2J9QA 4F3VA 4ILGA 3BG1B 4I2ZA 5FQ8A 2Y69E 4K03A 2IEJA 4GZCA 2XS1A 3ZVVA 4CRWA 4I2WA 2LAHA 1N95A 3APCA 4MRUA 5FZQA 4OYSA 2R03A 1HF8A 3ULQA 5FT9A 3KSQA 3PZ3A 2C0LA 3D9OA 3QAQA 3SGHA 1IQUA 3CKCA 3QNKA 4Q96A 5FZRA 5EILA 4BSZB 4CCAA 2Y4UA 3UM0A 2OCCE 4HOTA 4TUMA 4YDYA 3JXJA 2P9SG 4F6RD 5AJDA 2WXHA 4GTOA 5KJLA 2PQNA 2IO3C 3PUKA 5T3RA 5BV1A 5AQ9A 3T9KA 3D9JA 1N4RA 4LCTA 2C0MA 1UJJA 4TRQA 3D9PA 3FTSA 5D66A 3E34A 2WXPA 3HVEA 4LNUD 4Y6WA 4K5CA 2XZTG 3Q7AA 3FUHA 4JVSA 5CEAA 1N4QA 2WXJA 4K5BA 3ML8A 2GRPB 3T8MA 5ANLA 5JJTA 2VSXE 3TJPA 2GRMA 1E7UA 3ASNE 3FWVA 3S7FA 2XPIA 3I5PA 3N71A 2XPZA 1HFAA 3CHQA 2OV8A 2Y3AA 1N9AA 2ETAA 3Q75A 4I1MA 3KD7A 3EJNA 4AXHA 5CBNA 2JABA 3HXEA 4PDXA 3FY4A 3FH7A 2DBAA 3FUEA 4AJWA 2KATA 3PEVB 1BLXB 3UPVA 3FTVA 4G8LA 4E6HA 3UINC 1L5JA 1FT1A 3BG0B 4DI4A 2P9PG 3W9GA 5JMND 1TN8A 3T5VA 1E8XA 3E33A 4J0UA 2GW1A 4CT0A 3LCAA 4CDNA 1N0QA 2BEDA 5LFAA 2H6FA 4N3AA 1H2TC 3EU9A 3U64A 5J90A 3W9FA 2AW6A 3VLDA 4EBAG 3CVQA 3UMVA 4L1BA 4U0ZA 3HG0D 3V31A 4FADA 2ONDA 2QY7A 4IRUA 3AAAC 4YVOA 4A55A 2QYJA 1QQEA 4M7CA 3FTXA 3ZHEA 3DSUA 1H2VC 3TWRA 2KBXA 5CMWA 3FU5A 3FTUA 5B1BE 2X6KA 3TWWA 3AS4A 3Q5MA 5FTPA 2FF4A 3LS8A 2MRIA 2E2EA 2XCBA 2P9UG 5CMYA 4B89A 1OT8A 3QK0A 3G2TA 4WNEA 4GPMA 1LTXA 1WAO1 4XKBA 4ILHB 3TWVA 2EIJE 3ZRHA 2Y4TA 5KJMA 4WNDA 2M63A 5BUZA 5G05J 1GW6A 3FUDA 3FUFA 3ZGQA 3L6AA 2XEEA 2PM7A 5AYWD 1K8KG 2J49A 4MLPA 3E37A 2IFUA 4DRXE 3RIBA 3DSVA 1E90A 3OXFA 1MX4A 3JYSA 5KCMA 3GW4A 4GMJA 4F53A 2WMNA 4APOA 4GCNA 4BX9A 3FDHA 4GYWA 4FJYA 2ZIRA 1HX8A 3UUXA 2J4DA 5KJNA 1EYHA 2QFCA 4XE0A 4FU3A 2FO7A 4UWGA 3C3OA 2BF0X 1UN9A 1N0RA 3BEEA 3MX3A 1TEZA 4BT8A 3TWTA 5LCWJ 2L0TB 4YDOA 3LXUX 3MKRA 1Y8MA 4UQXA 4RG6A 4I9EA 3NBNB 3ZXPA 4V3IA 4XI9A 2LUHA 3QJZA 4N3CA 3NZUA 3ZFWA 3D9KA 4UI9C 4AOFA 4G8KA 4N39A 4BSXA 4GAAA 1OXJA 4PUCA 4FA6A 4NQ0A 3SFZA 1TNOA 2CHXA 3QKYA 3ZEFA 2PQRA 3ABLE 1E8WA 2Y0BG 2DZNA 4KZCA 3EUVA 2IQCA 5FIOA 1DNPA 3IHVA 1OY3D 2XRYA 3HIZA 3IKOB 3QDNA 3NB2A 3EIQC 3FUIA 4N2SA 2EIKE 4L7TA 3FEYA 1HE8A 3DSXA 3FUJA 3MKQB 5CERB 4J8FA 3UTMA 1TNZA 2IJGX 1ZU2A 3ONLA 2PZIA 3ABME 2KZTB 4GA2A 2WQ6A 2XCCA 3L13A 4HOUA 2J4BA 4B93B 3UIPC 4TXPA 5BXUA 1WM5A 3EHNA 3ZPJA 5LP0A 1W3BA 5BNWA 3PZ4A 3D9IA 2MYOA 2XEHA 1VDYA 2IF4A 3AG1E 1H19A 3U9WA 3ZW3A 4EECA 4N5QA 3S2AA 3ENEA 3MV2B 5ENRD 4JA9A 2Q7FA 3GZ1A 1Z3YA 3JQ1A 3MEKA 5HRYA 3ZYQA 4OAVB 3CLJA 4BETA 3T8KA 4U07A 3B7UX 3ULYA 3Q9NC 3TG5A 2VYIA 2IU1A 3DPYA 1SA4A 3CKBA 4HORA 1Z5SC 4J6IA 5A7DB 2XS8A 4GZDA 3ZUVB 3TWXA 4ANXA 3CVPA 4GU5A 2KM4A 3RK6A 2YHCA 3ZYMA 3EHMA 2UWJG 5AARA 1D8EA 3TWQA 3RRNB 3HXBA 2I9CA 5CRVA 2LO6A 1K3ZD 3Q7FA 1LF8A 3PNTB 2ZU6B 1EF1C 3U66A 4YDEA 3FEXA 3UIOC 4KYOB 2V5QC 4IN3B 4TUUA 4D10C 1DC2A 4Z68A 4ANUA 3C98A 2CFUA 4MBGA 4B8AA 5EX0A 4DPRA 4CYMD 3TL5A 4UWFA 1O1TA 5CCMA 2P2CP 3PVLA 3B13A 1QNFA 3L54A 2WXNA 3UT7A 3CVYA 3JCKC 4N3BA 3RRMB 1OCZE 3Q4AB 3J5QB 4R7LA 5CECB 2C2LA 3K9IA 4UQYA 2DCPA 2RG8A 4AM9A 4TXQA 5KJKA 3FTZA 3JUEA 3E30A 2QZAA 2WXRA 3S7BA 1RZ4A 4XEIG 4GTSA 3URZA 4N2QA 4MS6A 1UJKA 4ZHBA 3MYVA 2R59A 3LJ3A 2P58C 3RU0A 2QC9A 2YHEA 4LNBA 4QFVA 1YMPA 4NRHB 2OEWA 4HVBA 3B7TA 4FLHA 3G2SA 1O1SA 3SD5A 2LNIA 3UM1A 2J08A 2YNQA 4A1GA 4OVUA 5G04J 2AJAA 3DWLG 4U0SA 5ANRA 4O1PA 1FVFA 4CDRA 2ZISA 5CEDB 4DX6D 4C0EA 4DUIA 5HI7A 2BTDA 4CDMA 2PM6A 4URKA 3CQCB 2I6HA 2FULA 1JCQA 3UT4A 3TAXA 3UXGA 3IEGA 3FP3A 3PRZA 1QZ2A
chains in the Genus database with same CATH topology
2LAIA 3PDNA 3Q5MA 5FTPA 2FF4A 2XHEA 3LS8A 2MRIA 4JEHA 3Q47B 3AU5A 2E2EA 3TGOA 2XCBA 4XKCA 1B89A 1JUQA 2WM9A 5T4YA 4DI3A 3ZHEB 4F7AA 1NA0A 1XGWA 4U0UA 5CMYA 4KVMA 4B89A 5FQ6A 1UN8A 3QK0A 4FHJA 3SNXA 3G2TA 4WNEA 1WAO1 5T8IA 2VGXB 5EX3A 4XKBA 1OWMA 4ILHB 2X38A 4AIFA 2HM8A 3RKVA 3D3MA 2XQ0A 3ZRHA 2Y4TA 3FTWA 2A4ZA 2UY1A 5KJMA 4MKTA 4WNDA 1ELRA 2M63A 3CEQA 5G2NA 2JEKA 3OXGA 3CVVA 4Y6CA 4PS3A 4HOSA 4LRZA 4WNFA 2LSUA 4UQZA 2LSVA 2R5SA 2WXLA 2XPYA 3CVWA 3LVRE 3CSTA 3MJWA 5BUZA 5G05J 5EDSA 1GW6A 3CHOA 3ESKA 3FUDA 3FUFA 3L6AA 4FJZA 3ZGQA 4AP2A 2PM7A 3ZIMA 1TJCA 5AYWD 4APFA 2J49A 4MLPA 3FU6A 4HXIA 5G05C 4G23A 4JPSA 2IFUA 3RIBA 2PL2A 2R17C 1OWNA 2FI7A 1E90A 3OXFA 4I9CA 2X6FA 3IV0A 5LX8A 2FEZA 1NA3A 2KCVA 4HFGA 3GYZA 3L22A 1Z3XA 2UY1B 3Q15A 3JYSA 3IBEA 5KCMA 3O48A 1ZBPA 5JJ6A 1FCHA 2XGSA 3GW4A 4G25A 3ML9A 4GMJA 4F53A 4KZ0A 2WMNA 3KAEA 3SBSA 4APOA 3GZ2A 4DLOA 3R7RA 4G11A 4XZ4A 4GCNA 1TJFA 3L08A 4BX9A 4CT4A 3QWVA 1OWOA 3FDHA 4GZ6A 4FJYA 1YA0A 4GYWA 4EZJA 3D9LA 4H7YA 3R9AB 2VQ2A 4NURA 5BT1A 1N52A 2WMOA 3O4ZA 5BPPA 2JLBA 1HX8A 4I1AA 4XIFA 4GMLA 2I1KA 3UUXA 2J4DA 3PH0C 3QB2A 2J07A 3TXNA 3ZN3A 5KJNA 3APDA 1EYHA 4ILIA 4JHKA 4DK5A 1KLXA 2QFCA 1Z6TA 4XE0A 4A3TA 4FU3A 2NXPA 2FO7A 4UWGA 3SZ7A 4C0MA 2BF0X 2X3MA 3CK7A 4BX8A 3GZSA 1HH8A 1UN9A 4PS7A 4L23A 3BEEA 4GPKA 3MX3A 3R7QA 3I4RB 4NACA 4U8HA 4BTAA 4WWPA 2KCLA 4I1OB 5J08A 4LEUA 1TEZA 5G04C 3LY8A 4BT8A 5LCWJ 4G1TA 2L0TB 5FJYA 3IHYA 2ILRA 4DJAA 4BT9A 2L0IA 3ZYKA 4ACKA 5LCWC 3ASGA 4AEZC 1JWFA 2CFZA 4OVVA 2WXKA 3LXUX 3DPDA 3MKRA 3Q49B 4GCOA 3SF4A 4U63A 3PNLB 1Y8MA 4UQXA 1UW4B 4RG6A 4B8CB 4I9EA 1ELKA 2XEVA 3LY9A 2V8SE 4JHRA 1S0PA 4A1SA 4FC8A 4V3IA 4XI9A 1E8ZA 2VSYA 3CHRA 3QJZA 4N3CA 4P29A 3NZUA 3MGBA 3QWPA 1KT0A 2V0PA 3ZFWA 3D9KA 4UI9C 4AOFA 3CHMA 4N39A 4BSXA 4GAAA 4PUCA 4FA6A 1E7VA 3OTNA 2XGMA 4NQ0A 4O6FA 5A23A 1E96B 2CG3A 3AS5A 4JZYA 5FZSA 3SFZA 4YNDA 1IHGA 3MKQA 3B7SA 3UT8A 4H7XA 1MHQA 4BTBA 2CHXA 3QKYA 3ZEFA 2NSZA 3FTYA 2PQRA 4UWLA 1E8WA 2VJ8A 4AY5A 2MHKA 3SI5A 4WUYA 4C9BB 4KZCA 2KZTA 4BFRA 4EBAA 2VSNA 3PS6A 4B94A 2IQCA 1KT1A 4I6EA 1DNPA 5D0OD 3IHVA 3CIAA 3D9MA 3TXMA 2XRYA 4L2LA 4UWHA 3HIZA 3CR3A 3IKOB 2IOLA 3QDNA 2AXVA 5G55A 2AVPA 4G26A 3MA5A 2X6HA 3EIQC 4XI0A 3PE4A 3RRUA 3FUIA 3LDZA 4N2SA 1SZ9A 3AU4A 4L7TA 4F1SA 3FH8A 3FEYA 3VTYA 1HE8A 3FUJA 3MKQB 1U3CA 4CGVA 4J8FA 4ABNA 2IJGX 2VTBB 1ZU2A 3ONLA 2X6IA 5FQ4A 2PZIA 2KZTB 3LPZA 4GA2A 2WQ6A 2KC7A 3P2BA 4ME2A 1HXIA 2XCCA 3L13A 3LYAA 4HOUA 2J4BA 3RO2A 3CHSA 3EDTB 1WM5A 3EHNA 1NZNA 4G24A 3PEUB 4RSYA 3ZPJA 5LP0A 1W3BA 1U3DA 4ATGA 5BNWA 3D9IA 5FQ7A 1N54A 2XGOA 4GYYA 1HG5A 1VDYA 1BPOA 2IF4A 3ASFA 1H19A 3U9WA 2OOEA 3CVLA 3ONKA 3WXXA 3ZW3A 1SZAA 3FU3A 3ZXSA 3NZSA 2NC9A 4BWRA 4EECA 4GZ5A 5CCLA 3S2AA 2V4LA 3CVXA 1HO8A 5ARGA 4G2VA 1HG2A 3ENEA 3MV2B 4JA9A 4WAFA 3S7DA 2Q7FA 4ACLA 3GZ1A 1Z3YA 3JQ1A 3MEKA 3MV3B 2FBNA 3ZYQA 3P1UA 3CGHA 4GB9A 4J8EA 4XX5A 1SQMA 4L2YA 3CLJA 4PS8A 5ENNA 4I6GA 2HR2A 4U07A 2J9QA 3PZDA 4ILGA 4FP7A 4F3VA 2XRZA 3B7UX 3BG1B 4CGWA 2WXMA 4I2ZA 4WWNA 5FQ8A 1OWPA 1Y6IA 4K03A 4GZCA 3S7JA 3TG5A 3AS8A 3SBTB 4JA7A 4AY6A 3ZVVA 2VYIA 4CRWA 2WXQA 2IU1A 1DVPA 3CKBA 4I2WA 4HORA 4JL0A 4EQFA 2LAHA 4J6IA 1P5QA 5A7DB 3L16A 1PAQA 4WWOA 4KT6B 3APCA 4GZDA 4MRUA 5FZQA 4OYSA 5E76A 2VGYA 1HF8A 3ULQA 5FT9A 1UG3A 4ANXA 3PUJA 3CVPA 4GU5A 2KM4A 3RK6A 2YHCA 3I3NA 2C0LA 3D9OA 3MZLB 1FVHA 3ZYMA 5AJLA 3EHMA 4U04A 2UWJG 2OVFA 3QAQA 3QC1A 4BY6A 3SGHA 3KS2A 4EZLA 1IQUA 5A6CA 5HQ8A 1OWLA 3CKCA 3QNKA 1H6KA 4GYOA 4Q96A 5FZRA 3RRNB 1NP7A 3ASDA 2HYZA 4CCAA 2Y4UA 4YVQC 2I9CA 4DLQA 4HOTA 3ASHA 4I6JA 4AV7A 2LO6A 3APFA 4KMOA 5AJDA 2WXHA 4KXKB 5JHBA 5KJLA 2L6JA 2EQXA 2PQNA 3LY7A 5T3RA 3PUKA 5BV1A 1LF8A 4EZKA 5JHAA 3D9JA 2VTBA 4LCTA 2C0MA 1UJJA 4PH4B 2IOSA 3FU0A 3D9PA 3FTSA 4TRQA 2WQ7A 3QARA 3ZYLA 1H0AA 2WXPA 3PNTB 4JW1A 3HVEA 4J8SA 2VSOE 2AXUA 4WNGA 2ZU6B 4Y6WA 1EF1C 3CSFA 4I43A 3U66A 1MQSA 3I4GA 2IONA 4TV3A 3FUHA 3U3WA 5LOZA 4JVSA 5AIJA 3FEXA 3UQ3A 1HZ4A 4GA0A 4KYOB 3VLEA 1INZA 4IN3B 4TUUA 4D10C 5CHEE 2WXJA 3CV0A 2WVIA 3CVNA 4ANUA 3C98A 3FUKA 2CFUA 3ML8A 3T8MA 5ANLA 5AENA 3JUIA 1JPLA 5JJTA 4B8AA 5EX0A 4DPRA 1HS6A 4HS2A 3VTXA 2VSXE 4IYPA 4UWKA 3HVEB 5D0QD 3TL5A 3TJPA 4UWFA 2GRMA 2GGFA 2RD0A 5CCMA 1E7UA 3FWVA 3S7FA 2XPIA 3PVLA 2YINA 4IULA 4KVOA 3I5PA 3B13A 1QNFA 3N71A 1IYGA 3FUMA 3L54A 3LVQE 2XPZA 1HFAA 4HLEA 4LERA 2WXFA 3CHQA 3G2WA 4M3OA 5C1DA 2OVBA 2WXNA 3UX4A 3G2UA 4I17A 2GRLA 2OV8A 2Y3AA 2BUGA 3JCKC 3OXLA 3ESLA 3UT7A 3CVYA 4N3BA 3NQPA 3RRMB 3Q4AB 2WB2A 4JC8A 2WXOA 4R7LA 4I1MA 2C2LA 2AWIA 2DIWA 2I2OA 3K9IA 3KD7A 3LKUA 2A5UA 4UQYA 3SHFA 2DCPA 2RG8A 4AM9A 2WQHA 3PE3A 2CG2A 3EJNA 3FTZA 5KJKA 4AXHA 5EKQD 3FFLA 2WXRA 3FHEA 3S7BA 5JJ7A 3NF1A 4PDXA 3CVUA 3OAWA 2WXIA 3FY4A 3HYMB 3FH7A 2DBAA 3FUEA 4HOQA 3KEZA 3URZA 4AJWA 4N2QA 2KATA 3B7RL 1UJKA 4MS6A 4K0RA 4FHKA 4KBQA 5M72A 3MYVA 3PEVB 4LUNU 2R59A 3UPVA 3FTVA 3CK9A 4E6HA 3RO3A 2E0IA 1L5JA 2P58C 3LJ3A 3QWWA 3RU0A 4UI9K 4J8DA 3T5XA 5FWQA 1E8YA 2YHEA 3BG0B 4DI4A 1PY1A 2CHWA 4FLBA 4QFVA 4A3VA 4B0ZA 3T5VA 1E8XA 4NRHB 3L17A 1XNFA 5BW8C 3HDXA 4J0UA 4HVBA 2GW1A 3PREA 3B7TA 3MCXA 4JXTA 4GA1A 4GZ3A 4CT0A 1PC2A 4FLHA 3G2SA 3LCAA 4CDNA 4ANWA 3FH5A 5LFAA 5BV0A 1EPUA 3SD5A 1H2UA 2I1JA 2LNIA 4N3AA 5DIZA 1H2TC 1WY6A 3U64A 2WPVA 5J90A 2J08A 2YNQA 1OUVA 4A1GA 4OVUA 5G04J 4Q94A 2MOWA 4U0SA 5ANRA 5DBKA 4Q69A 3QOUA 2V5FA 4ANVA 5C2YA 2AW6A 3U4TA 4E85A 4FULA 3CQGB 4W9RA 3VLDA 1FVFA 5E75A 4CDRA 1X5BA 4N5CA 3CHPA 4EBAG 3E4BA 3CVQA 1ELWA 3LEWA 4L1BA 3UMVA 3DBSA 4C0EA 4CEMA 4U0ZA 4RVBA 2CHZA 1EDUA 4FADA 2ONDA 2QY7A 2L9BA 3EIJA 4IRUA 3FUNA 3FULA 4YVOA 2X6JA 3TG4A 5HI7A 4A55A 2BTDA 1QQEA 4CDMA 4UI9J 3FTXA 3ZHEA 1JWGA 2HO1A 2PM6A 3HHMA 4URKA 2AXZA 2WXGA 3CQCB 5ARFA 2I6HA 3D9NA 1IQRA 4EPZA 4RG9A 4JEUA 3VLFA 1A17A 2FULA 2YQ8A 2J09A 3UT4A 2VGXA 1H2VC 3G2VA 3TAXA 5CMWA 4JHJA 3FU5A 3FTUA 3IEGA 3CK8A 3FP3A 3PRZA 2X6KA 1QZ2A 1HU3A 3RJVA 3AS4A 4AVXA 3JQ0A 2KCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PDN A;  3Q5M A;  5FTP A;  2FF4 A;  3TGO A;  3Q47 B;  2E2E A;  2XCB A;  1B89 A;  3ZHE B;  1NA0 A;  4U0U A;  4WNE A;  1WAO 1;  2VGX B;  5EX3 A;  4AIF A;  3RKV A;  2Y4T A;  2UY1 A;  5KJM A;  4WND A;  1ELR A;  3CEQ A;  3OXG A;  4Y6C A;  4HOS A;  4WNF A;  2LSU A;  4UQZ A;  2LSV A;  2R5S A;  5G05 J;  3ESK A;  3ZGQ A;  1TJC A;  5AYW D;  5G05 C;  4G23 A;  2IFU A;  3RIB A;  2PL2 A;  2FI7 A;  3OXF A;  4I9C A;  2FEZ A;  1NA3 A;  2KCV A;  3GYZ A;  2UY1 B;  3Q15 A;  3JYS A;  3O48 A;  5JJ6 A;  1ZBP A;  1FCH A;  2XGS A;  3GW4 A;  4G25 A;  4APO A;  3KAE A;  3GZ2 A;  4GCN A;  3QWV A;  4GZ6 A;  4GYW A;  1YA0 A;  4H7Y A;  3R9A B;  2VQ2 A;  5BT1 A;  2JLB A;  4I1A A;  4XIF A;  3UUX A;  3ZN3 A;  5KJN A;  1KLX A;  2QFC A;  2FO7 A;  3SZ7 A;  3CK7 A;  1HH8 A;  3BEE A;  4GPK A;  4BTA A;  2KCL A;  4LEU A;  5G04 C;  3LY8 A;  4BT8 A;  5LCW J;  4G1T A;  5FJY A;  4BT9 A;  5LCW C;  3ASG A;  4GCO A;  3MKR A;  3Q49 B;  3SF4 A;  4UQX A;  1Y8M A;  4RG6 A;  4I9E A;  2XEV A;  3LY9 A;  4JHR A;  4A1S A;  4XI9 A;  2VSY A;  4N3C A;  3QWP A;  1KT0 A;  3ZFW A;  4UI9 C;  4N39 A;  2XGM A;  4NQ0 A;  4O6F A;  1E96 B;  3AS5 A;  5FZS A;  4YND A;  1IHG A;  4H7X A;  4BTB A;  3QKY A;  2PQR A;  4AY5 A;  2MHK A;  4WUY A;  2VSN A;  4B94 A;  1KT1 A;  5D0O D;  3QDN A;  2AVP A;  4G26 A;  3MA5 A;  4XI0 A;  3PE4 A;  4N2S A;  3VTY A;  4CGV A;  4J8F A;  4ABN A;  1ZU2 A;  2PZI A;  3LPZ A;  4GA2 A;  2KC7 A;  4ME2 A;  1HXI A;  2XCC A;  3LYA A;  4HOU A;  3RO2 A;  3EDT B;  1WM5 A;  1NZN A;  4G24 A;  3ZPJ A;  1W3B A;  5BNW A;  2XGO A;  4GYY A;  2IF4 A;  3ASF A;  2OOE A;  3CVL A;  3WXX A;  2NC9 A;  4BWR A;  4GZ5 A;  5CCL A;  5ARG A;  4G2V A;  3MV2 B;  4JA9 A;  3S7D A;  2Q7F A;  3GZ1 A;  3MEK A;  3MV3 B;  2FBN A;  4J8E A;  2HR2 A;  4U07 A;  2J9Q A;  4F3V A;  4CGW A;  4I2Z A;  3S7J A;  3TG5 A;  3AS8 A;  4JA7 A;  4AY6 A;  2VYI A;  3CKB A;  4I2W A;  4HOR A;  4JL0 A;  4EQF A;  1P5Q A;  5A7D B;  5FZQ A;  2VGY A;  3ULQ A;  5FT9 A;  3CVP A;  2YHC A;  2C0L A;  4U04 A;  2UWJ G;  3KS2 A;  5A6C A;  5HQ8 A;  3CKC A;  4GYO A;  5FZR A;  3ASD A;  2HYZ A;  2Y4U A;  4YVQ C;  4HOT A;  3ASH A;  4KXK B;  5KJL A;  2L6J A;  3LY7 A;  2PQN A;  2C0M A;  4Y6W A;  4WNG A;  3U3W A;  3UQ3 A;  1HZ4 A;  4GA0 A;  4KYO B;  4IN3 B;  5CHE E;  3CV0 A;  3CVN A;  5JJT A;  5EX0 A;  3VTX A;  5D0Q D;  5CCM A;  3FWV A;  3S7F A;  2XPI A;  1IYG A;  3N71 A;  5C1D A;  4I17 A;  2BUG A;  3OXL A;  4N3B A;  3Q4A B;  2C2L A;  3LKU A;  3KD7 A;  3K9I A;  4UQY A;  4AM9 A;  2WQH A;  3PE3 A;  5KJK A;  5EKQ D;  3FFL A;  3S7B A;  5JJ7 A;  3NF1 A;  4HOQ A;  3HYM B;  4N2Q A;  2DBA A;  3URZ A;  2KAT A;  4KBQ A;  5M72 A;  3UPV A;  3CK9 A;  3RO3 A;  2P58 C;  3QWW A;  3RU0 A;  4UI9 K;  4J8D A;  4NRH B;  1XNF A;  5BW8 C;  4J0U A;  2GW1 A;  4GA1 A;  4GZ3 A;  1PC2 A;  3LCA A;  2LNI A;  4N3A A;  5DIZ A;  2WPV A;  1OUV A;  5G04 J;  4U0S A;  5DBK A;  3QOU A;  2V5F A;  3U4T A;  4W9R A;  4CDR A;  4N5C A;  3E4B A;  3CVQ A;  1ELW A;  4U0Z A;  2OND A;  4YVO A;  3TG4 A;  5HI7 A;  1QQE A;  4UI9 J;  3ZHE A;  2HO1 A;  5ARF A;  2I6H A;  4RG9 A;  1A17 A;  2YQ8 A;  2VGX A;  3TAX A;  3IEG A;  3CK8 A;  3FP3 A;  1QZ2 A;  3RJV A;  3AS4 A;  2KCK A; 
#chains in the Genus database with same CATH topology
 2XEN A;  2DYR E;  3TGO A;  3Q47 B;  5CRU A;  1NA0 A;  1XGW A;  4RQI A;  4U0U A;  3SNX A;  1TNY A;  2VGX B;  2Y1L E;  1O5M A;  2X38 A;  4AIF A;  2HM8 A;  1JCS A;  3PZ2 A;  4GTM A;  3FTW A;  2A4Z A;  3B7B A;  1ELR A;  2RFM A;  3OXG A;  3CVV A;  4HOS A;  4GTT A;  2R5S A;  2WXL A;  3CST A;  4FJZ A;  4AP2 A;  1TJC A;  4HXI A;  5G05 C;  2PL2 A;  2R17 C;  3NAW A;  5BXO A;  4I9C A;  3IV0 A;  2KCV A;  4HFG A;  5CBO A;  2UY1 B;  3Q15 A;  3IBE A;  3O48 A;  5JJ6 A;  3Q78 A;  4KZ0 A;  3C3R A;  1N52 A;  5BPP A;  4I1A A;  2GRR B;  4GML A;  2F37 A;  3APD A;  1NL4 A;  2DZO A;  1ZB1 A;  4A3T A;  2RKK A;  3RSE G;  1MX6 A;  1HH8 A;  1V54 E;  4YDW A;  4U8H A;  4BTA A;  3LY8 A;  1V55 E;  3HXC A;  4G1T A;  5FJY A;  3IHY A;  5ENT D;  4ACK A;  5LCW C;  3ASG A;  3UI2 A;  1JWF A;  2WXK A;  4GCO A;  3SF4 A;  1K1A A;  3PNL B;  4F1P A;  5ENS D;  2XEV A;  2V8S E;  1S0P A;  1E8Z A;  2VSY A;  2RFA A;  4P29 A;  3UM2 A;  4U95 D;  4UUC A;  1TNU A;  3CHM A;  3BUA A;  2GRQ B;  1E7V A;  2GRO B;  4O6F A;  5FZS A;  2CG3 A;  1SA5 A;  2F0Y A;  3MKQ A;  3UT8 A;  2NSZ A;  4UWL A;  4AY5 A;  3BU8 A;  3SI5 A;  5EIB E;  2KZT A;  2VSN A;  4B94 A;  3TWU A;  1KT1 A;  4I6E A;  3D9M A;  2PNN A;  2AXV A;  3RRU A;  1SZ9 A;  3VTY A;  1OCO E;  1U3C A;  4CGV A;  4ABN A;  4GMR A;  2X6I A;  3LPZ A;  2P9I G;  3C72 A;  3V30 A;  1HXI A;  2OEV A;  3RO2 A;  3CHS A;  4HB5 A;  3EDT B;  5EYL A;  4RSY A;  1U3D A;  5FQ7 A;  2XGO A;  1H6P A;  3ONK A;  1SZA A;  3ZXS A;  2NC9 A;  2XZD G;  5CCL A;  3S7D A;  4WAF A;  1A5E A;  3SQV A;  4ACL A;  3MV3 B;  2H6H A;  4L2Y A;  3ULE G;  2HR2 A;  3PZD A;  5KWD A;  4CGW A;  2WXM A;  1OWP A;  1H6O A;  3S7J A;  5HS0 A;  3DXM G;  1FT2 A;  2WXQ A;  1DVP A;  4EQF A;  5B1A E;  3L16 A;  1PAQ A;  4WWO A;  1N11 A;  5E76 A;  1UG3 A;  3PUJ A;  1TYQ G;  1FVH A;  5IY5 E;  4U04 A;  2OVF A;  4BY6 A;  3QC1 A;  3KS2 A;  5A6C A;  1OWL A;  2HE0 A;  3EU5 A;  5AN8 A;  1H6K A;  4GYO A;  2J8S D;  1NP7 A;  3ZKJ A;  1NI1 A;  1MX2 A;  4KMO A;  2L6J A;  2EQX A;  3JXI A;  2VTB A;  2IOS A;  3FU0 A;  1MYO A;  2WQ7 A;  3QAR A;  3C3Q A;  4J8S A;  2VSO E;  1KZP A;  3CSF A;  4I43 A;  3I4G A;  3U3W A;  2KXP C;  5LOZ A;  3NOC D;  4GA0 A;  1INZ A;  5CHE E;  3CV0 A;  2DWZ A;  2WVI A;  3FUK A;  5AEN A;  3JUI A;  1HS6 A;  2P9N G;  3VTX A;  4UWK A;  5D0Q D;  2GGF A;  2B6C A;  4IUL A;  2H6G A;  2ETC A;  5ENP D;  4HLE A;  2QYU A;  2WXF A;  2P9L G;  4U8Y D;  2BKK B;  4I17 A;  2GRL A;  2BUG A;  3ESL A;  4TXR A;  3NQP A;  4O60 A;  4RLY A;  2AWI A;  2DIW A;  2I2O A;  4BEP A;  3DRA A;  2WQH A;  1TN7 A;  2CG2 A;  4A63 B;  1DCQ A;  5ENQ D;  3CVU A;  3NF1 A;  2WXI A;  4HOQ A;  3C5R A;  3KEZ A;  4BES A;  4FHK A;  5M72 A;  3HRA A;  1N94 A;  4LUN U;  3RO3 A;  2E0I A;  3DSS A;  3QWW A;  4UI9 K;  3T5X A;  1E8Y A;  1NFI E;  1PY1 A;  2CHW A;  3IXE A;  1D8D A;  5KNH D;  3L17 A;  1XNF A;  3HDX A;  2FO1 E;  3MCX A;  4JXT A;  4GZ3 A;  4ANW A;  1LD7 A;  1H2U A;  1D9S A;  2V4H C;  2WPV A;  4Q94 A;  3E32 A;  2MOW A;  5DBK A;  2V5F A;  4ANV A;  4E85 A;  3ZNG A;  4FUL A;  5E75 A;  1X5B A;  1OCR E;  1ELW A;  3LEW A;  3DBS A;  1EDU A;  1BD8 A;  2L9B A;  3FUN A;  3TG4 A;  3AG4 E;  4UI9 J;  1JWG A;  3HHM A;  1TN6 A;  3D9N A;  2EIL E;  5ENO D;  4EPZ A;  4JEU A;  2ZXW E;  4QQI A;  3VLF A;  2J09 A;  2VGX A;  3G2V A;  3CK8 A;  3RJV A;  5AAO A;  3JQ0 A;  2KCK A;  2LAI A;  3PDN A;  2XHE A;  3AU5 A;  3DEO A;  4XKC A;  1JUQ A;  5T4Y A;  4F7A A;  4JB8 P;  5FQ6 A;  3AJI A;  3DEP A;  3RKV A;  3D3M A;  2XQ0 A;  2UY1 A;  3ABK E;  4Y6C A;  4WNF A;  2LSU A;  4UQZ A;  2LSV A;  3CVW A;  1JCR A;  3ISM C;  3FU6 A;  4G23 A;  2NYJ A;  4JPS A;  1LD8 A;  2FI7 A;  5LX8 A;  1NA3 A;  2DVW A;  3V2O A;  3L22 A;  1FCH A;  2XGS A;  3SBS A;  4G11 A;  1TJF A;  3L08 A;  4CT4 A;  1OWO A;  4U7E B;  4EZJ A;  4H7Y A;  3R9A B;  3TWS A;  5BT1 A;  1SVX A;  4XIF A;  4ILI A;  4JHK A;  4J8Y A;  3SZ7 A;  4BX8 A;  3GZS A;  4PS7 A;  3R7Q A;  4LEU A;  3SFY A;  3L9T A;  4DJA A;  4U8V D;  3ZYK A;  4AEZ C;  4OVV A;  3KSL A;  4B8C B;  1ELK A;  3LY9 A;  1IKN D;  3CHR A;  3HXD A;  3QWP A;  2V0P A;  3SO8 A;  3OTN A;  5A23 A;  5JA4 D;  1E96 B;  3AS5 A;  4JZY A;  4YND A;  1IHG A;  2R2L A;  1MHQ A;  4BTB A;  4K5A B;  1RW2 A;  2VJ8 A;  4ATZ D;  3PS6 A;  4HI9 A;  5D0O D;  5HKP A;  4L2L A;  5G55 A;  3CR3 A;  3MA5 A;  2X6H A;  3R9M A;  3PE4 A;  4F1S A;  3FH8 A;  3X2Q E;  3P2B A;  5KNG A;  4J7W A;  4G24 A;  3PEU B;  5FIN A;  3L82 A;  3BQO A;  1U2V G;  3V2X A;  5KBA A;  1YCS B;  3ASF A;  2DYS E;  3CVL A;  5EYP F;  4U96 D;  3NZS A;  5D2M C;  1BU9 A;  4GZ5 A;  4BER A;  3Q73 A;  2V4L A;  3CVX A;  4G2V A;  1AP7 A;  2FBN A;  3CGH A;  4J8E A;  4XX5 A;  1SQM A;  5AQA A;  5ENN A;  4I6G A;  4FP7 A;  2XRZ A;  4L9P A;  4WWN A;  1Y6I A;  3AS8 A;  3SBT B;  4JA7 A;  4AY6 A;  4JL0 A;  1Q2Z A;  1P5Q A;  4KT6 B;  3D9H A;  2VGY A;  3Q79 A;  5EID A;  3J5P A;  3I3N A;  3MZL B;  4HI8 A;  4LSZ E;  5AJL A;  5HQ8 A;  1N4P A;  4EZL A;  4DX7 D;  3PZ1 A;  3ASD A;  2HYZ A;  4DLQ A;  1KPS B;  4YVQ C;  3ASH A;  2IO2 C;  4I6J A;  4AV7 A;  3APF A;  1WDY A;  1S63 A;  4KXK B;  5JHB A;  3LY7 A;  3B95 A;  1X81 A;  4EZK A;  5JHA A;  2VGE A;  4PH4 B;  4CZ2 D;  3DXK G;  2L6B A;  3ZYL A;  1H0A A;  4JW1 A;  2AXU A;  4WNG A;  1MQS A;  2ION A;  4TV3 A;  5AIJ A;  3UQ3 A;  1HZ4 A;  3VLE A;  1N4S A;  4HQD A;  3CVN A;  1SW6 A;  1JPL A;  3EHR A;  4HS2 A;  4GTP A;  4IYP A;  3HVE B;  2RD0 A;  3DST A;  3EHQ A;  2YIN A;  4KVO A;  1IYG A;  3FUM A;  3LVQ E;  4LER A;  3G2W A;  4M3O A;  4O1O A;  2IY0 C;  5C1D A;  2OVB A;  3UX4 A;  3G2U A;  3NOG D;  3OXL A;  2WB2 A;  4JC8 A;  2WXO A;  3LKU A;  3SHF A;  2A5U A;  1DCE A;  1QYM A;  3PE3 A;  3F6Q A;  2ZGD A;  1S70 B;  5EKQ D;  2BKG A;  3FFL A;  3FHE A;  5JJ7 A;  1TNB A;  3OAW A;  5EN5 D;  3HYM B;  3B7R L;  4K0R A;  4KBQ A;  4HRM B;  3ASO E;  3UKU G;  3CK9 A;  4J8D A;  3SY2 A;  5FWQ A;  4FLB A;  4A3V A;  1TR4 A;  4B0Z A;  1G3N B;  5BW8 C;  3PRE A;  4GA1 A;  1PC2 A;  2R02 A;  3FH5 A;  1BI7 B;  5BV0 A;  1EPU A;  2I1J A;  3RAU A;  1YYH A;  4GTV A;  5DIZ A;  1WY6 A;  1OUV A;  3DSW A;  4Q69 A;  3QOU A;  5C2Y A;  2A5E A;  3U4T A;  3CQG B;  4W9R A;  4N5C A;  1MJ0 A;  3CHP A;  3E4B A;  4CEM A;  4RVB A;  2CHZ A;  3EIJ A;  3FUL A;  2X6J A;  2HO1 A;  1QBQ A;  2AXZ A;  2WXG A;  5ARF A;  3LJN A;  4DX2 A;  1IQR A;  4RG9 A;  1A17 A;  2YQ8 A;  1BI8 B;  4DX1 A;  4JHJ A;  3KEA A;  1HU3 A;  1K1B A;  4AVX A;  1HG5 A;  5AQ7 A;  4GTQ A;  4JEH A;  1B89 A;  2WM9 A;  4DI3 A;  3ZHE B;  3Q9U C;  4KVM A;  1UN8 A;  4GTR A;  4FHJ A;  4HRN A;  5T8I A;  5EX3 A;  4ZFH A;  1OWM A;  2LXL A;  4JD2 G;  4LG6 A;  4MKT A;  3CEQ A;  5G2N A;  2JEK A;  4PS3 A;  4LRZ A;  2XPY A;  3LVR E;  3MJW A;  1MZC A;  5EDS A;  1FPP A;  3CHO A;  3ESK A;  3ZIM A;  3AG3 E;  3HXF A;  4APF A;  2LXM A;  1OWN A;  2X6F A;  2FEZ A;  3GYZ A;  2F8X K;  1Z3X A;  1ZBP A;  4G25 A;  3ML9 A;  3UM3 A;  3KAE A;  3GZ2 A;  4DLO A;  3R7R A;  4C48 B;  4XZ4 A;  3QWV A;  4GZ6 A;  1YA0 A;  3D9L A;  2VQ2 A;  4NUR A;  3O4Z A;  2WMO A;  2JLB A;  2I1K A;  3PH0 C;  3QB2 A;  2J07 A;  3TXN A;  3ZN3 A;  4DK5 A;  2R05 A;  1KLX A;  1Z6T A;  4DX5 D;  3SFX A;  2NXP A;  3WG7 E;  4C0M A;  2ZGG A;  2X3M A;  3CK7 A;  1IHB A;  1WG0 A;  4NIK A;  4L23 A;  4GPK A;  4LNG A;  3I4R B;  4NAC A;  4WWP A;  2KCL A;  4I1O B;  5J08 A;  5G04 C;  2ILR A;  4BT9 A;  2L0I A;  2CFZ A;  3ZU7 B;  3DPD A;  3Q49 B;  4U63 A;  1UW4 B;  4HLL A;  4JHR A;  4A1S A;  4FC8 A;  3V79 K;  3MGB A;  1KT0 A;  4HBD A;  2ETB A;  2XGM A;  3AG2 E;  1OCC E;  3B7S A;  4H7X A;  5B3S E;  2EIM E;  3FTY A;  2MHK A;  1O1R A;  4WUY A;  4C9B B;  4BFR A;  4EBA A;  4EHM A;  3CIA A;  3TXM A;  4UWH A;  2IOL A;  2AVP A;  4G26 A;  5ITZ F;  4XI0 A;  3LDZ A;  3AU4 A;  2EIN E;  4HRL A;  4X8Q A;  2VTB B;  3UKR G;  5FQ4 A;  2GRN B;  5H7P A;  2KC7 A;  4ME2 A;  3LYA A;  1KZO A;  1NZN A;  2P9K G;  4ATG A;  1N54 A;  4OAU C;  4GYY A;  1BPO A;  2OOE A;  3WXX A;  3FU3 A;  4BWR A;  2B0O E;  1HO8 A;  1S64 A;  5ARG A;  1IXV A;  1HG2 A;  2F8Y A;  2H6I A;  5AQB A;  1UOH A;  3P1U A;  4GB9 A;  4PS8 A;  1AWC B;  4HNA D;  2J9Q A;  4F3V A;  4ILG A;  3BG1 B;  4I2Z A;  5FQ8 A;  2Y69 E;  4K03 A;  2IEJ A;  4GZC A;  2XS1 A;  3ZVV A;  4CRW A;  4I2W A;  2LAH A;  1N95 A;  3APC A;  4MRU A;  5FZQ A;  4OYS A;  2R03 A;  1HF8 A;  3ULQ A;  5FT9 A;  3KSQ A;  3PZ3 A;  2C0L A;  3D9O A;  3QAQ A;  3SGH A;  1IQU A;  3CKC A;  3QNK A;  4Q96 A;  5FZR A;  5EIL A;  4BSZ B;  4CCA A;  2Y4U A;  3UM0 A;  2OCC E;  4HOT A;  4TUM A;  4YDY A;  3JXJ A;  2P9S G;  4F6R D;  5AJD A;  2WXH A;  4GTO A;  5KJL A;  2PQN A;  2IO3 C;  3PUK A;  5T3R A;  5BV1 A;  5AQ9 A;  3T9K A;  3D9J A;  1N4R A;  4LCT A;  2C0M A;  1UJJ A;  4TRQ A;  3D9P A;  3FTS A;  5D66 A;  3E34 A;  2WXP A;  3HVE A;  4LNU D;  4Y6W A;  4K5C A;  2XZT G;  3Q7A A;  3FUH A;  4JVS A;  5CEA A;  1N4Q A;  2WXJ A;  4K5B A;  3ML8 A;  2GRP B;  3T8M A;  5ANL A;  5JJT A;  2VSX E;  3TJP A;  2GRM A;  1E7U A;  3ASN E;  3FWV A;  3S7F A;  2XPI A;  3I5P A;  3N71 A;  2XPZ A;  1HFA A;  3CHQ A;  2OV8 A;  2Y3A A;  1N9A A;  2ETA A;  3Q75 A;  4I1M A;  3KD7 A;  3EJN A;  4AXH A;  5CBN A;  2JAB A;  3HXE A;  4PDX A;  3FY4 A;  3FH7 A;  2DBA A;  3FUE A;  4AJW A;  2KAT A;  3PEV B;  1BLX B;  3UPV A;  3FTV A;  4G8L A;  4E6H A;  3UIN C;  1L5J A;  1FT1 A;  3BG0 B;  4DI4 A;  2P9P G;  3W9G A;  5JMN D;  1TN8 A;  3T5V A;  1E8X A;  3E33 A;  4J0U A;  2GW1 A;  4CT0 A;  3LCA A;  4CDN A;  1N0Q A;  2BED A;  5LFA A;  2H6F A;  4N3A A;  1H2T C;  3EU9 A;  3U64 A;  5J90 A;  3W9F A;  2AW6 A;  3VLD A;  4EBA G;  3CVQ A;  3UMV A;  4L1B A;  4U0Z A;  3HG0 D;  3V31 A;  4FAD A;  2OND A;  2QY7 A;  4IRU A;  3AAA C;  4YVO A;  4A55 A;  2QYJ A;  1QQE A;  4M7C A;  3FTX A;  3ZHE A;  3DSU A;  1H2V C;  3TWR A;  2KBX A;  5CMW A;  3FU5 A;  3FTU A;  5B1B E;  2X6K A;  3TWW A;  3AS4 A;  3Q5M A;  5FTP A;  2FF4 A;  3LS8 A;  2MRI A;  2E2E A;  2XCB A;  2P9U G;  5CMY A;  4B89 A;  1OT8 A;  3QK0 A;  3G2T A;  4WNE A;  4GPM A;  1LTX A;  1WAO 1;  4XKB A;  4ILH B;  3TWV A;  2EIJ E;  3ZRH A;  2Y4T A;  5KJM A;  4WND A;  2M63 A;  5BUZ A;  5G05 J;  1GW6 A;  3FUD A;  3FUF A;  3ZGQ A;  3L6A A;  2XEE A;  2PM7 A;  5AYW D;  1K8K G;  2J49 A;  4MLP A;  3E37 A;  2IFU A;  4DRX E;  3RIB A;  3DSV A;  1E90 A;  3OXF A;  1MX4 A;  3JYS A;  5KCM A;  3GW4 A;  4GMJ A;  4F53 A;  2WMN A;  4APO A;  4GCN A;  4BX9 A;  3FDH A;  4GYW A;  4FJY A;  2ZIR A;  1HX8 A;  3UUX A;  2J4D A;  5KJN A;  1EYH A;  2QFC A;  4XE0 A;  4FU3 A;  2FO7 A;  4UWG A;  3C3O A;  2BF0 X;  1UN9 A;  1N0R A;  3BEE A;  3MX3 A;  1TEZ A;  4BT8 A;  3TWT A;  5LCW J;  2L0T B;  4YDO A;  3LXU X;  3MKR A;  1Y8M A;  4UQX A;  4RG6 A;  4I9E A;  3NBN B;  3ZXP A;  4V3I A;  4XI9 A;  2LUH A;  3QJZ A;  4N3C A;  3NZU A;  3ZFW A;  3D9K A;  4UI9 C;  4AOF A;  4G8K A;  4N39 A;  4BSX A;  4GAA A;  1OXJ A;  4PUC A;  4FA6 A;  4NQ0 A;  3SFZ A;  1TNO A;  2CHX A;  3QKY A;  3ZEF A;  2PQR A;  3ABL E;  1E8W A;  2Y0B G;  2DZN A;  4KZC A;  3EUV A;  2IQC A;  5FIO A;  1DNP A;  3IHV A;  1OY3 D;  2XRY A;  3HIZ A;  3IKO B;  3QDN A;  3NB2 A;  3EIQ C;  3FUI A;  4N2S A;  2EIK E;  4L7T A;  3FEY A;  1HE8 A;  3DSX A;  3FUJ A;  3MKQ B;  5CER B;  4J8F A;  3UTM A;  1TNZ A;  2IJG X;  1ZU2 A;  3ONL A;  2PZI A;  3ABM E;  2KZT B;  4GA2 A;  2WQ6 A;  2XCC A;  3L13 A;  4HOU A;  2J4B A;  4B93 B;  3UIP C;  4TXP A;  5BXU A;  1WM5 A;  3EHN A;  3ZPJ A;  5LP0 A;  1W3B A;  5BNW A;  3PZ4 A;  3D9I A;  2MYO A;  2XEH A;  1VDY A;  2IF4 A;  3AG1 E;  1H19 A;  3U9W A;  3ZW3 A;  4EEC A;  4N5Q A;  3S2A A;  3ENE A;  3MV2 B;  5ENR D;  4JA9 A;  2Q7F A;  3GZ1 A;  1Z3Y A;  3JQ1 A;  3MEK A;  5HRY A;  3ZYQ A;  4OAV B;  3CLJ A;  4BET A;  3T8K A;  4U07 A;  3B7U X;  3ULY A;  3Q9N C;  3TG5 A;  2VYI A;  2IU1 A;  3DPY A;  1SA4 A;  3CKB A;  4HOR A;  1Z5S C;  4J6I A;  5A7D B;  2XS8 A;  4GZD A;  3ZUV B;  3TWX A;  4ANX A;  3CVP A;  4GU5 A;  2KM4 A;  3RK6 A;  2YHC A;  3ZYM A;  3EHM A;  2UWJ G;  5AAR A;  1D8E A;  3TWQ A;  3RRN B;  3HXB A;  2I9C A;  5CRV A;  2LO6 A;  1K3Z D;  3Q7F A;  1LF8 A;  3PNT B;  2ZU6 B;  1EF1 C;  3U66 A;  4YDE A;  3FEX A;  3UIO C;  4KYO B;  2V5Q C;  4IN3 B;  4TUU A;  4D10 C;  1DC2 A;  4Z68 A;  4ANU A;  3C98 A;  2CFU A;  4MBG A;  4B8A A;  5EX0 A;  4DPR A;  4CYM D;  3TL5 A;  4UWF A;  1O1T A;  5CCM A;  2P2C P;  3PVL A;  3B13 A;  1QNF A;  3L54 A;  2WXN A;  3UT7 A;  3CVY A;  3JCK C;  4N3B A;  3RRM B;  1OCZ E;  3Q4A B;  3J5Q B;  4R7L A;  5CEC B;  2C2L A;  3K9I A;  4UQY A;  2DCP A;  2RG8 A;  4AM9 A;  4TXQ A;  5KJK A;  3FTZ A;  3JUE A;  3E30 A;  2QZA A;  2WXR A;  3S7B A;  1RZ4 A;  4XEI G;  4GTS A;  3URZ A;  4N2Q A;  4MS6 A;  1UJK A;  4ZHB A;  3MYV A;  2R59 A;  3LJ3 A;  2P58 C;  3RU0 A;  2QC9 A;  2YHE A;  4LNB A;  4QFV A;  1YMP A;  4NRH B;  2OEW A;  4HVB A;  3B7T A;  4FLH A;  3G2S A;  1O1S A;  3SD5 A;  2LNI A;  3UM1 A;  2J08 A;  2YNQ A;  4A1G A;  4OVU A;  5G04 J;  2AJA A;  3DWL G;  4U0S A;  5ANR A;  4O1P A;  1FVF A;  4CDR A;  2ZIS A;  5CED B;  4DX6 D;  4C0E A;  4DUI A;  5HI7 A;  2BTD A;  4CDM A;  2PM6 A;  4URK A;  3CQC B;  2I6H A;  2FUL A;  1JCQ A;  3UT4 A;  3TAX A;  3UXG A;  3IEG A;  3FP3 A;  3PRZ A;  1QZ2 A; 
#chains in the Genus database with same CATH homology
 2LAI A;  3PDN A;  3Q5M A;  5FTP A;  2FF4 A;  2XHE A;  3LS8 A;  2MRI A;  4JEH A;  3Q47 B;  3AU5 A;  2E2E A;  3TGO A;  2XCB A;  4XKC A;  1B89 A;  1JUQ A;  2WM9 A;  5T4Y A;  4DI3 A;  3ZHE B;  4F7A A;  1NA0 A;  1XGW A;  4U0U A;  5CMY A;  4KVM A;  4B89 A;  5FQ6 A;  1UN8 A;  3QK0 A;  4FHJ A;  3SNX A;  3G2T A;  4WNE A;  1WAO 1;  5T8I A;  2VGX B;  5EX3 A;  4XKB A;  1OWM A;  4ILH B;  2X38 A;  4AIF A;  2HM8 A;  3RKV A;  3D3M A;  2XQ0 A;  3ZRH A;  2Y4T A;  3FTW A;  2A4Z A;  2UY1 A;  5KJM A;  4MKT A;  4WND A;  1ELR A;  2M63 A;  3CEQ A;  5G2N A;  2JEK A;  3OXG A;  3CVV A;  4Y6C A;  4PS3 A;  4HOS A;  4LRZ A;  4WNF A;  2LSU A;  4UQZ A;  2LSV A;  2R5S A;  2WXL A;  2XPY A;  3CVW A;  3LVR E;  3CST A;  3MJW A;  5BUZ A;  5G05 J;  5EDS A;  1GW6 A;  3CHO A;  3ESK A;  3FUD A;  3FUF A;  3L6A A;  4FJZ A;  3ZGQ A;  4AP2 A;  2PM7 A;  3ZIM A;  1TJC A;  5AYW D;  4APF A;  2J49 A;  4MLP A;  3FU6 A;  4HXI A;  5G05 C;  4G23 A;  4JPS A;  2IFU A;  3RIB A;  2PL2 A;  2R17 C;  1OWN A;  2FI7 A;  1E90 A;  3OXF A;  4I9C A;  2X6F A;  3IV0 A;  5LX8 A;  2FEZ A;  1NA3 A;  2KCV A;  4HFG A;  3GYZ A;  3L22 A;  1Z3X A;  2UY1 B;  3Q15 A;  3JYS A;  3IBE A;  5KCM A;  3O48 A;  1ZBP A;  5JJ6 A;  1FCH A;  2XGS A;  3GW4 A;  4G25 A;  3ML9 A;  4GMJ A;  4F53 A;  4KZ0 A;  2WMN A;  3KAE A;  3SBS A;  4APO A;  3GZ2 A;  4DLO A;  3R7R A;  4G11 A;  4XZ4 A;  4GCN A;  1TJF A;  3L08 A;  4BX9 A;  4CT4 A;  3QWV A;  1OWO A;  3FDH A;  4GZ6 A;  4FJY A;  1YA0 A;  4GYW A;  4EZJ A;  3D9L A;  4H7Y A;  3R9A B;  2VQ2 A;  4NUR A;  5BT1 A;  1N52 A;  2WMO A;  3O4Z A;  5BPP A;  2JLB A;  1HX8 A;  4I1A A;  4XIF A;  4GML A;  2I1K A;  3UUX A;  2J4D A;  3PH0 C;  3QB2 A;  2J07 A;  3TXN A;  3ZN3 A;  5KJN A;  3APD A;  1EYH A;  4ILI A;  4JHK A;  4DK5 A;  1KLX A;  2QFC A;  1Z6T A;  4XE0 A;  4A3T A;  4FU3 A;  2NXP A;  2FO7 A;  4UWG A;  3SZ7 A;  4C0M A;  2BF0 X;  2X3M A;  3CK7 A;  4BX8 A;  3GZS A;  1HH8 A;  1UN9 A;  4PS7 A;  4L23 A;  3BEE A;  4GPK A;  3MX3 A;  3R7Q A;  3I4R B;  4NAC A;  4U8H A;  4BTA A;  4WWP A;  2KCL A;  4I1O B;  5J08 A;  4LEU A;  1TEZ A;  5G04 C;  3LY8 A;  4BT8 A;  5LCW J;  4G1T A;  2L0T B;  5FJY A;  3IHY A;  2ILR A;  4DJA A;  4BT9 A;  2L0I A;  3ZYK A;  4ACK A;  5LCW C;  3ASG A;  4AEZ C;  1JWF A;  2CFZ A;  4OVV A;  2WXK A;  3LXU X;  3DPD A;  3MKR A;  3Q49 B;  4GCO A;  3SF4 A;  4U63 A;  3PNL B;  1Y8M A;  4UQX A;  1UW4 B;  4RG6 A;  4B8C B;  4I9E A;  1ELK A;  2XEV A;  3LY9 A;  2V8S E;  4JHR A;  1S0P A;  4A1S A;  4FC8 A;  4V3I A;  4XI9 A;  1E8Z A;  2VSY A;  3CHR A;  3QJZ A;  4N3C A;  4P29 A;  3NZU A;  3MGB A;  3QWP A;  1KT0 A;  2V0P A;  3ZFW A;  3D9K A;  4UI9 C;  4AOF A;  3CHM A;  4N39 A;  4BSX A;  4GAA A;  4PUC A;  4FA6 A;  1E7V A;  3OTN A;  2XGM A;  4NQ0 A;  4O6F A;  5A23 A;  1E96 B;  2CG3 A;  3AS5 A;  4JZY A;  5FZS A;  3SFZ A;  4YND A;  1IHG A;  3MKQ A;  3B7S A;  3UT8 A;  4H7X A;  1MHQ A;  4BTB A;  2CHX A;  3QKY A;  3ZEF A;  2NSZ A;  3FTY A;  2PQR A;  4UWL A;  1E8W A;  2VJ8 A;  4AY5 A;  2MHK A;  3SI5 A;  4WUY A;  4C9B B;  4KZC A;  2KZT A;  4BFR A;  4EBA A;  2VSN A;  3PS6 A;  4B94 A;  2IQC A;  1KT1 A;  4I6E A;  1DNP A;  5D0O D;  3IHV A;  3CIA A;  3D9M A;  3TXM A;  2XRY A;  4L2L A;  4UWH A;  3HIZ A;  3CR3 A;  3IKO B;  2IOL A;  3QDN A;  2AXV A;  5G55 A;  2AVP A;  4G26 A;  3MA5 A;  2X6H A;  3EIQ C;  4XI0 A;  3PE4 A;  3RRU A;  3FUI A;  3LDZ A;  4N2S A;  1SZ9 A;  3AU4 A;  4L7T A;  4F1S A;  3FH8 A;  3FEY A;  3VTY A;  1HE8 A;  3FUJ A;  3MKQ B;  1U3C A;  4CGV A;  4J8F A;  4ABN A;  2IJG X;  2VTB B;  1ZU2 A;  3ONL A;  2X6I A;  5FQ4 A;  2PZI A;  2KZT B;  3LPZ A;  4GA2 A;  2WQ6 A;  2KC7 A;  3P2B A;  4ME2 A;  1HXI A;  2XCC A;  3L13 A;  3LYA A;  4HOU A;  2J4B A;  3RO2 A;  3CHS A;  3EDT B;  1WM5 A;  3EHN A;  1NZN A;  4G24 A;  3PEU B;  4RSY A;  3ZPJ A;  5LP0 A;  1W3B A;  1U3D A;  4ATG A;  5BNW A;  3D9I A;  5FQ7 A;  1N54 A;  2XGO A;  4GYY A;  1HG5 A;  1VDY A;  1BPO A;  2IF4 A;  3ASF A;  1H19 A;  3U9W A;  2OOE A;  3CVL A;  3ONK A;  3WXX A;  3ZW3 A;  1SZA A;  3FU3 A;  3ZXS A;  3NZS A;  2NC9 A;  4BWR A;  4EEC A;  4GZ5 A;  5CCL A;  3S2A A;  2V4L A;  3CVX A;  1HO8 A;  5ARG A;  4G2V A;  1HG2 A;  3ENE A;  3MV2 B;  4JA9 A;  4WAF A;  3S7D A;  2Q7F A;  4ACL A;  3GZ1 A;  1Z3Y A;  3JQ1 A;  3MEK A;  3MV3 B;  2FBN A;  3ZYQ A;  3P1U A;  3CGH A;  4GB9 A;  4J8E A;  4XX5 A;  1SQM A;  4L2Y A;  3CLJ A;  4PS8 A;  5ENN A;  4I6G A;  2HR2 A;  4U07 A;  2J9Q A;  3PZD A;  4ILG A;  4FP7 A;  4F3V A;  2XRZ A;  3B7U X;  3BG1 B;  4CGW A;  2WXM A;  4I2Z A;  4WWN A;  5FQ8 A;  1OWP A;  1Y6I A;  4K03 A;  4GZC A;  3S7J A;  3TG5 A;  3AS8 A;  3SBT B;  4JA7 A;  4AY6 A;  3ZVV A;  2VYI A;  4CRW A;  2WXQ A;  2IU1 A;  1DVP A;  3CKB A;  4I2W A;  4HOR A;  4JL0 A;  4EQF A;  2LAH A;  4J6I A;  1P5Q A;  5A7D B;  3L16 A;  1PAQ A;  4WWO A;  4KT6 B;  3APC A;  4GZD A;  4MRU A;  5FZQ A;  4OYS A;  5E76 A;  2VGY A;  1HF8 A;  3ULQ A;  5FT9 A;  1UG3 A;  4ANX A;  3PUJ A;  3CVP A;  4GU5 A;  2KM4 A;  3RK6 A;  2YHC A;  3I3N A;  2C0L A;  3D9O A;  3MZL B;  1FVH A;  3ZYM A;  5AJL A;  3EHM A;  4U04 A;  2UWJ G;  2OVF A;  3QAQ A;  3QC1 A;  4BY6 A;  3SGH A;  3KS2 A;  4EZL A;  1IQU A;  5A6C A;  5HQ8 A;  1OWL A;  3CKC A;  3QNK A;  1H6K A;  4GYO A;  4Q96 A;  5FZR A;  3RRN B;  1NP7 A;  3ASD A;  2HYZ A;  4CCA A;  2Y4U A;  4YVQ C;  2I9C A;  4DLQ A;  4HOT A;  3ASH A;  4I6J A;  4AV7 A;  2LO6 A;  3APF A;  4KMO A;  5AJD A;  2WXH A;  4KXK B;  5JHB A;  5KJL A;  2L6J A;  2EQX A;  2PQN A;  3LY7 A;  5T3R A;  3PUK A;  5BV1 A;  1LF8 A;  4EZK A;  5JHA A;  3D9J A;  2VTB A;  4LCT A;  2C0M A;  1UJJ A;  4PH4 B;  2IOS A;  3FU0 A;  3D9P A;  3FTS A;  4TRQ A;  2WQ7 A;  3QAR A;  3ZYL A;  1H0A A;  2WXP A;  3PNT B;  4JW1 A;  3HVE A;  4J8S A;  2VSO E;  2AXU A;  4WNG A;  2ZU6 B;  4Y6W A;  1EF1 C;  3CSF A;  4I43 A;  3U66 A;  1MQS A;  3I4G A;  2ION A;  4TV3 A;  3FUH A;  3U3W A;  5LOZ A;  4JVS A;  5AIJ A;  3FEX A;  3UQ3 A;  1HZ4 A;  4GA0 A;  4KYO B;  3VLE A;  1INZ A;  4IN3 B;  4TUU A;  4D10 C;  5CHE E;  2WXJ A;  3CV0 A;  2WVI A;  3CVN A;  4ANU A;  3C98 A;  3FUK A;  2CFU A;  3ML8 A;  3T8M A;  5ANL A;  5AEN A;  3JUI A;  1JPL A;  5JJT A;  4B8A A;  5EX0 A;  4DPR A;  1HS6 A;  4HS2 A;  3VTX A;  2VSX E;  4IYP A;  4UWK A;  3HVE B;  5D0Q D;  3TL5 A;  3TJP A;  4UWF A;  2GRM A;  2GGF A;  2RD0 A;  5CCM A;  1E7U A;  3FWV A;  3S7F A;  2XPI A;  3PVL A;  2YIN A;  4IUL A;  4KVO A;  3I5P A;  3B13 A;  1QNF A;  3N71 A;  1IYG A;  3FUM A;  3L54 A;  3LVQ E;  2XPZ A;  1HFA A;  4HLE A;  4LER A;  2WXF A;  3CHQ A;  3G2W A;  4M3O A;  5C1D A;  2OVB A;  2WXN A;  3UX4 A;  3G2U A;  4I17 A;  2GRL A;  2OV8 A;  2Y3A A;  2BUG A;  3JCK C;  3OXL A;  3ESL A;  3UT7 A;  3CVY A;  4N3B A;  3NQP A;  3RRM B;  3Q4A B;  2WB2 A;  4JC8 A;  2WXO A;  4R7L A;  4I1M A;  2C2L A;  2AWI A;  2DIW A;  2I2O A;  3K9I A;  3KD7 A;  3LKU A;  2A5U A;  4UQY A;  3SHF A;  2DCP A;  2RG8 A;  4AM9 A;  2WQH A;  3PE3 A;  2CG2 A;  3EJN A;  3FTZ A;  5KJK A;  4AXH A;  5EKQ D;  3FFL A;  2WXR A;  3FHE A;  3S7B A;  5JJ7 A;  3NF1 A;  4PDX A;  3CVU A;  3OAW A;  2WXI A;  3FY4 A;  3HYM B;  3FH7 A;  2DBA A;  3FUE A;  4HOQ A;  3KEZ A;  3URZ A;  4AJW A;  4N2Q A;  2KAT A;  3B7R L;  1UJK A;  4MS6 A;  4K0R A;  4FHK A;  4KBQ A;  5M72 A;  3MYV A;  3PEV B;  4LUN U;  2R59 A;  3UPV A;  3FTV A;  3CK9 A;  4E6H A;  3RO3 A;  2E0I A;  1L5J A;  2P58 C;  3LJ3 A;  3QWW A;  3RU0 A;  4UI9 K;  4J8D A;  3T5X A;  5FWQ A;  1E8Y A;  2YHE A;  3BG0 B;  4DI4 A;  1PY1 A;  2CHW A;  4FLB A;  4QFV A;  4A3V A;  4B0Z A;  3T5V A;  1E8X A;  4NRH B;  3L17 A;  1XNF A;  5BW8 C;  3HDX A;  4J0U A;  4HVB A;  2GW1 A;  3PRE A;  3B7T A;  3MCX A;  4JXT A;  4GA1 A;  4GZ3 A;  4CT0 A;  1PC2 A;  4FLH A;  3G2S A;  3LCA A;  4CDN A;  4ANW A;  3FH5 A;  5LFA A;  5BV0 A;  1EPU A;  3SD5 A;  1H2U A;  2I1J A;  2LNI A;  4N3A A;  5DIZ A;  1H2T C;  1WY6 A;  3U64 A;  2WPV A;  5J90 A;  2J08 A;  2YNQ A;  1OUV A;  4A1G A;  4OVU A;  5G04 J;  4Q94 A;  2MOW A;  4U0S A;  5ANR A;  5DBK A;  4Q69 A;  3QOU A;  2V5F A;  4ANV A;  5C2Y A;  2AW6 A;  3U4T A;  4E85 A;  4FUL A;  3CQG B;  4W9R A;  3VLD A;  1FVF A;  5E75 A;  4CDR A;  1X5B A;  4N5C A;  3CHP A;  4EBA G;  3E4B A;  3CVQ A;  1ELW A;  3LEW A;  4L1B A;  3UMV A;  3DBS A;  4C0E A;  4CEM A;  4U0Z A;  4RVB A;  2CHZ A;  1EDU A;  4FAD A;  2OND A;  2QY7 A;  2L9B A;  3EIJ A;  4IRU A;  3FUN A;  3FUL A;  4YVO A;  2X6J A;  3TG4 A;  5HI7 A;  4A55 A;  2BTD A;  1QQE A;  4CDM A;  4UI9 J;  3FTX A;  3ZHE A;  1JWG A;  2HO1 A;  2PM6 A;  3HHM A;  4URK A;  2AXZ A;  2WXG A;  3CQC B;  5ARF A;  2I6H A;  3D9N A;  1IQR A;  4EPZ A;  4RG9 A;  4JEU A;  3VLF A;  1A17 A;  2FUL A;  2YQ8 A;  2J09 A;  3UT4 A;  2VGX A;  1H2V C;  3G2V A;  3TAX A;  5CMW A;  4JHJ A;  3FU5 A;  3FTU A;  3IEG A;  3CK8 A;  3FP3 A;  3PRZ A;  2X6K A;  1QZ2 A;  1HU3 A;  3RJV A;  3AS4 A;  4AVX A;  3JQ0 A;  2KCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...