2VHGA

Crystal structure of the ishp608 transposase in complex with right end 31-mer dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
b'LYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVEIIEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKLPTLWTNSCFISTVGGAPLNVVKQYIENQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSASE ORFA
molecule tags Dna binding protein
source organism Helicobacter pylori
publication title Mechanism of is200/is605 Family DNA Transposases: Activation and Transposon-Directed Target Site Selection.
pubmed doi rcsb
total genus 33
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2vhgA00
2XM3A 2EC2A 2FYXA 2F4FA 2VHGA 2VICA 2F5GA 2VIHA 2VJUA 2XO6A 4ER8A 2XMAA 2A6MA 2XQCA 2A6OA 2VJVA
chains in the Genus database with same CATH superfamily
4M5GA 1N6QB 2ZD1A 1QAXA 1TFWA 3FEXB 3J81U 3CDWA 2HFNA 4NI2B 1U2RA 5DLFA 3H0PA 3LWMA 5AJ3F 4A48A 2HVIA 1XIQA 2G2YA 5LMUJ 4JOUA 4LF2A 2CNKB 1KVJA 4OX7A 3AFGA 2UXDJ 3PW2A 3L7OA 2X1FA 2CPFA 2C3OA 1VCTA 4PQAA 5KFIA 3D3BJ 1M5OC 2ZJQQ 1AFJA 3KDNA 3M6UA 1SIZA 5HBMA 1R89A 5A6WA 2IBKA 3AY0A 3OFHA 4X62F 3W1YC 3Q8QB 1HNVA 3R5JB 3M9MB 3OL9A 3VCDA 3QWUA 4RLEA 2MJUA 2VF3A 4Y0FA 3RZAA 4N56A 1YSJA 2CQIA 4IO1A 5KFLA 5HAOA 4JI8F 3DLLQ 4IQXA 5L38A 3L95X 3P49B 3HHKA 1TUGB 3QJJA 3TYTA 3OSNA 2UZAA 5I3PA 2ZHAA 1F1BB 5K14A 1HW8A 4LBPA 1AROP 3VF0B 4C0OC 2VG7B 2RD5C 1X4GA 2KN4A 2XNQA 3CCWA 4RR5A 5DO2A 3MUMP 1IKYB 2FJVA 1RT7B 3TA1A 2UUTA 2E5GA 3VGVA 3VHQA 3RB0A 3DLKA 4YR3A 1WNEA 1JKHB 2K3KA 5C25B 4EZ9A 1SQFA 4G3IA 1N33F 2ZEJA 3ETOA 4F0KA 4TY8A 5KT5A 3G8SA 3GIIA 4TXSA 2KB2A 2CJBA 2RU3A 3MOZA 3ZTRA 4ZVSB 3KUEA 2KJWA 2YWFA 1ZYQA 3DRSA 3OFFA 2LCWA 1RADB 2CYYA 2FHOB 2XZWA 1G4CA 3EMTA 2CPZA 4AXIA 4CLLA 4I7FB 4DU7A 3DLHA 2D1CA 2XZDB 4OHVA 3KLIB 5KG4A 4YHHJ 2NZ4A 1A9NB 4J9KA 4FVMA 4OX6A 1VK8A 1QSLA 1SJ4P 3NCQA 5B0CA 2MSTA 2V67A 4H4KC 2C3MA 3IMQJ 3V6KA 3RG6A 3KLGB 1WSVA 4UZBA 1VQMS 5HLFA 4K4ZA 3QGGA 2J0QD 1CLFA 4GKKF 5I42A 3TUJC 3M8RA 1MSWD 2HFUA 5F8HA 3IRXB 1AB8A 2CPIA 1TAQA 2LQBA 2SXLA 1REVB 4OFZA 4LRBA 2DGXA 4K4YA 1E6VA 4QPTA 5FDLB 1TK8A 3F73A 4ERDA 2E1CA 1MMDA 3NCPA 4DPUA 2RRBA 4DX6A 5EHHA 5IT0A 5F3TA 2F8MA 2MQMA 1KNZA 2IDEA 4MTPA 2NYIA 4PYAA 3LANA 2CPXA 3LGNA 4OV6A 1NSPA 3AXMA 3T9NA 4N41A 4FYYB 4O23A 2DGVA 2M52A 4P2XA 1MN7A 2DR8A 3KLFB 3KYLA 4QIGA 2R7VA 2Y1RI 3PM9A 1WUUA 3UD3P 4X62J 1MN9A 1HI0P 1VFJA 1SC1B 3NAHA 2V2QA 1MU2B 3AJ1A 2BJDA 5AT1B 2W4PA 4CH0S 2OSRA 2PO4A 2EK6A 1NJYA 1U47A 1VOMA 2G2ZA 3LAKA 1DRZA 3BEGB 3S8SA 4C8LA 2ZZNA 2FD2A 4IR1A 2VFUA 4L6V3 1FKPA 4EGLA 1HNWJ 4NWBA 3RGIA 4NRTA 3BH6B 4NYPA 1U26A 4PZVA 2CQPA 2C2EA 2MZJA 3PYGA 5A8KB 4OV1A 2LU2A 2YWWA 4CTAA 2BJ1A 2XB2D 3D0GE 2OTJS 2FJEB 3PO5A 1UVKA 1HYSB 3I0SA 5C7PA 1DLOB 8RUCA 3E3XA 2U2FA 4FYWB 3Q22A 1NH8A 4DS4A 2W7AA 2RT3A 4ZPTR 3S6EA 3L3CA 2EFNA 2CQ4A 2NS1B 2QSFA 2DGWA 3MEEB 1C0UB 4DR7J 3D28A 1S7HA 5HATA 4MFBA 4K7QA 2Y3YA 2BQRA 1S48A 2C2NA 4DHVA 2YKOA 2X3DA 1S97A 4WZQA 1HD1A 3RB3A 3G9CA 3PV8A 4DPYA 3BQ1A 4ZVQB 3EZUA 3BS9A 2GJFA 1TELA 2BZ2A 2ZC4A 1S9GA 3C16B 4CI0B 2F9DA 3Q23A 4OJHA 4MK9A 1XEZA 4USIA 1KHWA 3JTNA 2PIIA 5HI7A 1RAOA 1M1KT 2N4CA 1T11A 4LREA 1XMBA 4MFBB 1Y7PA 4BCAA 2XO6A 1WWHA 4ILRA 3BYPA 2MXYA 2GO8A 1S9EB 2QMXA 2VU5A 2FLOA 2EFVA 4ZITA 5K8MA 2RQCA 2VQFF 1SC3B 3HP6A 1PJ5A 3OTDA 3GIRA 3I82A 1ULRA 4OLOA 5D4LA 3R5BA 3ZZOA 5T14A 1Q5VA 3KK1A 2D9OA 4DX5A 4J9LA 2MJNA 3T3FA 3QATA 3HJFA 4ZPCA 4IG0B 3PVXA 1HYSA 2W24A 1FJGF 1BY9A 3QZ8A 3SV3A 2F1FA 3ZC4A 4BDPA 2IIHA 1RTIB 5ADZA 2POKA 1LNQA 4OI1A 3MURP 1U49A 1GMWD 2XHCA 3IS9B 3KMSA 1UW9A 4CO3A 4NLDA 4ICLB 2QX0A 3DNCA 4PYDA 1SL2A 1Y3KA 3JTOA 2YKNA 3OL8A 1S57A 2HK2A 2BJ9A 3NBPB 4ELVA 2HHQA 1S0VA 2EFOA 1ZAXA 3S7RA 2FLPA 2WTFA 2FHJA 4ZPBA 1BMQB 2J6TA 2HHTA 3PRBA 2V8DA 4AE5A 4CDIA 2IRUA 2H48B 4ANDA 5GVQA 1MU2A 3AODA 2VB6A 5GADI 3NNCA 1X4EA 4TYBA 2V2ZA 4PXBA 3N6MA 3NRBA 1HNZJ 2PEHA 1TP7A 2NQPA 3TEHB 3GJRB 1I1GA 2BRLA 2NXJA 3ITHA 4J9QA 2JLFA 2NSCA 2IYGA 3HI9A 5KG5A 1FWLA 4TQRA 3W60A 2XQCA 3V6DA 1HARA 3PHEA 4RZRA 1X4DA 2J9CA 2VBWA 3UR3C 1UVJA 1N0UA 4MYTA 2JDJA 4DR6J 1H3DA 2JEJA 1HQUA 3BPSP 5K8PA 3J81j 4Q2MA 1Q7YT 1REVA 3H5UA 2WW4A 1BC6A 2XYHB 1RDRA 2KRRA 2J8SA 1N52B 3JS9A 4NLPA 4PWUA 2R7UA 3NWGA 4WKRA 2ZOMA 2BRKA 3N79A 2NREA 4CLSA 1PYTA 5EX0A 4DV4F 2IY5B 3QBCA 1QAIA 3DGVA 4PQUA 1DZ5A 4Q8EA 3U02A 1DJ0A 3Q2SC 1S59A 4B08A 2DRAA 4AXJA 1OQ3A 4RWXA 4DR3F 2DISA 4EWTA 4B9NA 2HHUA 2DGQA 5SUHA 3KLVA 3H4BA 1YI2S 2EVZA 4USHA 2H4WB 1NB2A 3DMJA 4DFJA 3DDNA 5D78A 3DYAA 4LVNP 4NLSA 3US5A 2GFFA 2FTRA 2ZFHA 5LXRA 2ZKUA 1S4FA 3UNYA 2W2NP 4CO5A 3C2PA 1SKRA 4PPZA 4C8KA 4V19J 4KR0B 2MEWA 1LWFB 1JKHA 1VISA 2DHAA 3PFEA 3ZNJ1 5C25A 4IUFA 4GO7X 1YIJS 1VI7A 1X31C 2HLTA 2XZTB 1RACB 3TZXA 5KFGA 2DNMA 5DETA 3BN7A 4BS2A 4OIXA 3G82B 4ILLA 3SCJE 2VODA 3GWCA 1R6YA 5IQ6A 4U8YA 1RQ0A 4URQU 2OHDA 3UCGA 1RWWB 4I67A 3QGIA 1QM9A 1FXRA 1YLXA 2YY3A 2YXLA 5A8RA 2RUSA 3VTIA 4DBQA 4X64F 2UUAJ 2NPIA 5LJ3Y 3MMBA 2RH3A 3M7VA 3OTEA 2C22A 4X4NA 2B0GA 3CEDA 2VBXA 4PEOA 4IDKB 1EKRA 4LF6J 4DUYF 4ELUA 2QLBB 2XY6A 2XS7A 3SI8A 2DH9A 3LALA 4OZNA 3VALA 4M94A 3TZWA 4ZHRB 2ILZA 2XEXA 1RAHB 3M8SA 4LRAA 2HAFA 3BQ0A 1BUXA 1HBMA 3VAMA 3TANA 2B4PA 1VLOA 4LT6A 1XJWB 3QGHA 2KM8B 1HNXJ 1L5UA 2LQ8A 3LGHA 2GX8A 1BQNA 2DH7A 3AAWB 2K1RA 3MMAB 4KC5A 4YN3B 4B17A 2EI5A 5MAOA 2A6OA 1PILA 3KUHA 5B0EA 2DEIA 2BQ3A 4LRCA 3Q83A 3DCAA 4P9SA 2I8EA 3MDFA 3QT8A 4FNIA 4JI0F 3KJVB 4QIVA 3DLEA 2M8HA 2DGTA 2VJUA 3DRPA 1ZA2B 2ASLA 1M1GA 4CO1A 4PAAA 3A13A 2DKOB 4ZK7M 3GJSB 3I9ZA 2EKYA 2BABA 4P73A 2FJWA 2W9CA 1ZZFA 4OQJA 3A8EA 1F9EB 1MROA 2E1RA 4R25A 1EB0A 4WYWA 5LSOA 3TEGA 1M5PC 2ZBIA 3MTKA 4FF3A 1Q79A 4H4OA 3BGRB 3ZZTA 3IP0A 4C7QA 2KFYA 1LXJA 2VPWB 2HSEB 1JLFB 4RW6A 5KFXA 1Y9OA 2MHEA 4OJGA 1IKVA 4ZJOA 2HHPA 2WRMA 4B3TF 1JLBA 4FPIA 4RKUC 3POTA 3TUPA 3KLFA 1RGVA 2JEIA 3FEYB 3DOMB 1MWZA 4O4GA 1UWAA 4BLGA 5HP1B 3PKMA 1RJJA 2IC3A 1GEHA 1RWMB 1LEOA 2QIFA 2XMUA 3IXQA 3JTPA 4LJMA 3RAMA 3EJMA 3W7BA 4CQ1A 4W98A 1EZZB 1TL3B 2YVSA 2GIRA 4PR6A 4M1KA 4OI4A 1RYRA 2CFXA 3DLBA 2IRYA 1C4CA 5ETSA 3TAQA 2HBZB 3HX9A 1OPZA 1ZM9A 1Z1ZA 4MKVA 2UUCF 3OUYB 4LF4F 1HLWA 1TL7B 3IM9A 1WHWA 2D74B 3F0NA 2WBRA 3MR7A 5CYMA 1R8HA 3LPYA 1VQKS 3OD2A 1UEUA 3CWJA 1RAFB 3HHLA 4OLPA 4YQWA 2XO7A 2H3EB 4R5PA 1D9FA 1TZ0A 3D1QA 4LF6F 4GC7A 3M30B 4USTA 4DZ6A 3V81B 1FVQA 1SIWB 4KE5A 3A12A 2DNOA 2NUUG 1XR6A 3DC2A 3H2VE 1LKZA 3H42A 3PJWA 3SSSA 5LT5A 5BR8J 2FVCA 5KFNA 4DR6F 4HDGA 3MOJB 1KBRA 3SEOA 2EBGA 3DRSB 4MMOA 5AE1A 4DL4A 2ATLA 2C28A 1RBLA 3QLHA 3UN2A 4LF8F 2UVVA 4YFUA 3NMRA 3MCOA 1F5BA 4NZ7A 4QW8A 1JK9B 2NCKL 1N33J 4OHXA 1QTNB 2F9JA 4MT1A 4QIEA 4C0HA 3QRRA 1HWIA 2QE5A 3OXFA 4IOBA 4OJ3A 1T9UA 2FPHX 3NGSA 2ALZA 2FZKB 4YP3A 1EP4B 1QSYA 1V3RA 4ETZA 2GVZB 4QIFA 1RWKB 2NLWA 4ECWA 1XMQF 1HHQA 2F5GA 3HSDA 1SCJB 2XMMA 1GXLA 2ZNZA 3PJ9A 3QAEA 2VFRA 3QMQA 4M5LA 1V5VA 3AD8C 2G0CA 3M32B 4YB5A 4E8UA 5JVGQ 2GGPA 2XULA 1EETA 1PBAA 2J0WA 4A8WA 2QV6A 2E9ZA 2BE2B 2FHJD 1XR5A 4DV1F 4DV5J 1QUPA 4RNMA 2HBRB 3ENVA 3THPA 3CJ8A 1HNVB 4JV0A 1E6YA 2HWHA 2XG8A 2UV8A 2HBYB 5E3QA 4ZVOB 5HQLA 4CH1A 2LEAA 4WPAA 4XAKA 4YMEA 4X4UA 2R2UA 3K8WA 5F9LA 2CIMA 2HLUA 4NCGB 4CZCA 4O3OA 4ALZA 5DG7A 1BQMB 2J0XA 2HRTA 1CJTB 4M5KA 5HK4A 4CP5A 4F36A 2ZH1A 3PW0A 3ZNUA 2AD9A 1SKSA 2IPOB 4NLYA 4KKOA 3IGNA 4X4PA 2AX0A 1XNRF 4ZJQA 1LWXA 3FSYA 4HDHA 2ZJPQ 4K4UA 2ZH8A 1AFIA 3M2RA 1HPZA 3Q89A 3TJAA 4EBCA 1YITS 1KR4A 4KYZA 3EGZA 4U96A 3T1HJ 3U1LA 3K5OA 2GQ2A 2QYGA 1AT1B 4ED6A 1REGX 2IBOA 2HQCA 3VR1A 5B7WA 2NXNA 1PAUB 2CZ4A 3CCSS 4UY85 3CDAA 3EVOA 1RT2A 4I4BA 3VVUA 4JYAJ 2FGOA 2LQJA 3HSGA 3C14B 3W66A 4QBUA 1RT5B 4AT1B 2PGCA 2DYAA 1T9WA 2LQ9A 1EP4A 1BWVA 1QE1A 3KHRA 2O1PA 3V4IB 3ZZZA 1NU4A 4LBHA 4BC7A 2E7WA 2YWHA 1FJ7A 1P9YA 3DM2B 1U0SA 1UZDA 2IJNA 2XMTA 1RLCL 3HT3A 2OPRA 4AL7A 3CULA 2VKZG 2P5VA 3PEHA 4Y65A 3TNVA 3LP2A 2VBZA 1L3KA 3D6FB 4F4ZA 1UVMA 4RUAA 1UWBA 1K8AT 1LWCB 3GR1A 1FRLA 2UXCJ 2RDJA 1NBEB 2J9EA 4PWDB 3MGJA 2EFPA 5K20B 2F63A 3EM1A 1IKWA 1IKXA 2DCLA 4M5NA 1FKAF 2E5LF 3FSXA 2MKYA 2L9WA 2BM0A 2BV3A 4F67A 1WG5A 2IM0A 2Z2YB 2WOMA 2I2YA 4PG5A 1O0PA 2JWNA 2KU7A 2RNEA 1K0VA 2UUAF 2JC0A 3ENQA 3HHLB 2Y0SD 2C3UA 3HJVA 3W9HA 3KJNB 2R7XA 4FF4A 4IRDA 3QPIA 2KG1A 3TUZC 1Y5LB 3V6JA 1XWLA 4KJIA 2HVHA 2E7XA 3OUYA 5KT7A 4JI4J 1C0TA 1PC4A 4L73A 1TMJA 1FRMA 1UKUA 4RW9A 3SSQA 6AT1B 2XYPB 1VHFA 2D7SA 1WHXA 4ZS6A 2XHWA 2QA4G 2FLLA 1A6LA 1EJ7L 2VL1A 2ZE2B 3EGWB 1N34F 2KVIA 2PA8D 5D4PA 2MGZB 1VQ5S 3KG0A 2IC3B 2YKMA 3GB0A 3UN5A 3KHHA 2BR0A 2QL5B 1LWCA 3FGVA 4B9SA 1T7PA 1S99A 4OZ3A 1XERA 3JYTA 1UPMB 1B7YB 1NSQA 1I5OB 3RTVA 1J27A 4QU6A 2CQ3A 3FBCA 4X64J 1SH3A 5ETMA 4P74A 2BOAA 2CPYA 2YBVA 2R9LA 2OPRB 3IO1A 2E1AA 3BBCA 4H4OB 1TV6B 5DG8A 3DM2A 5KG0A 4XIUA 1YHQS 3Q8PB 4J37A 1KQGB 3H98A 4NA3A 4ED2A 4PUOB 2ACMA 4AQYF 1HHSA 1PAEX 2Y8WA 2KYXA 3M6VA 3G8TA 4LRFA 4HKQA 3DRPB 4KB7A 3MFHA 3C14A 1H98A 2BACA 2FY8A 5KFOA 2XCAA 3K59A 1KEKA 5DQGA 2UVRA 4LF8J 4OHWA 5IV4A 4I1TA 3EDQB 4DN9A 2LYVA 4IOAQ 2F4VF 2P2CB 4LIRA 2DXFA 3ZO7A 3D7SB 3BGUA 3GFXA 2HHHJ 1IR0A 1P8GA 2AEFA 3EXYA 5IC6B 5J2QB 1HR0J 4ETXA 4RU2A 5T41A 1YDLA 1FFWB 3EICA 2MKIA 5HROA 3ZZUA 2P8IA 2WSCC 3PYEA 3IAS9 3MWBA 1RHKB 2H5EA 2ZNYA 4EO8A 1UZHA 3CJ3A 2M0GB 3VAJA 3UDVA 4QWAA 3DLJA 3AA8A 4IDKA 2LEPA 4PABA 3J80Y 1DQAA 1R8AA 2O01C 4ED4A 2K2PA 4ECRA 3BKUA 2BXJA 3I31A 2WW8A 4J9NA 1M90T 1FEEA 1TR0A 3CMAS 3W2VB 1TFYA 4B02A 2CUYA 4DCOB 2YH0A 3PR5B 1MNEA 4ZA1A 3KLHB 1IBMJ 3QJLA 1CQMA 2BVZA 2NYHA 2KVQE 3RW6A 3CJRA 3BSNA 3IWXA 2GGPB 2UUBJ 1T9VA 1NK4A 2RKIA 2EK1A 2R8IA 1XMOF 2F4FA 1R8BA 1TKZB 3AB2B 3DOLB 4J7CA 5LSLA 2IVYA 1NK6A 4DSIA 2XMAA 2AYGA 3OJSA 3G82A 3S01A 3SFUA 4ECVA 2AJQA 1RWUA 2QTWA 3E8OA 3T6BA 3UO0A 1O8BA 3MPDA 2FJAB 1KQKA 1KKHA 4X66J 2HS3A 3UDCA 3TJ8A 5KFBA 4NEZA 3VAFA 3R5AA 2XGPA 2AYBA 1HMVA 1R3NA 4A47A 4O3NA 3IBWA 1LW0A 1RU1A 1UJ6A 3QWPA 1NDKA 2BE7D 4Y3CA 1YWXA 9RUBA 3HXMA 1GXTA 3I55S 4GKJJ 4DR4F 5IZHA 3HZEA 2L48A 4TVAB 1BGXT 1RE1B 3LGMA 2MY8A 4EO6A 5J1PA 3T5LA 3VGSA 3PZPA 5KFAA 1WTFA 2I1RA 3IBCB 2HKEA 3V81A 2HFZA 3LWLA 2ACYA 1FKOB 1MLAA 1NPKA 4FPRA 4HH1A 2EFGA 4OMFG 5E2QA 2NPFA 4DV7F 3PXGa 4QR1A 1VBXA 4I2QA 4JI1J 1UFKA 1TUVA 4TLRA 2KT5A 2Y1LB 3KHLA 1KRPA 1TL7A 3T5KA 1FTCA 1ZM3A 3VAIA 2HHWA 1CBKA 4DN0A 2YH1A 3N6LA 1T3NA 1CC8A 4JI0J 3UQSA 3ZXWA 1QVFR 2QLJB 5ETOA 3D66A 2V4RA 2RE1A 1NJIT 3MPWA 3Q8VA 1RAEB 4K2XA 5AXKA 3RB6A 3BSCA 1VBZA 5CABA 5L39A 3FNNA 3OTOF 1X4BA 4B9TA 1UW4A 2Q1LA 3ISZA 2GS8A 3PRDA 2IAJB 4DV0F 2Q79A 2UVWA 2R7OA 4D3HA 1WG1A 3HFKA 5LSRA 3ZZRA 3HF5A 4RW6B 5DQHA 2P9GA 3JSMB 1WOPA 3BGRA 1R31A 2HFVA 1KVIA 2BJ7A 3JQMA 2XI2A 2BANB 1B0PA 3NBPA 1JIHA 4TQSA 9ATCB 1S76D 5BYQA 1JXEA 5SZTA 5CH7B 5L8RC 1RHRB 4JI6J 4USMA 3MEGB 2N3LA 3PRVA 3OR2A 4EK2A 1RTIA 1N32F 2WZ1A 2V4JA 2GV1A 4U9RA 2FLNA 2ZH4A 1VS3A 2H54B 2FDNA 4OZ0A 4WU3A 4O3QA 3CCQS 1HNXF 4F02A 4UOHA 2C2OB 4ZLJA 2CKWA 2X1AA 2QFJA 3WC2A 3ISNC 1C1BB 1CJVA 1LW2B 4HTJA 4JUZA 3IM8A 1N5TA 5CYQA 4D3GA 4NPOA 2VG5A 3BSOA 2RJZA 4ZVRB 5H9FK 1W2IA 1NLKL 3B82A 3G6ES 2GMJA 1I94J 2DHGA 5ETLA 3FBBA 3M6WA 3CCJS 4LFBJ 4H4MB 4J9MA 4ECZA 1H0HB 5ETQA 3HMJG 2AGOA 3B6BA 4A8OA 5FLXU 4F4XA 5B09A 4DV6J 4P2FA 1S6QA 2RILA 1KFSA 2OPQB 3H8YA 3HD2A 2OO4A 4KPCA 4C3MA 4WK3A 1ZM4A 4U6PA 1D9AA 3D2WA 4P71A 2OAUA 1RI7A 1Q82T 3AJ2A 4LVOP 4B9VA 4RBVA 5A76A 1C0UA 1RYSA 3D68A 1M0SA 1VRUA 3C6UA 3EGVA 3OVSA 3GCWP 2AJ4A 3MMBB 2DB1A 2WVDA 3P5TL 2C2RA 4EI2A 1T03A 2GHWA 4KGKA 4M5HA 1U1QA 1DLOA 3MM6B 2D69A 3CCRS 2P6SA 4RNOA 1TL4A 2B8PA 4FKXA 3DHXA 1S49A 5HVGA 2HIQA 2Z2MA 2XY5A 3M6XA 4N76A 3QT6A 2KXFA 3MEGA 2DXEA 1FKPB 4MAKA 2DIVA 4PPDA 1P9QC 4ZPWR 2QN6B 1ZH5A 1SPBP 2QRRA 2W2QP 4WFNQ 3NWRA 1I3OB 4DFMA 1Q86T 2XI3A 2UUWA 3UPFA 5A0YA 3LP1B 3BBBA 3DYAB 1QD1A 3WBZA 3VAKA 3PDNA 2JX2A 4Y2IA 5D4NA 4DWIA 1NMEB 4I69A 4CO4A 1YJNS 2U1AA 2DY9A 3HO1A 1YK9A 2FQQB 2F8HA 1N56A 2E29A 3O44A 2D41A 1OWXA 1XC9A 4OX9F 5GADU 2AV5A 1K0TA 4N7TA 1ZOTA 5IFMA 5D8HB 1RP5A 3WIUA 2QL7B 4QYZK 1IM6A 4QYRA 1FDAA 2CPDA 1RTDA 5EX3A 3T19A 2MMYA 4JI7F 3NOCA 3PG9A 3CSKA 1NCLA 4RW7A 3G86A 5HLFB 1RTDB 3CO0P 1T94A 2V2KA 4A8QA 4F3MA 1AZSA 4W92B 2WVFA 4K0KF 2HHSA 5LMUF 4Y6IA 1N5SA 4J5OA 2YTCA 2Y9HA 3R27A 4OL8A 3ZZYA 2RSQA 1MMNA 3W3SA 1AW0A 3GV5B 3M05A 4RPFA 2EKNA 2V0NA 2QJ3A 2XMKA 3BGLA 1HA1A 1NPPA 3HKZD 3PJXA 2VJVA 3P6YC 5JUMA 4ZVGA 2H5JB 4C11B 5HJYA 1SH2A 2XLIA 3DFEA 4PCQA 3PW7A 4Y2MA 2HQ3A 3IGVA 4TY9A 5ETVA 3AA9A 2DPJA 4TN2A 4DF8A 3IWNC 4JI8J 1GX5A 5IT4A 3DLKB 5DG9A 1NDPA 2V94A 2W25A 2W2MP 4CCHA 4L74A 5CD4H 1RT7A 4DR5F 4ZVPB 4DUZF 1IKYA 4OX8A 4UQTA 5C5JA 3IS9A 1N34J 1FJEB 5I3UB 2DNKA 1H7XA 5GAEI 4LQ3A 1RUSA 4LR8A 4CO0A 3DI6B 3DOLA 3CMQA 3H90A 1F0XA 3T6JA 1UTAA 2MZRA 3LO3A 3MPYA 4IG0A 2HNZA 3C15A 4M5JA 4CLZA 1JB0C 5FIIA 2BKNA 3PNIA 3OL6A 3QAUA 4Q2LA 5GAEU 3H5XA 2CG8A 2E66A 4DV0J 5GMDA 2VKRA 2OEMA 1T03B 1T95A 2JRSA 3M2UA 2R8HA 1VRUB 2E44A 3C6UB 2FHMA 3N5BA 4KGMA 1FRKA 2K7JA 4GRSA 3HULA 1YJRA 2RDDA 2DHXA 3F56A 1OQ6A 2IM3A 4IQMA 4JV1A 1VQ6S 3K2YA 3MAHA 4DDFA 4DUTA 1VQSA 3CJ5A 3TX8A 4NLUA 2WVEA 2OPSA 4MIWA 2DEJA 2BJ3A 2XBPA 3M2VB 4RNHA 4J9PA 1W26A 4YB7A 4YY3J 4FYXB 3G96A 3NGKA 3OTBA 5HROB 1P1LA 1JLGA 1RT6A 2F7VA 1TTHB 2YPYA 1EARA 1VJWA 1VYAA 3EE3A 4XO0A 1X5TA 3MEEA 2YNIA 5CYQB 1N54B 1W25A 2OFGX 5KG7A 4EBDA 1C1BA 1CJVB 1GXUA 1YZ6A 2I5JB 4WXWA 4I6YA 4RNFA 4F3QA 3BB5A 4Y2KA 3J81Y 2CZVC 1WHVA 2PSZA 1VHIA 4OYIA 3M9NB 2WSEC 4DR4J 2QG9B 2VA3A 4ZPDA 2B9XA 3QZ7A 4DR3J 1L3SA 1TL5A 1GX6A 2RUGA 2WCXA 4AD6A 4P2SA 5HVFA 4ELTA 3BBFA 2P9CA 1CULB 2H1YA 4NMXA 1I94F 2CAJA 5HSPA 4A4JA 3Q0AA 3BPDA 1PBUA 2FVPA 2E5IA 3HHNB 4PWWA 2L9NA 3DN9A 5C2GA 4ANEA 3E01B 2DHHA 1VR6A 2RQKA 2V63A 4ID8A 3CD7A 1IQZA 3ZZ0A 4DCJB 2VIHA 3M8YA 2YQ1A 3MEDB 1WKJA 3JYTB 4DSJA 4JV2A 5DJBA 3WZ0A 5BYRA 5F8LA 2I9SA 2FC8A 2OUGA 2Q6CA 1QSSA 1URNA 1ZAWA 2YKMB 1NK5A 2LLZA 3TA2A 2MGZA 2OIHA 3EWGA 4M5DA 1UVLA 1N5YB 1DQ8A 4MIBA 2GW8A 3BQ2A 2PN6A 5FJ4A 5IWAF 3NNAA 2BX6A 3HZGA 1C0TB 4RW9B 4DL3A 1S6PB 5J1EA 1Q8IA 2VFVA 3M8QB 3K57A 1J5EJ 3FRZA 4F4KA 1LOUA 2PT0A 2DD8S 4ZCKA 4AL6A 6FD1A 4I0WA 2PE8A 4I2QB 1GTHA 2DNRA 4G1PA 3KLGA 2FVQA 1CVJA 2LU1A 2ZZMA 3CJSA 1CJUB 1WACA 5L1IA 2HVDA 2LFVA 3R97A 5ETNA 5KOXA 1RSCA 1HQ2A 3R7BB 1UA0A 1FWPA 3IAM9 4Y34A 4BHQA 5F9NA 3L9ZA 4I7FA 3SBMA 3V2UC 3MUTP 2C2MB 1LV5A 3Q8YA 1NXIA 3PYDA 4HR2A 3FFIA 1FWKA 4F25A 2N7CA 5HMWA 1K9MT 4RL1A 4QCLA 5A8WB 1T05A 3NS7B 4DL0C 4KO0B 1NO8A 2GC8A 2VASA 2MKHA 3UVJA 1RT1B 1HR0F 4C8ZA 1S12A 3GV7B 1NK9A 1VQYA 2NXCA 2DR5A 1JJHA 2DGOA 3IG1A 5G0RA 3L09A 3QIDA 4ZVHA 3B78A 4EYIB 5T7LB 2A0FB 3A8JA 2G13A 2GHVC 2UXDF 4X2BA 5FLXY 3KNGA 2W9BB 2Q6BA 1ROFA 2VPYB 1RT2B 5KG2A 2E5LJ 2WK4A 2HRUA 3AD9C 3L4BC 1CS4A 2OJ3A 2PFDA 2MQOA 3DLGA 3DRRA 2HYIB 3AB4B 1VDHA 5JMNA 4L75A 5C42A 1JLCA 1RCXB 2VQFJ 2QZ8A 3C66A 4B3TJ 5L9XA 2H51B 5RUBA 2J9DA 1FVSA 3VGUA 2OP5A 2BQUA 3HVTB 4KV8B 4NYZA 2ZVSA 1ZPWX 2RF2A 4O4RA 4OYOA 4YDDB 2W7OA 1FDDA 2A3JA 4A8SA 2RHQB 4KKOB 5KG3A 3RYLA 2D3ZA 3V6HA 2Z58B 3QIPB 2UXBJ 2RF2B 3GG0A 3GSDA 3FZ2A 4NZ0A 4NZ6A 2E1MC 3GJTB 4ECSA 3PO4A 2OLWA 3S1TA 4ZOSA 1VBKA 1YRTA 3I4PA 2JVRA 1D0EA 3O3LA 3TVKA 5J2PB 2YQ0A 4WP8A 4CM0A 4WTOB 3D1OA 5E3PA 2GHPA 4DSFA 2ZITA 2BE2A 2JLGA 1GT8A 4QWCA 2V69A 4RW8A 4K0KJ 5HANA 2MKJA 2ZDPA 2QA4S 1Y11A 5LL6d 2JC1A 3O1LA 3F44A 3NL0A 1R0CB 1WELA 1RAGB 3GZ7A 3DRXA 3KKFA 2WONB 1Y10A 3NOGA 4JBCA 3OPKA 1U6BA 1T02A 2CVIA 3TW0A 2PA3A 1A7GE 1ZM2A 3IG1B 4EFAC 2AU0A 1J5OB 1JLAB 2M3DA 1PCAA 4J9UE 4EZ6A 4DU8A 1F2GA 4P2MA 3WC0A 3O2IA 2D3O1 1H72C 1RWXB 2GNKA 3JB9k 3KK2B 3B4DA 4WU2A 1IJEB 2BYCA 1U25A 1KS2A 3K17A 2A18A 2CNNB 4WP9A 5E41A 4DR5J 4AQYJ 5KFKA 1OY9A 2VH7A 2D3OR 8ATCB 5HN0A 4FDFA 2HHVA 4GC6A 5H9EJ 3J7ZT 3MM5A 2HWIA 4BC9A 1HIYA 4JYAF 1TAUA 1EQMA 1R7IA 4K59A 4DR2J 1R0AB 3HHLD 2KZMA 3M30A 2NXEA 3A4TA 2C3PA 2ADBA 1VQOS 1NKEA 1TQLA 3W8GA 3MECA 4DPXA 2DRBA 5C24B 2H5IB 3UD5A 3FC9A 2AIRB 5CYMB 1NZAA 4LSNA 1EIYB 2C42A 4U8VA 2ZH3A 3Q2TC 3Q86A 1SH0A 5HL7Q 3NXZA 3N28A 4FS1A 1R27B 2GO9A 1DFDA 3M8QA 3MUVP 2RRAA 4CO2A 2W1BA 4ZCMA 2ATCB 2XSJA 4CNYA 1EHWA 1Q8LA 1FNMA 1TL3A 5H1SV 5F8NA 3CCVS 3MAQA 1FF2A 1R0AA 1IN0A 2RRNA 1IKWB 3FZBA 4L3KA 4PXCA 3SYZA 3T1YJ 1NUEA 3UDEA 4B3MJ 2RB7A 3Q8RB 3J7A1 3OQ2A 3NS6A 3W65A 3QRPA 1RT3B 5IWAJ 4I2PB 1OJ4A 5A2QY 2FY1A 4C8YA 2KFNA 5M2RA 4X4RA 2B3TB 2V4QA 4WF9Q 4X66F 3NY0A 1YGYA 2W2OP 4YEAA 2CPJA 2ZH2A 5DS7A 4IRCA 1FI4A 2B6AA 2A2DA 2JFDA 1WC6A 2DBBA 4GVLA 3MFIA 1UVNA 2VOOA 1HBUA 2EG2A 2GAGC 3ZTOA 4XDCA 2XS2A 4USUA 1WHYA 1QE1B 2MHNA 3AOCA 2KT3A 3FBFA 4OYZA 4P52A 3TQEA 2Y8YA 1NJZA 2VQEJ 3DRYA 3K5MA 2FJXA 1GH8A 3DLEB 4MKBA 4RJVA 5DDOC 2HS4A 4V1Ak 2F8EX 5J2MA 2CNLB 3I5BA 3UE2A 5EGYA 1HWLA 3CJTA 5KTQA 4DR1F 1HBNB 2IA0A 5KT6A 1JNRB 4LF9F 3PYFA 3TAMA 2AYMA 2YNIB 1DHMA 5J2PA 1U0HA 4DZDA 3MMAA 1BQNB 1DQ9A 2O67A 2YKPA 5EUHA 4M5IA 2LQ5A 3TA0A 2BW7A 1QAYA 5DDQC 1M5HA 4U7CA 4ED7A 4X4QA 1AUDA 4RU9A 3TZYA 2ILYA 3T1AA 1YJUA 4IH7A 1WKLA 4NRUA 4ZHRA 1BQMA 1RTZA 4QWDA 2Z56B 2AQ4A 2K3IA 4KHPJ 3MCNA 4CYUB 2OTLS 4FF1A 1WTBA 1KD1T 2VV5A 3PX0A 2DK2A 1M5KC 2ERRA 2PDAA 5KT3A 3DLGB 3DRRB 3QYYA 4X84A 2CQ0A 2V8HA 2PMWA 4HHJA 4CWBA 3GONA 4WKYA 3J7AN 1U1OA 4Q44A 4MH8A 1SQGA 4KHRA 5D3GA 2HNZB 3C15B 3M32A 2W9BA 4M8LA 1RCOB 1YBTA 4NLWA 2AT1B 2YNFA 3ET6A 1G3OA 5GAHI 3ISND 4P6QA 4RUBA 3MMCA 4FNHA 2AGQA 4FVCA 2MQQA 4K4SA 1G2EA 3BKFA 2KH9A 2M5YA 5KFPA 4XPEA 3C8YA 3GTYX 4Z7YA 3CJQA 3VWSA 1VQ4S 1Q16B 4QR0A 4WFYA 3VQSA 2ZBCA 2GIQA 5KG6A 2ZUAA 2ASYA 2FUG9 3MTJA 5D0HA 3SDEA 1L3VA 1B0TA 3IA0A 5DZ6A 1TKXB 4U7UK 3WQPA 3FFIB 4WE1B 1KVKA 1U6ZA 1WKKA 2CWKA 1UPPA 2GCFA 1YJVA 1VRTB 1YVFA 3D67A 4Y28C 2CDQA 4JV5J 5DM6Q 2ZOFA 1U2FA 3LUYA 3ILIA 2BDPA 3O8WA 3NMAA 3H2LA 4NLVA 5ETRA 3VZIA 3M8ZA 2IMWP 3SQGB 1OYEA 3DOKA 1JLQA 3CDEA 3LP0A 3N6NA 2WSFC 3THTA 3N5FA 4ZIWA 5L1KA 1I6JA 3UFCX 2DH8A 1AZSB 4YY3F 1CJUA 4X4OA 2J0SD 2LDIA 4KH0B 1OMSA 2CA9A 1AUSL 4URSA 2HMIA 4KTQA 4C8MA 4OI0A 2XNRA 1D09B 2IRXA 1FRHA 5D6GA 2OMOA 5CZVA 3QO9A 4X4SA 2JOQA 2HG4A 4DSEA 1YTYA 1FK9A 2MLYA 3HLUA 4NX9A 3NNHA 2B56A 2HEKA 4JP8A 1LK5A 1AXQA 1R0BG 3PFOA 4QR2A 5GAGU 2UXCF 2BBEA 2BJ8A 1QUVA 1A0OB 1NKBA 2QYCA 4I64A 4IG3B 3RBDA 5KT4A 2L08A 2RMLA 1WC3A 4DI6A 1VQ7S 2B7BB 4LR9A 1KSPA 1UJ5A 4PG8A 1FESA 1T9TA 3CJKA 5F8JA 2R7RA 1WC4A 1NNDA 4G1QA 4KH1B 2R7QA 3BGOP 3W5XA 1JLBB 2ROEA 3M9OB 3H5YA 3BO4A 3JAMU 2D3UA 4ZPVR 4CH7A 4ZLNA 1Q78A 2MKCA 5K8NA 1HWKA 3J7YU 4L3NA 1XQIA 1S7IA 2OD6A 3NP5A 3RR8A 2ZVIA 4UTGA 5IM0B 2UUBF 1FD8A 2ZOGA 3N0VA 4F8RA 3OXLA 3BF4A 2NZCA 2O5DA 3HCXA 1BE4A 2OGUA 4DCPB 2ROPA 4GVBB 5AE2A 1SBRA 2CQBA 4EU0A 3BV8A 1OY6A 3K5NA 3MM7A 1Q53A 2KXNB 4A8YA 4B3MF 1XNRJ 4QPXA 1NEEA 3K89A 1D1UA 3GPAA 1VQNS 1RA7A 2DGSA 4K2JA 1VIXA 3Q8SB 5D15A 2ZM6F 3JSBA 3H25A 1M1HA 4NLGA 4EBEA 4HTIA 1T9XA 2QL9B 2JJ4D 3KFWX 4HEA9 4IH5A 3VZHA 3NGDA 3HM9A 1T8EA 2JEFA 4O0NA 4J9SA 2EEYA 1IXKA 3UCZP 2K1RB 2BMBA 2EC2A 1WEZA 4U67Q 1GQEA 1SJFA 1U09A 1JLGB 1RT6B 2V8GA 3QSIA 4G6VB 3VAHA 4JI3J 5EWGA 5DDPC 1FX4A 2DO4A 2V50A 3M1VB 3P4UB 4FYVB 4N77A 4F4AA 2EG1A 2AJ1A 1ZTWA 1S6QB 2MKKA 2DHSA 3A3NB 3PIPQ 3BGFA 2HVEA 1S1XB 3NKYA 4ZLLA 1VBYA 2MSSA 5BR8F 1UAWA 4H4MA 4KIAA 3EDRB 4UUXA 1MWQA 3JSYA 2K7KA 4OI2A 1LFWA 4FXDA 2Y1JA 4URGA 1GNKA 2LP4A 2LVWA 3FRYA 3G87A 2HHHF 3OR1A 4UY8T 1NKCA 1B99A 2W4DA 2AHOB 4P72A 4M63A 4PXDA 1B70B 3T5HA 1VQLS 4JB8B 1RABB 4RW4B 5IS2A 2QA1A 3SQOP 3OHAA 4FBUA 1S77D 3IRWP 4IR9A 3OTOJ 4GVBA 4C4WA 1CJKB 4X4TA 4F0MA 2PI4A 4LF7J 1U24A 3FK4A 2W7PA 1K44A 1VLYA 1ZPVA 3I32A 2W8KA 4DV2F 1U48A 4FZVA 2E9RX 4B3OB 4LMZA 1IJFB 1VQPS 4LIWA 4NLRA 3AT1B 3NS5A 5D0RA 1HNIB 4DPTA 1FFSB 4KBIA 2FJBB 4LBIA 4DQSA 1ZS6A 3QSYB 1S1VB 2G2OA 2IAJA 2Z2ZA 1NZ8A 3D0HE 2AKWB 1TVRA 1UJ4A 3FCWA 3MM9A 1PYOB 3DMJB 1PC5A 2X7IA 3P3DA 2OPPA 2VG6A 2BEFA 2GA7A 2AGPA 3W61A 1K1SA 2IM2A 4NLOA 3SV4A 5E7OB 4X65J 3SXLA 2MQ8A 2WAQD 2HGMA 4IG3A 1ITPA 1S6OA 2HQFA 1S5ZA 3AD7C 2RVJA 2DNQA 4YOEA 3CMES 3QT5A 4PQUB 3HHEA 1E6VB 2Z30B 3OXGA 4UUWA 5DZ7A 3G71S 2IVMA 1U1MA 3EPIA 2IM1A 1SVDA 1XBWA 4OZ1A 2OEKA 4KGXB 4RW7B 2GQQA 2N4DA 5DM7Q 3CC2S 2G0IA 3B4MA 2AJFE 1B7FA 3U27A 3PW5A 1KDNA 3PX6A 4QQBA 2HMIB 1GMVA 3QQCD 4LR7A 5AE3A 2WHOA 4QZVB 1QAJA 1RBOB 4JV5F 5CXTA 2DITA 2J5AA 2EWHA 2M9KA 2B8QA 3CNQP 2CQCA 5B0FA 1WJ9A 1H38A 3OBIA 3V6DB 4UOFA 4LSZB 1W7WA 4NXNF 1VRTA 2MKSA 3AJDA 3C19A 1VRQC 1Q95G 2FGCA 5DRKA 5IV3A 1H74A 1B4SA 1TVRB 3W8PA 4DLGA 4P10A 2P6TA 3TUIC 3FQKA 5A0YB 5DGBA 4DFKA 2HZVA 4JI1F 1FE0A 2E1PA 2G0JA 2YWGA 3RW7A 2COLA 4TY8B 1LWEA 4ZP7A 4ECQA 2M4MA 1H2UX 3KLEA 3LOUA 3HHLC 3LQVA 3TX0A 1L3UA 4C8OA 4B3RJ 5K9FA 4HHUA 1RWOB 4DLEA 2H4YB 2YKNB 3NGTA 5D77A 1Z2LA 2QT7A 1CJKA 1URRA 4I68A 2CQGA 2FJDB 4OI6A 3OL7A 2ASDA 4JI2J 2DCUB 1UP1A 2AJ2A 4J9OA 3FMWA 2XSFA 1X4AA 3CIZA 3MCSA 1WORA 1DAXA 3KXDA 3UN3A 4WFXA 2OKQA 2RKIB 3FDSA 3E51A 1IBLJ 1GFWB 2CJQA 4IOCQ 5EDWA 4XTTA 2VOPA 3PW4A 3M8WA 4LF1A 4ED8A 5KAKA 1P27B 5KFEA 2E5JA 3FKBA 3KG4A 1N8RT 3MPVA 4Z2XA 4FF2A 2OFHX 2V68A 3OW2R 1VGYA 3CGIA 2ZH9A 4TLQA 4NEYA 4CLPA 1PJ6A 5F0UA 3GILA 2W4CA 4ECUA 4GKJF 4MKAA 4ZP9A 5HQMA 3RRHA 3TJ9A 2QMUB 2R7TA 3LTOA 2F65A 3C16A 3TRGA 2FYXA 5KFVA 3O5TB 4LUBA 1WI6A 3OFGA 2ZUGA 4E0DA 3D54A 5IXUA 5THWA 1S0NA 1H7WA 3UWTA 2CZ9A 2QA2A 4IFYB 4QU7A 2ZBPA 3V5RA 3H40A 2GAHC 4JI7J 4Q43A 2HFSA 1OS5A 3I0RA 5GMKa 5DLGA 3CB4A 2VG5B 2ZH5A 1N36F 3VV2B 4DL5A 4DPWA 1HQEA 4WJBA 4ZPAA 3PX4A 1LW2A 1PYSB 3SIPB 1UA1A 1RAAB 4DMZA 2YX4A 4P75A 4TNOA 4CRJA 4J9VA 3G6XA 1HHTP 4K4VA 3WX8A 1WF0A 1UFWA 4Z7CA 3I96A 4F3OA 4S0MA 3EGNA 1FRXA 3J7Z5 4MK7A 1PKUA 2DVIA 1FE4A 2KG0A 3MD3A 2KO1A 4CTAB 4FYDA 1SJRA 1SKUB 1YG0A 5B0GA 5F3ZA 1JNZB 5KFCA 3SCLE 2HK3A 1XMQJ 1SQEA 1KLMA 2B9WA 1YKWA 2VQEF 1SXLA 1MG7A 1Q8KA 2RDIA 1RU2A 2DO0A 2XWYA 2BANA 1FTRA 5B0AA 3T1HF 1DTTA 2G9OA 3CIMA 2W01A 5IM0A 2VUGA 2XYGB 3CPWR 5HMXA 2DPIA 1YRXA 1U7LA 2B6AB 2L9DA 2MLXA 4Q8FA 1PO6A 2HHXA 3BM7A 2F4VJ 2HFOA 2DNHA 3OLAA 4FN5A 5KFFA 3KK3B 4DEZA 3UD4P 2UP1A 3KMQA 4G1QB 4JI6F 4F0HA 1S6UA 3BKTA 3C6TA 2LECA 3R1LA 1NPRA 2O3DA 5KFYA 2RQMA 3M4XA 1TL1A 4F4YA 7AT1B 3OVBA 2DTJA 1PIEA 2ZE2A 1H2TZ 2OD4A 3CCMS 1U1LA 1NJWA 1NSKL 1S79A 1X8DA 1VC6A 2MDAA 4NLTA 4KFBA 1O6XA 1FHTA 1S1UB 3JXOA 4OZ2A 3GV8B 3MR5A 1UCNA 2MLZA 3ENAA 2YX7A 1F5CA 5IC4B 4O3RA 2DNYA 4WTYA 3DXBA 4CLTA 1LK7A 3IC1A 3WDOA 4Y00A 2LKZA 4CT8A 3CUNA 2JSXA 4R0JA 3V4MA 1FDNA 4CM2A 5HVHA 3EYZA 4MKYA 2J76E 3JAMY 2MY7A 3MECB 1ZZNA 3G8QA 2WOMB 1YQHA 2XY7A 1FKOA 3DOKB 4PG6A 1X60A 2RS2A 4DV6F 1DTQA 4CNZA 3D4JA 3MM5B 3TVYA 2W2PP 3G2XA 1C1CB 1FEHA 2OI2A 3KJQB 1S0OA 3KTQA 2R3VA 4PWDA 3AOBA 3SCKE 2UU9J 5IT9U 4WE1A 1UWBB 3P45B 1QDUB 2QMWA 2R8GA 1RHMB 5GAHU 5G4DA 4A8FA 2KZZA 1Y4ZB 1FRJA 1FX2A 2BW2A 4RWWA 1YBAA 2KKHA 3SFGA 1FT8A 2WB1D 5K5MA 5B0DA 1N5VA 3EVMA 4CIOA 3D6TB 3OVAA 4F4WA 3UCUP 3R1HA 1HI8A 2DXDA 1OPIA 3LW5C 5D3GB 1WG4A 3ONQA 2XTJP 2ZH6A 1JLEB 4LFAF 5AJ3J 4TU7A 4ID5B 3MMCB 2UVUA 5A6PA 2IJFA 5KT2A 1LFPA 1FJCA 1RT5A 1ICEB 5K14B 5CCMA 2J9DE 3D0IE 2J7UA 3TQ1A 3FSIA 2EW9A 4R8UB 3KDOA 2IDLA 2BM1A 5F0WA 3WHIA 2KYZA 4RW8B 5ITHA 4QW9A 2CXEA 3J80U 1UFLA 3BR9A 2CPHA 3KLHA 4DV7J 1RT4B 3THVA 2DY1A 3T9ZA 2EFQA 2YWEA 3GMGA 3UDLA 3W2VA 2V2VA 2M70A 4CLUA 2UV8G 1PSDA 4C3KA 2BE9B 2ZDOA 1HBOB 3GJQB 4CYUA 1G6BA 1Y5IB 3CVKA 3R8YA 5KFUA 2MTLA 4IYQA 4KT0C 4X65F 5D0EA 4OZJA 2CQ1A 1HKAA 1WD6A 3CCLS 2MZTA 2DNLA 3GYGA 4GMKA 4DX7A 3RBXA 2FC9A 1P1TA 3G4SS 2RS8A 2GMHA 1S9FA 3CC4S 2ZD1B 1S0MA 2VA2A 1T0TV 1U0HB 1RTJA 4NA2A 4MK8A 4ZP6A 4UQGA 2IA6A 3R5DA 3HVAA 5L46A 4USWA 3GE9A 2KHCA 5J2NA 1RT4A 3H59A 3W63A 1RB0A 3P5BP 4WK1A 2Y1IA 1CS4B 1MWYA 1EETB 4R8UA 7FDRA 3CJ4A 1HNWF 4IFVB 4NLQA 4RX6A 4LF5F 3RRKA 2GVZA 1D8YA 4ID5A 2Z0GA 1OSCA 4YHHF 4U95A 5G0RB 2N7YA 4HH0A 1KN6A 3D3CJ 3ZTSA 4Y2AA 4ZVUB 1RISA 4WWSA 3G6VA 4PUOA 1C4AA 2ZHOA 1QY7A 4F2RA 3UNGC 2J6UA 4KO0A 3DGPA 1KQFB 3TR5A 2QGFB 3QGPA 1U8WA 3W2WA 4RUHA 4IRKA 4M5MA 4W90B 4OYWA 2ZBRA 1B64A 5L1JA 4DV4J 3RAXA 3OJUA 4I2PA 1EX8A 4K4WA 4ZDNA 2HAIA 1TMMA 4OYBA 2HBQB 4QOTA 3I56S 1U1KA 4LFCF 1X4FA 2G4BA 5E0OA 1DTQB 2B9YA 4O44B 2DNPA 1BD6A 4FKYA 2MZQA 2HW3A 2NUHA 2VC0A 1KOHA 2AF6A 4JI5J 3RAQA 4R5PB 2FVRA 3HK2A 3IWLA 4KSEB 4FS2A 2B9EA 3CW2C 4LQ9A 4QWBA 3RBZA 5KFHA 3MXHP 5KFWA 4UF4A 2Q3PA 1W2BR 2Q66A 2HNYB 2K06A 1UVIA 3CDBA 1N0VC 2AJ0A 4NMLA 5CYJA 1S6PA 4L72B 1LQ9A 1GK8A 2AMCB 1VK3A 1LXNA 2NXUA 4HI1A 4KFBB 4OZ5A 1S10A 4DSLA 2A2CA 4M5DB 1IKXB 1EKSA 3MMJA 4WYLA 5DQIA 3A8KA 5JJBA 2IVFB 3TOQA 4DG1A 4OYPA 1BWEA 3PEJA 1QJHA 2RU9A 2KTQA 3D5MA 4QWEA 5IOLA 3TVZA 4B3SF 4E98A 1X4HA 2XCPA 1VIOA 4USKA 5L1LA 1V3SA 3OT9A 1Z2ZA 3KK3A 1N36J 3BR8A 4UW2A 4G1IA 1M5VC 2X1GA 3ETMA 2XLKA 1JLFA 5HO4A 3MR2A 1U1RA 2YNGA 1CPZA 4OHYA 1RAIB 2I6WA 5JXSA 1O5JA 1RWPB 4DSKA 1KC8T 1UMJA 4GO5X 2B4UA 1DURA 1MROB 5AXLA 5LOQA 4DS5A 1R8CA 1ZA1B 4HT7A 3FMBA 4NLXA 5HMYA 1NHVA 1CULA 2CVEA 3AQOA 1FXDA 2MZ1A 2RQ4A 3Q24A 1J5OA 3R7NB 3SMZA 3HPOA 3QT7A 1GAOA 3P8BB 2H65B 5HQ8A 3TI0A 4NXNJ 4IFVA 3U1MA 2LA6A 3DDKA 3W9IA 1L3TA 1JJ4A 2G1DA 4F7VA 3CF5Q 4B9UA 3KWMA 3X3UA 2DR9A 2LMIA 3MR6A 4ECTA 1NRKA 1ZETA 3ILJA 2DJWA 2OH2A 1BQXA 1RTJB 1Y0HA 1RLDA 2QSWA 5GMEA 3I0RB 5J1NA 4HHHA 4A8MP 2FVSA 4B3RF 1HPZB 2Z8QA 2HIYA 3M2RB 3B8HA 3R6LB 4N8NA 4YUDA 3OV7A 1RHUB 5EWEA 1D3WA 3LPEA 4JI2F 4A8KA 3NLCA 3QIPA 2G1HA 4ITSA 2OPSB 1CJTA 4YDXA 3HVTA 1SB6A 4KV8A 5IT9Y 4NCGA 2LA4A 1HBOA 3CD6S 2X51A 1RK8A 6FDRA 1E6YB 1G1XA 2XC9A 2MQNA 3M2UB 1WDDA 2DNGA 4LF4J 1SI9A 2KDOA 1U02A 2HGLA 4JI4F 3AHPA 5CQGA 1NAQA 1S1WB 2AX1A 4TYAA 3ZZPA 1JQGA 2MYFA 3RR7A 5F8GA 2YX1A 1F9FA 2R4FA 2JVOA 3DU6A 2X1BA 3CD5A 4IKAA 1YRUA 4OJ1A 4ENOA 3ENWA 1N88A 4O3SA 2B51A 4WCEQ 5I3UA 3CDUA 4B3SJ 2DNNA 1FFGB 1R8PA 1X0FA 4MIAA 1HL6A 2EPIA 2KT2A 2FZGB 1FDBA 2J8AA 5B08A 1RT1A 3UVJB 5EN1A 4HACA 1LWFA 5AXNA 3MM8A 4RUCA 1SJ3P 3QRQA 2JZ5A 3AOAA 2EC0A 1X5PA 4CT9A 2VICA 4NXMF 2FIUA 1U2CA 2F40A 2WVCA 1WSRA 1NK0A 3MI7X 2FZCB 4C97A 5A8WA 3CXCR 1T05B 4CLWA 3QLHB 1SC6A 1WF2A 3L7PA 4DF4A 4B9MA 3N9UC 3ILLA 4RBUA 3AH6A 4WIIA 1NHUA 2RIJA 3PR4A 3LH2S 1S1TB 3H7HB 4USJC 1RHJB 2C2DA 3C46A 4EUVA 2Y0BB 2AEJA 3TWZA 2ZC3A 3R5CA 2HVZA 2QLWA 4RNNA 2CJYB 1X7VA 1HWUA 1JJCB 1Q7LB 1U1NA 5EWFA 2V9WA 2PFFB 3JQJA 1F6TA 2IYIA 1NSAA 3BH7B 3CE8A 3OSPA 3DKDA 2X3GA 3ULHA 4DJBA 3R2DJ 4OHZA 1D9DA 5J1EB 2DGUA 3M8PB 4WP3A 2EXUA 3ZFVA 1FERA 3LA0A 1S1UA 1HQUB 1RAJA 2F3JA 5M2PA 3GCXP 5CD4A 3B54A 4ED3A 4P7TA 3VAGA 1N5YA 1R43A 1H6KX 4LFCJ 3KNAA 1KP6A 4Q45A 1TL1B 1RWVB 5LMNF 2ALYB 4OI3A 2JL9A 3ITHB 3HSZA 2HRYA 2VG6B 2OPPB 2VPZB 3DOMA 4O4GB 4DV3J 5HP1A 3IR5B 1VQ9S 3MM9B 2KRBA 2YKAA 3BSAA 3MEDA 4UOGA 1G7CB 1X5OA 3LP1A 1IKVB 3VGTA 4QJVA 4BBYA 3GIKA 4DV1J 4G65A 4DV5F 1WF1A 1SL1A 4NA1A 4C2MA 1XNQJ 3W5ZA 2XWXA 4HLBA 2J7WA 2GVDB 1M5SA 3W5YA 1XN9A 3EXCX 3R5GA 5DGAA 2E5HA 2DRDA 1HW9A 1RKIA 2VDHA 3H5SA 1Q81T 2W9CB 2DIUA 4LF5J 3MZIA 4ILMA 2B5JA 1WC5A 2PD1A 5E5NA 1U45A 2ZWPA 3NCRA 3W9JA 3QJPA 2V9KA 4KPYA 4DX8H 3KOAA 4PG4A 1OY8A 1F5AA 1WOSA 5HMZA 2JHEA 3I5CA 4YB6A 3KJVA 4DQQA 4AL5A 3ADAC 3EVWA 4DL7A 4F50A 4FXVA 2CPEA 1JXLA 5IQQA 3KK1B 2FB0A 5K8OA 1X0PA 5JVHQ 1U1PA 2VC1A 1U8SA 2PC6A 2UUCJ 3F41A 1HQEB 2CJAA 5U47A 3CD0A 2BJEA 4H54A 3DXSX 4Q5VA 2LXIA 3VQTA 3CTRA 4C6AA 1IBKF 2VD3A 4IFYA 3WX4A 1TKDA 2XLJA 1S9GB 2BKOA 2WB4A 1J2VA 1HBMB 2YNHA 3GU0A 3L7UA 4UZCA 2CRLA 2CWXA 3K5LA 3FUYA 1S72S 3M2VA 2NR0A 2PEBA 1RWNB 5B0BA 3BO2A 2GJIA 3MAAB 4GKKJ 1IR1A 3N4WA 2MB0B 1XR7A 3K0JA 5KFMA 3HVWA 1EQ0A 1GMUA 5C2CA 1NHKL 2HZAA 3CJ0A 4MYUA 3A3PB 3TP2A 4O3PA 5A8RB 1CG2A 1BHNA 3A1YG 3MF5A 1YJTA 1P6TA 1Q5YA 2LDYA 2ZBQA 1QLNA 3I0SB 1WC0A 1MW7A 5E3AA 4DQIA 5KFTA 1VQ8S 3MM7B 3DI6A 5KFJA 2V6AA 4DUZJ 3OR2B 1KONA 2C1EB 2I0XA 4BWJA 2B5JB 2UXBF 4EEYA 4C8NA 3HT0A 2ZZTA 4LSLA 2ABYA 3GR0A 3GQCA 2J7KA 2L41A 2OSQA 2MPUA 3J7YI 1YX2A 4BWMA 2GVDA 3KLEB 3JSMA 2C2ZB 1R6VA 1LWEB 3OHBA 1H2VZ 3TAPA 3E2EA 4AUKA 5BJRA 3ILOA 4C11A 2VFSA 2BA9A 5D4OA 1V6HA 1Q4RA 5CAAA 3GYNA 1ZBTA 1F3FA 2HWTA 3CJKB 2VBYA 4F26A 8AT1B 4K4XA 1RTHB 1N5QA 4DUYJ 3R2CJ 3RUBL 4OZLA 3HFVA 3CC7S 5GAGI 2HPUA 2PMZD 4ZN3A 3KG1A 2UU9F 3NGRA 1FXLA 3EUNA 5FDLA 4CLYA 1FK9B 1V3ZA 5HJXA 4YB1P 3RBEA 7FD1A 1VC0A 4WIQA 2XMWA 2VDIA 1IBKJ 2ZKTA 1H73A 4K8RA 1PGZA 2L3MA 2WVBA 3D6MB 1Y5NB 3D1HA 2N3OA 1X9SA 1DARA 2CQHA 4IO9Q 3R6GB 2GZOA 3LP0B 4HI2A 3SQGA 4DL2A 1TU0B 3HDSA 3D9BA 1YJWS 2QC3A 3KLIA 2CJXB 5KFSA 4XDDA 2LEBA 3GFYA 4C0BA 1RTHA 4ZVFA 2V8VA 2YWKA 2XGQA 3SCIE 1IM4A 2A10A 4J9RA 2QLXA 2IFXA 4I6AA 3I5AA 4K5SA 4OYAA 1N4LA 1S1VA 2Z57B 3CT9A 3HD1A 1KHVA 2R42A 3N01A 5H9FJ 5F8MA 1HNIA 4DR1J 1SKWA 4F2SA 1HMVB 1WOOA 3JSRA 2R2TA 1IBMF 1OO0B 3I6PA 4O0IA 4HACB 4B3OA 4K5RA 2KXHA 3AQPA 5ETPA 1PJ7A 1QTMA 2Z4PA 3CO9A 3MCMA 4HL9A 4I6WA 4OYXA 2BOPA 3TARA 2R8KA 4ED1A 3MPUB 1WC1A 4ICLA 3NEKA 4LSLB 3A8IA 3UI3A 4QYZJ 2LXUA 3GSIA 3PHTA 4F04B 2XMVA 2VG7A 5F41A 3GFHA 5KFZA 1KTQA 3D6HB 2YNFB 3ET6B 3MR3A 4RW4A 2MZSA 2AP6A 3MM6A 1S1WA 3LAMA 3W64A 1YJ9S 5I4MA 3FCVA 3OR1B 4ZVTB 5E3CA 1SC4B 4NL5A 3RJMB 2CG4A 1J5EF 3AXKA 1IBCB 5F8IA 1S9EA 3RB4A 1Q0NA 1X4CA 3EZ5A 2PI5A 3QFWA 2VHGA 1TK5A 1Q8BA 2GJ2A 2HURA 3FEZA 5KFQA 3BZQA 3IR6B 5L9NA 2GMLA 3MAAA 5AXMA 2XMJA 2OPQA 2EBEA 1S1XA 5LM7E 2HQDA 2VFTA 4AYBD 2VZ9A 2KI2A 4WBFA 4Z37A 1GMWA 4PXEA 2YNHB 3BDEA 4H4KA 3T1YF 4KQZA 3M1VA 4UOCA 1B3TA 1CQNA 3BDPA 5LXYA 4DQPA 2OMLA 4NOHA 4ZCIA 2W9AA 1UETA 1U4BA 1N6QA 3W62A 4FBTA 3HKWA 2A6MA 5J2QA 1FA0A 1X9WA 2HZCA 3JQKA 4J91A 1NDCA 2KJVA 3TAMB 4CLFA 1FCAA 2J6SA 1HBNA 4A8XA 4TU9A 2CNOB 4LFBF 2B7CB 4E2FB 3HSJA 3H4DA 3RU0A 2ZHBA 3FQLA 3TO8A 5KG1A 2ASJA 2E7VA 1DBDA 1KFDA 1Y3JA 1YJ7A 2AEMA 2V4JB 1SUQA 3OTCA 3R3TA 4LFAJ 4ES1A 1TK0A 1RHQB 4MJKA 2JH3A 5A8KA 5DDRC 2E9TA 4DR2F 5H9EK 3QNWB 4KGZB 2HS0A 1NDLA 1HBUB 5D0GA 1IBLF 2DNZA 2ROGA 1CSJA 1AA1B 4PG7A 4ZJLA 5KOWA 1UEVA 1ZTTA 2YNGB 1DY3A 3MHYA 3DU5A 2M2BA 1VJQA 2HQGA 2YKQA 1N48A 2R8JA 4RO0A 4LRDA 2HNDA 2HGNA 2JFKA 3K58A 1OIAA 4M95A 3BYRA 1RT3A 1S4EA 3CCES 1FJGJ 1N32J 4DG1B 2DR7A 2YQ3A 1B0VA 3H20A 5LJ5Y 1NB7A 1UL3A 3GFZA 1QVGR 4N47A 4DOZA 3EPGA 2M7SA 1NH7A 4Y2CA 2O66A 1F2HA 2XSJB 1IR2A 4P7VA 2MQPA 3M8PA 4ZLPA 1RA6A 2GQCA 2V34A 3QO9B 3IRXA 1X9MA 1FRIA 1HWJA 5I42B 4UT4A 3NGUA 3HVRA 3T41A 2KM8C 2QFIA 4DQRA 4KHMA 2V8PA 4HVZA 1SV5A 1T3OA 2QEXS 4TKTA 2RHSB 3H2UB 4NYOA 1CC7A 1JLQB 4L76A 3FCHA 4O44A 1TKTA 2NSBA 5KFDA 3OLBA 3GIMA 1XMOJ 2XM3A 1S1TA 2D9PA 1NK8A 3UW1A 4OX9J 4C9DA 2AZ1A 4WXOA 4DXLA 4ZP8A 3MD1A 4K4TA 1FD2A 1NJXA 1TKXA 1SJQA 4YS2A 3NAIA 1JX4A 2JEGA 1LW0B 1T9YA 3SDEB 2Q43A 2MQLA 3LP2B 3W2WB 4PRFA 4WZMA 4CLKA 1ZAVA 2IHR1 2R7SA 3MM8B 3KJFB 2CQ2A 1APSA 5I3QA 1FO1A 1KOOA 2B4OA 2GIFA 3OFEA 1Q1KA 1JLAA 2QLFB 2KHDA 3TZZA 2R7WA 3V4IA 2AYEA 1VC5A 1RZMA 2P9EA 2R2RA 5LMNJ 2CADA 4OYMA 4NCBA 4U7UD 1TKZA 2OEJA 1I51B 1V9OA 2N82B 3PY8A 3O6QA 2ADCA 4Q7AA 2M8DB 4KHPF 2KFZA 4JI5F 1Y00A 3T5JA 3IBFB 4N8OA 5J2NB 4ES3A 1KQSR 4C48A 3FJ2A 4YR0A 4RBTA 4YR2A 1UEKA 5HBMB 2I38A 5BYSA 3A3OB 3GG1A 5ETKA 2H9ZA 1ELOA 2IJRA 3GYXB 3WIVA 3PTWA 3ZTPA 4ZMMA 3DDIA 3DHWC 1NK7A 1ACMB 3IN5A 2CQDA 1FNOA 2AZ3A 3FBEA 1WEYA 3BN4A 3PACA 4ZCLA 4V19X 2VONA 3I4HX 2AW0A 1F3VA 2C2KB 4NI2A 4ES2A 1HI1A 3EZOA 4WFAQ 5A2QU 1AYEA 3QFHA 3BJYA 1KLNA 4LF7F 1YBUA 4DV3F 3GIJA 4Q0BB 4AFFA 4TU8A 1JLCB 5C42B 4ECYA 1IWAA 4DPOA 3GLJA 1FNXH 1HFEL 3VVTA 2HQIA 5CCLA 1XNQF 3CCTA 3MEKA 1TUWA 2B43A 5M2UA 5J2MB 3NG8A 3K7RA 5FD1A 2PMHA 4KAIA 2ZWOA 1BXNA 2Z2LA 3RRGA 2JLEA 3X1LB 5T7LA 1IUJA 3CJ2A 4PKDB 4I56A 2AWZA 3ICLA 4XK8C 3UR0A 4C98A 1JLEA 4ER8A 3EX7B 2YPZA 4A46A 4ZVEA 2ZM6J 4HT5A 1TV6A 2BUNA 1WEXA 3ZTQA 1NM2A 2VPXB 4ZKAA 3C3LA 1SJ1A 4ATNA 4HYKA 1MMLA 1O51A 2DT9A 3I87A 4QIWD 4USVA 3PIOQ 3I9V9 3BREA 1JMTA 4JI3F 4NASA 3K8VA 2V5HG 3BO3A 2CJKA 4DFPA 1C1CA 2DR6A 5CHCB 1K1QA 2JNJA 5E3RA 1TKTB 2RAQA 2R2SA 1C2PA 1X5SA 1GTEA 3R9LA 2M88A 4KGVB 1JXVA 4FXWA 3R7SB 1SV5B 5BXIA 4C3LA 3IR7B 1D8ZA 2HNYA 2LXFA 4EMDA 4N5SA 2W8LA 3P96A 2A1BA 3Q8UA 4ED0A 1Z4UA 1IWGA 1V5IB 1U6FA 3ELHA 4IH6A 4LSNB 3U1NA 4ANCA 1F9HA 4XPCA 3CCUS 1K73T 2XS5A 5C24A 2FHKA 1JWWA 1RKJA 1KWMA 4X4VA 1HD0A 1XK8A 2ZH7A 4B9LA 4ECXA 4LF9J 1BLUA 2CJ9A 1SL0A 3PCOB 4FP9A 2BKPA 3G6YA 1JJ2R 1RBAA 1YZ7A 5KFRA 3U7JA 3C6TB 5CA5A 1CEZA 4DL6A 1OSDA 3POTB 3SSRA 4ZIVA 3KHGA 2KL8A 3HHDA 2HNDB 2WBMA 3LF0A 4R0EA 5MLCV 4ED5A 2IMOA 2QO3A 3DGPB 2OELA 3E01A 4DV2J 3IFEA 1XTZA 2K8GA 5E33A 3KK2A 4Q0BA 4DR7F 4NXMJ 1K47A 1DTTB 3K5PA 4KRWA 4ZN1A 1KLMB 1IVZA 2WONA 1SUQB 2ZJRQ 1KTVA 3GP9A 3FVYA 4J90A 4WFZA 4W4MA 5ETTA 3SZ2A 4K50A 1IQTA 1RXOB 2C3YA 3KUGA 3PKYA 3CCZA 1EAYC 1F60B 1PG5B 1VMBA 4NE9C 1OYDA 1HNZF 1WDTA 1WI8A 4KY3A 2I5JA 4NCAA 5CZXA 2CDRB 4WFBQ 3HFZB 2B4VA 4EYHB 2APOA
chains in the Genus database with same CATH topology
2XM3A 2EC2A 2FYXA 2F4FA 2VHGA 2VICA 2F5GA 2VIHA 2VJUA 2XO6A 4ER8A 2XMAA 2A6MA 2XQCA 2A6OA 2VJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XM3 A;  2EC2 A;  2FYX A;  2F4F A;  2VHG A;  2VIC A;  2F5G A;  2VIH A;  2VJU A;  2XO6 A;  4ER8 A;  2XMA A;  2A6M A;  2XQC A;  2A6O A;  2VJV A; 
#chains in the Genus database with same CATH topology
 4M5G A;  1N6Q B;  2ZD1 A;  1QAX A;  1TFW A;  3FEX B;  3J81 U;  3CDW A;  2HFN A;  4NI2 B;  1U2R A;  5DLF A;  3H0P A;  3LWM A;  5AJ3 F;  4A48 A;  2HVI A;  1XIQ A;  2G2Y A;  5LMU J;  4JOU A;  4LF2 A;  2CNK B;  1KVJ A;  4OX7 A;  3AFG A;  2UXD J;  3PW2 A;  3L7O A;  2X1F A;  2CPF A;  2C3O A;  1VCT A;  4PQA A;  5KFI A;  3D3B J;  1M5O C;  2ZJQ Q;  1AFJ A;  3KDN A;  3M6U A;  1SIZ A;  5HBM A;  1R89 A;  5A6W A;  2IBK A;  3AY0 A;  3OFH A;  4X62 F;  3W1Y C;  3Q8Q B;  1HNV A;  3R5J B;  3M9M B;  3OL9 A;  3VCD A;  3QWU A;  4RLE A;  2MJU A;  2VF3 A;  4Y0F A;  3RZA A;  4N56 A;  1YSJ A;  2CQI A;  4IO1 A;  5KFL A;  5HAO A;  4JI8 F;  3DLL Q;  4IQX A;  5L38 A;  3L95 X;  3P49 B;  3HHK A;  1TUG B;  3QJJ A;  3TYT A;  3OSN A;  2UZA A;  5I3P A;  2ZHA A;  1F1B B;  5K14 A;  1HW8 A;  4LBP A;  1ARO P;  3VF0 B;  4C0O C;  2VG7 B;  2RD5 C;  1X4G A;  2KN4 A;  2XNQ A;  3CCW A;  4RR5 A;  5DO2 A;  3MUM P;  1IKY B;  2FJV A;  1RT7 B;  3TA1 A;  2UUT A;  2E5G A;  3VGV A;  3VHQ A;  3RB0 A;  3DLK A;  4YR3 A;  1WNE A;  1JKH B;  2K3K A;  5C25 B;  4EZ9 A;  1SQF A;  4G3I A;  1N33 F;  2ZEJ A;  3ETO A;  4F0K A;  4TY8 A;  5KT5 A;  3G8S A;  3GII A;  4TXS A;  2KB2 A;  2CJB A;  2RU3 A;  3MOZ A;  3ZTR A;  4ZVS B;  3KUE A;  2KJW A;  2YWF A;  1ZYQ A;  3DRS A;  3OFF A;  2LCW A;  1RAD B;  2CYY A;  2FHO B;  2XZW A;  1G4C A;  3EMT A;  2CPZ A;  4AXI A;  4CLL A;  4I7F B;  4DU7 A;  3DLH A;  2D1C A;  2XZD B;  4OHV A;  3KLI B;  5KG4 A;  4YHH J;  2NZ4 A;  1A9N B;  4J9K A;  4FVM A;  4OX6 A;  1VK8 A;  1QSL A;  1SJ4 P;  3NCQ A;  5B0C A;  2MST A;  2V67 A;  4H4K C;  2C3M A;  3IMQ J;  3V6K A;  3RG6 A;  3KLG B;  1WSV A;  4UZB A;  1VQM S;  5HLF A;  4K4Z A;  3QGG A;  2J0Q D;  1CLF A;  4GKK F;  5I42 A;  3TUJ C;  3M8R A;  1MSW D;  2HFU A;  5F8H A;  3IRX B;  1AB8 A;  2CPI A;  1TAQ A;  2LQB A;  2SXL A;  1REV B;  4OFZ A;  4LRB A;  2DGX A;  4K4Y A;  1E6V A;  4QPT A;  5FDL B;  1TK8 A;  3F73 A;  4ERD A;  2E1C A;  1MMD A;  3NCP A;  4DPU A;  2RRB A;  4DX6 A;  5EHH A;  5IT0 A;  5F3T A;  2F8M A;  2MQM A;  1KNZ A;  2IDE A;  4MTP A;  2NYI A;  4PYA A;  3LAN A;  2CPX A;  3LGN A;  4OV6 A;  1NSP A;  3AXM A;  3T9N A;  4N41 A;  4FYY B;  4O23 A;  2DGV A;  2M52 A;  4P2X A;  1MN7 A;  2DR8 A;  3KLF B;  3KYL A;  4QIG A;  2R7V A;  2Y1R I;  3PM9 A;  1WUU A;  3UD3 P;  4X62 J;  1MN9 A;  1HI0 P;  1VFJ A;  1SC1 B;  3NAH A;  2V2Q A;  1MU2 B;  3AJ1 A;  2BJD A;  5AT1 B;  2W4P A;  4CH0 S;  2OSR A;  2PO4 A;  2EK6 A;  1NJY A;  1U47 A;  1VOM A;  2G2Z A;  3LAK A;  1DRZ A;  3BEG B;  3S8S A;  4C8L A;  2ZZN A;  2FD2 A;  4IR1 A;  2VFU A;  4L6V 3;  1FKP A;  4EGL A;  1HNW J;  4NWB A;  3RGI A;  4NRT A;  3BH6 B;  4NYP A;  1U26 A;  4PZV A;  2CQP A;  2C2E A;  2MZJ A;  3PYG A;  5A8K B;  4OV1 A;  2LU2 A;  2YWW A;  4CTA A;  2BJ1 A;  2XB2 D;  3D0G E;  2OTJ S;  2FJE B;  3PO5 A;  1UVK A;  1HYS B;  3I0S A;  5C7P A;  1DLO B;  8RUC A;  3E3X A;  2U2F A;  4FYW B;  3Q22 A;  1NH8 A;  4DS4 A;  2W7A A;  2RT3 A;  4ZPT R;  3S6E A;  3L3C A;  2EFN A;  2CQ4 A;  2NS1 B;  2QSF A;  2DGW A;  3MEE B;  1C0U B;  4DR7 J;  3D28 A;  1S7H A;  5HAT A;  4MFB A;  4K7Q A;  2Y3Y A;  2BQR A;  1S48 A;  2C2N A;  4DHV A;  2YKO A;  2X3D A;  1S97 A;  4WZQ A;  1HD1 A;  3RB3 A;  3G9C A;  3PV8 A;  4DPY A;  3BQ1 A;  4ZVQ B;  3EZU A;  3BS9 A;  2GJF A;  1TEL A;  2BZ2 A;  2ZC4 A;  1S9G A;  3C16 B;  4CI0 B;  2F9D A;  3Q23 A;  4OJH A;  4MK9 A;  1XEZ A;  4USI A;  1KHW A;  3JTN A;  2PII A;  5HI7 A;  1RAO A;  1M1K T;  2N4C A;  1T11 A;  4LRE A;  1XMB A;  4MFB B;  1Y7P A;  4BCA A;  2XO6 A;  1WWH A;  4ILR A;  3BYP A;  2MXY A;  2GO8 A;  1S9E B;  2QMX A;  2VU5 A;  2FLO A;  2EFV A;  4ZIT A;  5K8M A;  2RQC A;  2VQF F;  1SC3 B;  3HP6 A;  1PJ5 A;  3OTD A;  3GIR A;  3I82 A;  1ULR A;  4OLO A;  5D4L A;  3R5B A;  3ZZO A;  5T14 A;  1Q5V A;  3KK1 A;  2D9O A;  4DX5 A;  4J9L A;  2MJN A;  3T3F A;  3QAT A;  3HJF A;  4ZPC A;  4IG0 B;  3PVX A;  1HYS A;  2W24 A;  1FJG F;  1BY9 A;  3QZ8 A;  3SV3 A;  2F1F A;  3ZC4 A;  4BDP A;  2IIH A;  1RTI B;  5ADZ A;  2POK A;  1LNQ A;  4OI1 A;  3MUR P;  1U49 A;  1GMW D;  2XHC A;  3IS9 B;  3KMS A;  1UW9 A;  4CO3 A;  4NLD A;  4ICL B;  2QX0 A;  3DNC A;  4PYD A;  1SL2 A;  1Y3K A;  3JTO A;  2YKN A;  3OL8 A;  1S57 A;  2HK2 A;  2BJ9 A;  3NBP B;  4ELV A;  2HHQ A;  1S0V A;  2EFO A;  1ZAX A;  3S7R A;  2FLP A;  2WTF A;  2FHJ A;  4ZPB A;  1BMQ B;  2J6T A;  2HHT A;  3PRB A;  2V8D A;  4AE5 A;  4CDI A;  2IRU A;  2H48 B;  4AND A;  5GVQ A;  1MU2 A;  3AOD A;  2VB6 A;  5GAD I;  3NNC A;  1X4E A;  4TYB A;  2V2Z A;  4PXB A;  3N6M A;  3NRB A;  1HNZ J;  2PEH A;  1TP7 A;  2NQP A;  3TEH B;  3GJR B;  1I1G A;  2BRL A;  2NXJ A;  3ITH A;  4J9Q A;  2JLF A;  2NSC A;  2IYG A;  3HI9 A;  5KG5 A;  1FWL A;  4TQR A;  3W60 A;  2XQC A;  3V6D A;  1HAR A;  3PHE A;  4RZR A;  1X4D A;  2J9C A;  2VBW A;  3UR3 C;  1UVJ A;  1N0U A;  4MYT A;  2JDJ A;  4DR6 J;  1H3D A;  2JEJ A;  1HQU A;  3BPS P;  5K8P A;  3J81 j;  4Q2M A;  1Q7Y T;  1REV A;  3H5U A;  2WW4 A;  1BC6 A;  2XYH B;  1RDR A;  2KRR A;  2J8S A;  1N52 B;  3JS9 A;  4NLP A;  4PWU A;  2R7U A;  3NWG A;  4WKR A;  2ZOM A;  2BRK A;  3N79 A;  2NRE A;  4CLS A;  1PYT A;  5EX0 A;  4DV4 F;  2IY5 B;  3QBC A;  1QAI A;  3DGV A;  4PQU A;  1DZ5 A;  4Q8E A;  3U02 A;  1DJ0 A;  3Q2S C;  1S59 A;  4B08 A;  2DRA A;  4AXJ A;  1OQ3 A;  4RWX A;  4DR3 F;  2DIS A;  4EWT A;  4B9N A;  2HHU A;  2DGQ A;  5SUH A;  3KLV A;  3H4B A;  1YI2 S;  2EVZ A;  4USH A;  2H4W B;  1NB2 A;  3DMJ A;  4DFJ A;  3DDN A;  5D78 A;  3DYA A;  4LVN P;  4NLS A;  3US5 A;  2GFF A;  2FTR A;  2ZFH A;  5LXR A;  2ZKU A;  1S4F A;  3UNY A;  2W2N P;  4CO5 A;  3C2P A;  1SKR A;  4PPZ A;  4C8K A;  4V19 J;  4KR0 B;  2MEW A;  1LWF B;  1JKH A;  1VIS A;  2DHA A;  3PFE A;  3ZNJ 1;  5C25 A;  4IUF A;  4GO7 X;  1YIJ S;  1VI7 A;  1X31 C;  2HLT A;  2XZT B;  1RAC B;  3TZX A;  5KFG A;  2DNM A;  5DET A;  3BN7 A;  4BS2 A;  4OIX A;  3G82 B;  4ILL A;  3SCJ E;  2VOD A;  3GWC A;  1R6Y A;  5IQ6 A;  4U8Y A;  1RQ0 A;  4URQ U;  2OHD A;  3UCG A;  1RWW B;  4I67 A;  3QGI A;  1QM9 A;  1FXR A;  1YLX A;  2YY3 A;  2YXL A;  5A8R A;  2RUS A;  3VTI A;  4DBQ A;  4X64 F;  2UUA J;  2NPI A;  5LJ3 Y;  3MMB A;  2RH3 A;  3M7V A;  3OTE A;  2C22 A;  4X4N A;  2B0G A;  3CED A;  2VBX A;  4PEO A;  4IDK B;  1EKR A;  4LF6 J;  4DUY F;  4ELU A;  2QLB B;  2XY6 A;  2XS7 A;  3SI8 A;  2DH9 A;  3LAL A;  4OZN A;  3VAL A;  4M94 A;  3TZW A;  4ZHR B;  2ILZ A;  2XEX A;  1RAH B;  3M8S A;  4LRA A;  2HAF A;  3BQ0 A;  1BUX A;  1HBM A;  3VAM A;  3TAN A;  2B4P A;  1VLO A;  4LT6 A;  1XJW B;  3QGH A;  2KM8 B;  1HNX J;  1L5U A;  2LQ8 A;  3LGH A;  2GX8 A;  1BQN A;  2DH7 A;  3AAW B;  2K1R A;  3MMA B;  4KC5 A;  4YN3 B;  4B17 A;  2EI5 A;  5MAO A;  2A6O A;  1PIL A;  3KUH A;  5B0E A;  2DEI A;  2BQ3 A;  4LRC A;  3Q83 A;  3DCA A;  4P9S A;  2I8E A;  3MDF A;  3QT8 A;  4FNI A;  4JI0 F;  3KJV B;  4QIV A;  3DLE A;  2M8H A;  2DGT A;  2VJU A;  3DRP A;  1ZA2 B;  2ASL A;  1M1G A;  4CO1 A;  4PAA A;  3A13 A;  2DKO B;  4ZK7 M;  3GJS B;  3I9Z A;  2EKY A;  2BAB A;  4P73 A;  2FJW A;  2W9C A;  1ZZF A;  4OQJ A;  3A8E A;  1F9E B;  1MRO A;  2E1R A;  4R25 A;  1EB0 A;  4WYW A;  5LSO A;  3TEG A;  1M5P C;  2ZBI A;  3MTK A;  4FF3 A;  1Q79 A;  4H4O A;  3BGR B;  3ZZT A;  3IP0 A;  4C7Q A;  2KFY A;  1LXJ A;  2VPW B;  2HSE B;  1JLF B;  4RW6 A;  5KFX A;  1Y9O A;  2MHE A;  4OJG A;  1IKV A;  4ZJO A;  2HHP A;  2WRM A;  4B3T F;  1JLB A;  4FPI A;  4RKU C;  3POT A;  3TUP A;  3KLF A;  1RGV A;  2JEI A;  3FEY B;  3DOM B;  1MWZ A;  4O4G A;  1UWA A;  4BLG A;  5HP1 B;  3PKM A;  1RJJ A;  2IC3 A;  1GEH A;  1RWM B;  1LEO A;  2QIF A;  2XMU A;  3IXQ A;  3JTP A;  4LJM A;  3RAM A;  3EJM A;  3W7B A;  4CQ1 A;  4W98 A;  1EZZ B;  1TL3 B;  2YVS A;  2GIR A;  4PR6 A;  4M1K A;  4OI4 A;  1RYR A;  2CFX A;  3DLB A;  2IRY A;  1C4C A;  5ETS A;  3TAQ A;  2HBZ B;  3HX9 A;  1OPZ A;  1ZM9 A;  1Z1Z A;  4MKV A;  2UUC F;  3OUY B;  4LF4 F;  1HLW A;  1TL7 B;  3IM9 A;  1WHW A;  2D74 B;  3F0N A;  2WBR A;  3MR7 A;  5CYM A;  1R8H A;  3LPY A;  1VQK S;  3OD2 A;  1UEU A;  3CWJ A;  1RAF B;  3HHL A;  4OLP A;  4YQW A;  2XO7 A;  2H3E B;  4R5P A;  1D9F A;  1TZ0 A;  3D1Q A;  4LF6 F;  4GC7 A;  3M30 B;  4UST A;  4DZ6 A;  3V81 B;  1FVQ A;  1SIW B;  4KE5 A;  3A12 A;  2DNO A;  2NUU G;  1XR6 A;  3DC2 A;  3H2V E;  1LKZ A;  3H42 A;  3PJW A;  3SSS A;  5LT5 A;  5BR8 J;  2FVC A;  5KFN A;  4DR6 F;  4HDG A;  3MOJ B;  1KBR A;  3SEO A;  2EBG A;  3DRS B;  4MMO A;  5AE1 A;  4DL4 A;  2ATL A;  2C28 A;  1RBL A;  3QLH A;  3UN2 A;  4LF8 F;  2UVV A;  4YFU A;  3NMR A;  3MCO A;  1F5B A;  4NZ7 A;  4QW8 A;  1JK9 B;  2NCK L;  1N33 J;  4OHX A;  1QTN B;  2F9J A;  4MT1 A;  4QIE A;  4C0H A;  3QRR A;  1HWI A;  2QE5 A;  3OXF A;  4IOB A;  4OJ3 A;  1T9U A;  2FPH X;  3NGS A;  2ALZ A;  2FZK B;  4YP3 A;  1EP4 B;  1QSY A;  1V3R A;  4ETZ A;  2GVZ B;  4QIF A;  1RWK B;  2NLW A;  4ECW A;  1XMQ F;  1HHQ A;  2F5G A;  3HSD A;  1SCJ B;  2XMM A;  1GXL A;  2ZNZ A;  3PJ9 A;  3QAE A;  2VFR A;  3QMQ A;  4M5L A;  1V5V A;  3AD8 C;  2G0C A;  3M32 B;  4YB5 A;  4E8U A;  5JVG Q;  2GGP A;  2XUL A;  1EET A;  1PBA A;  2J0W A;  4A8W A;  2QV6 A;  2E9Z A;  2BE2 B;  2FHJ D;  1XR5 A;  4DV1 F;  4DV5 J;  1QUP A;  4RNM A;  2HBR B;  3ENV A;  3THP A;  3CJ8 A;  1HNV B;  4JV0 A;  1E6Y A;  2HWH A;  2XG8 A;  2UV8 A;  2HBY B;  5E3Q A;  4ZVO B;  5HQL A;  4CH1 A;  2LEA A;  4WPA A;  4XAK A;  4YME A;  4X4U A;  2R2U A;  3K8W A;  5F9L A;  2CIM A;  2HLU A;  4NCG B;  4CZC A;  4O3O A;  4ALZ A;  5DG7 A;  1BQM B;  2J0X A;  2HRT A;  1CJT B;  4M5K A;  5HK4 A;  4CP5 A;  4F36 A;  2ZH1 A;  3PW0 A;  3ZNU A;  2AD9 A;  1SKS A;  2IPO B;  4NLY A;  4KKO A;  3IGN A;  4X4P A;  2AX0 A;  1XNR F;  4ZJQ A;  1LWX A;  3FSY A;  4HDH A;  2ZJP Q;  4K4U A;  2ZH8 A;  1AFI A;  3M2R A;  1HPZ A;  3Q89 A;  3TJA A;  4EBC A;  1YIT S;  1KR4 A;  4KYZ A;  3EGZ A;  4U96 A;  3T1H J;  3U1L A;  3K5O A;  2GQ2 A;  2QYG A;  1AT1 B;  4ED6 A;  1REG X;  2IBO A;  2HQC A;  3VR1 A;  5B7W A;  2NXN A;  1PAU B;  2CZ4 A;  3CCS S;  4UY8 5;  3CDA A;  3EVO A;  1RT2 A;  4I4B A;  3VVU A;  4JYA J;  2FGO A;  2LQJ A;  3HSG A;  3C14 B;  3W66 A;  4QBU A;  1RT5 B;  4AT1 B;  2PGC A;  2DYA A;  1T9W A;  2LQ9 A;  1EP4 A;  1BWV A;  1QE1 A;  3KHR A;  2O1P A;  3V4I B;  3ZZZ A;  1NU4 A;  4LBH A;  4BC7 A;  2E7W A;  2YWH A;  1FJ7 A;  1P9Y A;  3DM2 B;  1U0S A;  1UZD A;  2IJN A;  2XMT A;  1RLC L;  3HT3 A;  2OPR A;  4AL7 A;  3CUL A;  2VKZ G;  2P5V A;  3PEH A;  4Y65 A;  3TNV A;  3LP2 A;  2VBZ A;  1L3K A;  3D6F B;  4F4Z A;  1UVM A;  4RUA A;  1UWB A;  1K8A T;  1LWC B;  3GR1 A;  1FRL A;  2UXC J;  2RDJ A;  1NBE B;  2J9E A;  4PWD B;  3MGJ A;  2EFP A;  5K20 B;  2F63 A;  3EM1 A;  1IKW A;  1IKX A;  2DCL A;  4M5N A;  1FKA F;  2E5L F;  3FSX A;  2MKY A;  2L9W A;  2BM0 A;  2BV3 A;  4F67 A;  1WG5 A;  2IM0 A;  2Z2Y B;  2WOM A;  2I2Y A;  4PG5 A;  1O0P A;  2JWN A;  2KU7 A;  2RNE A;  1K0V A;  2UUA F;  2JC0 A;  3ENQ A;  3HHL B;  2Y0S D;  2C3U A;  3HJV A;  3W9H A;  3KJN B;  2R7X A;  4FF4 A;  4IRD A;  3QPI A;  2KG1 A;  3TUZ C;  1Y5L B;  3V6J A;  1XWL A;  4KJI A;  2HVH A;  2E7X A;  3OUY A;  5KT7 A;  4JI4 J;  1C0T A;  1PC4 A;  4L73 A;  1TMJ A;  1FRM A;  1UKU A;  4RW9 A;  3SSQ A;  6AT1 B;  2XYP B;  1VHF A;  2D7S A;  1WHX A;  4ZS6 A;  2XHW A;  2QA4 G;  2FLL A;  1A6L A;  1EJ7 L;  2VL1 A;  2ZE2 B;  3EGW B;  1N34 F;  2KVI A;  2PA8 D;  5D4P A;  2MGZ B;  1VQ5 S;  3KG0 A;  2IC3 B;  2YKM A;  3GB0 A;  3UN5 A;  3KHH A;  2BR0 A;  2QL5 B;  1LWC A;  3FGV A;  4B9S A;  1T7P A;  1S99 A;  4OZ3 A;  1XER A;  3JYT A;  1UPM B;  1B7Y B;  1NSQ A;  1I5O B;  3RTV A;  1J27 A;  4QU6 A;  2CQ3 A;  3FBC A;  4X64 J;  1SH3 A;  5ETM A;  4P74 A;  2BOA A;  2CPY A;  2YBV A;  2R9L A;  2OPR B;  3IO1 A;  2E1A A;  3BBC A;  4H4O B;  1TV6 B;  5DG8 A;  3DM2 A;  5KG0 A;  4XIU A;  1YHQ S;  3Q8P B;  4J37 A;  1KQG B;  3H98 A;  4NA3 A;  4ED2 A;  4PUO B;  2ACM A;  4AQY F;  1HHS A;  1PAE X;  2Y8W A;  2KYX A;  3M6V A;  3G8T A;  4LRF A;  4HKQ A;  3DRP B;  4KB7 A;  3MFH A;  3C14 A;  1H98 A;  2BAC A;  2FY8 A;  5KFO A;  2XCA A;  3K59 A;  1KEK A;  5DQG A;  2UVR A;  4LF8 J;  4OHW A;  5IV4 A;  4I1T A;  3EDQ B;  4DN9 A;  2LYV A;  4IOA Q;  2F4V F;  2P2C B;  4LIR A;  2DXF A;  3ZO7 A;  3D7S B;  3BGU A;  3GFX A;  2HHH J;  1IR0 A;  1P8G A;  2AEF A;  3EXY A;  5IC6 B;  5J2Q B;  1HR0 J;  4ETX A;  4RU2 A;  5T41 A;  1YDL A;  1FFW B;  3EIC A;  2MKI A;  5HRO A;  3ZZU A;  2P8I A;  2WSC C;  3PYE A;  3IAS 9;  3MWB A;  1RHK B;  2H5E A;  2ZNY A;  4EO8 A;  1UZH A;  3CJ3 A;  2M0G B;  3VAJ A;  3UDV A;  4QWA A;  3DLJ A;  3AA8 A;  4IDK A;  2LEP A;  4PAB A;  3J80 Y;  1DQA A;  1R8A A;  2O01 C;  4ED4 A;  2K2P A;  4ECR A;  3BKU A;  2BXJ A;  3I31 A;  2WW8 A;  4J9N A;  1M90 T;  1FEE A;  1TR0 A;  3CMA S;  3W2V B;  1TFY A;  4B02 A;  2CUY A;  4DCO B;  2YH0 A;  3PR5 B;  1MNE A;  4ZA1 A;  3KLH B;  1IBM J;  3QJL A;  1CQM A;  2BVZ A;  2NYH A;  2KVQ E;  3RW6 A;  3CJR A;  3BSN A;  3IWX A;  2GGP B;  2UUB J;  1T9V A;  1NK4 A;  2RKI A;  2EK1 A;  2R8I A;  1XMO F;  2F4F A;  1R8B A;  1TKZ B;  3AB2 B;  3DOL B;  4J7C A;  5LSL A;  2IVY A;  1NK6 A;  4DSI A;  2XMA A;  2AYG A;  3OJS A;  3G82 A;  3S01 A;  3SFU A;  4ECV A;  2AJQ A;  1RWU A;  2QTW A;  3E8O A;  3T6B A;  3UO0 A;  1O8B A;  3MPD A;  2FJA B;  1KQK A;  1KKH A;  4X66 J;  2HS3 A;  3UDC A;  3TJ8 A;  5KFB A;  4NEZ A;  3VAF A;  3R5A A;  2XGP A;  2AYB A;  1HMV A;  1R3N A;  4A47 A;  4O3N A;  3IBW A;  1LW0 A;  1RU1 A;  1UJ6 A;  3QWP A;  1NDK A;  2BE7 D;  4Y3C A;  1YWX A;  9RUB A;  3HXM A;  1GXT A;  3I55 S;  4GKJ J;  4DR4 F;  5IZH A;  3HZE A;  2L48 A;  4TVA B;  1BGX T;  1RE1 B;  3LGM A;  2MY8 A;  4EO6 A;  5J1P A;  3T5L A;  3VGS A;  3PZP A;  5KFA A;  1WTF A;  2I1R A;  3IBC B;  2HKE A;  3V81 A;  2HFZ A;  3LWL A;  2ACY A;  1FKO B;  1MLA A;  1NPK A;  4FPR A;  4HH1 A;  2EFG A;  4OMF G;  5E2Q A;  2NPF A;  4DV7 F;  3PXG a;  4QR1 A;  1VBX A;  4I2Q A;  4JI1 J;  1UFK A;  1TUV A;  4TLR A;  2KT5 A;  2Y1L B;  3KHL A;  1KRP A;  1TL7 A;  3T5K A;  1FTC A;  1ZM3 A;  3VAI A;  2HHW A;  1CBK A;  4DN0 A;  2YH1 A;  3N6L A;  1T3N A;  1CC8 A;  4JI0 J;  3UQS A;  3ZXW A;  1QVF R;  2QLJ B;  5ETO A;  3D66 A;  2V4R A;  2RE1 A;  1NJI T;  3MPW A;  3Q8V A;  1RAE B;  4K2X A;  5AXK A;  3RB6 A;  3BSC A;  1VBZ A;  5CAB A;  5L39 A;  3FNN A;  3OTO F;  1X4B A;  4B9T A;  1UW4 A;  2Q1L A;  3ISZ A;  2GS8 A;  3PRD A;  2IAJ B;  4DV0 F;  2Q79 A;  2UVW A;  2R7O A;  4D3H A;  1WG1 A;  3HFK A;  5LSR A;  3ZZR A;  3HF5 A;  4RW6 B;  5DQH A;  2P9G A;  3JSM B;  1WOP A;  3BGR A;  1R31 A;  2HFV A;  1KVI A;  2BJ7 A;  3JQM A;  2XI2 A;  2BAN B;  1B0P A;  3NBP A;  1JIH A;  4TQS A;  9ATC B;  1S76 D;  5BYQ A;  1JXE A;  5SZT A;  5CH7 B;  5L8R C;  1RHR B;  4JI6 J;  4USM A;  3MEG B;  2N3L A;  3PRV A;  3OR2 A;  4EK2 A;  1RTI A;  1N32 F;  2WZ1 A;  2V4J A;  2GV1 A;  4U9R A;  2FLN A;  2ZH4 A;  1VS3 A;  2H54 B;  2FDN A;  4OZ0 A;  4WU3 A;  4O3Q A;  3CCQ S;  1HNX F;  4F02 A;  4UOH A;  2C2O B;  4ZLJ A;  2CKW A;  2X1A A;  2QFJ A;  3WC2 A;  3ISN C;  1C1B B;  1CJV A;  1LW2 B;  4HTJ A;  4JUZ A;  3IM8 A;  1N5T A;  5CYQ A;  4D3G A;  4NPO A;  2VG5 A;  3BSO A;  2RJZ A;  4ZVR B;  5H9F K;  1W2I A;  1NLK L;  3B82 A;  3G6E S;  2GMJ A;  1I94 J;  2DHG A;  5ETL A;  3FBB A;  3M6W A;  3CCJ S;  4LFB J;  4H4M B;  4J9M A;  4ECZ A;  1H0H B;  5ETQ A;  3HMJ G;  2AGO A;  3B6B A;  4A8O A;  5FLX U;  4F4X A;  5B09 A;  4DV6 J;  4P2F A;  1S6Q A;  2RIL A;  1KFS A;  2OPQ B;  3H8Y A;  3HD2 A;  2OO4 A;  4KPC A;  4C3M A;  4WK3 A;  1ZM4 A;  4U6P A;  1D9A A;  3D2W A;  4P71 A;  2OAU A;  1RI7 A;  1Q82 T;  3AJ2 A;  4LVO P;  4B9V A;  4RBV A;  5A76 A;  1C0U A;  1RYS A;  3D68 A;  1M0S A;  1VRU A;  3C6U A;  3EGV A;  3OVS A;  3GCW P;  2AJ4 A;  3MMB B;  2DB1 A;  2WVD A;  3P5T L;  2C2R A;  4EI2 A;  1T03 A;  2GHW A;  4KGK A;  4M5H A;  1U1Q A;  1DLO A;  3MM6 B;  2D69 A;  3CCR S;  2P6S A;  4RNO A;  1TL4 A;  2B8P A;  4FKX A;  3DHX A;  1S49 A;  5HVG A;  2HIQ A;  2Z2M A;  2XY5 A;  3M6X A;  4N76 A;  3QT6 A;  2KXF A;  3MEG A;  2DXE A;  1FKP B;  4MAK A;  2DIV A;  4PPD A;  1P9Q C;  4ZPW R;  2QN6 B;  1ZH5 A;  1SPB P;  2QRR A;  2W2Q P;  4WFN Q;  3NWR A;  1I3O B;  4DFM A;  1Q86 T;  2XI3 A;  2UUW A;  3UPF A;  5A0Y A;  3LP1 B;  3BBB A;  3DYA B;  1QD1 A;  3WBZ A;  3VAK A;  3PDN A;  2JX2 A;  4Y2I A;  5D4N A;  4DWI A;  1NME B;  4I69 A;  4CO4 A;  1YJN S;  2U1A A;  2DY9 A;  3HO1 A;  1YK9 A;  2FQQ B;  2F8H A;  1N56 A;  2E29 A;  3O44 A;  2D41 A;  1OWX A;  1XC9 A;  4OX9 F;  5GAD U;  2AV5 A;  1K0T A;  4N7T A;  1ZOT A;  5IFM A;  5D8H B;  1RP5 A;  3WIU A;  2QL7 B;  4QYZ K;  1IM6 A;  4QYR A;  1FDA A;  2CPD A;  1RTD A;  5EX3 A;  3T19 A;  2MMY A;  4JI7 F;  3NOC A;  3PG9 A;  3CSK A;  1NCL A;  4RW7 A;  3G86 A;  5HLF B;  1RTD B;  3CO0 P;  1T94 A;  2V2K A;  4A8Q A;  4F3M A;  1AZS A;  4W92 B;  2WVF A;  4K0K F;  2HHS A;  5LMU F;  4Y6I A;  1N5S A;  4J5O A;  2YTC A;  2Y9H A;  3R27 A;  4OL8 A;  3ZZY A;  2RSQ A;  1MMN A;  3W3S A;  1AW0 A;  3GV5 B;  3M05 A;  4RPF A;  2EKN A;  2V0N A;  2QJ3 A;  2XMK A;  3BGL A;  1HA1 A;  1NPP A;  3HKZ D;  3PJX A;  2VJV A;  3P6Y C;  5JUM A;  4ZVG A;  2H5J B;  4C11 B;  5HJY A;  1SH2 A;  2XLI A;  3DFE A;  4PCQ A;  3PW7 A;  4Y2M A;  2HQ3 A;  3IGV A;  4TY9 A;  5ETV A;  3AA9 A;  2DPJ A;  4TN2 A;  4DF8 A;  3IWN C;  4JI8 J;  1GX5 A;  5IT4 A;  3DLK B;  5DG9 A;  1NDP A;  2V94 A;  2W25 A;  2W2M P;  4CCH A;  4L74 A;  5CD4 H;  1RT7 A;  4DR5 F;  4ZVP B;  4DUZ F;  1IKY A;  4OX8 A;  4UQT A;  5C5J A;  3IS9 A;  1N34 J;  1FJE B;  5I3U B;  2DNK A;  1H7X A;  5GAE I;  4LQ3 A;  1RUS A;  4LR8 A;  4CO0 A;  3DI6 B;  3DOL A;  3CMQ A;  3H90 A;  1F0X A;  3T6J A;  1UTA A;  2MZR A;  3LO3 A;  3MPY A;  4IG0 A;  2HNZ A;  3C15 A;  4M5J A;  4CLZ A;  1JB0 C;  5FII A;  2BKN A;  3PNI A;  3OL6 A;  3QAU A;  4Q2L A;  5GAE U;  3H5X A;  2CG8 A;  2E66 A;  4DV0 J;  5GMD A;  2VKR A;  2OEM A;  1T03 B;  1T95 A;  2JRS A;  3M2U A;  2R8H A;  1VRU B;  2E44 A;  3C6U B;  2FHM A;  3N5B A;  4KGM A;  1FRK A;  2K7J A;  4GRS A;  3HUL A;  1YJR A;  2RDD A;  2DHX A;  3F56 A;  1OQ6 A;  2IM3 A;  4IQM A;  4JV1 A;  1VQ6 S;  3K2Y A;  3MAH A;  4DDF A;  4DUT A;  1VQS A;  3CJ5 A;  3TX8 A;  4NLU A;  2WVE A;  2OPS A;  4MIW A;  2DEJ A;  2BJ3 A;  2XBP A;  3M2V B;  4RNH A;  4J9P A;  1W26 A;  4YB7 A;  4YY3 J;  4FYX B;  3G96 A;  3NGK A;  3OTB A;  5HRO B;  1P1L A;  1JLG A;  1RT6 A;  2F7V A;  1TTH B;  2YPY A;  1EAR A;  1VJW A;  1VYA A;  3EE3 A;  4XO0 A;  1X5T A;  3MEE A;  2YNI A;  5CYQ B;  1N54 B;  1W25 A;  2OFG X;  5KG7 A;  4EBD A;  1C1B A;  1CJV B;  1GXU A;  1YZ6 A;  2I5J B;  4WXW A;  4I6Y A;  4RNF A;  4F3Q A;  3BB5 A;  4Y2K A;  3J81 Y;  2CZV C;  1WHV A;  2PSZ A;  1VHI A;  4OYI A;  3M9N B;  2WSE C;  4DR4 J;  2QG9 B;  2VA3 A;  4ZPD A;  2B9X A;  3QZ7 A;  4DR3 J;  1L3S A;  1TL5 A;  1GX6 A;  2RUG A;  2WCX A;  4AD6 A;  4P2S A;  5HVF A;  4ELT A;  3BBF A;  2P9C A;  1CUL B;  2H1Y A;  4NMX A;  1I94 F;  2CAJ A;  5HSP A;  4A4J A;  3Q0A A;  3BPD A;  1PBU A;  2FVP A;  2E5I A;  3HHN B;  4PWW A;  2L9N A;  3DN9 A;  5C2G A;  4ANE A;  3E01 B;  2DHH A;  1VR6 A;  2RQK A;  2V63 A;  4ID8 A;  3CD7 A;  1IQZ A;  3ZZ0 A;  4DCJ B;  2VIH A;  3M8Y A;  2YQ1 A;  3MED B;  1WKJ A;  3JYT B;  4DSJ A;  4JV2 A;  5DJB A;  3WZ0 A;  5BYR A;  5F8L A;  2I9S A;  2FC8 A;  2OUG A;  2Q6C A;  1QSS A;  1URN A;  1ZAW A;  2YKM B;  1NK5 A;  2LLZ A;  3TA2 A;  2MGZ A;  2OIH A;  3EWG A;  4M5D A;  1UVL A;  1N5Y B;  1DQ8 A;  4MIB A;  2GW8 A;  3BQ2 A;  2PN6 A;  5FJ4 A;  5IWA F;  3NNA A;  2BX6 A;  3HZG A;  1C0T B;  4RW9 B;  4DL3 A;  1S6P B;  5J1E A;  1Q8I A;  2VFV A;  3M8Q B;  3K57 A;  1J5E J;  3FRZ A;  4F4K A;  1LOU A;  2PT0 A;  2DD8 S;  4ZCK A;  4AL6 A;  6FD1 A;  4I0W A;  2PE8 A;  4I2Q B;  1GTH A;  2DNR A;  4G1P A;  3KLG A;  2FVQ A;  1CVJ A;  2LU1 A;  2ZZM A;  3CJS A;  1CJU B;  1WAC A;  5L1I A;  2HVD A;  2LFV A;  3R97 A;  5ETN A;  5KOX A;  1RSC A;  1HQ2 A;  3R7B B;  1UA0 A;  1FWP A;  3IAM 9;  4Y34 A;  4BHQ A;  5F9N A;  3L9Z A;  4I7F A;  3SBM A;  3V2U C;  3MUT P;  2C2M B;  1LV5 A;  3Q8Y A;  1NXI A;  3PYD A;  4HR2 A;  3FFI A;  1FWK A;  4F25 A;  2N7C A;  5HMW A;  1K9M T;  4RL1 A;  4QCL A;  5A8W B;  1T05 A;  3NS7 B;  4DL0 C;  4KO0 B;  1NO8 A;  2GC8 A;  2VAS A;  2MKH A;  3UVJ A;  1RT1 B;  1HR0 F;  4C8Z A;  1S12 A;  3GV7 B;  1NK9 A;  1VQY A;  2NXC A;  2DR5 A;  1JJH A;  2DGO A;  3IG1 A;  5G0R A;  3L09 A;  3QID A;  4ZVH A;  3B78 A;  4EYI B;  5T7L B;  2A0F B;  3A8J A;  2G13 A;  2GHV C;  2UXD F;  4X2B A;  5FLX Y;  3KNG A;  2W9B B;  2Q6B A;  1ROF A;  2VPY B;  1RT2 B;  5KG2 A;  2E5L J;  2WK4 A;  2HRU A;  3AD9 C;  3L4B C;  1CS4 A;  2OJ3 A;  2PFD A;  2MQO A;  3DLG A;  3DRR A;  2HYI B;  3AB4 B;  1VDH A;  5JMN A;  4L75 A;  5C42 A;  1JLC A;  1RCX B;  2VQF J;  2QZ8 A;  3C66 A;  4B3T J;  5L9X A;  2H51 B;  5RUB A;  2J9D A;  1FVS A;  3VGU A;  2OP5 A;  2BQU A;  3HVT B;  4KV8 B;  4NYZ A;  2ZVS A;  1ZPW X;  2RF2 A;  4O4R A;  4OYO A;  4YDD B;  2W7O A;  1FDD A;  2A3J A;  4A8S A;  2RHQ B;  4KKO B;  5KG3 A;  3RYL A;  2D3Z A;  3V6H A;  2Z58 B;  3QIP B;  2UXB J;  2RF2 B;  3GG0 A;  3GSD A;  3FZ2 A;  4NZ0 A;  4NZ6 A;  2E1M C;  3GJT B;  4ECS A;  3PO4 A;  2OLW A;  3S1T A;  4ZOS A;  1VBK A;  1YRT A;  3I4P A;  2JVR A;  1D0E A;  3O3L A;  3TVK A;  5J2P B;  2YQ0 A;  4WP8 A;  4CM0 A;  4WTO B;  3D1O A;  5E3P A;  2GHP A;  4DSF A;  2ZIT A;  2BE2 A;  2JLG A;  1GT8 A;  4QWC A;  2V69 A;  4RW8 A;  4K0K J;  5HAN A;  2MKJ A;  2ZDP A;  2QA4 S;  1Y11 A;  5LL6 d;  2JC1 A;  3O1L A;  3F44 A;  3NL0 A;  1R0C B;  1WEL A;  1RAG B;  3GZ7 A;  3DRX A;  3KKF A;  2WON B;  1Y10 A;  3NOG A;  4JBC A;  3OPK A;  1U6B A;  1T02 A;  2CVI A;  3TW0 A;  2PA3 A;  1A7G E;  1ZM2 A;  3IG1 B;  4EFA C;  2AU0 A;  1J5O B;  1JLA B;  2M3D A;  1PCA A;  4J9U E;  4EZ6 A;  4DU8 A;  1F2G A;  4P2M A;  3WC0 A;  3O2I A;  2D3O 1;  1H72 C;  1RWX B;  2GNK A;  3JB9 k;  3KK2 B;  3B4D A;  4WU2 A;  1IJE B;  2BYC A;  1U25 A;  1KS2 A;  3K17 A;  2A18 A;  2CNN B;  4WP9 A;  5E41 A;  4DR5 J;  4AQY J;  5KFK A;  1OY9 A;  2VH7 A;  2D3O R;  8ATC B;  5HN0 A;  4FDF A;  2HHV A;  4GC6 A;  5H9E J;  3J7Z T;  3MM5 A;  2HWI A;  4BC9 A;  1HIY A;  4JYA F;  1TAU A;  1EQM A;  1R7I A;  4K59 A;  4DR2 J;  1R0A B;  3HHL D;  2KZM A;  3M30 A;  2NXE A;  3A4T A;  2C3P A;  2ADB A;  1VQO S;  1NKE A;  1TQL A;  3W8G A;  3MEC A;  4DPX A;  2DRB A;  5C24 B;  2H5I B;  3UD5 A;  3FC9 A;  2AIR B;  5CYM B;  1NZA A;  4LSN A;  1EIY B;  2C42 A;  4U8V A;  2ZH3 A;  3Q2T C;  3Q86 A;  1SH0 A;  5HL7 Q;  3NXZ A;  3N28 A;  4FS1 A;  1R27 B;  2GO9 A;  1DFD A;  3M8Q A;  3MUV P;  2RRA A;  4CO2 A;  2W1B A;  4ZCM A;  2ATC B;  2XSJ A;  4CNY A;  1EHW A;  1Q8L A;  1FNM A;  1TL3 A;  5H1S V;  5F8N A;  3CCV S;  3MAQ A;  1FF2 A;  1R0A A;  1IN0 A;  2RRN A;  1IKW B;  3FZB A;  4L3K A;  4PXC A;  3SYZ A;  3T1Y J;  1NUE A;  3UDE A;  4B3M J;  2RB7 A;  3Q8R B;  3J7A 1;  3OQ2 A;  3NS6 A;  3W65 A;  3QRP A;  1RT3 B;  5IWA J;  4I2P B;  1OJ4 A;  5A2Q Y;  2FY1 A;  4C8Y A;  2KFN A;  5M2R A;  4X4R A;  2B3T B;  2V4Q A;  4WF9 Q;  4X66 F;  3NY0 A;  1YGY A;  2W2O P;  4YEA A;  2CPJ A;  2ZH2 A;  5DS7 A;  4IRC A;  1FI4 A;  2B6A A;  2A2D A;  2JFD A;  1WC6 A;  2DBB A;  4GVL A;  3MFI A;  1UVN A;  2VOO A;  1HBU A;  2EG2 A;  2GAG C;  3ZTO A;  4XDC A;  2XS2 A;  4USU A;  1WHY A;  1QE1 B;  2MHN A;  3AOC A;  2KT3 A;  3FBF A;  4OYZ A;  4P52 A;  3TQE A;  2Y8Y A;  1NJZ A;  2VQE J;  3DRY A;  3K5M A;  2FJX A;  1GH8 A;  3DLE B;  4MKB A;  4RJV A;  5DDO C;  2HS4 A;  4V1A k;  2F8E X;  5J2M A;  2CNL B;  3I5B A;  3UE2 A;  5EGY A;  1HWL A;  3CJT A;  5KTQ A;  4DR1 F;  1HBN B;  2IA0 A;  5KT6 A;  1JNR B;  4LF9 F;  3PYF A;  3TAM A;  2AYM A;  2YNI B;  1DHM A;  5J2P A;  1U0H A;  4DZD A;  3MMA A;  1BQN B;  1DQ9 A;  2O67 A;  2YKP A;  5EUH A;  4M5I A;  2LQ5 A;  3TA0 A;  2BW7 A;  1QAY A;  5DDQ C;  1M5H A;  4U7C A;  4ED7 A;  4X4Q A;  1AUD A;  4RU9 A;  3TZY A;  2ILY A;  3T1A A;  1YJU A;  4IH7 A;  1WKL A;  4NRU A;  4ZHR A;  1BQM A;  1RTZ A;  4QWD A;  2Z56 B;  2AQ4 A;  2K3I A;  4KHP J;  3MCN A;  4CYU B;  2OTL S;  4FF1 A;  1WTB A;  1KD1 T;  2VV5 A;  3PX0 A;  2DK2 A;  1M5K C;  2ERR A;  2PDA A;  5KT3 A;  3DLG B;  3DRR B;  3QYY A;  4X84 A;  2CQ0 A;  2V8H A;  2PMW A;  4HHJ A;  4CWB A;  3GON A;  4WKY A;  3J7A N;  1U1O A;  4Q44 A;  4MH8 A;  1SQG A;  4KHR A;  5D3G A;  2HNZ B;  3C15 B;  3M32 A;  2W9B A;  4M8L A;  1RCO B;  1YBT A;  4NLW A;  2AT1 B;  2YNF A;  3ET6 A;  1G3O A;  5GAH I;  3ISN D;  4P6Q A;  4RUB A;  3MMC A;  4FNH A;  2AGQ A;  4FVC A;  2MQQ A;  4K4S A;  1G2E A;  3BKF A;  2KH9 A;  2M5Y A;  5KFP A;  4XPE A;  3C8Y A;  3GTY X;  4Z7Y A;  3CJQ A;  3VWS A;  1VQ4 S;  1Q16 B;  4QR0 A;  4WFY A;  3VQS A;  2ZBC A;  2GIQ A;  5KG6 A;  2ZUA A;  2ASY A;  2FUG 9;  3MTJ A;  5D0H A;  3SDE A;  1L3V A;  1B0T A;  3IA0 A;  5DZ6 A;  1TKX B;  4U7U K;  3WQP A;  3FFI B;  4WE1 B;  1KVK A;  1U6Z A;  1WKK A;  2CWK A;  1UPP A;  2GCF A;  1YJV A;  1VRT B;  1YVF A;  3D67 A;  4Y28 C;  2CDQ A;  4JV5 J;  5DM6 Q;  2ZOF A;  1U2F A;  3LUY A;  3ILI A;  2BDP A;  3O8W A;  3NMA A;  3H2L A;  4NLV A;  5ETR A;  3VZI A;  3M8Z A;  2IMW P;  3SQG B;  1OYE A;  3DOK A;  1JLQ A;  3CDE A;  3LP0 A;  3N6N A;  2WSF C;  3THT A;  3N5F A;  4ZIW A;  5L1K A;  1I6J A;  3UFC X;  2DH8 A;  1AZS B;  4YY3 F;  1CJU A;  4X4O A;  2J0S D;  2LDI A;  4KH0 B;  1OMS A;  2CA9 A;  1AUS L;  4URS A;  2HMI A;  4KTQ A;  4C8M A;  4OI0 A;  2XNR A;  1D09 B;  2IRX A;  1FRH A;  5D6G A;  2OMO A;  5CZV A;  3QO9 A;  4X4S A;  2JOQ A;  2HG4 A;  4DSE A;  1YTY A;  1FK9 A;  2MLY A;  3HLU A;  4NX9 A;  3NNH A;  2B56 A;  2HEK A;  4JP8 A;  1LK5 A;  1AXQ A;  1R0B G;  3PFO A;  4QR2 A;  5GAG U;  2UXC F;  2BBE A;  2BJ8 A;  1QUV A;  1A0O B;  1NKB A;  2QYC A;  4I64 A;  4IG3 B;  3RBD A;  5KT4 A;  2L08 A;  2RML A;  1WC3 A;  4DI6 A;  1VQ7 S;  2B7B B;  4LR9 A;  1KSP A;  1UJ5 A;  4PG8 A;  1FES A;  1T9T A;  3CJK A;  5F8J A;  2R7R A;  1WC4 A;  1NND A;  4G1Q A;  4KH1 B;  2R7Q A;  3BGO P;  3W5X A;  1JLB B;  2ROE A;  3M9O B;  3H5Y A;  3BO4 A;  3JAM U;  2D3U A;  4ZPV R;  4CH7 A;  4ZLN A;  1Q78 A;  2MKC A;  5K8N A;  1HWK A;  3J7Y U;  4L3N A;  1XQI A;  1S7I A;  2OD6 A;  3NP5 A;  3RR8 A;  2ZVI A;  4UTG A;  5IM0 B;  2UUB F;  1FD8 A;  2ZOG A;  3N0V A;  4F8R A;  3OXL A;  3BF4 A;  2NZC A;  2O5D A;  3HCX A;  1BE4 A;  2OGU A;  4DCP B;  2ROP A;  4GVB B;  5AE2 A;  1SBR A;  2CQB A;  4EU0 A;  3BV8 A;  1OY6 A;  3K5N A;  3MM7 A;  1Q53 A;  2KXN B;  4A8Y A;  4B3M F;  1XNR J;  4QPX A;  1NEE A;  3K89 A;  1D1U A;  3GPA A;  1VQN S;  1RA7 A;  2DGS A;  4K2J A;  1VIX A;  3Q8S B;  5D15 A;  2ZM6 F;  3JSB A;  3H25 A;  1M1H A;  4NLG A;  4EBE A;  4HTI A;  1T9X A;  2QL9 B;  2JJ4 D;  3KFW X;  4HEA 9;  4IH5 A;  3VZH A;  3NGD A;  3HM9 A;  1T8E A;  2JEF A;  4O0N A;  4J9S A;  2EEY A;  1IXK A;  3UCZ P;  2K1R B;  2BMB A;  2EC2 A;  1WEZ A;  4U67 Q;  1GQE A;  1SJF A;  1U09 A;  1JLG B;  1RT6 B;  2V8G A;  3QSI A;  4G6V B;  3VAH A;  4JI3 J;  5EWG A;  5DDP C;  1FX4 A;  2DO4 A;  2V50 A;  3M1V B;  3P4U B;  4FYV B;  4N77 A;  4F4A A;  2EG1 A;  2AJ1 A;  1ZTW A;  1S6Q B;  2MKK A;  2DHS A;  3A3N B;  3PIP Q;  3BGF A;  2HVE A;  1S1X B;  3NKY A;  4ZLL A;  1VBY A;  2MSS A;  5BR8 F;  1UAW A;  4H4M A;  4KIA A;  3EDR B;  4UUX A;  1MWQ A;  3JSY A;  2K7K A;  4OI2 A;  1LFW A;  4FXD A;  2Y1J A;  4URG A;  1GNK A;  2LP4 A;  2LVW A;  3FRY A;  3G87 A;  2HHH F;  3OR1 A;  4UY8 T;  1NKC A;  1B99 A;  2W4D A;  2AHO B;  4P72 A;  4M63 A;  4PXD A;  1B70 B;  3T5H A;  1VQL S;  4JB8 B;  1RAB B;  4RW4 B;  5IS2 A;  2QA1 A;  3SQO P;  3OHA A;  4FBU A;  1S77 D;  3IRW P;  4IR9 A;  3OTO J;  4GVB A;  4C4W A;  1CJK B;  4X4T A;  4F0M A;  2PI4 A;  4LF7 J;  1U24 A;  3FK4 A;  2W7P A;  1K44 A;  1VLY A;  1ZPV A;  3I32 A;  2W8K A;  4DV2 F;  1U48 A;  4FZV A;  2E9R X;  4B3O B;  4LMZ A;  1IJF B;  1VQP S;  4LIW A;  4NLR A;  3AT1 B;  3NS5 A;  5D0R A;  1HNI B;  4DPT A;  1FFS B;  4KBI A;  2FJB B;  4LBI A;  4DQS A;  1ZS6 A;  3QSY B;  1S1V B;  2G2O A;  2IAJ A;  2Z2Z A;  1NZ8 A;  3D0H E;  2AKW B;  1TVR A;  1UJ4 A;  3FCW A;  3MM9 A;  1PYO B;  3DMJ B;  1PC5 A;  2X7I A;  3P3D A;  2OPP A;  2VG6 A;  2BEF A;  2GA7 A;  2AGP A;  3W61 A;  1K1S A;  2IM2 A;  4NLO A;  3SV4 A;  5E7O B;  4X65 J;  3SXL A;  2MQ8 A;  2WAQ D;  2HGM A;  4IG3 A;  1ITP A;  1S6O A;  2HQF A;  1S5Z A;  3AD7 C;  2RVJ A;  2DNQ A;  4YOE A;  3CME S;  3QT5 A;  4PQU B;  3HHE A;  1E6V B;  2Z30 B;  3OXG A;  4UUW A;  5DZ7 A;  3G71 S;  2IVM A;  1U1M A;  3EPI A;  2IM1 A;  1SVD A;  1XBW A;  4OZ1 A;  2OEK A;  4KGX B;  4RW7 B;  2GQQ A;  2N4D A;  5DM7 Q;  3CC2 S;  2G0I A;  3B4M A;  2AJF E;  1B7F A;  3U27 A;  3PW5 A;  1KDN A;  3PX6 A;  4QQB A;  2HMI B;  1GMV A;  3QQC D;  4LR7 A;  5AE3 A;  2WHO A;  4QZV B;  1QAJ A;  1RBO B;  4JV5 F;  5CXT A;  2DIT A;  2J5A A;  2EWH A;  2M9K A;  2B8Q A;  3CNQ P;  2CQC A;  5B0F A;  1WJ9 A;  1H38 A;  3OBI A;  3V6D B;  4UOF A;  4LSZ B;  1W7W A;  4NXN F;  1VRT A;  2MKS A;  3AJD A;  3C19 A;  1VRQ C;  1Q95 G;  2FGC A;  5DRK A;  5IV3 A;  1H74 A;  1B4S A;  1TVR B;  3W8P A;  4DLG A;  4P10 A;  2P6T A;  3TUI C;  3FQK A;  5A0Y B;  5DGB A;  4DFK A;  2HZV A;  4JI1 F;  1FE0 A;  2E1P A;  2G0J A;  2YWG A;  3RW7 A;  2COL A;  4TY8 B;  1LWE A;  4ZP7 A;  4ECQ A;  2M4M A;  1H2U X;  3KLE A;  3LOU A;  3HHL C;  3LQV A;  3TX0 A;  1L3U A;  4C8O A;  4B3R J;  5K9F A;  4HHU A;  1RWO B;  4DLE A;  2H4Y B;  2YKN B;  3NGT A;  5D77 A;  1Z2L A;  2QT7 A;  1CJK A;  1URR A;  4I68 A;  2CQG A;  2FJD B;  4OI6 A;  3OL7 A;  2ASD A;  4JI2 J;  2DCU B;  1UP1 A;  2AJ2 A;  4J9O A;  3FMW A;  2XSF A;  1X4A A;  3CIZ A;  3MCS A;  1WOR A;  1DAX A;  3KXD A;  3UN3 A;  4WFX A;  2OKQ A;  2RKI B;  3FDS A;  3E51 A;  1IBL J;  1GFW B;  2CJQ A;  4IOC Q;  5EDW A;  4XTT A;  2VOP A;  3PW4 A;  3M8W A;  4LF1 A;  4ED8 A;  5KAK A;  1P27 B;  5KFE A;  2E5J A;  3FKB A;  3KG4 A;  1N8R T;  3MPV A;  4Z2X A;  4FF2 A;  2OFH X;  2V68 A;  3OW2 R;  1VGY A;  3CGI A;  2ZH9 A;  4TLQ A;  4NEY A;  4CLP A;  1PJ6 A;  5F0U A;  3GIL A;  2W4C A;  4ECU A;  4GKJ F;  4MKA A;  4ZP9 A;  5HQM A;  3RRH A;  3TJ9 A;  2QMU B;  2R7T A;  3LTO A;  2F65 A;  3C16 A;  3TRG A;  2FYX A;  5KFV A;  3O5T B;  4LUB A;  1WI6 A;  3OFG A;  2ZUG A;  4E0D A;  3D54 A;  5IXU A;  5THW A;  1S0N A;  1H7W A;  3UWT A;  2CZ9 A;  2QA2 A;  4IFY B;  4QU7 A;  2ZBP A;  3V5R A;  3H40 A;  2GAH C;  4JI7 J;  4Q43 A;  2HFS A;  1OS5 A;  3I0R A;  5GMK a;  5DLG A;  3CB4 A;  2VG5 B;  2ZH5 A;  1N36 F;  3VV2 B;  4DL5 A;  4DPW A;  1HQE A;  4WJB A;  4ZPA A;  3PX4 A;  1LW2 A;  1PYS B;  3SIP B;  1UA1 A;  1RAA B;  4DMZ A;  2YX4 A;  4P75 A;  4TNO A;  4CRJ A;  4J9V A;  3G6X A;  1HHT P;  4K4V A;  3WX8 A;  1WF0 A;  1UFW A;  4Z7C A;  3I96 A;  4F3O A;  4S0M A;  3EGN A;  1FRX A;  3J7Z 5;  4MK7 A;  1PKU A;  2DVI A;  1FE4 A;  2KG0 A;  3MD3 A;  2KO1 A;  4CTA B;  4FYD A;  1SJR A;  1SKU B;  1YG0 A;  5B0G A;  5F3Z A;  1JNZ B;  5KFC A;  3SCL E;  2HK3 A;  1XMQ J;  1SQE A;  1KLM A;  2B9W A;  1YKW A;  2VQE F;  1SXL A;  1MG7 A;  1Q8K A;  2RDI A;  1RU2 A;  2DO0 A;  2XWY A;  2BAN A;  1FTR A;  5B0A A;  3T1H F;  1DTT A;  2G9O A;  3CIM A;  2W01 A;  5IM0 A;  2VUG A;  2XYG B;  3CPW R;  5HMX A;  2DPI A;  1YRX A;  1U7L A;  2B6A B;  2L9D A;  2MLX A;  4Q8F A;  1PO6 A;  2HHX A;  3BM7 A;  2F4V J;  2HFO A;  2DNH A;  3OLA A;  4FN5 A;  5KFF A;  3KK3 B;  4DEZ A;  3UD4 P;  2UP1 A;  3KMQ A;  4G1Q B;  4JI6 F;  4F0H A;  1S6U A;  3BKT A;  3C6T A;  2LEC A;  3R1L A;  1NPR A;  2O3D A;  5KFY A;  2RQM A;  3M4X A;  1TL1 A;  4F4Y A;  7AT1 B;  3OVB A;  2DTJ A;  1PIE A;  2ZE2 A;  1H2T Z;  2OD4 A;  3CCM S;  1U1L A;  1NJW A;  1NSK L;  1S79 A;  1X8D A;  1VC6 A;  2MDA A;  4NLT A;  4KFB A;  1O6X A;  1FHT A;  1S1U B;  3JXO A;  4OZ2 A;  3GV8 B;  3MR5 A;  1UCN A;  2MLZ A;  3ENA A;  2YX7 A;  1F5C A;  5IC4 B;  4O3R A;  2DNY A;  4WTY A;  3DXB A;  4CLT A;  1LK7 A;  3IC1 A;  3WDO A;  4Y00 A;  2LKZ A;  4CT8 A;  3CUN A;  2JSX A;  4R0J A;  3V4M A;  1FDN A;  4CM2 A;  5HVH A;  3EYZ A;  4MKY A;  2J76 E;  3JAM Y;  2MY7 A;  3MEC B;  1ZZN A;  3G8Q A;  2WOM B;  1YQH A;  2XY7 A;  1FKO A;  3DOK B;  4PG6 A;  1X60 A;  2RS2 A;  4DV6 F;  1DTQ A;  4CNZ A;  3D4J A;  3MM5 B;  3TVY A;  2W2P P;  3G2X A;  1C1C B;  1FEH A;  2OI2 A;  3KJQ B;  1S0O A;  3KTQ A;  2R3V A;  4PWD A;  3AOB A;  3SCK E;  2UU9 J;  5IT9 U;  4WE1 A;  1UWB B;  3P45 B;  1QDU B;  2QMW A;  2R8G A;  1RHM B;  5GAH U;  5G4D A;  4A8F A;  2KZZ A;  1Y4Z B;  1FRJ A;  1FX2 A;  2BW2 A;  4RWW A;  1YBA A;  2KKH A;  3SFG A;  1FT8 A;  2WB1 D;  5K5M A;  5B0D A;  1N5V A;  3EVM A;  4CIO A;  3D6T B;  3OVA A;  4F4W A;  3UCU P;  3R1H A;  1HI8 A;  2DXD A;  1OPI A;  3LW5 C;  5D3G B;  1WG4 A;  3ONQ A;  2XTJ P;  2ZH6 A;  1JLE B;  4LFA F;  5AJ3 J;  4TU7 A;  4ID5 B;  3MMC B;  2UVU A;  5A6P A;  2IJF A;  5KT2 A;  1LFP A;  1FJC A;  1RT5 A;  1ICE B;  5K14 B;  5CCM A;  2J9D E;  3D0I E;  2J7U A;  3TQ1 A;  3FSI A;  2EW9 A;  4R8U B;  3KDO A;  2IDL A;  2BM1 A;  5F0W A;  3WHI A;  2KYZ A;  4RW8 B;  5ITH A;  4QW9 A;  2CXE A;  3J80 U;  1UFL A;  3BR9 A;  2CPH A;  3KLH A;  4DV7 J;  1RT4 B;  3THV A;  2DY1 A;  3T9Z A;  2EFQ A;  2YWE A;  3GMG A;  3UDL A;  3W2V A;  2V2V A;  2M70 A;  4CLU A;  2UV8 G;  1PSD A;  4C3K A;  2BE9 B;  2ZDO A;  1HBO B;  3GJQ B;  4CYU A;  1G6B A;  1Y5I B;  3CVK A;  3R8Y A;  5KFU A;  2MTL A;  4IYQ A;  4KT0 C;  4X65 F;  5D0E A;  4OZJ A;  2CQ1 A;  1HKA A;  1WD6 A;  3CCL S;  2MZT A;  2DNL A;  3GYG A;  4GMK A;  4DX7 A;  3RBX A;  2FC9 A;  1P1T A;  3G4S S;  2RS8 A;  2GMH A;  1S9F A;  3CC4 S;  2ZD1 B;  1S0M A;  2VA2 A;  1T0T V;  1U0H B;  1RTJ A;  4NA2 A;  4MK8 A;  4ZP6 A;  4UQG A;  2IA6 A;  3R5D A;  3HVA A;  5L46 A;  4USW A;  3GE9 A;  2KHC A;  5J2N A;  1RT4 A;  3H59 A;  3W63 A;  1RB0 A;  3P5B P;  4WK1 A;  2Y1I A;  1CS4 B;  1MWY A;  1EET B;  4R8U A;  7FDR A;  3CJ4 A;  1HNW F;  4IFV B;  4NLQ A;  4RX6 A;  4LF5 F;  3RRK A;  2GVZ A;  1D8Y A;  4ID5 A;  2Z0G A;  1OSC A;  4YHH F;  4U95 A;  5G0R B;  2N7Y A;  4HH0 A;  1KN6 A;  3D3C J;  3ZTS A;  4Y2A A;  4ZVU B;  1RIS A;  4WWS A;  3G6V A;  4PUO A;  1C4A A;  2ZHO A;  1QY7 A;  4F2R A;  3UNG C;  2J6U A;  4KO0 A;  3DGP A;  1KQF B;  3TR5 A;  2QGF B;  3QGP A;  1U8W A;  3W2W A;  4RUH A;  4IRK A;  4M5M A;  4W90 B;  4OYW A;  2ZBR A;  1B64 A;  5L1J A;  4DV4 J;  3RAX A;  3OJU A;  4I2P A;  1EX8 A;  4K4W A;  4ZDN A;  2HAI A;  1TMM A;  4OYB A;  2HBQ B;  4QOT A;  3I56 S;  1U1K A;  4LFC F;  1X4F A;  2G4B A;  5E0O A;  1DTQ B;  2B9Y A;  4O44 B;  2DNP A;  1BD6 A;  4FKY A;  2MZQ A;  2HW3 A;  2NUH A;  2VC0 A;  1KOH A;  2AF6 A;  4JI5 J;  3RAQ A;  4R5P B;  2FVR A;  3HK2 A;  3IWL A;  4KSE B;  4FS2 A;  2B9E A;  3CW2 C;  4LQ9 A;  4QWB A;  3RBZ A;  5KFH A;  3MXH P;  5KFW A;  4UF4 A;  2Q3P A;  1W2B R;  2Q66 A;  2HNY B;  2K06 A;  1UVI A;  3CDB A;  1N0V C;  2AJ0 A;  4NML A;  5CYJ A;  1S6P A;  4L72 B;  1LQ9 A;  1GK8 A;  2AMC B;  1VK3 A;  1LXN A;  2NXU A;  4HI1 A;  4KFB B;  4OZ5 A;  1S10 A;  4DSL A;  2A2C A;  4M5D B;  1IKX B;  1EKS A;  3MMJ A;  4WYL A;  5DQI A;  3A8K A;  5JJB A;  2IVF B;  3TOQ A;  4DG1 A;  4OYP A;  1BWE A;  3PEJ A;  1QJH A;  2RU9 A;  2KTQ A;  3D5M A;  4QWE A;  5IOL A;  3TVZ A;  4B3S F;  4E98 A;  1X4H A;  2XCP A;  1VIO A;  4USK A;  5L1L A;  1V3S A;  3OT9 A;  1Z2Z A;  3KK3 A;  1N36 J;  3BR8 A;  4UW2 A;  4G1I A;  1M5V C;  2X1G A;  3ETM A;  2XLK A;  1JLF A;  5HO4 A;  3MR2 A;  1U1R A;  2YNG A;  1CPZ A;  4OHY A;  1RAI B;  2I6W A;  5JXS A;  1O5J A;  1RWP B;  4DSK A;  1KC8 T;  1UMJ A;  4GO5 X;  2B4U A;  1DUR A;  1MRO B;  5AXL A;  5LOQ A;  4DS5 A;  1R8C A;  1ZA1 B;  4HT7 A;  3FMB A;  4NLX A;  5HMY A;  1NHV A;  1CUL A;  2CVE A;  3AQO A;  1FXD A;  2MZ1 A;  2RQ4 A;  3Q24 A;  1J5O A;  3R7N B;  3SMZ A;  3HPO A;  3QT7 A;  1GAO A;  3P8B B;  2H65 B;  5HQ8 A;  3TI0 A;  4NXN J;  4IFV A;  3U1M A;  2LA6 A;  3DDK A;  3W9I A;  1L3T A;  1JJ4 A;  2G1D A;  4F7V A;  3CF5 Q;  4B9U A;  3KWM A;  3X3U A;  2DR9 A;  2LMI A;  3MR6 A;  4ECT A;  1NRK A;  1ZET A;  3ILJ A;  2DJW A;  2OH2 A;  1BQX A;  1RTJ B;  1Y0H A;  1RLD A;  2QSW A;  5GME A;  3I0R B;  5J1N A;  4HHH A;  4A8M P;  2FVS A;  4B3R F;  1HPZ B;  2Z8Q A;  2HIY A;  3M2R B;  3B8H A;  3R6L B;  4N8N A;  4YUD A;  3OV7 A;  1RHU B;  5EWE A;  1D3W A;  3LPE A;  4JI2 F;  4A8K A;  3NLC A;  3QIP A;  2G1H A;  4ITS A;  2OPS B;  1CJT A;  4YDX A;  3HVT A;  1SB6 A;  4KV8 A;  5IT9 Y;  4NCG A;  2LA4 A;  1HBO A;  3CD6 S;  2X51 A;  1RK8 A;  6FDR A;  1E6Y B;  1G1X A;  2XC9 A;  2MQN A;  3M2U B;  1WDD A;  2DNG A;  4LF4 J;  1SI9 A;  2KDO A;  1U02 A;  2HGL A;  4JI4 F;  3AHP A;  5CQG A;  1NAQ A;  1S1W B;  2AX1 A;  4TYA A;  3ZZP A;  1JQG A;  2MYF A;  3RR7 A;  5F8G A;  2YX1 A;  1F9F A;  2R4F A;  2JVO A;  3DU6 A;  2X1B A;  3CD5 A;  4IKA A;  1YRU A;  4OJ1 A;  4ENO A;  3ENW A;  1N88 A;  4O3S A;  2B51 A;  4WCE Q;  5I3U A;  3CDU A;  4B3S J;  2DNN A;  1FFG B;  1R8P A;  1X0F A;  4MIA A;  1HL6 A;  2EPI A;  2KT2 A;  2FZG B;  1FDB A;  2J8A A;  5B08 A;  1RT1 A;  3UVJ B;  5EN1 A;  4HAC A;  1LWF A;  5AXN A;  3MM8 A;  4RUC A;  1SJ3 P;  3QRQ A;  2JZ5 A;  3AOA A;  2EC0 A;  1X5P A;  4CT9 A;  2VIC A;  4NXM F;  2FIU A;  1U2C A;  2F40 A;  2WVC A;  1WSR A;  1NK0 A;  3MI7 X;  2FZC B;  4C97 A;  5A8W A;  3CXC R;  1T05 B;  4CLW A;  3QLH B;  1SC6 A;  1WF2 A;  3L7P A;  4DF4 A;  4B9M A;  3N9U C;  3ILL A;  4RBU A;  3AH6 A;  4WII A;  1NHU A;  2RIJ A;  3PR4 A;  3LH2 S;  1S1T B;  3H7H B;  4USJ C;  1RHJ B;  2C2D A;  3C46 A;  4EUV A;  2Y0B B;  2AEJ A;  3TWZ A;  2ZC3 A;  3R5C A;  2HVZ A;  2QLW A;  4RNN A;  2CJY B;  1X7V A;  1HWU A;  1JJC B;  1Q7L B;  1U1N A;  5EWF A;  2V9W A;  2PFF B;  3JQJ A;  1F6T A;  2IYI A;  1NSA A;  3BH7 B;  3CE8 A;  3OSP A;  3DKD A;  2X3G A;  3ULH A;  4DJB A;  3R2D J;  4OHZ A;  1D9D A;  5J1E B;  2DGU A;  3M8P B;  4WP3 A;  2EXU A;  3ZFV A;  1FER A;  3LA0 A;  1S1U A;  1HQU B;  1RAJ A;  2F3J A;  5M2P A;  3GCX P;  5CD4 A;  3B54 A;  4ED3 A;  4P7T A;  3VAG A;  1N5Y A;  1R43 A;  1H6K X;  4LFC J;  3KNA A;  1KP6 A;  4Q45 A;  1TL1 B;  1RWV B;  5LMN F;  2ALY B;  4OI3 A;  2JL9 A;  3ITH B;  3HSZ A;  2HRY A;  2VG6 B;  2OPP B;  2VPZ B;  3DOM A;  4O4G B;  4DV3 J;  5HP1 A;  3IR5 B;  1VQ9 S;  3MM9 B;  2KRB A;  2YKA A;  3BSA A;  3MED A;  4UOG A;  1G7C B;  1X5O A;  3LP1 A;  1IKV B;  3VGT A;  4QJV A;  4BBY A;  3GIK A;  4DV1 J;  4G65 A;  4DV5 F;  1WF1 A;  1SL1 A;  4NA1 A;  4C2M A;  1XNQ J;  3W5Z A;  2XWX A;  4HLB A;  2J7W A;  2GVD B;  1M5S A;  3W5Y A;  1XN9 A;  3EXC X;  3R5G A;  5DGA A;  2E5H A;  2DRD A;  1HW9 A;  1RKI A;  2VDH A;  3H5S A;  1Q81 T;  2W9C B;  2DIU A;  4LF5 J;  3MZI A;  4ILM A;  2B5J A;  1WC5 A;  2PD1 A;  5E5N A;  1U45 A;  2ZWP A;  3NCR A;  3W9J A;  3QJP A;  2V9K A;  4KPY A;  4DX8 H;  3KOA A;  4PG4 A;  1OY8 A;  1F5A A;  1WOS A;  5HMZ A;  2JHE A;  3I5C A;  4YB6 A;  3KJV A;  4DQQ A;  4AL5 A;  3ADA C;  3EVW A;  4DL7 A;  4F50 A;  4FXV A;  2CPE A;  1JXL A;  5IQQ A;  3KK1 B;  2FB0 A;  5K8O A;  1X0P A;  5JVH Q;  1U1P A;  2VC1 A;  1U8S A;  2PC6 A;  2UUC J;  3F41 A;  1HQE B;  2CJA A;  5U47 A;  3CD0 A;  2BJE A;  4H54 A;  3DXS X;  4Q5V A;  2LXI A;  3VQT A;  3CTR A;  4C6A A;  1IBK F;  2VD3 A;  4IFY A;  3WX4 A;  1TKD A;  2XLJ A;  1S9G B;  2BKO A;  2WB4 A;  1J2V A;  1HBM B;  2YNH A;  3GU0 A;  3L7U A;  4UZC A;  2CRL A;  2CWX A;  3K5L A;  3FUY A;  1S72 S;  3M2V A;  2NR0 A;  2PEB A;  1RWN B;  5B0B A;  3BO2 A;  2GJI A;  3MAA B;  4GKK J;  1IR1 A;  3N4W A;  2MB0 B;  1XR7 A;  3K0J A;  5KFM A;  3HVW A;  1EQ0 A;  1GMU A;  5C2C A;  1NHK L;  2HZA A;  3CJ0 A;  4MYU A;  3A3P B;  3TP2 A;  4O3P A;  5A8R B;  1CG2 A;  1BHN A;  3A1Y G;  3MF5 A;  1YJT A;  1P6T A;  1Q5Y A;  2LDY A;  2ZBQ A;  1QLN A;  3I0S B;  1WC0 A;  1MW7 A;  5E3A A;  4DQI A;  5KFT A;  1VQ8 S;  3MM7 B;  3DI6 A;  5KFJ A;  2V6A A;  4DUZ J;  3OR2 B;  1KON A;  2C1E B;  2I0X A;  4BWJ A;  2B5J B;  2UXB F;  4EEY A;  4C8N A;  3HT0 A;  2ZZT A;  4LSL A;  2ABY A;  3GR0 A;  3GQC A;  2J7K A;  2L41 A;  2OSQ A;  2MPU A;  3J7Y I;  1YX2 A;  4BWM A;  2GVD A;  3KLE B;  3JSM A;  2C2Z B;  1R6V A;  1LWE B;  3OHB A;  1H2V Z;  3TAP A;  3E2E A;  4AUK A;  5BJR A;  3ILO A;  4C11 A;  2VFS A;  2BA9 A;  5D4O A;  1V6H A;  1Q4R A;  5CAA A;  3GYN A;  1ZBT A;  1F3F A;  2HWT A;  3CJK B;  2VBY A;  4F26 A;  8AT1 B;  4K4X A;  1RTH B;  1N5Q A;  4DUY J;  3R2C J;  3RUB L;  4OZL A;  3HFV A;  3CC7 S;  5GAG I;  2HPU A;  2PMZ D;  4ZN3 A;  3KG1 A;  2UU9 F;  3NGR A;  1FXL A;  3EUN A;  5FDL A;  4CLY A;  1FK9 B;  1V3Z A;  5HJX A;  4YB1 P;  3RBE A;  7FD1 A;  1VC0 A;  4WIQ A;  2XMW A;  2VDI A;  1IBK J;  2ZKT A;  1H73 A;  4K8R A;  1PGZ A;  2L3M A;  2WVB A;  3D6M B;  1Y5N B;  3D1H A;  2N3O A;  1X9S A;  1DAR A;  2CQH A;  4IO9 Q;  3R6G B;  2GZO A;  3LP0 B;  4HI2 A;  3SQG A;  4DL2 A;  1TU0 B;  3HDS A;  3D9B A;  1YJW S;  2QC3 A;  3KLI A;  2CJX B;  5KFS A;  4XDD A;  2LEB A;  3GFY A;  4C0B A;  1RTH A;  4ZVF A;  2V8V A;  2YWK A;  2XGQ A;  3SCI E;  1IM4 A;  2A10 A;  4J9R A;  2QLX A;  2IFX A;  4I6A A;  3I5A A;  4K5S A;  4OYA A;  1N4L A;  1S1V A;  2Z57 B;  3CT9 A;  3HD1 A;  1KHV A;  2R42 A;  3N01 A;  5H9F J;  5F8M A;  1HNI A;  4DR1 J;  1SKW A;  4F2S A;  1HMV B;  1WOO A;  3JSR A;  2R2T A;  1IBM F;  1OO0 B;  3I6P A;  4O0I A;  4HAC B;  4B3O A;  4K5R A;  2KXH A;  3AQP A;  5ETP A;  1PJ7 A;  1QTM A;  2Z4P A;  3CO9 A;  3MCM A;  4HL9 A;  4I6W A;  4OYX A;  2BOP A;  3TAR A;  2R8K A;  4ED1 A;  3MPU B;  1WC1 A;  4ICL A;  3NEK A;  4LSL B;  3A8I A;  3UI3 A;  4QYZ J;  2LXU A;  3GSI A;  3PHT A;  4F04 B;  2XMV A;  2VG7 A;  5F41 A;  3GFH A;  5KFZ A;  1KTQ A;  3D6H B;  2YNF B;  3ET6 B;  3MR3 A;  4RW4 A;  2MZS A;  2AP6 A;  3MM6 A;  1S1W A;  3LAM A;  3W64 A;  1YJ9 S;  5I4M A;  3FCV A;  3OR1 B;  4ZVT B;  5E3C A;  1SC4 B;  4NL5 A;  3RJM B;  2CG4 A;  1J5E F;  3AXK A;  1IBC B;  5F8I A;  1S9E A;  3RB4 A;  1Q0N A;  1X4C A;  3EZ5 A;  2PI5 A;  3QFW A;  2VHG A;  1TK5 A;  1Q8B A;  2GJ2 A;  2HUR A;  3FEZ A;  5KFQ A;  3BZQ A;  3IR6 B;  5L9N A;  2GML A;  3MAA A;  5AXM A;  2XMJ A;  2OPQ A;  2EBE A;  1S1X A;  5LM7 E;  2HQD A;  2VFT A;  4AYB D;  2VZ9 A;  2KI2 A;  4WBF A;  4Z37 A;  1GMW A;  4PXE A;  2YNH B;  3BDE A;  4H4K A;  3T1Y F;  4KQZ A;  3M1V A;  4UOC A;  1B3T A;  1CQN A;  3BDP A;  5LXY A;  4DQP A;  2OML A;  4NOH A;  4ZCI A;  2W9A A;  1UET A;  1U4B A;  1N6Q A;  3W62 A;  4FBT A;  3HKW A;  2A6M A;  5J2Q A;  1FA0 A;  1X9W A;  2HZC A;  3JQK A;  4J91 A;  1NDC A;  2KJV A;  3TAM B;  4CLF A;  1FCA A;  2J6S A;  1HBN A;  4A8X A;  4TU9 A;  2CNO B;  4LFB F;  2B7C B;  4E2F B;  3HSJ A;  3H4D A;  3RU0 A;  2ZHB A;  3FQL A;  3TO8 A;  5KG1 A;  2ASJ A;  2E7V A;  1DBD A;  1KFD A;  1Y3J A;  1YJ7 A;  2AEM A;  2V4J B;  1SUQ A;  3OTC A;  3R3T A;  4LFA J;  4ES1 A;  1TK0 A;  1RHQ B;  4MJK A;  2JH3 A;  5A8K A;  5DDR C;  2E9T A;  4DR2 F;  5H9E K;  3QNW B;  4KGZ B;  2HS0 A;  1NDL A;  1HBU B;  5D0G A;  1IBL F;  2DNZ A;  2ROG A;  1CSJ A;  1AA1 B;  4PG7 A;  4ZJL A;  5KOW A;  1UEV A;  1ZTT A;  2YNG B;  1DY3 A;  3MHY A;  3DU5 A;  2M2B A;  1VJQ A;  2HQG A;  2YKQ A;  1N48 A;  2R8J A;  4RO0 A;  4LRD A;  2HND A;  2HGN A;  2JFK A;  3K58 A;  1OIA A;  4M95 A;  3BYR A;  1RT3 A;  1S4E A;  3CCE S;  1FJG J;  1N32 J;  4DG1 B;  2DR7 A;  2YQ3 A;  1B0V A;  3H20 A;  5LJ5 Y;  1NB7 A;  1UL3 A;  3GFZ A;  1QVG R;  4N47 A;  4DOZ A;  3EPG A;  2M7S A;  1NH7 A;  4Y2C A;  2O66 A;  1F2H A;  2XSJ B;  1IR2 A;  4P7V A;  2MQP A;  3M8P A;  4ZLP A;  1RA6 A;  2GQC A;  2V34 A;  3QO9 B;  3IRX A;  1X9M A;  1FRI A;  1HWJ A;  5I42 B;  4UT4 A;  3NGU A;  3HVR A;  3T41 A;  2KM8 C;  2QFI A;  4DQR A;  4KHM A;  2V8P A;  4HVZ A;  1SV5 A;  1T3O A;  2QEX S;  4TKT A;  2RHS B;  3H2U B;  4NYO A;  1CC7 A;  1JLQ B;  4L76 A;  3FCH A;  4O44 A;  1TKT A;  2NSB A;  5KFD A;  3OLB A;  3GIM A;  1XMO J;  2XM3 A;  1S1T A;  2D9P A;  1NK8 A;  3UW1 A;  4OX9 J;  4C9D A;  2AZ1 A;  4WXO A;  4DXL A;  4ZP8 A;  3MD1 A;  4K4T A;  1FD2 A;  1NJX A;  1TKX A;  1SJQ A;  4YS2 A;  3NAI A;  1JX4 A;  2JEG A;  1LW0 B;  1T9Y A;  3SDE B;  2Q43 A;  2MQL A;  3LP2 B;  3W2W B;  4PRF A;  4WZM A;  4CLK A;  1ZAV A;  2IHR 1;  2R7S A;  3MM8 B;  3KJF B;  2CQ2 A;  1APS A;  5I3Q A;  1FO1 A;  1KOO A;  2B4O A;  2GIF A;  3OFE A;  1Q1K A;  1JLA A;  2QLF B;  2KHD A;  3TZZ A;  2R7W A;  3V4I A;  2AYE A;  1VC5 A;  1RZM A;  2P9E A;  2R2R A;  5LMN J;  2CAD A;  4OYM A;  4NCB A;  4U7U D;  1TKZ A;  2OEJ A;  1I51 B;  1V9O A;  2N82 B;  3PY8 A;  3O6Q A;  2ADC A;  4Q7A A;  2M8D B;  4KHP F;  2KFZ A;  4JI5 F;  1Y00 A;  3T5J A;  3IBF B;  4N8O A;  5J2N B;  4ES3 A;  1KQS R;  4C48 A;  3FJ2 A;  4YR0 A;  4RBT A;  4YR2 A;  1UEK A;  5HBM B;  2I38 A;  5BYS A;  3A3O B;  3GG1 A;  5ETK A;  2H9Z A;  1ELO A;  2IJR A;  3GYX B;  3WIV A;  3PTW A;  3ZTP A;  4ZMM A;  3DDI A;  3DHW C;  1NK7 A;  1ACM B;  3IN5 A;  2CQD A;  1FNO A;  2AZ3 A;  3FBE A;  1WEY A;  3BN4 A;  3PAC A;  4ZCL A;  4V19 X;  2VON A;  3I4H X;  2AW0 A;  1F3V A;  2C2K B;  4NI2 A;  4ES2 A;  1HI1 A;  3EZO A;  4WFA Q;  5A2Q U;  1AYE A;  3QFH A;  3BJY A;  1KLN A;  4LF7 F;  1YBU A;  4DV3 F;  3GIJ A;  4Q0B B;  4AFF A;  4TU8 A;  1JLC B;  5C42 B;  4ECY A;  1IWA A;  4DPO A;  3GLJ A;  1FNX H;  1HFE L;  3VVT A;  2HQI A;  5CCL A;  1XNQ F;  3CCT A;  3MEK A;  1TUW A;  2B43 A;  5M2U A;  5J2M B;  3NG8 A;  3K7R A;  5FD1 A;  2PMH A;  4KAI A;  2ZWO A;  1BXN A;  2Z2L A;  3RRG A;  2JLE A;  3X1L B;  5T7L A;  1IUJ A;  3CJ2 A;  4PKD B;  4I56 A;  2AWZ A;  3ICL A;  4XK8 C;  3UR0 A;  4C98 A;  1JLE A;  4ER8 A;  3EX7 B;  2YPZ A;  4A46 A;  4ZVE A;  2ZM6 J;  4HT5 A;  1TV6 A;  2BUN A;  1WEX A;  3ZTQ A;  1NM2 A;  2VPX B;  4ZKA A;  3C3L A;  1SJ1 A;  4ATN A;  4HYK A;  1MML A;  1O51 A;  2DT9 A;  3I87 A;  4QIW D;  4USV A;  3PIO Q;  3I9V 9;  3BRE A;  1JMT A;  4JI3 F;  4NAS A;  3K8V A;  2V5H G;  3BO3 A;  2CJK A;  4DFP A;  1C1C A;  2DR6 A;  5CHC B;  1K1Q A;  2JNJ A;  5E3R A;  1TKT B;  2RAQ A;  2R2S A;  1C2P A;  1X5S A;  1GTE A;  3R9L A;  2M88 A;  4KGV B;  1JXV A;  4FXW A;  3R7S B;  1SV5 B;  5BXI A;  4C3L A;  3IR7 B;  1D8Z A;  2HNY A;  2LXF A;  4EMD A;  4N5S A;  2W8L A;  3P96 A;  2A1B A;  3Q8U A;  4ED0 A;  1Z4U A;  1IWG A;  1V5I B;  1U6F A;  3ELH A;  4IH6 A;  4LSN B;  3U1N A;  4ANC A;  1F9H A;  4XPC A;  3CCU S;  1K73 T;  2XS5 A;  5C24 A;  2FHK A;  1JWW A;  1RKJ A;  1KWM A;  4X4V A;  1HD0 A;  1XK8 A;  2ZH7 A;  4B9L A;  4ECX A;  4LF9 J;  1BLU A;  2CJ9 A;  1SL0 A;  3PCO B;  4FP9 A;  2BKP A;  3G6Y A;  1JJ2 R;  1RBA A;  1YZ7 A;  5KFR A;  3U7J A;  3C6T B;  5CA5 A;  1CEZ A;  4DL6 A;  1OSD A;  3POT B;  3SSR A;  4ZIV A;  3KHG A;  2KL8 A;  3HHD A;  2HND B;  2WBM A;  3LF0 A;  4R0E A;  5MLC V;  4ED5 A;  2IMO A;  2QO3 A;  3DGP B;  2OEL A;  3E01 A;  4DV2 J;  3IFE A;  1XTZ A;  2K8G A;  5E33 A;  3KK2 A;  4Q0B A;  4DR7 F;  4NXM J;  1K47 A;  1DTT B;  3K5P A;  4KRW A;  4ZN1 A;  1KLM B;  1IVZ A;  2WON A;  1SUQ B;  2ZJR Q;  1KTV A;  3GP9 A;  3FVY A;  4J90 A;  4WFZ A;  4W4M A;  5ETT A;  3SZ2 A;  4K50 A;  1IQT A;  1RXO B;  2C3Y A;  3KUG A;  3PKY A;  3CCZ A;  1EAY C;  1F60 B;  1PG5 B;  1VMB A;  4NE9 C;  1OYD A;  1HNZ F;  1WDT A;  1WI8 A;  4KY3 A;  2I5J A;  4NCA A;  5CZX A;  2CDR B;  4WFB Q;  3HFZ B;  2B4V A;  4EYH B;  2APO A; 
#chains in the Genus database with same CATH homology
 2XM3 A;  2EC2 A;  2FYX A;  2F4F A;  2VHG A;  2VIC A;  2F5G A;  2VIH A;  2VJU A;  2XO6 A;  4ER8 A;  2XMA A;  2A6M A;  2XQC A;  2A6O A;  2VJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...