2VHGA

Crystal structure of the ishp608 transposase in complex with right end 31-mer dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
b'LYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVEIIEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKLPTLWTNSCFISTVGGAPLNVVKQYIENQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSASE ORFA
publication title Mechanism of is200/is605 Family DNA Transposases: Activation and Transposon-Directed Target Site Selection.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Dna binding protein
total genus 33
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2vhgA00
2VICA 2VJUA 2XMAA 4ER8A 2A6MA 2F5GA 2XM3A 2VHGA 2VJVA 2A6OA 2FYXA 2F4FA 2VIHA 2XQCA 2EC2A 2XO6A
chains in the Genus database with same CATH superfamily
2VKRA 4LFCJ 3I56S 3HVTB 3Q8PB 1MNEA 1H7XA 2W2PP 4B3RJ 5A8KA 4YB1P 2XSFA 3RZAA 1WTFA 4YDXA 2F65A 3R5GA 5L9NA 1U09A 4LIWA 1MN9A 2YKOA 2MY7A 8AT1B 2CNKB 1C1CB 3LPYA 2MQPA 5AE3A 2V67A 3QIPB 2DR7A 4PUOB 4CLWA 2C2NA 3QBCA 5JMNA 1HBNA 3CW2C 2E29A 3VAFA 4L72B 4DZDA 3OL6A 4F02A 2M9KA 3Q8VA 4YR0A 4DDFA 4I6YA 2W8KA 5J2QB 3CXCR 3FSIA 2LVWA 5E33A 4CT9A 2QC3A 3SQGA 4E2FB 2CPXA 2KU7A 3ZNJ1 4JI1J 1HW9A 4OZ1A 2PC6A 3BO3A 2R7QA 1S6UA 4NCGB 2YTCA 5ETMA 3GR0A 3BDEA 1FD2A 3H0PA 2H65B 2ZH5A 4TU8A 5K8OA 4CZCA 5LMNF 4USKA 4U96A 1WC4A 4OYOA 3EDRB 3PZPA 2K06A 3E01A 3C16A 3CJ2A 5KFBA 4WFBQ 3C46A 2BM1A 3T5LA 5KT7A 2B9EA 2CQGA 2GVDB 3ZO7A 1WG4A 3WZ0A 1YRTA 4CLFA 5E41A 2DNRA 1MWZA 4Y65A 4IOCQ 2R2TA 4C48A 2JFKA 4X65J 4ECYA 3PJ9A 3GJSB 1GTEA 1U26A 1WC1A 1IM4A 3FBBA 3V4IB 2LQJA 2JZ5A 1DY3A 1B3TA 4RO0A 1BWEA 1FA0A 2DYAA 2ZH1A 2DR8A 4A46A 1PAUB 4ID8A 4FPIA 3BSOA 4A8MP 1FE4A 3W2VA 3V6JA 1BWVA 1RA7A 4OMFG 1SKWA 2AGOA 1RHJB 5JXSA 1T9VA 2GZOA 1RHKB 1U49A 2V8DA 2RU3A 3UR3C 2XNQA 2LECA 1S7HA 1RSCA 1LW2A 4C3KA 3ZXWA 3TVYA 4MTPA 2OPRA 4P2XA 3G9CA 4WZMA 1OMSA 5CYMA 4XPEA 1VRTB 1JLCA 2HNZA 2MSSA 2H4WB 2ZDOA 2NUHA 2HQCA 1SV5A 1IXKA 4USMA 1S97A 2A18A 4M5NA 3CD0A 1XK8A 1H98A 2WVEA 3IBFB 4ZVQB 2YNHA 2HFUA 4IG3A 1RZMA 1VISA 1WC5A 1AA1B 1RAAB 1XNQF 1HYSB 3FBFA 2AF6A 1IBKJ 1W25A 1RHUB 2ZBRA 4QQBA 3R5JB 4X4OA 3UCUP 3G6ES 5IXUA 5KFFA 2XMJA 1S4FA 3BR8A 3IBCB 3AOCA 1IWAA 4IH7A 2ZOFA 1K1SA 3QWPA 5BR8F 4HKQA 5B0CA 1GMVA 1JJCB 3JYTB 2ZJPQ 5J1EA 3CCJS 1FI4A 3Q89A 5L1KA 2OEJA 3QPIA 4QU7A 2RS8A 4RW9A 5JUMA 4K7QA 4KKOB 2FZKB 3QSYB 2WVCA 3DI6B 4Q8EA 4USUA 3A8KA 2MKKA 2VB6A 2VQFJ 4LRCA 3ZNUA 4H4KC 4PG7A 3T41A 2OMOA 1FEEA 4PEOA 1G2EA 3I0SB 2MHEA 2RSQA 3FSYA 3MM6B 2HW3A 4WWSA 4URGA 2HHXA 3R2DJ 2HGLA 2VFTA 1TKZB 2GMJA 2I38A 3K89A 1HMVA 1H6KX 3BREA 1N4LA 4OI2A 3QT7A 4RW4B 4JB8B 2VV5A 3LANA 1VQOS 3BGFA 2P6TA 2IM0A 4CLZA 2LCWA 3AOAA 3ZZZA 4HDGA 4KGMA 5DDOC 2CZ4A 2B4UA 2X3GA 1U1KA 4I1TA 3KNAA 4CI0B 1SH3A 4DV0J 3FFIA 2OPQA 1X8DA 3HP6A 3ADAC 3TOQA 4XK8C 1ELOA 3DXBA 2KL8A 4RUCA 4CO5A 2W7PA 2EC2A 1RHMB 2W4CA 4ZP6A 3OT9A 4GVLA 2AW0A 2ROEA 3TARA 2ZHOA 2NUUG 4O3RA 4AD6A 1FWPA 3QT8A 5FDLB 3LW5C 2F8MA 3FVYA 1J5EF 5F8GA 1Y0HA 2DIVA 2H3EB 2DNHA 3A8JA 2VH7A 1RTIA 2VBWA 5CD4H 4UZBA 5B7WA 4DV3J 4EO8A 3MMCA 1NJXA 4LRBA 1KTQA 5DGAA 3QATA 3M9OB 1C1BB 1JLQA 4JV5J 2YKNA 1N6QA 1O51A 5EGYA 3AB4B 2KO1A 4TKTA 2E5LJ 2MPUA 4OX7A 3NAIA 3HPOA 4OYBA 1N32J 3DKDA 3MM9A 4LF6F 3MMJA 4DN0A 2YKPA 1UAWA 2CJQA 3BSAA 2F5GA 2X3DA 5I3UA 4NLUA 2LMIA 1NK4A 3B54A 2HLUA 3BKFA 3O8WA 5E2QA 5A8WB 2W01A 1WF2A 2J9DE 1SJ3P 3WX4A 3M6VA 2FGCA 1LWFB 4ECQA 4B9MA 2A0FB 4ZPTR 2UUWA 4LRFA 3GIRA 1F5BA 1EJ7L 2OD6A 1A0OB 3K5MA 4FF2A 3IBWA 5H1SV 1K1QA 3R27A 3UPFA 2BA9A 4KV8B 3LGHA 3F56A 4N47A 4LF9J 2UXCJ 4ZPCA 5CCMA 4QR2A 3OL9A 3ITHB 4RWWA 2DHXA 3D1OA 3QFHA 4P10A 1Q5VA 3BYPA 4OL8A 2CG8A 1Q8LA 3GJRB 4C11A 2C3UA 5DZ6A 2ZH7A 4LBIA 1K9MT 2NS1B 1RTDB 1MWYA 4ZP8A 4M5JA 1LK5A 2F3JA 2FDNA 3H4BA 1PCAA 2CPJA 3HKWA 4DMZA 3W65A 2VUGA 3VV2B 4KB7A 2YX4A 5A0YA 1FX4A 4RU2A 1UETA 3G8QA 1F60B 3FQLA 4UOHA 5F8JA 1FCAA 3JXOA 3MECB 1HD1A 2KYXA 2LEAA 2AEFA 3PX0A 3OLBA 1NK8A 5IS2A 4J5OA 4DV5J 3CCRS 5HN0A 1RWWB 3KJQB 2VPWB 1AROP 1JX4A 4OI1A 3AH6A 5D77A 2IAJA 1RT5A 3KYLA 1HBUB 2VQEF 2BE7D 1DTQA 3LALA 3KTQA 5KFPA 3VGSA 2MZ1A 3FBEA 1X9MA 5FIIA 1MU2B 5L9XA 3KDOA 5LMNJ 5H9FJ 2K1RA 1JJHA 1R6YA 2BKOA 4G1IA 4OX8A 4NYZA 3GTYX 2W2QP 4MK8A 1GQEA 4PZVA 3NCRA 4BWMA 4A8WA 4YN3B 4URQU 3DLKB 1XR5A 3G82A 3TQEA 1K73T 3O44A 5J1PA 5KAKA 4F8RA 4ILLA 3OTCA 2R8HA 1C0UB 5KG6A 1N8RT 1U6BA 2GS8A 2EI5A 1N5SA 1YK9A 3DOKA 2HHWA 5AE2A 2BQRA 4P2MA 4NZ0A 1N5TA 3TAQA 5T7LB 1FTRA 4DR1F 4QWAA 2F8HA 3KFWX 2DGTA 4HVZA 4K50A 4ZVEA 2GIQA 3OTBA 3KNGA 1F2HA 1YJTA 1LEOA 2YNGB 1RBAA 1ZM3A 2JRSA 1UJ6A 2N3OA 1TZ0A 5GMDA 1K47A 2BOPA 5ETTA 5BYRA 4A8FA 2KXHA 1IBLF 3MR5A 2B56A 3T6JA 1TL1B 4BWJA 2YXLA 4LR8A 4R5PB 1OY9A 1VIXA 4U95A 2AZ3A 4OHVA 4B9NA 1FTCA 2C3PA 2DB1A 1UW9A 1D8ZA 3C6TB 4PABA 2HWIA 3MPDA 1VC0A 2CPFA 1JLGA 2VONA 2GJIA 1T0TV 3R6GB 1Q8BA 2GHWA 1ZM9A 4USHA 2EBGA 2G0IA 1KOOA 5CYQB 4IRDA 5BXIA 2RRBA 3HT0A 4IG0A 1XNQJ 1R8CA 1B0VA 4OYXA 3R1HA 2FZCB 4Q7AA 2HBRB 3EE3A 5IQQA 4WP9A 4OYAA 3M8SA 4EYHB 2LXIA 2PMHA 3O1LA 2Z2YB 1UWBA 3D0GE 5A8KB 1UL3A 1BQXA 3L7OA 3BGLA 4Z37A 5JJBA 5I42B 2AHOB 2V6AA 5BR8J 1X4DA 3T5JA 5F8HA 3GV7B 2V2VA 3A8EA 2HBZB 2IVMA 1PBAA 3NS5A 1FKPA 3HSZA 4ES2A 4QPXA 3BYRA 3IR5B 3HT3A 1B99A 3GV5B 2CDQA 3QLHA 2D9PA 1LFPA 4K4YA 3GV8B 4EK2A 2V5HG 3HFZB 4HEA9 1U8WA 2C2ZB 3SQGB 4TYAA 3V6DB 2LEBA 3FUYA 3PX4A 1HNXF 3VGVA 3P3DA 3VALA 3GIKA 4Q43A 4GVBA 3TJ8A 4M63A 5LSOA 3BGRA 3KLEA 1RI7A 2R7VA 5ETVA 2AV5A 4A8SA 2FGOA 2RB7A 1T9TA 2XG8A 3TAMA 3E01B 3UR0A 3C16B 4DI6A 3QQCD 2R8IA 4P9SA 4LFAF 4ETZA 4O3SA 4FF1A 4WP8A 2AYMA 5KFEA 1IR1A 4PR6A 4CNZA 3V81A 2DT9A 2FIUA 4NZ6A 3DLHA 3DRPA 3ISNC 4FS1A 4CRJA 2H1YA 1UFKA 2HNDB 4ZVFA 3DU5A 2K8GA 5ETPA 3QJPA 4Y34A 4NEZA 2OMLA 2AYGA 4JI6F 5EDWA 1HQUA 4X4SA 3KUHA 2HKEA 1VJWA 3EJMA 2DITA 1M5HA 3U27A 3RBZA 4YY3F 1WF1A 3RUBL 4E98A 2ZH4A 3BO2A 2QA1A 3MEDB 3VVUA 3B6BA 1RHRB 1N34F 3PY8A 1J5EJ 1EHWA 1CC7A 1SI9A 1U0SA 2CPEA 3AT1B 3PYFA 1TV6A 2VG7B 3W63A 1QJHA 4PG5A 4KQZA 3RG6A 5DG7A 1LW2B 5IM0A 5EWFA 1FNMA 5A2QY 2IY5B 1X4BA 1HWUA 3D3BJ 1UEVA 3G71S 5CZXA 4MH8A 4F36A 3RR8A 5CYMB 4NXNJ 1JLCB 2HNZB 3CJ3A 3G8SA 4F0MA 4A8XA 1HHQA 4H54A 3ET6A 3D0IE 3CJRA 3QGIA 2G1HA 1S76D 3UWTA 5T41A 3X3UA 1VQLS 1LK7A 2UP1A 2YNHB 1GXLA 4M5GA 2DIUA 3OR2A 1JLFA 2B5JA 4IG3B 3VZIA 4G3IA 3RAMA 1KFDA 3UDCA 3DDIA 2RQMA 3OTOF 3PFEA 2JEIA 2J9DA 3FEZA 2QGFB 4TU7A 3OL7A 4LF6J 2R2RA 1VCTA 4P74A 2OH2A 2QE5A 2MGZA 4WIIA 3CVKA 1S12A 1PYOB 4DPUA 3PEJA 4LSZB 2RKIB 4MAKA 2BZ2A 2QLWA 3N4WA 3I96A 2UV8G 3DOLA 4X62J 5A8RA 2UUCF 1Q7LB 1FXDA 2RQCA 3RB0A 4OHYA 1R8PA 4TQSA 1SQEA 2BV3A 4KR0B 2G13A 2E5JA 2EKNA 4NMXA 4F25A 4KAIA 4HHHA 1ZZFA 4OV6A 1WEXA 5B08A 3OSNA 4NLRA 1U4BA 1WKLA 2F4VF 4WP3A 4RW9B 2FPHX 2WBMA 3DDNA 2ZBQA 3H98A 3ELHA 4Q45A 3QMQA 1H2TZ 4RBTA 2B3TB 3Q0AA 5GMKa 3QGPA 2HIYA 5F8IA 3D68A 2ZJRQ 4DL7A 3OPKA 3U1LA 2IBKA 2BW2A 1SVDA 2HFNA 3GIIA 3EXYA 1DAXA 3W60A 2DNOA 2DH7A 3ZZOA 5HQ8A 3EYZA 4GO5X 1FVQA 4YUDA 1FDNA 1IQZA 4J9QA 4B9TA 2HZCA 3S7RA 2EFGA 1NB7A 1VS3A 4F4WA 5HO4A 4C8NA 3BPDA 1BD6A 3D0HE 3ILJA 2HLTA 2YNIB 4QYRA 3TA0A 3SEOA 2VG5A 2XEXA 5KOWA 2EXUA 2EBEA 3KMQA 2GQ2A 7FD1A 2F9DA 2WZ1A 3DHWC 4DOZA 3FFIB 4TLRA 2OPQB 4J9LA 2Z0GA 2E1AA 2I1RA 3ENQA 1P6TA 2AMCB 4YQWA 1VGYA 3H2UB 3H8YA 3I9ZA 4KBIA 3T1AA 1YJRA 3G87A 3HX9A 3K17A 2HK3A 2FVCA 4K59A 3H7HB 1UFWA 3LWLA 1RJJA 1RU1A 2CWKA 1X4CA 1RGVA 2QFIA 2LYVA 4F3QA 1JIHA 1HI8A 2Q66A 3L7UA 5ETNA 4QIEA 2H9ZA 1RXOB 3VVTA 3H5SA 3I0RB 1FVSA 3MUMP 1N88A 1IKXA 1GTHA 3KJFB 2KT3A 1U24A 3IM8A 3J7YU 3E51A 3GU0A 1WOSA 1JLQB 4X4PA 2CAJA 3TUIC 5J2MA 2YKNB 1N6QB 2QSWA 1N0UA 4X4QA 4I6AA 1HI1A 2ZVSA 2X1GA 2QL7B 1TUGB 2AT1B 2LDIA 1WWHA 3NG8A 2AKWB 4W92B 4RJVA 1VBXA 2E1MC 4DR1J 2DBBA 1REVA 2EFVA 5I3UB 4QPTA 2GIRA 1I6JA 4Q8FA 1IBMJ 1RB0A 4A8YA 2O01C 9ATCB 1BC6A 4NRUA 4LF7F 4PYAA 2PFFB 4ETXA 4OZNA 4NLYA 1R0BG 4ZVTB 2FJVA 3PIOQ 1IBLJ 1P1TA 2YVSA 3MDFA 1ZM4A 1VK3A 4CCHA 3H4DA 1WC3A 4HT7A 2J6UA 2KVQE 1N5QA 4OI0A 2FYXA 5DLFA 3VGTA 1S1TA 2O66A 3DLEB 4M94A 1UEKA 3NGDA 4HI2A 4LMZA 2ZC3A 4AXIA 4LQ3A 2W7OA 3HCXA 4C11B 4ZCIA 2GJ2A 1QAYA 1WOPA 1U7LA 1G1XA 3DNCA 2D3O1 4WTYA 2QYGA 3W9JA 3CC4S 2HHHF 2QJ3A 4DR2F 1HNZF 4X4NA 2M52A 5E3CA 2OI2A 5A0YB 2AZ1A 3POTB 2J0XA 4DS5A 2MKSA 3EDQB 1HHSA 2DTJA 1KLNA 3IAS9 4DL2A 3MAQA 3FCWA 3JSRA 5IC4B 3DCAA 4NLPA 4B9VA 4KHPF 4RL1A 3MEEB 3AB2B 4WCEQ 1YTYA 3W66A 2HS3A 1ICEB 1GAOA 5KFRA 4C8MA 4Q5VA 3GFZA 3VR1A 2W4DA 4OZ2A 3K0JA 1NZAA 2DPIA 3AA9A 1U6ZA 3GZ7A 4ED1A 1X5OA 1KQGB 3KJNB 2K3KA 3KJVA 2IAJB 3CJ8A 1HNXJ 4FXDA 3OD2A 1RT5B 2FHJD 3MUTP 1B64A 1DTQB 4EWTA 4ITSA 3KK2A 2D9OA 4ZP7A 1NKBA 3J80U 3PJWA 2VPYB 2DJWA 2K1RB 3AD9C 2HS4A 5DDRC 1FRIA 4EFAC 4LFAJ 4JI0F 1KQKA 3CULA 4IQMA 4HH1A 3DC2A 2KRRA 2V9KA 4K4TA 2A3JA 2ASYA 2ZUGA 2EW9A 1N5VA 2QA4S 2Q1LA 2WSCC 2LU2A 3AD8C 4V19X 1YSJA 3DOKB 4XTTA 2A6MA 4RPFA 1Z2LA 5KTQA 2J7KA 2DEJA 2R7RA 2R4FA 5J1NA 1SC4B 2QMUB 3EXCX 2ADBA 1ZZNA 5KG7A 1EQ0A 2MQ8A 3OR1A 2E7WA 5F3ZA 2O3DA 5LOQA 2W9BA 2UV8A 2MJNA 4DF4A 1WNEA 1M5KC 4PRFA 1N34J 2DXFA 4O4GA 4M8LA 4I56A 4JI4F 2JX2A 3IWLA 1NH8A 2DEIA 2XLIA 2ASJA 3ZZRA 2GO9A 2QYCA 3R5DA 3LP0A 3LGNA 2BOAA 2FLLA 2UUAJ 2AJQA 4JI2J 4EMDA 2RDIA 1UA1A 1P8GA 2K2PA 3RAQA 4DV4F 1XMOF 2DNMA 3QO9A 4OI6A 4ZPVR 2FZGB 1MN7A 1KOHA 3FSXA 3HZGA 3EZUA 8ATCB 3ZTOA 3HSJA 2UVUA 3RGIA 1YJ7A 2W2NP 4IG0B 2AEMA 5KFCA 4P2FA 4IRKA 2RF2A 1FERA 1PJ6A 1KN6A 3OTOJ 1NJIT 4J9VA 4QWCA 3H5UA 4IRCA 1L3UA 1VRQC 4C9DA 4LVNP 4DV7F 2J9CA 3PW2A 2DRDA 2HHSA 3W3SA 3NS6A 2EG2A 4DZ6A 5I3PA 5E3RA 3P4UB 3R7BB 3RAXA 2UUCJ 3C8YA 2CQBA 2HK2A 4L73A 4Y3CA 4A4JA 4TY8B 1TAUA 1K0TA 5G4DA 2E9TA 2OJ3A 4FNHA 5H9EJ 2L3MA 1FKPB 2LA4A 4N5SA 1U1PA 1RU2A 2KDOA 2UVWA 2CJ9A 2F4VJ 5DG8A 2Y8WA 3CJ4A 3QLHB 2BQ3A 3RU0A 3IWXA 4WKYA 2J6TA 1N56A 1Q16B 3KLVA 3EVMA 4CH7A 1U2CA 3LPEA 3I5CA 2OTJS 3CCZA 5HBMA 3WQPA 2HZVA 3JQJA 2D7SA 4B17A 4GVBB 2XWXA 4ECTA 2Z58B 2JJ4D 1Q53A 1SH0A 3BGRB 3KLEB 3PX6A 3HHNB 5D4PA 1UPMB 5D0GA 4DFJA 3TAMB 3IXQA 4C4WA 3K57A 2J6SA 3K2YA 1IR0A 4B3TF 2MZTA 3MURP 2FUG9 2BKNA 5EX3A 1JK9B 1S0VA 1XQIA 2ZFHA 3EGZA 1LOUA 1GMUA 3V81B 1WHVA 1T8EA 2WSFC 4ENOA 1SC1B 1LWCA 4QW8A 2HQFA 2KKHA 2JVOA 5EUHA 2KXFA 3NOCA 3RRHA 1KWMA 4YB7A 2MLXA 5CQGA 2ZM6J 1ZETA 1F9HA 3PYEA 4RR5A 1QLNA 2X1BA 3TVZA 3C3LA 4A8QA 2MMYA 4QBUA 1TUVA 3KLGB 2Y1JA 2HWTA 2DHAA 2BJEA 2IIHA 2Y3YA 2IMWP 3JSMA 3JAMY 1UMJA 3OVBA 2EFPA 1TV6B 1NNDA 1HWLA 2V68A 2YWHA 3CJSA 1YBTA 5H9FK 1T95A 4QR0A 4Y0FA 4J7CA 4NLVA 5IM0B 2HHUA 3WC0A 3V6KA 3OXFA 3S6EA 4A8OA 2I8EA 1OQ6A 4DCJB 3RYLA 3ZTSA 3I9V9 2NR0A 2QEXS 1DHMA 3TEHB 3Q2SC 1LW0A 1YITS 1J5OA 4FYDA 2MJUA 4MKVA 1W2IA 2XGQA 1RT1A 2GAGC 2XMMA 2G2OA 2VODA 4OYMA 1M90T 3ET6B 1UJ5A 1VQ5S 1FT8A 2ZUAA 1Q8KA 3K5LA 3OSPA 1JLFB 2B5JB 1CJTB 4D3GA 1RCOB 2VBZA 2QL9B 3T9ZA 4NCAA 3KG0A 3RBXA 4HHUA 1CJUA 1OYDA 3VZHA 2BE2A 4ZIVA 1Y9OA 5D0EA 3N28A 2GVZA 1BLUA 4ZA1A 4BBYA 1V3SA 2EK6A 4WXWA 4LF7J 1XR7A 2HQDA 1FHTA 1R7IA 3DOLB 5A8RB 1TVRA 2M8DB 3MCSA 4WPAA 3CO0P 4ATNA 1SJFA 1V3ZA 2CG4A 3D6TB 2LLZA 1YHQS 5DM7Q 1TL7B 4F4YA 1X4GA 1NKCA 4F4AA 3DLGA 2ZKTA 3CDBA 5LSRA 4ZIWA 2HVZA 3NNAA 4ECVA 4ES3A 1IKVA 3DGVA 2CXEA 1H38A 1R31A 4IOAQ 5DJBA 1XIQA 4BS2A 4R0EA 2V2QA 4L75A 1XEZA 3RJMB 3VF0B 4DV2F 2HFVA 2L9NA 2X1AA 4C97A 5HLFB 1GT8A 6FD1A 2B0GA 2Z57B 1TL3A 3HD1A 1R8HA 1HNZJ 2CJYB 1U47A 2CYYA 4QJVA 5M2PA 3GCWP 2D41A 3RB4A 3MFHA 2R2SA 1NZ8A 1SPBP 4B3SF 3MI7X 1B70B 5K5MA 2LEPA 2WVFA 3C15A 4LSNB 1Y4ZB 1NPKA 2BXJA 2R7XA 4KHPJ 2VG5B 5ETSA 4ZLLA 1YI2S 2DCLA 1AFJA 5CH7B 4PYDA 5EX0A 1WD6A 4XDCA 2O5DA 2HRYA 3CCQS 1DQ9A 3DRSA 3MM5A 1T11A 3W1YC 2HFZA 3D28A 3P5TL 3BF4A 1RWKB 1R27B 1KC8T 2PMWA 2MLZA 1O0PA 2RRNA 4ZK7M 3D6FB 3LH2S 2HHPA 4C8LA 3SIPB 3MM8A 4IOBA 4JOUA 5M2RA 1FEHA 3P6YC 5BYSA 3BBFA 4ZS6A 2CPZA 5LXYA 3IMQJ 3SFUA 2DKOB 2Q6BA 1RYRA 2DPJA 2VD3A 4G65A 3NXZA 2AJ0A 4IFYA 3CD6S 1IKXB 4OFZA 3I4PA 1M1GA 4L3NA 3M1VB 5F41A 4DL5A 1QSYA 1VHFA 2FVPA 3PR4A 1T03B 1APSA 4J9PA 2MEWA 1QUVA 1X9WA 3D1HA 4URSA 3CDWA 3ETMA 4LBHA 1CSJA 1U48A 1IQTA 3NEKA 2HVIA 2YY3A 2X1FA 2B9YA 5HP1A 5KFZA 5DDPC 1RAFB 3IFEA 3B82A 3QAUA 3Q8YA 4C0HA 5KFIA 1ZAWA 5JVHQ 4TQRA 2IHR1 3GMGA 4I68A 5FLXU 1NDLA 4BC7A 5DG9A 5L1LA 4QIGA 4Y00A 1GX5A 3HJVA 2LQ8A 2BRLA 2KJVA 1N33F 1KP6A 4KRWA 2V50A 3P8BB 4JI4J 3CJKB 1EZZB 1NAQA 4H4OA 4UZCA 3NL0A 3V6HA 2PT0A 3G6VA 1OPZA 1VQ4S 3HHKA 3HD2A 3TR5A 3ULHA 1S1TB 2I0XA 2CQ4A 4H4MA 1HQ2A 2UVRA 2VOPA 2L41A 2VBYA 2WB1D 1JLAA 2FY1A 4DSFA 2EG1A 4OZ5A 1X5SA 3G8TA 4DL0C 1RAIB 4RLEA 3LP2A 4K4UA 1YJUA 4ED7A 1A9NB 4DV7J 2H5JB 4LREA 5C25A 1CJVA 3I82A 2OPSA 1X31C 4NI2A 4FF4A 1MROB 4CDIA 3CJ0A 5EWGA 2HQIA 1FF2A 4OJ1A 1DQAA 4YR3A 4EZ6A 3HFVA 1DBDA 1FFSB 4LBPA 1S1UB 4F2RA 4RKUC 5IQ6A 2HFSA 2KHDA 4LSLA 2WVDA 1DJ0A 4JBCA 5J2PA 1KFSA 4M5KA 3QGHA 2AYEA 5C5JA 4CTAA 1U1LA 1U1OA 2HAIA 5U47A 3VQTA 1D9DA 5I3QA 4EBCA 4WXOA 1F2GA 1WHWA 4IQXA 2CFXA 1RTZA 1S1VA 1SC6A 4Q2MA 4USTA 4XIUA 5HVHA 2QA4G 1GMWD 2OTLS 4HTIA 4K0KF 4EUVA 2XSJA 1LV5A 4QCLA 3TUJC 1NRKA 3PRBA 3M2RA 3BBBA 3FEYB 4QIWD 2XYHB 1R0AA 2QMWA 1NMEB 5ETOA 1X4AA 4DPOA 4E8UA 1S1XA 2EWHA 4B3TJ 2FVSA 4W4MA 4L74A 3LWMA 1LXNA 1X4FA 4RNFA 5HQMA 4J9OA 4ES1A 2YNFA 4DFMA 3R5AA 2PA8D 2HHVA 3BS9A 1FJGJ 1FK9A 2AX1A 3BZQA 3ENVA 3CB4A 1GXUA 3CGIA 3ISND 1SCJB 2ALZA 3C6UA 4AL7A 5ETRA 2Y0SD 3UW1A 2Z56B 1VHIA 3WBZA 2BR0A 2MTLA 1QAXA 3TI0A 4CO1A 2PSZA 2W9BB 5LL6d 4LR9A 4DL6A 4R8UA 2EPIA 3M2UA 5LXRA 3WIUA 2E5IA 2PI4A 1PJ7A 4FKXA 3D2WA 5D4LA 2IRXA 5KFGA 3ZFVA 4U6PA 3BV8A 2M3DA 1I94F 4Y2CA 1SJ1A 2WAQD 4AUKA 4ELTA 5HANA 4DCOB 3LP0B 3D1QA 4C7QA 2N4DA 1EKRA 1N5YA 2JSXA 1YBAA 5K8NA 2QN6B 3P96A 2OKQA 3QO9B 4UUXA 1NUEA 4FXVA 2IJFA 2AJ1A 3CJ5A 2CQCA 2XMTA 5FJ4A 4ZCLA 3SCLE 3DRRA 1FNXH 1SC3B 4MK9A 3PM9A 2E9RX 2RF2B 5THWA 4R0JA 4CT8A 3Q8RB 2VC1A 3MMAA 4UT4A 2IMOA 4JUZA 1U1QA 3W64A 3PG9A 2BJ9A 2B6AB 1IWGA 1U2FA 3EWGA 4AXJA 1KBRA 2VJUA 4KJIA 4LF4F 2H4YB 4YHHF 3KLIA 5F9LA 3NCQA 1DURA 4PG6A 1BUXA 3GE9A 4JI8F 3CCMS 4OLOA 1YRXA 2GGPB 3J7ZT 4NLXA 2GHVC 2LQ5A 2AGQA 3W7BA 4F3OA 3NRBA 2BQUA 2OFHX 2XC9A 5FD1A 1RT6A 3VGUA 1NB2A 3GFXA 1G7CB 3ZZPA 2EC0A 3GCXP 3MUVP 3TA2A 4IO9Q 5HBMB 3BQ2A 8RUCA 2QLFB 2VHGA 3QJJA 5AXKA 4DV2J 2DNQA 1CULA 4HT5A 1TAQA 4YFUA 1V9OA 5KG3A 4I6WA 3Q2TC 5CABA 3FNNA 4M5LA 4FYWB 4ZLJA 1KSPA 2BM0A 2E1RA 4FYVB 1K0VA 4X66F 1URNA 3AOBA 1Y7PA 1W7WA 4B3SJ 5E7OB 3J7YI 5LM7E 3DGPA 1JKHB 2G2YA 2DISA 3VAGA 2MKYA 3JSYA 2VPXB 1LWCB 2NLWA 2FHJA 1RT4A 5CYJA 2YKAA 3K5NA 3TO8A 3TUZC 1QSSA 5M2UA 1N52B 4GKKF 1PSDA 2FHKA 2I6WA 2FQQB 2GNKA 3G6XA 3OFEA 1WG1A 2LA6A 1CS4B 4Y2IA 2UXBJ 4MYTA 1IM6A 4ZPWR 4OHXA 4L76A 2CJXB 1RTJA 3EVOA 5D0RA 3ZZ0A 4MFBA 3NOGA 4C8OA 1QD1A 4NLSA 3OFHA 1VMBA 2LKZA 4F0HA 1FKOA 1DTTB 4DPTA 3JSMB 1EP4B 2NCKL 2E9ZA 1RAGB 2IDEA 1MG7A 3IGVA 4USJC 4HH0A 4NXMF 1IVZA 3Q83A 2GX8A 2JDJA 1HPZA 1QUPA 3L95X 3QAEA 5L39A 5KFJA 3ZZTA 4CIOA 3QZ8A 3Q8QB 1T9YA 2MKCA 2DO0A 4C98A 2RUGA 2VDHA 3BH7B 2KXNB 5G0RA 5KG5A 2RMLA 4ICLA 1D9AA 1KTVA 3FC9A 1J5OB 1VLOA 1LW0B 3UNYA 1YJVA 3PO4A 3CD7A 1RT1B 2O1PA 3AHPA 1Z1ZA 3PO5A 1QVGR 1UPPA 2RS2A 2DO4A 5KFDA 2R7SA 3T1HF 3N9UC 3EMTA 1AZSB 3QRRA 2APOA 1R43A 4X4UA 3OFGA 3LA0A 5KT5A 2KM8B 4DQIA 1HLWA 3OW2R 5B0EA 1CJUB 3HFKA 4DUZF 4QOTA 1QAIA 4FKYA 3MXHP 2ACYA 2YBVA 5L1JA 2VA3A 2BE2B 1WC6A 2GMHA 1ZA1B 5B0AA 1C1CA 1QVFR 2UZAA 1N33J 5HVGA 1WELA 1VQSA 1E6VB 3I31A 1RABB 4IYQA 3LAKA 1XC9A 2A6OA 3PRVA 4ZPDA 3DLGB 5CXTA 2MDAA 1XMQF 2N4CA 2XWYA 1IKVB 2KJWA 4IKAA 3BKTA 1FX2A 3D67A 4DUYJ 3OBIA 3IRWP 2AX0A 1M5SA 4DLEA 2CWXA 3CO9A 4NA2A 2YH1A 1S6PB 4OHWA 1LWXA 1HNWF 4HHJA 4WBFA 1NDKA 4MIWA 4FBUA 1YIJS 1TL3B 4X64J 2HWHA 4TVAB 1X9SA 4OI3A 4ZLNA 4NYOA 1TL5A 3QFWA 1KR4A 2V8PA 3FQKA 3CC7S 2VICA 4UY8T 3IM9A 1UVJA 5KFUA 2ASDA 3C15B 2AJFE 3CJQA 3SDEA 4OJHA 3V4IA 4DQPA 1M5PC 3DRYA 2K7KA 3AQPA 4GKJF 1N54B 2R9LA 4J37A 1H0HB 3RBEA 5H9EK 2B7CB 3DRSB 2KM8C 2ZITA 3MM5B 3PTWA 2J7WA 3GG1A 1KNZA 1MWQA 2YQ1A 2KVIA 3OXGA 2G4BA 1CBKA 1WG5A 2BKPA 3RRGA 3FDSA 3G86A 1NM2A 4K0KJ 3T1YF 2MZQA 2XULA 3MM8B 5LMUF 3DLJA 1F9EB 4DG1A 3GPAA 3RB3A 3MEGA 2PGCA 4CLPA 3I6PA 5F9NA 1UZHA 5DS7A 1VRTA 3NGUA 1OO0B 2KYZA 2MZSA 5RUBA 4RUBA 3CCLS 4PQAA 2Y8YA 3NCPA 2R3VA 4ECZA 1OJ4A 2FJXA 4CLKA 4DR7J 4IFYB 2XS7A 2XY6A 2V8HA 2D69A 5GMEA 5HSPA 1UVMA 5HROB 3EPIA 2UXDF 1MMDA 3JSBA 1ZBTA 1L3TA 5ITHA 2ADCA 3GWCA 4FBTA 2G2ZA 2I9SA 2FD2A 1T9UA 4N7TA 5DQIA 3A3OB 2DNZA 4OX9F 5T14A 3H40A 1YQHA 2OUGA 4JV2A 3HHLD 3EX7B 5DETA 1WDTA 1S99A 5GAGI 1UP1A 1HNIB 2SXLA 3I32A 2VFVA 3H2VE 2ZD1B 3PIPQ 2NPFA 4WU3A 2U1AA 3GYXB 5GADI 3QGGA 3T3FA 1IUJA 4QYZJ 3JYTA 3GIMA 2BRKA 1BHNA 4I69A 3P45B 4FVCA 2BW7A 5KOXA 3DLLQ 3QSIA 4CH0S 4H4OB 1WTBA 4GC7A 2ZDPA 1RBLA 4KKOA 4ELVA 4UOFA 4DXLA 1BQNA 4EGLA 1I94J 1Q95G 1EARA 1KD1T 2JOQA 2F7VA 4C8ZA 4FXWA 2GHPA 1AUDA 1L3VA 5SZTA 1VLYA 3DYAA 2VG6A 4H4MB 1NJYA 2C1EB 3UVJA 4KO0A 3MM6A 2BJ3A 2VFSA 3BSCA 1WF0A 4ZDNA 4AT1B 2W25A 2HVEA 2OFGX 4OZLA 3MEKA 2V2KA 4FNIA 2FJBB 1QM9A 3LP2B 3R1LA 4PPZA 3K58A 1S72S 4DJBA 3PKMA 5C25B 4LIRA 1TUWA 2ZOGA 3GG0A 4WKRA 1WSRA 4M5DB 2J5AA 2OPSB 3F0NA 1B7YB 2C42A 1UVNA 4B9LA 3SFGA 1U1NA 4YHHJ 1ZAVA 1JLEA 4YB6A 1D0EA 1RLCL 4JI8J 5C24A 2N3LA 4ZCKA 2ILYA 1V5VA 4PQUA 4LSLB 2CQHA 3MGJA 5J2PB 2KT2A 3TX8A 4CTAB 1MLAA 3VAHA 4DR3F 1KRPA 3PW0A 1GH8A 1RHQB 1HWKA 2E1CA 1KHVA 4LJMA 2MQQA 1S1VB 3CD5A 5K20B 4ECWA 2XZDB 2I5JA 1XWLA 2LP4A 3SYZA 5KT6A 2KH9A 1QAJA 4P6QA 4A47A 1R3NA 3I55S 2PIIA 4DQRA 3M2RB 3B4DA 1HQEA 3KHGA 4M5MA 4ANDA 1R0AB 5F0WA 3M7VA 5HQLA 1C1BA 1AUSL 3MAAA 5IV4A 3J81U 1S1XB 4C3MA 4F4KA 1O5JA 2NREA 1N36F 4X66J 1XNRF 1VQPS 1CPZA 4J9SA 3BSNA 5DRKA 5K8MA 2YNFB 1VC5A 3IC1A 1F3VA 1J27A 3MPWA 2YQ3A 3IRXB 1M5OC 3I5AA 1Q78A 4XPCA 5B09A 4DPWA 1SKRA 1JNRB 1RT3A 1U0HA 5LT5A 3BR9A 4GKKJ 4ER8A 3Q22A 3IS9A 3M8ZA 3AJ2A 2PMZD 2Z8QA 1KEKA 3A1YG 3E2EA 2B8QA 2DGXA 2AGPA 1RK8A 5A6WA 2CVEA 4MIBA 4AYBD 1RISA 2P5VA 1OWXA 1F0XA 1GK8A 4OYWA 2HBYB 1UVLA 1MMLA 2JWNA 3BN4A 3KLHA 4PXBA 4R8UB 4BHQA 3R6LB 2J0SD 3M2UB 1JXEA 4NXMJ 2CQDA 2EKYA 4OZ0A 5HATA 2RQKA 1RBOB 1NHUA 4CWBA 2WW4A 1ZAXA 1RLDA 4U7UK 2ASLA 1R6VA 4KV8A 3IG1A 3HHDA 1T3NA 2CQIA 3U7JA 2FC8A 1NSPA 4BLGA 4QWEA 2FVRA 3HKZD 1VI7A 1N5YB 4CYUA 6FDRA 4KGZB 3GIJA 1S77D 1RTDA 4KT0C 4B9SA 4MIAA 3T1HJ 3MR2A 3K59A 2XMKA 1D1UA 1PILA 2PA3A 4RNOA 2XY7A 3H42A 2J7UA 5IT9U 5B0GA 3DRRB 2G1DA 3A3NB 4AE5A 3A12A 1KQFB 2RDDA 4FF3A 4K5SA 3BEGB 3KUGA 2OPPA 3H2LA 3CCSS 3NGKA 4DUZJ 3MMAB 1HW8A 2V63A 3UQSA 2YWFA 5F8LA 3MECA 2ATCB 1AW0A 1IN0A 1YBUA 3MMBA 4FYYB 4JP8A 3CMES 3LAMA 1NK6A 5KFHA 1CLFA 1PYSB 1TTHB 2P9EA 3MWBA 3CCVS 3ETOA 5B0FA 2RUSA 4QU6A 2M4MA 2FLPA 2ROPA 2C2EA 4CO3A 4FZVA 2ZKUA 3QT6A 3JTOA 5KFNA 1RT6B 2JL9A 2RIJA 4CO2A 3TWZA 2RQ4A 1FRHA 3FZBA 2B4PA 1S0MA 4UOCA 1BE4A 3C66A 2NXUA 1CULB 4ANEA 1VK8A 4J9KA 4K2XA 1RAOA 2PD1A 1HBNB 4MK7A 2PE8A 4DQSA 2C22A 3DDKA 1SL2A 2D3OR 1NK0A 1EX8A 4KC5A 3B4MA 3OHBA 4MKBA 1EB0A 1WUUA 3DGPB 4ZOSA 1GMWA 2EFOA 3IO1A 1RT4B 3PKYA 3GSIA 4GKJJ 3CC2S 4DUTA 2YKMA 1IJFB 1NJZA 4HLBA 1TFYA 1YG0A 2QLJB 3BH6B 3WHIA 2RDJA 2YWGA 4IH6A 1K8AT 1FWKA 4ANCA 3KDNA 1YWXA 2NYHA 1NU4A 4I2PA 4OYPA 3D7SB 3VAKA 1RTJB 2HYIB 2CKWA 3MR3A 4MFBB 3TUPA 2JLGA 1ZS6A 2MLYA 3NY0A 4YB5A 4I2QA 1FKOB 3J80Y 4R5PA 2ZOMA 5LMUJ 3MCOA 2CA9A 1NSKL 4ZVHA 1S9EA 2ILZA 1HPZB 5HL7Q 4FN5A 2HPUA 2QZ8A 3D66A 2CRLA 4Y2KA 3NP5A 3TEGA 3KHLA 2COLA 2ZZTA 3THTA 4G1PA 1CQNA 5DDQC 2UXDJ 1RWUA 4F3MA 4HTJA 4FS2A 1FKAF 4TNOA 1T05A 1ROFA 1U02A 3RBDA 4PWDA 4OX9J 1ITPA 3KKFA 3W2VB 2LFVA 3THPA 2CADA 3PXGa 1XMBA 4O23A 5IFMA 2M0GB 3V2UC 3D5MA 1WHXA 2DGVA 4ZKAA 2HNYA 3N5BA 4J9UE 3N6LA 2J0WA 1HL6A 1JNZB 1YVFA 2OPRB 5I42A 4N77A 1ACMB 3MHYA 3BGUA 5F8NA 3CSKA 2JEGA 4K4ZA 3CDUA 2FLOA 4MMOA 1Y00A 1UVIA 5EHHA 2XTJP 4WE1A 4DV5F 1SV5B 3CTRA 2CQ1A 3R5BA 2G0CA 2RD5C 3PACA 1Q81T 2XZWA 2MYFA 1GX6A 3HVRA 2VFUA 1Q7YT 2JC0A 5HMZA 3V6DA 3MD3A 1N0VC 1BGXT 1TQLA 3LF0A 4RWXA 2XI2A 4L6V3 1FJCA 2ZH3A 3BB5A 3EICA 3Q8SB 1P9QC 1YLXA 3C19A 4ID5A 3CIZA 1L3KA 3NNCA 4EI2A 1EIYB 2ZC4A 4RW6A 5I4MA 1A6LA 4K4WA 4ZVPB 1SL1A 5J1EB 5K14A 1ZPVA 1T9XA 3UO0A 3P49B 2Z4PA 3OUYA 5B0DA 4G1QA 3NMAA 1ULRA 3L09A 5J2NA 2C28A 2HNDA 4Y28C 3BPSP 4RBUA 2HZAA 1SIZA 1QTNB 2DGUA 3HJFA 1T02A 3SDEB 1D8YA 1SJRA 2HVHA 1VOMA 4UF4A 1TK5A 4MKYA 3M05A 1HBMA 3GYNA 4DR3J 3MEDA 3UDLA 4J91A 2OD4A 1WI8A 2VC0A 2PN6A 2ROGA 2QIFA 2VASA 1HMVB 3OJSA 1D9FA 2VG7A 3BN7A 4LR7A 3EGNA 4XDDA 4DG1B 3MEGB 1U6FA 2R8JA 3MM7A 4F04B 2R7TA 3V5RA 3QYYA 4DSLA 3MCNA 3SMZA 1N36J 4USWA 1XNRJ 2YWEA 4D3HA 2XYGB 4F7VA 2XY5A 1VYAA 2ZE2A 2AQ4A 1RCXB 4K4SA 3NBPA 2DHGA 3KUEA 3TP2A 5KG2A 4WJBA 3ZTQA 2VQEJ 2VU5A 3MTJA 4Q2LA 3HI9A 2RJZA 4KH1B 3T5KA 2ZWPA 2AWZA 4ELUA 1HBOA 4ZPBA 2RKIA 1HA1A 5DQGA 1RTIB 3P5BP 2OEMA 1S57A 1S5ZA 2FHMA 3OVSA 3CDAA 3SV4A 3MMCB 1OSCA 4F4ZA 4EEYA 2WONA 1NSAA 1YJWS 4NLOA 5DQHA 1P9YA 1HFEL 2Y0BB 1FNOA 4ILRA 1PAEX 1RAJA 4NMLA 2HAFA 4UTGA 3DMJA 4NX9A 5F3TA 4DSEA 3LP1A 1YZ6A 4I64A 1S7IA 3KG1A 4C3LA 5C2GA 1NHKL 2G9OA 4LF1A 1BQNB 1YGYA 5DM6Q 1FDAA 2YWKA 4WFXA 3MM9B 4NLDA 4Z7CA 3QRPA 2DXDA 2KT5A 3DYAB 3JTNA 2VG6B 3D6HB 5IT0A 3UVJB 1SJ4P 1RWOB 5D4OA 4KO0B 1BXNA 4P7VA 1UZDA 2EK1A 4K4XA 4ZVGA 2A2DA 3H5XA 4UW2A 4Q0BA 3IN5A 5MAOA 3I4HX 4LVOP 1Y3JA 2IC3A 2YNIA 3HDSA 3UD5A 2N7YA 3BGOP 3L4BC 4LRAA 3OQ2A 1RDRA 2KHCA 1YRUA 4QR1A 3U1NA 3PDNA 2JVRA 1JLEB 2ZHBA 4P72A 3PYDA 2VPZB 1IR2A 4O0IA 3PW5A 2CZ9A 1VQ6S 4NASA 1X4HA 4NYPA 5C24B 2MB0B 4PQUB 2M2BA 2Y9HA 2NXNA 2VL1A 5AJ3F 4P2SA 3GILA 2LDYA 1UW4A 1V6HA 1VDHA 4DWIA 3F44A 4KPYA 2PEHA 1TMJA 2W1BA 2A10A 1QE1A 1HNVA 3NLCA 3W8PA 4WIQA 1M0SA 2ACMA 2I5JB 4M5HA 1FO1A 5K9FA 3M8WA 5IZHA 4RW8A 3EUNA 4F67A 1SQFA 3AD7C 3I0RA 4DU7A 4ECXA 3T6BA 1HQEB 3K8WA 4ERDA 4NXNF 2XCPA 2J76E 2H5IB 4PWWA 3CWJA 3MAAB 2FY8A 1KLMA 4JI5F 2ZNYA 1H74A 4U8YA 1XR6A 2C2RA 1S49A 1YJ9S 2R7UA 2R7WA 4WFZA 4WFYA 5L38A 1F3FA 2ZZNA 4UQTA 2BANA 5IOLA 5DGBA 4QZVB 4ZJLA 3EGWB 3HULA 3WDOA 2FB0A 2YPZA 2IVFB 1H3DA 4A48A 4YEAA 2WBRA 1RT3B 1U0HB 1HD0A 4OHZA 3ZTPA 4EBDA 3IS9B 4KGXB 3Q24A 2E5HA 4L3KA 4XO0A 1BY9A 3QZ7A 4ZN1A 5KG0A 4X62F 3NWRA 4O3PA 1LQ9A 4CLLA 4MJKA 4GC6A 2ZJQQ 4U9RA 2KG1A 3KLHB 4F0KA 3G82B 4WZQA 1FRJA 3ILLA 2RH3A 1FJEB 5GVQA 5ETQA 3VAJA 3DN9A 4G6VB 4CLTA 2P8IA 1NSQA 3HHLA 3IG1B 3ZTRA 4CM2A 3DLEA 2EVZA 3W5ZA 2Y1RI 3GLJA 3M8RA 2CPIA 4JI6J 2IM1A 5DLGA 5KFVA 4CYUB 4O0NA 3W9IA 2HFOA 4GO7X 4KHMA 4YY3J 4X4TA 3OXLA 2H48B 1FE0A 1KHWA 2RU9A 1NJWA 1VQ9S 1Q79A 4U7CA 1NCLA 1FFGB 7FDRA 2OPPB 4DS4A 1UWAA 3POTA 4YDDB 5FLXY 1ZYQA 3O2IA 5KT4A 1TFWA 4RNHA 2R7OA 3SCIE 3K5PA 3CT9A 5KFYA 4WFNQ 3AQOA 5CCLA 3TJAA 1HHTP 2GO8A 3MEEA 4JI7F 1R8BA 1JLGB 3MMBB 4QYZK 1FESA 5HAOA 4CNYA 3FK4A 2QMXA 2NSBA 2JLFA 2ATLA 1WDDA 3CUNA 2GA7A 2M7SA 5GAGU 3G6YA 1V3RA 3OFFA 4IR9A 3A13A 2XQCA 2UVVA 2AD9A 5E3PA 5MLCV 3SSRA 5GADU 1IKYA 4FVMA 2AEJA 4PAAA 2OEKA 1RACB 2NYIA 3JQMA 1UWBB 1JXVA 5ADZA 1NXIA 1JLBA 2DNKA 4IR1A 1JMTA 3HK2A 3MTKA 1DARA 1U8SA 3EGVA 4HDHA 3SQOP 3N01A 3QNWB 5HJYA 3A8IA 2VA2A 1VQ7S 2K7JA 2F63A 3KLFA 2WVBA 2W9CA 5CA5A 4WU2A 3TZXA 3CE8A 2UU9F 2OHDA 5LJ3Y 3OJUA 2NXEA 2ZEJA 4RU9A 2RILA 2BX6A 3D4JA 1WHYA 3BO4A 1RYSA 4CO4A 2GMLA 1H72C 2IFXA 2LXFA 2CNOB 1ZM2A 2L9WA 2Q6CA 3THVA 2YKMB 5HVFA 3IWNC 2CVIA 3TNVA 4IDKA 1VQYA 1IBMF 3MPUB 1VBZA 2KN4A 2BYCA 3ZZYA 3M9NB 4DSJA 1PG5B 2R8GA 4I2PB 4KSEB 2YX1A 1WSVA 2W2OP 2RHSB 4I2QB 4KIAA 2GW8A 4CH1A 3UDEA 2JLEA 3B8HA 3DRPB 4PKDB 1S9EB 3ISZA 4M1KA 3Q86A 3R97A 2AJ2A 3MOJB 4DR4F 4JYAF 3IR6B 3R7NB 1HWIA 3M8PA 4F4XA 1NEEA 2VBXA 1HQUB 1R89A 2MQMA 5KG1A 4CP5A 3HMJG 2CZVC 4YMEA 1S0NA 5L46A 4QIVA 3KG4A 1T05B 2XMUA 3MCMA 1Y5LB 4PWDB 2FVQA 3MPYA 3MR6A 4NPOA 3UDVA 3M32A 3AJDA 3D9BA 2VJVA 4PG4A 1XTZA 1X7VA 2AP6A 2HNYB 4YOEA 2M5YA 2MZJA 3L9ZA 4DEZA 3ZZUA 4HYKA 2X7IA 5L8RC 3UN3A 4TY8A 2RNEA 2CQ0A 4P73A 1T7PA 3W62A 2HVDA 1RTHA 3O6QA 4WE1B 1S9FA 1U2RA 3FRYA 4B3OA 3M30A 2HQGA 3F41A 3OR2B 4OYZA 1LXJA 1UEUA 3UN2A 2YX7A 3DM2A 2KZZA 2I2YA 2XMAA 2V9WA 3VAIA 3OL8A 4MYUA 2P2CB 4J9NA 2NSCA 1SBRA 4LF2A 2IVYA 2MGZB 1LFWA 1N48A 3W2WA 5KFLA 3S01A 2EFQA 1VQ8S 5HMWA 4ID5B 3H25A 1NK5A 4DX6A 2IA0A 1QSLA 1FRXA 5KFQA 4Y2AA 5IC6B 3M6WA 4CLYA 2DGOA 4RW6B 4ZITA 2QA2A 2HURA 2F1FA 4DCPB 1S1WA 2ZH2A 1CVJA 3W9HA 1ZH5A 4OZ3A 4FDFA 5K14B 1FJ7A 2HIQA 2HRTA 2HGNA 2L48A 3AJ1A 3TZYA 1JWWA 4IO1A 5KT3A 3HHEA 1SH2A 3ICLA 3TRGA 4C2MA 3OUYB 1CEZA 4ED0A 2AIRB 4G1QB 2Q3PA 3H90A 4C8KA 4J90A 2DCUB 5J2NB 4M95A 2KRBA 1TKXA 2BUNA 4DPYA 4O3NA 5A76A 1IBCB 2CDRB 1C0TA 1G3OA 1S6QA 3UD4P 5AJ3J 2V2ZA 4Z7YA 3QT5A 1RAHB 1Q5YA 3KLGA 1HBMB 1JJ2R 4OX6A 3E8OA 4RX6A 4OLPA 2HHHJ 1X5PA 3HLUA 2ZBCA 4KPCA 1X60A 4DR2J 1EETA 4Z2XA 3O5TB 4LRDA 3TYTA 1TKTA 2UUTA 4JI3F 1Y5NB 4TU9A 1FD8A 5KFTA 1UA0A 2E66A 1D3WA 1B0PA 1RWPB 2UUBF 3C2PA 1Y11A 1FDBA 2UUAF 4JI2F 3MM7B 1S10A 1E6YA 2XO7A 2VZ9A 4ED8A 4JI5J 4YR2A 2E5GA 1O8BA 4I0WA 3VWSA 1RWNB 4C6AA 3TZWA 5AE1A 2OLWA 3PW4A 1CJTA 2ZE2B 3F73A 2R2UA 3NBPB 2KB2A 3PRDA 3CMQA 2CJBA 3BKUA 4RBVA 3CMAS 4KGVB 2PEBA 4TY9A 2XS5A 4DU8A 4NE9C 4DFPA 1HBOB 3JS9A 3AY0A 4PXEA 5DO2A 1S6OA 2OP5A 3VHQA 2CPYA 4FPRA 2V0NA 2Z2MA 5AXMA 3SCKE 2VFRA 3LGMA 1SUQA 4JI0J 2WONB 5AT1B 6AT1B 3GFHA 2MXYA 3HVWA 1AT1B 2DRAA 1MW7A 3IAM9 1TL7A 3JTPA 2W8LA 4N8OA 5LSLA 1HI0P 4TXSA 1JXLA 5J2MB 2LXUA 3DMJB 2HGMA 5CAAA 4HACA 3LP1B 4ECSA 2KFZA 2J8SA 3UFCX 3V4MA 1S0OA 3CIMA 2FTRA 1KONA 2OELA 1HR0F 1PC4A 4BC9A 5GAEI 4DR6F 1RA6A 1WKKA 1REVB 2C2DA 4X2BA 1VR6A 4ZHRA 4NLGA 1Y3KA 5A6PA 5E5NA 5HLFA 4V19J 2DY1A 1OPIA 1CJKA 1HIYA 2MQNA 2XB2D 2KZMA 2GIFA 4Q0BB 7AT1B 2IDLA 1PC5A 3DLBA 2JH3A 3D6MB 5GAHI 5E0OA 4B3MF 2RT3A 4KFBA 4QWDA 3SXLA 1UCNA 3PFOA 2IC3B 1WEZA 1BQMA 4AL5A 2XLJA 4LSNA 3KK3A 3TAPA 2J9EA 4A8KA 2PO4A 5D78A 4I4BA 2VDIA 4JI7J 4ECUA 4CLUA 3VTIA 3HO1A 3EPGA 4DV4J 3BQ1A 1XMOJ 2PDAA 3OTDA 1S9GA 1PIEA 3W8GA 4J9RA 1RQ0A 1GFWB 3DOMA 5D15A 4DF8A 2ZM6F 2CPDA 1PKUA 2XZTB 1REGX 2WW8A 2KFYA 1YJNS 4TN2A 4KE5A 3WC2A 3LQVA 1VRUA 2JEJA 4N41A 1W26A 2V8VA 2NXCA 1QE1B 1KVIA 1HNVB 3UNGC 2M70A 2RRAA 1SB6A 3SI8A 3NGTA 4RW8B 3D3CJ 3HF5A 2HSEB 2CQ3A 4IFVA 5EN1A 2BDPA 3M1VA 2GJFA 1Y5IB 2IYIA 2RE1A 4P7TA 1KLMB 4AQYF 1T03A 4WK3A 3UI3A 3C14A 4ED6A 4Y6IA 1TR0A 2UU9J 1K44A 4JV0A 2V4JA 2F40A 3KHHA 2QX0A 5KFWA 2CNNB 4RUHA 2ZZMA 2X51A 1Q82T 2BANB 3R9LA 4O44A 4DN9A 2CQPA 3KJVB 2GCFA 3SZ2A 1VC6A 1RWXB 4N76A 1RT2A 4RW7A 3NS7B 1VBYA 2XI3A 1FRMA 4ZMMA 3KK2B 3J7AN 2JC1A 4HI1A 3FZ2A 2DVIA 4CLSA 3AXMA 3GSDA 1ZTWA 1SL0A 1Q86T 1KVJA 3RTVA 1JQGA 4FYXB 3PVXA 2WK4A 3FCHA 3CJKA 2Z2LA 3BDPA 1RT7A 2F4FA 2XS2A 2XNRA 5D6GA 4LF5F 1WI6A 1KDNA 2QLBB 3K5OA 4UQGA 4OV1A 5D0HA 3HHLB 3JB9k 2ZVIA 4DR4J 2PI5A 1J2VA 2DNPA 4JYAJ 1OQ3A 2L9DA 1G4CA 4DL3A 2FJAB 3J7Z5 3CJTA 1S4EA 3GP9A 4LQ9A 2CNLB 2E7XA 3OR1B 2FC9A 2DXEA 1UFLA 3SV3A 3MD1A 2MKJA 1IKWA 2B51A 2OO4A 1ZPWX 2QG9B 2CJAA 4O4GB 4NLWA 2MKIA 2B7BB 2CUYA 3PW7A 1WKJA 2HS0A 1HARA 3M4XA 3QJLA 1MROA 1R8AA 1AYEA 3QRQA 3S8SA 5JVGQ 1UKUA 1S1UA 4ZJOA 3NAHA 3GJQB 1LWEA 3UD3P 5C42A 4WFAQ 3NGRA 2R42A 1RKJA 4KH0B 2BJDA 4BCAA 2HMIA 9RUBA 4Q44A 2HBQB 2C3OA 2QSFA 1NKEA 2QO3A 3E3XA 3M8QA 1NK7A 2DH9A 2NZCA 1WACA 4J9MA 1IKYB 4K8RA 5HMXA 2XO6A 3RW7A 3AFGA 4X4VA 5E3QA 3FGVA 4LUBA 1JLBB 3ZC4A 2KTQA 3NGSA 3TA1A 1OY6A 2E7VA 5AXNA 2ZHAA 2Y1IA 4RUAA 2ZH8A 4K5RA 1U1MA 3M2VA 3LOUA 5E3AA 4OZJA 1PJ5A 3KLFB 2QT7A 3HHLC 3EM1A 2W9CB 2DR5A 2ZH6A 2C3YA 2VF3A 4I7FA 2IRYA 4WTOB 1L5UA 4EU0A 1TELA 3B78A 2W4PA 3HZEA 2AYBA 2MY8A 1M5VC 3IGNA 1TK8A 2DNNA 1DFDA 1YZ7A 2LQ9A 1TKDA 1NO8A 4NLTA 1PYTA 4DX7A 2HEKA 1XJWB 1P27B 3U1MA 2W7AA 2IBOA 3VQSA 2FJDB 4R25A 2DHSA 2Q79A 1EKSA 2V69A 4IDKB 4KY3A 3CCTA 1QDUB 2B43A 3A3PB 5A2QU 2BMBA 2OAUA 2QTWA 2NXJA 3N6MA 4ILMA 4X84A 4OJGA 4BDPA 3ILOA 4NOHA 3O3LA 4NLQA 4LF8F 1T9WA 1GXTA 3PEHA 2DNYA 2RAQA 4JI3J 4NWBA 4RZRA 4USIA 2ZH9A 2QLXA 2UUBJ 3J81Y 1X0PA 2YQ0A 3OV7A 1OIAA 2DR9A 1P1LA 1NDPA 4F26A 3TZZA 4DR5F 3AODA 2H54B 2IYGA 3KK1A 1DLOA 3M8PB 3PCOB 2D3ZA 3D54A 4UOGA 3US5A 4PG8A 5D8HB 2NZ4A 3VAMA 5SUHA 5B0BA 4EYIB 2C2OB 5BJRA 1ZTTA 2AJ4A 2NQPA 3H20A 4DHVA 1JJ4A 3AAWB 4ZVOB 4AFFA 3M32B 1NDCA 2HHTA 2B6AA 3R8YA 3Q8UA 1C4CA 2WOMA 5BYQA 3UCZP 2GFFA 2H5EA 3VCDA 3KXDA 3I5BA 3KOAA 2BACA 4RNNA 5D3GA 2WSEC 2E1PA 2POKA 5CHCB 2GGPA 4QIFA 5IT4A 3FCVA 1T94A 4NEYA 1RTHB 4UY85 1W2BR 3CNQP 4B3OB 3ILIA 3M30B 2M88A 3HVTA 1FDDA 4ECRA 1Q0NA 2IJRA 1FRLA 3DM2B 2YWWA 2Z30B 4MT1A 5CZVA 4P71A 1HR0J 2CIMA 2WTFA 1SKUB 4DR6J 4DV1F 3CCUS 2KFNA 1VJQA 3M6XA 3IR7B 2XMWA 1U1RA 1AFIA 3W2WB 2GVZB 5IT9Y 3HSDA 1DRZA 3QIPA 4XAKA 4OI4A 3GONA 2V8GA 1LKZA 4PUOA 4DSKA 2XHWA 1TVRB 4U67Q 3W5YA 3WIVA 3DHXA 3MOZA 3BBCA 2XHCA 3S1TA 3J81j 1G6BA 1S1WB 1UJ4A 4B3MJ 4AL6A 3SSQA 4M5IA 4IH5A 2C3MA 3GQCA 2V34A 1B4SA 5J2QA 4KGKA 2WCXA 2QFJA 3J7A1 1RWMB 4EO6A 3M8YA 1JKHA 1FXLA 3G2XA 4PXDA 3T19A 2RHQB 2W24A 3ENAA 3PHTA 1FJGF 3TJ9A 4NCGA 1F5CA 1TKXB 2L08A 1IJEB 4PXCA 1AXQA 1H2UX 4ZVRB 1C0TB 1CS4A 4C0BA 1S6QB 3CCES 4DV6F 1NHVA 1TL4A 1KVKA 1U25A 4JV1A 2GVDA 3U02A 3R5CA 2CJKA 4RNMA 3LUYA 4QW9A 3R2CJ 2FJEB 2QL5B 4O3OA 3KHRA 4WF9Q 1DTTA 2ZBIA 1EETB 2LU1A 1EP4A 3PNIA 2J0QD 1KKHA 2YKQA 1SKSA 2HQ3A 1TKTB 1NBEB 2BABA 3BM7A 3W61A 1DZ5A 1VBKA 2F8EX 2G0JA 2C2MB 4HL9A 2N82B 2BJ1A 4YS2A 1AB8A 2XCAA 1E6YB 2OSRA 1CC8A 3EVWA 4W90B 4NA3A 4AQYJ 2BJ7A 4TYBA 4LFBF 2B9XA 4H4KA 3MAHA 1Z4UA 1AZSA 2BVZA 3DFEA 4TLQA 1Q4RA 4DSIA 5KG4A 1RKIA 1NPRA 1U45A 3HXMA 4P75A 2ZNZA 1OS5A 3GR1A 2B4VA 4LT6A 1CQMA 1RADB 2VIHA 2FLNA 1EAYC 1RP5A 2IM3A 4KYZA 2PFDA 1A7GE 4ED2A 5EWEA 2BE9B 1GEHA 2DHHA 5D4NA 1I51B 1YKWA 1VQNS 2NPIA 3DU6A 1WORA 2IM2A 1SUQB 4C8YA 1Y10A 1E6VA 2IPOB 1H2VZ 1F9FA 1S59A 4OJ3A 4ZCMA 4ZVUB 4O4RA 4LF5J 4O3QA 3T9NA 4DFKA 1X0FA 1HYSA 2J8AA 3G96A 2YPYA 3NNHA 5IWAF 1RWVB 4HACB 1PO6A 4LFCF 1D09B 3FJ2A 2JFDA 5IV3A 5HMYA 4B3RF 3MFIA 5HP1B 2Z2ZA 2WRMA 1FXRA 1NK9A 4I67A 1KS2A 1S6PA 5F8MA 4DQQA 2XYPB 3Q23A 3PJXA 1SXLA 4ZHRB 3OTEA 3DXSX 4DX8H 4ZJQA 4NA1A 3NMRA 2KG0A 1CJKB 3IP0A 3EZOA 3FMBA 5ETLA 2DNGA 5KFMA 3GJTB 2BEFA 1VIOA 4KFBB 1BQMB 3UE2A 1TK0A 2BBEA 5HK4A 3DI6A 3M9MB 3DRXA 3KK3B 3GFYA 1NPPA 2HG4A 1F6TA 1UTAA 2DGSA 4JI1F 2AU0A 3IA0A 1WEYA 3CPWR 2IA6A 1ZA2B 1JB0C 3EZ5A 1EQMA 1S9GB 3A4TA 3I0SA 2N7CA 1TP7A 4N8NA 1O6XA 3DOMB 4E0DA 2UXBF 4OQJA 1H7WA 1JLAB 1I3OB 1RUSA 4W98A 5C7PA 2EFNA 2VKZG 1VQKS 4ZLPA 4B02A 2F9JA 1TKZA 4UUWA 3MF5A 3TVKA 4DL4A 1VRUB 3RRKA 4PCQA 4RW4A 5HI7A 1CJVB 2E44A 1H73A 5KFSA 4EBEA 1MMNA 4ALZA 4NI2B 4CQ1A 2W9AA 1FRKA 4LF4J 4X65F 2MSTA 5L1IA 1Q8IA 2P6SA 4QWBA 2V94A 1SQGA 5CD4A 4IFVB 1PBUA 5HJXA 4F50A 2WB4A 2ZWOA 5HROA 4GRSA 2JNJA 2MQOA 3C14B 4NZ7A 3I87A 4B08A 2V4JB 3QIDA 5FDLA 3QWUA 4MKAA 4O44B 1VQMS 1C4AA 1HNIA 4U7UD 2WHOA 2ZD1A 2XBPA 1RT2B 4K4VA 4RW7B 3BQ0A 1GNKA 4X4RA 3HSGA 2XSJB 1RE1B 3UCGA 1C2PA 1NLKL 1B0TA 4CM0A 2LQBA 4B9UA 1X4EA 3MR7A 4U8VA 3L3CA 3PV8A 4K2JA 4YP3A 2HHQA 3SSSA 5ETKA 4LF8J 4NCBA 3WX8A 5C2CA 1RT7B 3TQ1A 3GB0A 2IRUA 3FRZA 2RVJA 2ALYB 2A1BA 1IBKF 3FMWA 4ZP9A 3MZIA 3N79A 1FK9B 2U2FA 2W2MP 3BJYA 4DR5J 2H51B 2V4QA 3NKYA 3ONQA 3C6UB 1F1BB 2DRBA 4DUYF 3MPVA 3CCWA 5A8WA 2K3IA 2HRUA 1KQSR 2D3UA 1M1KT 2QRRA 1SIWB 1LWFA 1SJQA 1FWLA 3M6UA 2DH8A 1V5IB 2DR6A 1IKWB 4EZ9A 1OYEA 4X64F 1URRA 1R0CB 1OSDA 2GAHC 4NL5A 4M5DA 1Z2ZA 1M1HA 4OIXA 1PGZA 2MKHA 1QY7A 3TX0A 3ITHA 4FP9A 1XN9A 1BMQB 2QV6A 1F5AA 2P9GA 3OHAA 2EEYA 4PWUA 3KWMA 3NWGA 2VQFF 1I1GA 1LWEB 5C42B 3X1LB 2XM3A 2IJNA 1MSWD 3GYGA 2HMIB 4PPDA 2C2KB 2A2CA 5K8PA 3CF5Q 5KFXA 4DPXA 3UN5A 3OVAA 4V1Ak 1XBWA 1WJ9A 3M8QB 3CDEA 1HWJA 1LNQA 1WC0A 2YH0A 5KT2A 4DV1J 1TU0B 2MZRA 1HKAA 3HM9A 2DK2A 5F0UA 1XERA 2JEFA 2JHEA 3RR7A 4WK1A 2GQQA 3FBCA 3KLIB 3H5YA 3N6NA 4DV0F 2Q43A 4USVA 3OLAA 3FKBA 3RW6A 4DR7F 4ZVSB 4ED4A 5KFOA 2XGPA 1ZOTA 1T3OA 3AA8A 3ENWA 1S79A 2BJ8A 3M2VB 3PR5B 2OIHA 1XMQJ 4I7FB 3LO3A 5GAEU 3N0VA 3HVAA 2GQCA 3IRXA 1HBUA 3H59A 2V4RA 2MQLA 1X5TA 4WYWA 4P52A 3TW0A 1MU2A 3JAMU 4ED3A 3FEXB 4DBQA 3TANA 4DV6J 2Y1LB 4DV3F 2XMVA 1HNWJ 1YDLA 2B9WA 5GAHU 5AXLA 3LTOA 2R8KA 1Q1KA 3K7RA 5KFKA 4DLGA 3DLKA 2DD8S 1WOOA 3L7PA 1RAEB 2D1CA 4CO0A 2ZBPA 1B7FA 4JV5F 2DGWA 2DGQA 1FFWB 1C0UA 2OGUA 2B4OA 1CG2A 1QTMA 2E5LF 4N56A 1OY8A 1VFJA 2ERRA 3R3TA 2FJWA 1N32F 3AXKA 4OYIA 5T7LA 4DX5A 1YX2A 4S0MA 4LFBJ 2M8HA 3KK1B 1DLOB 1S48A 1NH7A 2YNGA 2CQ2A 4KHRA 4IUFA 2P9CA 2B8PA 2CPHA 2D74B 2O67A 2OSQA 4KTQA 4GMKA 5DZ7A 3T5HA 3RB6A 3R7SB 4C0OC 2ABYA 1TL1A 5KFAA 2FHOB 3JQKA 2DY9A 3T1YJ 2XLKA 4ED5A 2KI2A 4HR2A 3SCJE 4ZPAA 3CEDA 2GC8A 2VOOA 3C6TA 1L3SA 3PYGA 3KMSA 2WOMB 1DQ8A 4LF9F 3G4SS 2UXCF 4ZN3A 2GV1A 3W5XA 2DNLA 4F2SA 5G0RB 3PHEA 4ICLB 3K8VA 3SBMA 5D3GB 1I5OB 4WYLA 3N5FA 4Y2MA 1UVKA 5CYQA 4NRTA 2MHNA 1TMMA 5LJ5Y 5IWAJ
chains in the Genus database with same CATH topology
2VICA 2VJUA 2XMAA 4ER8A 2A6MA 2F5GA 2XM3A 2VHGA 2VJVA 2A6OA 2FYXA 2F4FA 2VIHA 2XQCA 2EC2A 2XO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VIC A;  2VJU A;  2XMA A;  4ER8 A;  2A6M A;  2F5G A;  2XM3 A;  2VHG A;  2VJV A;  2A6O A;  2FYX A;  2F4F A;  2VIH A;  2XQC A;  2EC2 A;  2XO6 A; 
#chains in the Genus database with same CATH topology
 2VKR A;  4LFC J;  3I56 S;  3HVT B;  3Q8P B;  1MNE A;  1H7X A;  2W2P P;  4B3R J;  5A8K A;  4YB1 P;  2XSF A;  3RZA A;  1WTF A;  4YDX A;  2F65 A;  3R5G A;  5L9N A;  1U09 A;  4LIW A;  1MN9 A;  2YKO A;  2MY7 A;  8AT1 B;  2CNK B;  1C1C B;  3LPY A;  2MQP A;  5AE3 A;  2V67 A;  3QIP B;  2DR7 A;  4PUO B;  4CLW A;  2C2N A;  3QBC A;  5JMN A;  1HBN A;  3CW2 C;  2E29 A;  3VAF A;  4L72 B;  4DZD A;  3OL6 A;  4F02 A;  2M9K A;  3Q8V A;  4YR0 A;  4DDF A;  4I6Y A;  2W8K A;  5J2Q B;  3CXC R;  3FSI A;  2LVW A;  5E33 A;  4CT9 A;  2QC3 A;  3SQG A;  4E2F B;  2CPX A;  2KU7 A;  3ZNJ 1;  4JI1 J;  1HW9 A;  4OZ1 A;  2PC6 A;  3BO3 A;  2R7Q A;  1S6U A;  4NCG B;  2YTC A;  5ETM A;  3GR0 A;  3BDE A;  1FD2 A;  3H0P A;  2H65 B;  2ZH5 A;  4TU8 A;  5K8O A;  4CZC A;  5LMN F;  4USK A;  4U96 A;  1WC4 A;  4OYO A;  3EDR B;  3PZP A;  2K06 A;  3E01 A;  3C16 A;  3CJ2 A;  5KFB A;  4WFB Q;  3C46 A;  2BM1 A;  3T5L A;  5KT7 A;  2B9E A;  2CQG A;  2GVD B;  3ZO7 A;  1WG4 A;  3WZ0 A;  1YRT A;  4CLF A;  5E41 A;  2DNR A;  1MWZ A;  4Y65 A;  4IOC Q;  2R2T A;  4C48 A;  2JFK A;  4X65 J;  4ECY A;  3PJ9 A;  3GJS B;  1GTE A;  1U26 A;  1WC1 A;  1IM4 A;  3FBB A;  3V4I B;  2LQJ A;  2JZ5 A;  1DY3 A;  1B3T A;  4RO0 A;  1BWE A;  1FA0 A;  2DYA A;  2ZH1 A;  2DR8 A;  4A46 A;  1PAU B;  4ID8 A;  4FPI A;  3BSO A;  4A8M P;  1FE4 A;  3W2V A;  3V6J A;  1BWV A;  1RA7 A;  4OMF G;  1SKW A;  2AGO A;  1RHJ B;  5JXS A;  1T9V A;  2GZO A;  1RHK B;  1U49 A;  2V8D A;  2RU3 A;  3UR3 C;  2XNQ A;  2LEC A;  1S7H A;  1RSC A;  1LW2 A;  4C3K A;  3ZXW A;  3TVY A;  4MTP A;  2OPR A;  4P2X A;  3G9C A;  4WZM A;  1OMS A;  5CYM A;  4XPE A;  1VRT B;  1JLC A;  2HNZ A;  2MSS A;  2H4W B;  2ZDO A;  2NUH A;  2HQC A;  1SV5 A;  1IXK A;  4USM A;  1S97 A;  2A18 A;  4M5N A;  3CD0 A;  1XK8 A;  1H98 A;  2WVE A;  3IBF B;  4ZVQ B;  2YNH A;  2HFU A;  4IG3 A;  1RZM A;  1VIS A;  1WC5 A;  1AA1 B;  1RAA B;  1XNQ F;  1HYS B;  3FBF A;  2AF6 A;  1IBK J;  1W25 A;  1RHU B;  2ZBR A;  4QQB A;  3R5J B;  4X4O A;  3UCU P;  3G6E S;  5IXU A;  5KFF A;  2XMJ A;  1S4F A;  3BR8 A;  3IBC B;  3AOC A;  1IWA A;  4IH7 A;  2ZOF A;  1K1S A;  3QWP A;  5BR8 F;  4HKQ A;  5B0C A;  1GMV A;  1JJC B;  3JYT B;  2ZJP Q;  5J1E A;  3CCJ S;  1FI4 A;  3Q89 A;  5L1K A;  2OEJ A;  3QPI A;  4QU7 A;  2RS8 A;  4RW9 A;  5JUM A;  4K7Q A;  4KKO B;  2FZK B;  3QSY B;  2WVC A;  3DI6 B;  4Q8E A;  4USU A;  3A8K A;  2MKK A;  2VB6 A;  2VQF J;  4LRC A;  3ZNU A;  4H4K C;  4PG7 A;  3T41 A;  2OMO A;  1FEE A;  4PEO A;  1G2E A;  3I0S B;  2MHE A;  2RSQ A;  3FSY A;  3MM6 B;  2HW3 A;  4WWS A;  4URG A;  2HHX A;  3R2D J;  2HGL A;  2VFT A;  1TKZ B;  2GMJ A;  2I38 A;  3K89 A;  1HMV A;  1H6K X;  3BRE A;  1N4L A;  4OI2 A;  3QT7 A;  4RW4 B;  4JB8 B;  2VV5 A;  3LAN A;  1VQO S;  3BGF A;  2P6T A;  2IM0 A;  4CLZ A;  2LCW A;  3AOA A;  3ZZZ A;  4HDG A;  4KGM A;  5DDO C;  2CZ4 A;  2B4U A;  2X3G A;  1U1K A;  4I1T A;  3KNA A;  4CI0 B;  1SH3 A;  4DV0 J;  3FFI A;  2OPQ A;  1X8D A;  3HP6 A;  3ADA C;  3TOQ A;  4XK8 C;  1ELO A;  3DXB A;  2KL8 A;  4RUC A;  4CO5 A;  2W7P A;  2EC2 A;  1RHM B;  2W4C A;  4ZP6 A;  3OT9 A;  4GVL A;  2AW0 A;  2ROE A;  3TAR A;  2ZHO A;  2NUU G;  4O3R A;  4AD6 A;  1FWP A;  3QT8 A;  5FDL B;  3LW5 C;  2F8M A;  3FVY A;  1J5E F;  5F8G A;  1Y0H A;  2DIV A;  2H3E B;  2DNH A;  3A8J A;  2VH7 A;  1RTI A;  2VBW A;  5CD4 H;  4UZB A;  5B7W A;  4DV3 J;  4EO8 A;  3MMC A;  1NJX A;  4LRB A;  1KTQ A;  5DGA A;  3QAT A;  3M9O B;  1C1B B;  1JLQ A;  4JV5 J;  2YKN A;  1N6Q A;  1O51 A;  5EGY A;  3AB4 B;  2KO1 A;  4TKT A;  2E5L J;  2MPU A;  4OX7 A;  3NAI A;  3HPO A;  4OYB A;  1N32 J;  3DKD A;  3MM9 A;  4LF6 F;  3MMJ A;  4DN0 A;  2YKP A;  1UAW A;  2CJQ A;  3BSA A;  2F5G A;  2X3D A;  5I3U A;  4NLU A;  2LMI A;  1NK4 A;  3B54 A;  2HLU A;  3BKF A;  3O8W A;  5E2Q A;  5A8W B;  2W01 A;  1WF2 A;  2J9D E;  1SJ3 P;  3WX4 A;  3M6V A;  2FGC A;  1LWF B;  4ECQ A;  4B9M A;  2A0F B;  4ZPT R;  2UUW A;  4LRF A;  3GIR A;  1F5B A;  1EJ7 L;  2OD6 A;  1A0O B;  3K5M A;  4FF2 A;  3IBW A;  5H1S V;  1K1Q A;  3R27 A;  3UPF A;  2BA9 A;  4KV8 B;  3LGH A;  3F56 A;  4N47 A;  4LF9 J;  2UXC J;  4ZPC A;  5CCM A;  4QR2 A;  3OL9 A;  3ITH B;  4RWW A;  2DHX A;  3D1O A;  3QFH A;  4P10 A;  1Q5V A;  3BYP A;  4OL8 A;  2CG8 A;  1Q8L A;  3GJR B;  4C11 A;  2C3U A;  5DZ6 A;  2ZH7 A;  4LBI A;  1K9M T;  2NS1 B;  1RTD B;  1MWY A;  4ZP8 A;  4M5J A;  1LK5 A;  2F3J A;  2FDN A;  3H4B A;  1PCA A;  2CPJ A;  3HKW A;  4DMZ A;  3W65 A;  2VUG A;  3VV2 B;  4KB7 A;  2YX4 A;  5A0Y A;  1FX4 A;  4RU2 A;  1UET A;  3G8Q A;  1F60 B;  3FQL A;  4UOH A;  5F8J A;  1FCA A;  3JXO A;  3MEC B;  1HD1 A;  2KYX A;  2LEA A;  2AEF A;  3PX0 A;  3OLB A;  1NK8 A;  5IS2 A;  4J5O A;  4DV5 J;  3CCR S;  5HN0 A;  1RWW B;  3KJQ B;  2VPW B;  1ARO P;  1JX4 A;  4OI1 A;  3AH6 A;  5D77 A;  2IAJ A;  1RT5 A;  3KYL A;  1HBU B;  2VQE F;  2BE7 D;  1DTQ A;  3LAL A;  3KTQ A;  5KFP A;  3VGS A;  2MZ1 A;  3FBE A;  1X9M A;  5FII A;  1MU2 B;  5L9X A;  3KDO A;  5LMN J;  5H9F J;  2K1R A;  1JJH A;  1R6Y A;  2BKO A;  4G1I A;  4OX8 A;  4NYZ A;  3GTY X;  2W2Q P;  4MK8 A;  1GQE A;  4PZV A;  3NCR A;  4BWM A;  4A8W A;  4YN3 B;  4URQ U;  3DLK B;  1XR5 A;  3G82 A;  3TQE A;  1K73 T;  3O44 A;  5J1P A;  5KAK A;  4F8R A;  4ILL A;  3OTC A;  2R8H A;  1C0U B;  5KG6 A;  1N8R T;  1U6B A;  2GS8 A;  2EI5 A;  1N5S A;  1YK9 A;  3DOK A;  2HHW A;  5AE2 A;  2BQR A;  4P2M A;  4NZ0 A;  1N5T A;  3TAQ A;  5T7L B;  1FTR A;  4DR1 F;  4QWA A;  2F8H A;  3KFW X;  2DGT A;  4HVZ A;  4K50 A;  4ZVE A;  2GIQ A;  3OTB A;  3KNG A;  1F2H A;  1YJT A;  1LEO A;  2YNG B;  1RBA A;  1ZM3 A;  2JRS A;  1UJ6 A;  2N3O A;  1TZ0 A;  5GMD A;  1K47 A;  2BOP A;  5ETT A;  5BYR A;  4A8F A;  2KXH A;  1IBL F;  3MR5 A;  2B56 A;  3T6J A;  1TL1 B;  4BWJ A;  2YXL A;  4LR8 A;  4R5P B;  1OY9 A;  1VIX A;  4U95 A;  2AZ3 A;  4OHV A;  4B9N A;  1FTC A;  2C3P A;  2DB1 A;  1UW9 A;  1D8Z A;  3C6T B;  4PAB A;  2HWI A;  3MPD A;  1VC0 A;  2CPF A;  1JLG A;  2VON A;  2GJI A;  1T0T V;  3R6G B;  1Q8B A;  2GHW A;  1ZM9 A;  4USH A;  2EBG A;  2G0I A;  1KOO A;  5CYQ B;  4IRD A;  5BXI A;  2RRB A;  3HT0 A;  4IG0 A;  1XNQ J;  1R8C A;  1B0V A;  4OYX A;  3R1H A;  2FZC B;  4Q7A A;  2HBR B;  3EE3 A;  5IQQ A;  4WP9 A;  4OYA A;  3M8S A;  4EYH B;  2LXI A;  2PMH A;  3O1L A;  2Z2Y B;  1UWB A;  3D0G E;  5A8K B;  1UL3 A;  1BQX A;  3L7O A;  3BGL A;  4Z37 A;  5JJB A;  5I42 B;  2AHO B;  2V6A A;  5BR8 J;  1X4D A;  3T5J A;  5F8H A;  3GV7 B;  2V2V A;  3A8E A;  2HBZ B;  2IVM A;  1PBA A;  3NS5 A;  1FKP A;  3HSZ A;  4ES2 A;  4QPX A;  3BYR A;  3IR5 B;  3HT3 A;  1B99 A;  3GV5 B;  2CDQ A;  3QLH A;  2D9P A;  1LFP A;  4K4Y A;  3GV8 B;  4EK2 A;  2V5H G;  3HFZ B;  4HEA 9;  1U8W A;  2C2Z B;  3SQG B;  4TYA A;  3V6D B;  2LEB A;  3FUY A;  3PX4 A;  1HNX F;  3VGV A;  3P3D A;  3VAL A;  3GIK A;  4Q43 A;  4GVB A;  3TJ8 A;  4M63 A;  5LSO A;  3BGR A;  3KLE A;  1RI7 A;  2R7V A;  5ETV A;  2AV5 A;  4A8S A;  2FGO A;  2RB7 A;  1T9T A;  2XG8 A;  3TAM A;  3E01 B;  3UR0 A;  3C16 B;  4DI6 A;  3QQC D;  2R8I A;  4P9S A;  4LFA F;  4ETZ A;  4O3S A;  4FF1 A;  4WP8 A;  2AYM A;  5KFE A;  1IR1 A;  4PR6 A;  4CNZ A;  3V81 A;  2DT9 A;  2FIU A;  4NZ6 A;  3DLH A;  3DRP A;  3ISN C;  4FS1 A;  4CRJ A;  2H1Y A;  1UFK A;  2HND B;  4ZVF A;  3DU5 A;  2K8G A;  5ETP A;  3QJP A;  4Y34 A;  4NEZ A;  2OML A;  2AYG A;  4JI6 F;  5EDW A;  1HQU A;  4X4S A;  3KUH A;  2HKE A;  1VJW A;  3EJM A;  2DIT A;  1M5H A;  3U27 A;  3RBZ A;  4YY3 F;  1WF1 A;  3RUB L;  4E98 A;  2ZH4 A;  3BO2 A;  2QA1 A;  3MED B;  3VVU A;  3B6B A;  1RHR B;  1N34 F;  3PY8 A;  1J5E J;  1EHW A;  1CC7 A;  1SI9 A;  1U0S A;  2CPE A;  3AT1 B;  3PYF A;  1TV6 A;  2VG7 B;  3W63 A;  1QJH A;  4PG5 A;  4KQZ A;  3RG6 A;  5DG7 A;  1LW2 B;  5IM0 A;  5EWF A;  1FNM A;  5A2Q Y;  2IY5 B;  1X4B A;  1HWU A;  3D3B J;  1UEV A;  3G71 S;  5CZX A;  4MH8 A;  4F36 A;  3RR8 A;  5CYM B;  4NXN J;  1JLC B;  2HNZ B;  3CJ3 A;  3G8S A;  4F0M A;  4A8X A;  1HHQ A;  4H54 A;  3ET6 A;  3D0I E;  3CJR A;  3QGI A;  2G1H A;  1S76 D;  3UWT A;  5T41 A;  3X3U A;  1VQL S;  1LK7 A;  2UP1 A;  2YNH B;  1GXL A;  4M5G A;  2DIU A;  3OR2 A;  1JLF A;  2B5J A;  4IG3 B;  3VZI A;  4G3I A;  3RAM A;  1KFD A;  3UDC A;  3DDI A;  2RQM A;  3OTO F;  3PFE A;  2JEI A;  2J9D A;  3FEZ A;  2QGF B;  4TU7 A;  3OL7 A;  4LF6 J;  2R2R A;  1VCT A;  4P74 A;  2OH2 A;  2QE5 A;  2MGZ A;  4WII A;  3CVK A;  1S12 A;  1PYO B;  4DPU A;  3PEJ A;  4LSZ B;  2RKI B;  4MAK A;  2BZ2 A;  2QLW A;  3N4W A;  3I96 A;  2UV8 G;  3DOL A;  4X62 J;  5A8R A;  2UUC F;  1Q7L B;  1FXD A;  2RQC A;  3RB0 A;  4OHY A;  1R8P A;  4TQS A;  1SQE A;  2BV3 A;  4KR0 B;  2G13 A;  2E5J A;  2EKN A;  4NMX A;  4F25 A;  4KAI A;  4HHH A;  1ZZF A;  4OV6 A;  1WEX A;  5B08 A;  3OSN A;  4NLR A;  1U4B A;  1WKL A;  2F4V F;  4WP3 A;  4RW9 B;  2FPH X;  2WBM A;  3DDN A;  2ZBQ A;  3H98 A;  3ELH A;  4Q45 A;  3QMQ A;  1H2T Z;  4RBT A;  2B3T B;  3Q0A A;  5GMK a;  3QGP A;  2HIY A;  5F8I A;  3D68 A;  2ZJR Q;  4DL7 A;  3OPK A;  3U1L A;  2IBK A;  2BW2 A;  1SVD A;  2HFN A;  3GII A;  3EXY A;  1DAX A;  3W60 A;  2DNO A;  2DH7 A;  3ZZO A;  5HQ8 A;  3EYZ A;  4GO5 X;  1FVQ A;  4YUD A;  1FDN A;  1IQZ A;  4J9Q A;  4B9T A;  2HZC A;  3S7R A;  2EFG A;  1NB7 A;  1VS3 A;  4F4W A;  5HO4 A;  4C8N A;  3BPD A;  1BD6 A;  3D0H E;  3ILJ A;  2HLT A;  2YNI B;  4QYR A;  3TA0 A;  3SEO A;  2VG5 A;  2XEX A;  5KOW A;  2EXU A;  2EBE A;  3KMQ A;  2GQ2 A;  7FD1 A;  2F9D A;  2WZ1 A;  3DHW C;  4DOZ A;  3FFI B;  4TLR A;  2OPQ B;  4J9L A;  2Z0G A;  2E1A A;  2I1R A;  3ENQ A;  1P6T A;  2AMC B;  4YQW A;  1VGY A;  3H2U B;  3H8Y A;  3I9Z A;  4KBI A;  3T1A A;  1YJR A;  3G87 A;  3HX9 A;  3K17 A;  2HK3 A;  2FVC A;  4K59 A;  3H7H B;  1UFW A;  3LWL A;  1RJJ A;  1RU1 A;  2CWK A;  1X4C A;  1RGV A;  2QFI A;  2LYV A;  4F3Q A;  1JIH A;  1HI8 A;  2Q66 A;  3L7U A;  5ETN A;  4QIE A;  2H9Z A;  1RXO B;  3VVT A;  3H5S A;  3I0R B;  1FVS A;  3MUM P;  1N88 A;  1IKX A;  1GTH A;  3KJF B;  2KT3 A;  1U24 A;  3IM8 A;  3J7Y U;  3E51 A;  3GU0 A;  1WOS A;  1JLQ B;  4X4P A;  2CAJ A;  3TUI C;  5J2M A;  2YKN B;  1N6Q B;  2QSW A;  1N0U A;  4X4Q A;  4I6A A;  1HI1 A;  2ZVS A;  2X1G A;  2QL7 B;  1TUG B;  2AT1 B;  2LDI A;  1WWH A;  3NG8 A;  2AKW B;  4W92 B;  4RJV A;  1VBX A;  2E1M C;  4DR1 J;  2DBB A;  1REV A;  2EFV A;  5I3U B;  4QPT A;  2GIR A;  1I6J A;  4Q8F A;  1IBM J;  1RB0 A;  4A8Y A;  2O01 C;  9ATC B;  1BC6 A;  4NRU A;  4LF7 F;  4PYA A;  2PFF B;  4ETX A;  4OZN A;  4NLY A;  1R0B G;  4ZVT B;  2FJV A;  3PIO Q;  1IBL J;  1P1T A;  2YVS A;  3MDF A;  1ZM4 A;  1VK3 A;  4CCH A;  3H4D A;  1WC3 A;  4HT7 A;  2J6U A;  2KVQ E;  1N5Q A;  4OI0 A;  2FYX A;  5DLF A;  3VGT A;  1S1T A;  2O66 A;  3DLE B;  4M94 A;  1UEK A;  3NGD A;  4HI2 A;  4LMZ A;  2ZC3 A;  4AXI A;  4LQ3 A;  2W7O A;  3HCX A;  4C11 B;  4ZCI A;  2GJ2 A;  1QAY A;  1WOP A;  1U7L A;  1G1X A;  3DNC A;  2D3O 1;  4WTY A;  2QYG A;  3W9J A;  3CC4 S;  2HHH F;  2QJ3 A;  4DR2 F;  1HNZ F;  4X4N A;  2M52 A;  5E3C A;  2OI2 A;  5A0Y B;  2AZ1 A;  3POT B;  2J0X A;  4DS5 A;  2MKS A;  3EDQ B;  1HHS A;  2DTJ A;  1KLN A;  3IAS 9;  4DL2 A;  3MAQ A;  3FCW A;  3JSR A;  5IC4 B;  3DCA A;  4NLP A;  4B9V A;  4KHP F;  4RL1 A;  3MEE B;  3AB2 B;  4WCE Q;  1YTY A;  3W66 A;  2HS3 A;  1ICE B;  1GAO A;  5KFR A;  4C8M A;  4Q5V A;  3GFZ A;  3VR1 A;  2W4D A;  4OZ2 A;  3K0J A;  1NZA A;  2DPI A;  3AA9 A;  1U6Z A;  3GZ7 A;  4ED1 A;  1X5O A;  1KQG B;  3KJN B;  2K3K A;  3KJV A;  2IAJ B;  3CJ8 A;  1HNX J;  4FXD A;  3OD2 A;  1RT5 B;  2FHJ D;  3MUT P;  1B64 A;  1DTQ B;  4EWT A;  4ITS A;  3KK2 A;  2D9O A;  4ZP7 A;  1NKB A;  3J80 U;  3PJW A;  2VPY B;  2DJW A;  2K1R B;  3AD9 C;  2HS4 A;  5DDR C;  1FRI A;  4EFA C;  4LFA J;  4JI0 F;  1KQK A;  3CUL A;  4IQM A;  4HH1 A;  3DC2 A;  2KRR A;  2V9K A;  4K4T A;  2A3J A;  2ASY A;  2ZUG A;  2EW9 A;  1N5V A;  2QA4 S;  2Q1L A;  2WSC C;  2LU2 A;  3AD8 C;  4V19 X;  1YSJ A;  3DOK B;  4XTT A;  2A6M A;  4RPF A;  1Z2L A;  5KTQ A;  2J7K A;  2DEJ A;  2R7R A;  2R4F A;  5J1N A;  1SC4 B;  2QMU B;  3EXC X;  2ADB A;  1ZZN A;  5KG7 A;  1EQ0 A;  2MQ8 A;  3OR1 A;  2E7W A;  5F3Z A;  2O3D A;  5LOQ A;  2W9B A;  2UV8 A;  2MJN A;  4DF4 A;  1WNE A;  1M5K C;  4PRF A;  1N34 J;  2DXF A;  4O4G A;  4M8L A;  4I56 A;  4JI4 F;  2JX2 A;  3IWL A;  1NH8 A;  2DEI A;  2XLI A;  2ASJ A;  3ZZR A;  2GO9 A;  2QYC A;  3R5D A;  3LP0 A;  3LGN A;  2BOA A;  2FLL A;  2UUA J;  2AJQ A;  4JI2 J;  4EMD A;  2RDI A;  1UA1 A;  1P8G A;  2K2P A;  3RAQ A;  4DV4 F;  1XMO F;  2DNM A;  3QO9 A;  4OI6 A;  4ZPV R;  2FZG B;  1MN7 A;  1KOH A;  3FSX A;  3HZG A;  3EZU A;  8ATC B;  3ZTO A;  3HSJ A;  2UVU A;  3RGI A;  1YJ7 A;  2W2N P;  4IG0 B;  2AEM A;  5KFC A;  4P2F A;  4IRK A;  2RF2 A;  1FER A;  1PJ6 A;  1KN6 A;  3OTO J;  1NJI T;  4J9V A;  4QWC A;  3H5U A;  4IRC A;  1L3U A;  1VRQ C;  4C9D A;  4LVN P;  4DV7 F;  2J9C A;  3PW2 A;  2DRD A;  2HHS A;  3W3S A;  3NS6 A;  2EG2 A;  4DZ6 A;  5I3P A;  5E3R A;  3P4U B;  3R7B B;  3RAX A;  2UUC J;  3C8Y A;  2CQB A;  2HK2 A;  4L73 A;  4Y3C A;  4A4J A;  4TY8 B;  1TAU A;  1K0T A;  5G4D A;  2E9T A;  2OJ3 A;  4FNH A;  5H9E J;  2L3M A;  1FKP B;  2LA4 A;  4N5S A;  1U1P A;  1RU2 A;  2KDO A;  2UVW A;  2CJ9 A;  2F4V J;  5DG8 A;  2Y8W A;  3CJ4 A;  3QLH B;  2BQ3 A;  3RU0 A;  3IWX A;  4WKY A;  2J6T A;  1N56 A;  1Q16 B;  3KLV A;  3EVM A;  4CH7 A;  1U2C A;  3LPE A;  3I5C A;  2OTJ S;  3CCZ A;  5HBM A;  3WQP A;  2HZV A;  3JQJ A;  2D7S A;  4B17 A;  4GVB B;  2XWX A;  4ECT A;  2Z58 B;  2JJ4 D;  1Q53 A;  1SH0 A;  3BGR B;  3KLE B;  3PX6 A;  3HHN B;  5D4P A;  1UPM B;  5D0G A;  4DFJ A;  3TAM B;  3IXQ A;  4C4W A;  3K57 A;  2J6S A;  3K2Y A;  1IR0 A;  4B3T F;  2MZT A;  3MUR P;  2FUG 9;  2BKN A;  5EX3 A;  1JK9 B;  1S0V A;  1XQI A;  2ZFH A;  3EGZ A;  1LOU A;  1GMU A;  3V81 B;  1WHV A;  1T8E A;  2WSF C;  4ENO A;  1SC1 B;  1LWC A;  4QW8 A;  2HQF A;  2KKH A;  2JVO A;  5EUH A;  2KXF A;  3NOC A;  3RRH A;  1KWM A;  4YB7 A;  2MLX A;  5CQG A;  2ZM6 J;  1ZET A;  1F9H A;  3PYE A;  4RR5 A;  1QLN A;  2X1B A;  3TVZ A;  3C3L A;  4A8Q A;  2MMY A;  4QBU A;  1TUV A;  3KLG B;  2Y1J A;  2HWT A;  2DHA A;  2BJE A;  2IIH A;  2Y3Y A;  2IMW P;  3JSM A;  3JAM Y;  1UMJ A;  3OVB A;  2EFP A;  1TV6 B;  1NND A;  1HWL A;  2V68 A;  2YWH A;  3CJS A;  1YBT A;  5H9F K;  1T95 A;  4QR0 A;  4Y0F A;  4J7C A;  4NLV A;  5IM0 B;  2HHU A;  3WC0 A;  3V6K A;  3OXF A;  3S6E A;  4A8O A;  2I8E A;  1OQ6 A;  4DCJ B;  3RYL A;  3ZTS A;  3I9V 9;  2NR0 A;  2QEX S;  1DHM A;  3TEH B;  3Q2S C;  1LW0 A;  1YIT S;  1J5O A;  4FYD A;  2MJU A;  4MKV A;  1W2I A;  2XGQ A;  1RT1 A;  2GAG C;  2XMM A;  2G2O A;  2VOD A;  4OYM A;  1M90 T;  3ET6 B;  1UJ5 A;  1VQ5 S;  1FT8 A;  2ZUA A;  1Q8K A;  3K5L A;  3OSP A;  1JLF B;  2B5J B;  1CJT B;  4D3G A;  1RCO B;  2VBZ A;  2QL9 B;  3T9Z A;  4NCA A;  3KG0 A;  3RBX A;  4HHU A;  1CJU A;  1OYD A;  3VZH A;  2BE2 A;  4ZIV A;  1Y9O A;  5D0E A;  3N28 A;  2GVZ A;  1BLU A;  4ZA1 A;  4BBY A;  1V3S A;  2EK6 A;  4WXW A;  4LF7 J;  1XR7 A;  2HQD A;  1FHT A;  1R7I A;  3DOL B;  5A8R B;  1TVR A;  2M8D B;  3MCS A;  4WPA A;  3CO0 P;  4ATN A;  1SJF A;  1V3Z A;  2CG4 A;  3D6T B;  2LLZ A;  1YHQ S;  5DM7 Q;  1TL7 B;  4F4Y A;  1X4G A;  1NKC A;  4F4A A;  3DLG A;  2ZKT A;  3CDB A;  5LSR A;  4ZIW A;  2HVZ A;  3NNA A;  4ECV A;  4ES3 A;  1IKV A;  3DGV A;  2CXE A;  1H38 A;  1R31 A;  4IOA Q;  5DJB A;  1XIQ A;  4BS2 A;  4R0E A;  2V2Q A;  4L75 A;  1XEZ A;  3RJM B;  3VF0 B;  4DV2 F;  2HFV A;  2L9N A;  2X1A A;  4C97 A;  5HLF B;  1GT8 A;  6FD1 A;  2B0G A;  2Z57 B;  1TL3 A;  3HD1 A;  1R8H A;  1HNZ J;  2CJY B;  1U47 A;  2CYY A;  4QJV A;  5M2P A;  3GCW P;  2D41 A;  3RB4 A;  3MFH A;  2R2S A;  1NZ8 A;  1SPB P;  4B3S F;  3MI7 X;  1B70 B;  5K5M A;  2LEP A;  2WVF A;  3C15 A;  4LSN B;  1Y4Z B;  1NPK A;  2BXJ A;  2R7X A;  4KHP J;  2VG5 B;  5ETS A;  4ZLL A;  1YI2 S;  2DCL A;  1AFJ A;  5CH7 B;  4PYD A;  5EX0 A;  1WD6 A;  4XDC A;  2O5D A;  2HRY A;  3CCQ S;  1DQ9 A;  3DRS A;  3MM5 A;  1T11 A;  3W1Y C;  2HFZ A;  3D28 A;  3P5T L;  3BF4 A;  1RWK B;  1R27 B;  1KC8 T;  2PMW A;  2MLZ A;  1O0P A;  2RRN A;  4ZK7 M;  3D6F B;  3LH2 S;  2HHP A;  4C8L A;  3SIP B;  3MM8 A;  4IOB A;  4JOU A;  5M2R A;  1FEH A;  3P6Y C;  5BYS A;  3BBF A;  4ZS6 A;  2CPZ A;  5LXY A;  3IMQ J;  3SFU A;  2DKO B;  2Q6B A;  1RYR A;  2DPJ A;  2VD3 A;  4G65 A;  3NXZ A;  2AJ0 A;  4IFY A;  3CD6 S;  1IKX B;  4OFZ A;  3I4P A;  1M1G A;  4L3N A;  3M1V B;  5F41 A;  4DL5 A;  1QSY A;  1VHF A;  2FVP A;  3PR4 A;  1T03 B;  1APS A;  4J9P A;  2MEW A;  1QUV A;  1X9W A;  3D1H A;  4URS A;  3CDW A;  3ETM A;  4LBH A;  1CSJ A;  1U48 A;  1IQT A;  3NEK A;  2HVI A;  2YY3 A;  2X1F A;  2B9Y A;  5HP1 A;  5KFZ A;  5DDP C;  1RAF B;  3IFE A;  3B82 A;  3QAU A;  3Q8Y A;  4C0H A;  5KFI A;  1ZAW A;  5JVH Q;  4TQR A;  2IHR 1;  3GMG A;  4I68 A;  5FLX U;  1NDL A;  4BC7 A;  5DG9 A;  5L1L A;  4QIG A;  4Y00 A;  1GX5 A;  3HJV A;  2LQ8 A;  2BRL A;  2KJV A;  1N33 F;  1KP6 A;  4KRW A;  2V50 A;  3P8B B;  4JI4 J;  3CJK B;  1EZZ B;  1NAQ A;  4H4O A;  4UZC A;  3NL0 A;  3V6H A;  2PT0 A;  3G6V A;  1OPZ A;  1VQ4 S;  3HHK A;  3HD2 A;  3TR5 A;  3ULH A;  1S1T B;  2I0X A;  2CQ4 A;  4H4M A;  1HQ2 A;  2UVR A;  2VOP A;  2L41 A;  2VBY A;  2WB1 D;  1JLA A;  2FY1 A;  4DSF A;  2EG1 A;  4OZ5 A;  1X5S A;  3G8T A;  4DL0 C;  1RAI B;  4RLE A;  3LP2 A;  4K4U A;  1YJU A;  4ED7 A;  1A9N B;  4DV7 J;  2H5J B;  4LRE A;  5C25 A;  1CJV A;  3I82 A;  2OPS A;  1X31 C;  4NI2 A;  4FF4 A;  1MRO B;  4CDI A;  3CJ0 A;  5EWG A;  2HQI A;  1FF2 A;  4OJ1 A;  1DQA A;  4YR3 A;  4EZ6 A;  3HFV A;  1DBD A;  1FFS B;  4LBP A;  1S1U B;  4F2R A;  4RKU C;  5IQ6 A;  2HFS A;  2KHD A;  4LSL A;  2WVD A;  1DJ0 A;  4JBC A;  5J2P A;  1KFS A;  4M5K A;  3QGH A;  2AYE A;  5C5J A;  4CTA A;  1U1L A;  1U1O A;  2HAI A;  5U47 A;  3VQT A;  1D9D A;  5I3Q A;  4EBC A;  4WXO A;  1F2G A;  1WHW A;  4IQX A;  2CFX A;  1RTZ A;  1S1V A;  1SC6 A;  4Q2M A;  4UST A;  4XIU A;  5HVH A;  2QA4 G;  1GMW D;  2OTL S;  4HTI A;  4K0K F;  4EUV A;  2XSJ A;  1LV5 A;  4QCL A;  3TUJ C;  1NRK A;  3PRB A;  3M2R A;  3BBB A;  3FEY B;  4QIW D;  2XYH B;  1R0A A;  2QMW A;  1NME B;  5ETO A;  1X4A A;  4DPO A;  4E8U A;  1S1X A;  2EWH A;  4B3T J;  2FVS A;  4W4M A;  4L74 A;  3LWM A;  1LXN A;  1X4F A;  4RNF A;  5HQM A;  4J9O A;  4ES1 A;  2YNF A;  4DFM A;  3R5A A;  2PA8 D;  2HHV A;  3BS9 A;  1FJG J;  1FK9 A;  2AX1 A;  3BZQ A;  3ENV A;  3CB4 A;  1GXU A;  3CGI A;  3ISN D;  1SCJ B;  2ALZ A;  3C6U A;  4AL7 A;  5ETR A;  2Y0S D;  3UW1 A;  2Z56 B;  1VHI A;  3WBZ A;  2BR0 A;  2MTL A;  1QAX A;  3TI0 A;  4CO1 A;  2PSZ A;  2W9B B;  5LL6 d;  4LR9 A;  4DL6 A;  4R8U A;  2EPI A;  3M2U A;  5LXR A;  3WIU A;  2E5I A;  2PI4 A;  1PJ7 A;  4FKX A;  3D2W A;  5D4L A;  2IRX A;  5KFG A;  3ZFV A;  4U6P A;  3BV8 A;  2M3D A;  1I94 F;  4Y2C A;  1SJ1 A;  2WAQ D;  4AUK A;  4ELT A;  5HAN A;  4DCO B;  3LP0 B;  3D1Q A;  4C7Q A;  2N4D A;  1EKR A;  1N5Y A;  2JSX A;  1YBA A;  5K8N A;  2QN6 B;  3P96 A;  2OKQ A;  3QO9 B;  4UUX A;  1NUE A;  4FXV A;  2IJF A;  2AJ1 A;  3CJ5 A;  2CQC A;  2XMT A;  5FJ4 A;  4ZCL A;  3SCL E;  3DRR A;  1FNX H;  1SC3 B;  4MK9 A;  3PM9 A;  2E9R X;  2RF2 B;  5THW A;  4R0J A;  4CT8 A;  3Q8R B;  2VC1 A;  3MMA A;  4UT4 A;  2IMO A;  4JUZ A;  1U1Q A;  3W64 A;  3PG9 A;  2BJ9 A;  2B6A B;  1IWG A;  1U2F A;  3EWG A;  4AXJ A;  1KBR A;  2VJU A;  4KJI A;  4LF4 F;  2H4Y B;  4YHH F;  3KLI A;  5F9L A;  3NCQ A;  1DUR A;  4PG6 A;  1BUX A;  3GE9 A;  4JI8 F;  3CCM S;  4OLO A;  1YRX A;  2GGP B;  3J7Z T;  4NLX A;  2GHV C;  2LQ5 A;  2AGQ A;  3W7B A;  4F3O A;  3NRB A;  2BQU A;  2OFH X;  2XC9 A;  5FD1 A;  1RT6 A;  3VGU A;  1NB2 A;  3GFX A;  1G7C B;  3ZZP A;  2EC0 A;  3GCX P;  3MUV P;  3TA2 A;  4IO9 Q;  5HBM B;  3BQ2 A;  8RUC A;  2QLF B;  2VHG A;  3QJJ A;  5AXK A;  4DV2 J;  2DNQ A;  1CUL A;  4HT5 A;  1TAQ A;  4YFU A;  1V9O A;  5KG3 A;  4I6W A;  3Q2T C;  5CAB A;  3FNN A;  4M5L A;  4FYW B;  4ZLJ A;  1KSP A;  2BM0 A;  2E1R A;  4FYV B;  1K0V A;  4X66 F;  1URN A;  3AOB A;  1Y7P A;  1W7W A;  4B3S J;  5E7O B;  3J7Y I;  5LM7 E;  3DGP A;  1JKH B;  2G2Y A;  2DIS A;  3VAG A;  2MKY A;  3JSY A;  2VPX B;  1LWC B;  2NLW A;  2FHJ A;  1RT4 A;  5CYJ A;  2YKA A;  3K5N A;  3TO8 A;  3TUZ C;  1QSS A;  5M2U A;  1N52 B;  4GKK F;  1PSD A;  2FHK A;  2I6W A;  2FQQ B;  2GNK A;  3G6X A;  3OFE A;  1WG1 A;  2LA6 A;  1CS4 B;  4Y2I A;  2UXB J;  4MYT A;  1IM6 A;  4ZPW R;  4OHX A;  4L76 A;  2CJX B;  1RTJ A;  3EVO A;  5D0R A;  3ZZ0 A;  4MFB A;  3NOG A;  4C8O A;  1QD1 A;  4NLS A;  3OFH A;  1VMB A;  2LKZ A;  4F0H A;  1FKO A;  1DTT B;  4DPT A;  3JSM B;  1EP4 B;  2NCK L;  2E9Z A;  1RAG B;  2IDE A;  1MG7 A;  3IGV A;  4USJ C;  4HH0 A;  4NXM F;  1IVZ A;  3Q83 A;  2GX8 A;  2JDJ A;  1HPZ A;  1QUP A;  3L95 X;  3QAE A;  5L39 A;  5KFJ A;  3ZZT A;  4CIO A;  3QZ8 A;  3Q8Q B;  1T9Y A;  2MKC A;  2DO0 A;  4C98 A;  2RUG A;  2VDH A;  3BH7 B;  2KXN B;  5G0R A;  5KG5 A;  2RML A;  4ICL A;  1D9A A;  1KTV A;  3FC9 A;  1J5O B;  1VLO A;  1LW0 B;  3UNY A;  1YJV A;  3PO4 A;  3CD7 A;  1RT1 B;  2O1P A;  3AHP A;  1Z1Z A;  3PO5 A;  1QVG R;  1UPP A;  2RS2 A;  2DO4 A;  5KFD A;  2R7S A;  3T1H F;  3N9U C;  3EMT A;  1AZS B;  3QRR A;  2APO A;  1R43 A;  4X4U A;  3OFG A;  3LA0 A;  5KT5 A;  2KM8 B;  4DQI A;  1HLW A;  3OW2 R;  5B0E A;  1CJU B;  3HFK A;  4DUZ F;  4QOT A;  1QAI A;  4FKY A;  3MXH P;  2ACY A;  2YBV A;  5L1J A;  2VA3 A;  2BE2 B;  1WC6 A;  2GMH A;  1ZA1 B;  5B0A A;  1C1C A;  1QVF R;  2UZA A;  1N33 J;  5HVG A;  1WEL A;  1VQS A;  1E6V B;  3I31 A;  1RAB B;  4IYQ A;  3LAK A;  1XC9 A;  2A6O A;  3PRV A;  4ZPD A;  3DLG B;  5CXT A;  2MDA A;  1XMQ F;  2N4C A;  2XWY A;  1IKV B;  2KJW A;  4IKA A;  3BKT A;  1FX2 A;  3D67 A;  4DUY J;  3OBI A;  3IRW P;  2AX0 A;  1M5S A;  4DLE A;  2CWX A;  3CO9 A;  4NA2 A;  2YH1 A;  1S6P B;  4OHW A;  1LWX A;  1HNW F;  4HHJ A;  4WBF A;  1NDK A;  4MIW A;  4FBU A;  1YIJ S;  1TL3 B;  4X64 J;  2HWH A;  4TVA B;  1X9S A;  4OI3 A;  4ZLN A;  4NYO A;  1TL5 A;  3QFW A;  1KR4 A;  2V8P A;  3FQK A;  3CC7 S;  2VIC A;  4UY8 T;  3IM9 A;  1UVJ A;  5KFU A;  2ASD A;  3C15 B;  2AJF E;  3CJQ A;  3SDE A;  4OJH A;  3V4I A;  4DQP A;  1M5P C;  3DRY A;  2K7K A;  3AQP A;  4GKJ F;  1N54 B;  2R9L A;  4J37 A;  1H0H B;  3RBE A;  5H9E K;  2B7C B;  3DRS B;  2KM8 C;  2ZIT A;  3MM5 B;  3PTW A;  2J7W A;  3GG1 A;  1KNZ A;  1MWQ A;  2YQ1 A;  2KVI A;  3OXG A;  2G4B A;  1CBK A;  1WG5 A;  2BKP A;  3RRG A;  3FDS A;  3G86 A;  1NM2 A;  4K0K J;  3T1Y F;  2MZQ A;  2XUL A;  3MM8 B;  5LMU F;  3DLJ A;  1F9E B;  4DG1 A;  3GPA A;  3RB3 A;  3MEG A;  2PGC A;  4CLP A;  3I6P A;  5F9N A;  1UZH A;  5DS7 A;  1VRT A;  3NGU A;  1OO0 B;  2KYZ A;  2MZS A;  5RUB A;  4RUB A;  3CCL S;  4PQA A;  2Y8Y A;  3NCP A;  2R3V A;  4ECZ A;  1OJ4 A;  2FJX A;  4CLK A;  4DR7 J;  4IFY B;  2XS7 A;  2XY6 A;  2V8H A;  2D69 A;  5GME A;  5HSP A;  1UVM A;  5HRO B;  3EPI A;  2UXD F;  1MMD A;  3JSB A;  1ZBT A;  1L3T A;  5ITH A;  2ADC A;  3GWC A;  4FBT A;  2G2Z A;  2I9S A;  2FD2 A;  1T9U A;  4N7T A;  5DQI A;  3A3O B;  2DNZ A;  4OX9 F;  5T14 A;  3H40 A;  1YQH A;  2OUG A;  4JV2 A;  3HHL D;  3EX7 B;  5DET A;  1WDT A;  1S99 A;  5GAG I;  1UP1 A;  1HNI B;  2SXL A;  3I32 A;  2VFV A;  3H2V E;  2ZD1 B;  3PIP Q;  2NPF A;  4WU3 A;  2U1A A;  3GYX B;  5GAD I;  3QGG A;  3T3F A;  1IUJ A;  4QYZ J;  3JYT A;  3GIM A;  2BRK A;  1BHN A;  4I69 A;  3P45 B;  4FVC A;  2BW7 A;  5KOX A;  3DLL Q;  3QSI A;  4CH0 S;  4H4O B;  1WTB A;  4GC7 A;  2ZDP A;  1RBL A;  4KKO A;  4ELV A;  4UOF A;  4DXL A;  1BQN A;  4EGL A;  1I94 J;  1Q95 G;  1EAR A;  1KD1 T;  2JOQ A;  2F7V A;  4C8Z A;  4FXW A;  2GHP A;  1AUD A;  1L3V A;  5SZT A;  1VLY A;  3DYA A;  2VG6 A;  4H4M B;  1NJY A;  2C1E B;  3UVJ A;  4KO0 A;  3MM6 A;  2BJ3 A;  2VFS A;  3BSC A;  1WF0 A;  4ZDN A;  4AT1 B;  2W25 A;  2HVE A;  2OFG X;  4OZL A;  3MEK A;  2V2K A;  4FNI A;  2FJB B;  1QM9 A;  3LP2 B;  3R1L A;  4PPZ A;  3K58 A;  1S72 S;  4DJB A;  3PKM A;  5C25 B;  4LIR A;  1TUW A;  2ZOG A;  3GG0 A;  4WKR A;  1WSR A;  4M5D B;  2J5A A;  2OPS B;  3F0N A;  1B7Y B;  2C42 A;  1UVN A;  4B9L A;  3SFG A;  1U1N A;  4YHH J;  1ZAV A;  1JLE A;  4YB6 A;  1D0E A;  1RLC L;  4JI8 J;  5C24 A;  2N3L A;  4ZCK A;  2ILY A;  1V5V A;  4PQU A;  4LSL B;  2CQH A;  3MGJ A;  5J2P B;  2KT2 A;  3TX8 A;  4CTA B;  1MLA A;  3VAH A;  4DR3 F;  1KRP A;  3PW0 A;  1GH8 A;  1RHQ B;  1HWK A;  2E1C A;  1KHV A;  4LJM A;  2MQQ A;  1S1V B;  3CD5 A;  5K20 B;  4ECW A;  2XZD B;  2I5J A;  1XWL A;  2LP4 A;  3SYZ A;  5KT6 A;  2KH9 A;  1QAJ A;  4P6Q A;  4A47 A;  1R3N A;  3I55 S;  2PII A;  4DQR A;  3M2R B;  3B4D A;  1HQE A;  3KHG A;  4M5M A;  4AND A;  1R0A B;  5F0W A;  3M7V A;  5HQL A;  1C1B A;  1AUS L;  3MAA A;  5IV4 A;  3J81 U;  1S1X B;  4C3M A;  4F4K A;  1O5J A;  2NRE A;  1N36 F;  4X66 J;  1XNR F;  1VQP S;  1CPZ A;  4J9S A;  3BSN A;  5DRK A;  5K8M A;  2YNF B;  1VC5 A;  3IC1 A;  1F3V A;  1J27 A;  3MPW A;  2YQ3 A;  3IRX B;  1M5O C;  3I5A A;  1Q78 A;  4XPC A;  5B09 A;  4DPW A;  1SKR A;  1JNR B;  1RT3 A;  1U0H A;  5LT5 A;  3BR9 A;  4GKK J;  4ER8 A;  3Q22 A;  3IS9 A;  3M8Z A;  3AJ2 A;  2PMZ D;  2Z8Q A;  1KEK A;  3A1Y G;  3E2E A;  2B8Q A;  2DGX A;  2AGP A;  1RK8 A;  5A6W A;  2CVE A;  4MIB A;  4AYB D;  1RIS A;  2P5V A;  1OWX A;  1F0X A;  1GK8 A;  4OYW A;  2HBY B;  1UVL A;  1MML A;  2JWN A;  3BN4 A;  3KLH A;  4PXB A;  4R8U B;  4BHQ A;  3R6L B;  2J0S D;  3M2U B;  1JXE A;  4NXM J;  2CQD A;  2EKY A;  4OZ0 A;  5HAT A;  2RQK A;  1RBO B;  1NHU A;  4CWB A;  2WW4 A;  1ZAX A;  1RLD A;  4U7U K;  2ASL A;  1R6V A;  4KV8 A;  3IG1 A;  3HHD A;  1T3N A;  2CQI A;  3U7J A;  2FC8 A;  1NSP A;  4BLG A;  4QWE A;  2FVR A;  3HKZ D;  1VI7 A;  1N5Y B;  4CYU A;  6FDR A;  4KGZ B;  3GIJ A;  1S77 D;  1RTD A;  4KT0 C;  4B9S A;  4MIA A;  3T1H J;  3MR2 A;  3K59 A;  2XMK A;  1D1U A;  1PIL A;  2PA3 A;  4RNO A;  2XY7 A;  3H42 A;  2J7U A;  5IT9 U;  5B0G A;  3DRR B;  2G1D A;  3A3N B;  4AE5 A;  3A12 A;  1KQF B;  2RDD A;  4FF3 A;  4K5S A;  3BEG B;  3KUG A;  2OPP A;  3H2L A;  3CCS S;  3NGK A;  4DUZ J;  3MMA B;  1HW8 A;  2V63 A;  3UQS A;  2YWF A;  5F8L A;  3MEC A;  2ATC B;  1AW0 A;  1IN0 A;  1YBU A;  3MMB A;  4FYY B;  4JP8 A;  3CME S;  3LAM A;  1NK6 A;  5KFH A;  1CLF A;  1PYS B;  1TTH B;  2P9E A;  3MWB A;  3CCV S;  3ETO A;  5B0F A;  2RUS A;  4QU6 A;  2M4M A;  2FLP A;  2ROP A;  2C2E A;  4CO3 A;  4FZV A;  2ZKU A;  3QT6 A;  3JTO A;  5KFN A;  1RT6 B;  2JL9 A;  2RIJ A;  4CO2 A;  3TWZ A;  2RQ4 A;  1FRH A;  3FZB A;  2B4P A;  1S0M A;  4UOC A;  1BE4 A;  3C66 A;  2NXU A;  1CUL B;  4ANE A;  1VK8 A;  4J9K A;  4K2X A;  1RAO A;  2PD1 A;  1HBN B;  4MK7 A;  2PE8 A;  4DQS A;  2C22 A;  3DDK A;  1SL2 A;  2D3O R;  1NK0 A;  1EX8 A;  4KC5 A;  3B4M A;  3OHB A;  4MKB A;  1EB0 A;  1WUU A;  3DGP B;  4ZOS A;  1GMW A;  2EFO A;  3IO1 A;  1RT4 B;  3PKY A;  3GSI A;  4GKJ J;  3CC2 S;  4DUT A;  2YKM A;  1IJF B;  1NJZ A;  4HLB A;  1TFY A;  1YG0 A;  2QLJ B;  3BH6 B;  3WHI A;  2RDJ A;  2YWG A;  4IH6 A;  1K8A T;  1FWK A;  4ANC A;  3KDN A;  1YWX A;  2NYH A;  1NU4 A;  4I2P A;  4OYP A;  3D7S B;  3VAK A;  1RTJ B;  2HYI B;  2CKW A;  3MR3 A;  4MFB B;  3TUP A;  2JLG A;  1ZS6 A;  2MLY A;  3NY0 A;  4YB5 A;  4I2Q A;  1FKO B;  3J80 Y;  4R5P A;  2ZOM A;  5LMU J;  3MCO A;  2CA9 A;  1NSK L;  4ZVH A;  1S9E A;  2ILZ A;  1HPZ B;  5HL7 Q;  4FN5 A;  2HPU A;  2QZ8 A;  3D66 A;  2CRL A;  4Y2K A;  3NP5 A;  3TEG A;  3KHL A;  2COL A;  2ZZT A;  3THT A;  4G1P A;  1CQN A;  5DDQ C;  2UXD J;  1RWU A;  4F3M A;  4HTJ A;  4FS2 A;  1FKA F;  4TNO A;  1T05 A;  1ROF A;  1U02 A;  3RBD A;  4PWD A;  4OX9 J;  1ITP A;  3KKF A;  3W2V B;  2LFV A;  3THP A;  2CAD A;  3PXG a;  1XMB A;  4O23 A;  5IFM A;  2M0G B;  3V2U C;  3D5M A;  1WHX A;  2DGV A;  4ZKA A;  2HNY A;  3N5B A;  4J9U E;  3N6L A;  2J0W A;  1HL6 A;  1JNZ B;  1YVF A;  2OPR B;  5I42 A;  4N77 A;  1ACM B;  3MHY A;  3BGU A;  5F8N A;  3CSK A;  2JEG A;  4K4Z A;  3CDU A;  2FLO A;  4MMO A;  1Y00 A;  1UVI A;  5EHH A;  2XTJ P;  4WE1 A;  4DV5 F;  1SV5 B;  3CTR A;  2CQ1 A;  3R5B A;  2G0C A;  2RD5 C;  3PAC A;  1Q81 T;  2XZW A;  2MYF A;  1GX6 A;  3HVR A;  2VFU A;  1Q7Y T;  2JC0 A;  5HMZ A;  3V6D A;  3MD3 A;  1N0V C;  1BGX T;  1TQL A;  3LF0 A;  4RWX A;  2XI2 A;  4L6V 3;  1FJC A;  2ZH3 A;  3BB5 A;  3EIC A;  3Q8S B;  1P9Q C;  1YLX A;  3C19 A;  4ID5 A;  3CIZ A;  1L3K A;  3NNC A;  4EI2 A;  1EIY B;  2ZC4 A;  4RW6 A;  5I4M A;  1A6L A;  4K4W A;  4ZVP B;  1SL1 A;  5J1E B;  5K14 A;  1ZPV A;  1T9X A;  3UO0 A;  3P49 B;  2Z4P A;  3OUY A;  5B0D A;  4G1Q A;  3NMA A;  1ULR A;  3L09 A;  5J2N A;  2C28 A;  2HND A;  4Y28 C;  3BPS P;  4RBU A;  2HZA A;  1SIZ A;  1QTN B;  2DGU A;  3HJF A;  1T02 A;  3SDE B;  1D8Y A;  1SJR A;  2HVH A;  1VOM A;  4UF4 A;  1TK5 A;  4MKY A;  3M05 A;  1HBM A;  3GYN A;  4DR3 J;  3MED A;  3UDL A;  4J91 A;  2OD4 A;  1WI8 A;  2VC0 A;  2PN6 A;  2ROG A;  2QIF A;  2VAS A;  1HMV B;  3OJS A;  1D9F A;  2VG7 A;  3BN7 A;  4LR7 A;  3EGN A;  4XDD A;  4DG1 B;  3MEG B;  1U6F A;  2R8J A;  3MM7 A;  4F04 B;  2R7T A;  3V5R A;  3QYY A;  4DSL A;  3MCN A;  3SMZ A;  1N36 J;  4USW A;  1XNR J;  2YWE A;  4D3H A;  2XYG B;  4F7V A;  2XY5 A;  1VYA A;  2ZE2 A;  2AQ4 A;  1RCX B;  4K4S A;  3NBP A;  2DHG A;  3KUE A;  3TP2 A;  5KG2 A;  4WJB A;  3ZTQ A;  2VQE J;  2VU5 A;  3MTJ A;  4Q2L A;  3HI9 A;  2RJZ A;  4KH1 B;  3T5K A;  2ZWP A;  2AWZ A;  4ELU A;  1HBO A;  4ZPB A;  2RKI A;  1HA1 A;  5DQG A;  1RTI B;  3P5B P;  2OEM A;  1S57 A;  1S5Z A;  2FHM A;  3OVS A;  3CDA A;  3SV4 A;  3MMC B;  1OSC A;  4F4Z A;  4EEY A;  2WON A;  1NSA A;  1YJW S;  4NLO A;  5DQH A;  1P9Y A;  1HFE L;  2Y0B B;  1FNO A;  4ILR A;  1PAE X;  1RAJ A;  4NML A;  2HAF A;  4UTG A;  3DMJ A;  4NX9 A;  5F3T A;  4DSE A;  3LP1 A;  1YZ6 A;  4I64 A;  1S7I A;  3KG1 A;  4C3L A;  5C2G A;  1NHK L;  2G9O A;  4LF1 A;  1BQN B;  1YGY A;  5DM6 Q;  1FDA A;  2YWK A;  4WFX A;  3MM9 B;  4NLD A;  4Z7C A;  3QRP A;  2DXD A;  2KT5 A;  3DYA B;  3JTN A;  2VG6 B;  3D6H B;  5IT0 A;  3UVJ B;  1SJ4 P;  1RWO B;  5D4O A;  4KO0 B;  1BXN A;  4P7V A;  1UZD A;  2EK1 A;  4K4X A;  4ZVG A;  2A2D A;  3H5X A;  4UW2 A;  4Q0B A;  3IN5 A;  5MAO A;  3I4H X;  4LVO P;  1Y3J A;  2IC3 A;  2YNI A;  3HDS A;  3UD5 A;  2N7Y A;  3BGO P;  3L4B C;  4LRA A;  3OQ2 A;  1RDR A;  2KHC A;  1YRU A;  4QR1 A;  3U1N A;  3PDN A;  2JVR A;  1JLE B;  2ZHB A;  4P72 A;  3PYD A;  2VPZ B;  1IR2 A;  4O0I A;  3PW5 A;  2CZ9 A;  1VQ6 S;  4NAS A;  1X4H A;  4NYP A;  5C24 B;  2MB0 B;  4PQU B;  2M2B A;  2Y9H A;  2NXN A;  2VL1 A;  5AJ3 F;  4P2S A;  3GIL A;  2LDY A;  1UW4 A;  1V6H A;  1VDH A;  4DWI A;  3F44 A;  4KPY A;  2PEH A;  1TMJ A;  2W1B A;  2A10 A;  1QE1 A;  1HNV A;  3NLC A;  3W8P A;  4WIQ A;  1M0S A;  2ACM A;  2I5J B;  4M5H A;  1FO1 A;  5K9F A;  3M8W A;  5IZH A;  4RW8 A;  3EUN A;  4F67 A;  1SQF A;  3AD7 C;  3I0R A;  4DU7 A;  4ECX A;  3T6B A;  1HQE B;  3K8W A;  4ERD A;  4NXN F;  2XCP A;  2J76 E;  2H5I B;  4PWW A;  3CWJ A;  3MAA B;  2FY8 A;  1KLM A;  4JI5 F;  2ZNY A;  1H74 A;  4U8Y A;  1XR6 A;  2C2R A;  1S49 A;  1YJ9 S;  2R7U A;  2R7W A;  4WFZ A;  4WFY A;  5L38 A;  1F3F A;  2ZZN A;  4UQT A;  2BAN A;  5IOL A;  5DGB A;  4QZV B;  4ZJL A;  3EGW B;  3HUL A;  3WDO A;  2FB0 A;  2YPZ A;  2IVF B;  1H3D A;  4A48 A;  4YEA A;  2WBR A;  1RT3 B;  1U0H B;  1HD0 A;  4OHZ A;  3ZTP A;  4EBD A;  3IS9 B;  4KGX B;  3Q24 A;  2E5H A;  4L3K A;  4XO0 A;  1BY9 A;  3QZ7 A;  4ZN1 A;  5KG0 A;  4X62 F;  3NWR A;  4O3P A;  1LQ9 A;  4CLL A;  4MJK A;  4GC6 A;  2ZJQ Q;  4U9R A;  2KG1 A;  3KLH B;  4F0K A;  3G82 B;  4WZQ A;  1FRJ A;  3ILL A;  2RH3 A;  1FJE B;  5GVQ A;  5ETQ A;  3VAJ A;  3DN9 A;  4G6V B;  4CLT A;  2P8I A;  1NSQ A;  3HHL A;  3IG1 B;  3ZTR A;  4CM2 A;  3DLE A;  2EVZ A;  3W5Z A;  2Y1R I;  3GLJ A;  3M8R A;  2CPI A;  4JI6 J;  2IM1 A;  5DLG A;  5KFV A;  4CYU B;  4O0N A;  3W9I A;  2HFO A;  4GO7 X;  4KHM A;  4YY3 J;  4X4T A;  3OXL A;  2H48 B;  1FE0 A;  1KHW A;  2RU9 A;  1NJW A;  1VQ9 S;  1Q79 A;  4U7C A;  1NCL A;  1FFG B;  7FDR A;  2OPP B;  4DS4 A;  1UWA A;  3POT A;  4YDD B;  5FLX Y;  1ZYQ A;  3O2I A;  5KT4 A;  1TFW A;  4RNH A;  2R7O A;  3SCI E;  3K5P A;  3CT9 A;  5KFY A;  4WFN Q;  3AQO A;  5CCL A;  3TJA A;  1HHT P;  2GO8 A;  3MEE A;  4JI7 F;  1R8B A;  1JLG B;  3MMB B;  4QYZ K;  1FES A;  5HAO A;  4CNY A;  3FK4 A;  2QMX A;  2NSB A;  2JLF A;  2ATL A;  1WDD A;  3CUN A;  2GA7 A;  2M7S A;  5GAG U;  3G6Y A;  1V3R A;  3OFF A;  4IR9 A;  3A13 A;  2XQC A;  2UVV A;  2AD9 A;  5E3P A;  5MLC V;  3SSR A;  5GAD U;  1IKY A;  4FVM A;  2AEJ A;  4PAA A;  2OEK A;  1RAC B;  2NYI A;  3JQM A;  1UWB B;  1JXV A;  5ADZ A;  1NXI A;  1JLB A;  2DNK A;  4IR1 A;  1JMT A;  3HK2 A;  3MTK A;  1DAR A;  1U8S A;  3EGV A;  4HDH A;  3SQO P;  3N01 A;  3QNW B;  5HJY A;  3A8I A;  2VA2 A;  1VQ7 S;  2K7J A;  2F63 A;  3KLF A;  2WVB A;  2W9C A;  5CA5 A;  4WU2 A;  3TZX A;  3CE8 A;  2UU9 F;  2OHD A;  5LJ3 Y;  3OJU A;  2NXE A;  2ZEJ A;  4RU9 A;  2RIL A;  2BX6 A;  3D4J A;  1WHY A;  3BO4 A;  1RYS A;  4CO4 A;  2GML A;  1H72 C;  2IFX A;  2LXF A;  2CNO B;  1ZM2 A;  2L9W A;  2Q6C A;  3THV A;  2YKM B;  5HVF A;  3IWN C;  2CVI A;  3TNV A;  4IDK A;  1VQY A;  1IBM F;  3MPU B;  1VBZ A;  2KN4 A;  2BYC A;  3ZZY A;  3M9N B;  4DSJ A;  1PG5 B;  2R8G A;  4I2P B;  4KSE B;  2YX1 A;  1WSV A;  2W2O P;  2RHS B;  4I2Q B;  4KIA A;  2GW8 A;  4CH1 A;  3UDE A;  2JLE A;  3B8H A;  3DRP B;  4PKD B;  1S9E B;  3ISZ A;  4M1K A;  3Q86 A;  3R97 A;  2AJ2 A;  3MOJ B;  4DR4 F;  4JYA F;  3IR6 B;  3R7N B;  1HWI A;  3M8P A;  4F4X A;  1NEE A;  2VBX A;  1HQU B;  1R89 A;  2MQM A;  5KG1 A;  4CP5 A;  3HMJ G;  2CZV C;  4YME A;  1S0N A;  5L46 A;  4QIV A;  3KG4 A;  1T05 B;  2XMU A;  3MCM A;  1Y5L B;  4PWD B;  2FVQ A;  3MPY A;  3MR6 A;  4NPO A;  3UDV A;  3M32 A;  3AJD A;  3D9B A;  2VJV A;  4PG4 A;  1XTZ A;  1X7V A;  2AP6 A;  2HNY B;  4YOE A;  2M5Y A;  2MZJ A;  3L9Z A;  4DEZ A;  3ZZU A;  4HYK A;  2X7I A;  5L8R C;  3UN3 A;  4TY8 A;  2RNE A;  2CQ0 A;  4P73 A;  1T7P A;  3W62 A;  2HVD A;  1RTH A;  3O6Q A;  4WE1 B;  1S9F A;  1U2R A;  3FRY A;  4B3O A;  3M30 A;  2HQG A;  3F41 A;  3OR2 B;  4OYZ A;  1LXJ A;  1UEU A;  3UN2 A;  2YX7 A;  3DM2 A;  2KZZ A;  2I2Y A;  2XMA A;  2V9W A;  3VAI A;  3OL8 A;  4MYU A;  2P2C B;  4J9N A;  2NSC A;  1SBR A;  4LF2 A;  2IVY A;  2MGZ B;  1LFW A;  1N48 A;  3W2W A;  5KFL A;  3S01 A;  2EFQ A;  1VQ8 S;  5HMW A;  4ID5 B;  3H25 A;  1NK5 A;  4DX6 A;  2IA0 A;  1QSL A;  1FRX A;  5KFQ A;  4Y2A A;  5IC6 B;  3M6W A;  4CLY A;  2DGO A;  4RW6 B;  4ZIT A;  2QA2 A;  2HUR A;  2F1F A;  4DCP B;  1S1W A;  2ZH2 A;  1CVJ A;  3W9H A;  1ZH5 A;  4OZ3 A;  4FDF A;  5K14 B;  1FJ7 A;  2HIQ A;  2HRT A;  2HGN A;  2L48 A;  3AJ1 A;  3TZY A;  1JWW A;  4IO1 A;  5KT3 A;  3HHE A;  1SH2 A;  3ICL A;  3TRG A;  4C2M A;  3OUY B;  1CEZ A;  4ED0 A;  2AIR B;  4G1Q B;  2Q3P A;  3H90 A;  4C8K A;  4J90 A;  2DCU B;  5J2N B;  4M95 A;  2KRB A;  1TKX A;  2BUN A;  4DPY A;  4O3N A;  5A76 A;  1IBC B;  2CDR B;  1C0T A;  1G3O A;  1S6Q A;  3UD4 P;  5AJ3 J;  2V2Z A;  4Z7Y A;  3QT5 A;  1RAH B;  1Q5Y A;  3KLG A;  1HBM B;  1JJ2 R;  4OX6 A;  3E8O A;  4RX6 A;  4OLP A;  2HHH J;  1X5P A;  3HLU A;  2ZBC A;  4KPC A;  1X60 A;  4DR2 J;  1EET A;  4Z2X A;  3O5T B;  4LRD A;  3TYT A;  1TKT A;  2UUT A;  4JI3 F;  1Y5N B;  4TU9 A;  1FD8 A;  5KFT A;  1UA0 A;  2E66 A;  1D3W A;  1B0P A;  1RWP B;  2UUB F;  3C2P A;  1Y11 A;  1FDB A;  2UUA F;  4JI2 F;  3MM7 B;  1S10 A;  1E6Y A;  2XO7 A;  2VZ9 A;  4ED8 A;  4JI5 J;  4YR2 A;  2E5G A;  1O8B A;  4I0W A;  3VWS A;  1RWN B;  4C6A A;  3TZW A;  5AE1 A;  2OLW A;  3PW4 A;  1CJT A;  2ZE2 B;  3F73 A;  2R2U A;  3NBP B;  2KB2 A;  3PRD A;  3CMQ A;  2CJB A;  3BKU A;  4RBV A;  3CMA S;  4KGV B;  2PEB A;  4TY9 A;  2XS5 A;  4DU8 A;  4NE9 C;  4DFP A;  1HBO B;  3JS9 A;  3AY0 A;  4PXE A;  5DO2 A;  1S6O A;  2OP5 A;  3VHQ A;  2CPY A;  4FPR A;  2V0N A;  2Z2M A;  5AXM A;  3SCK E;  2VFR A;  3LGM A;  1SUQ A;  4JI0 J;  2WON B;  5AT1 B;  6AT1 B;  3GFH A;  2MXY A;  3HVW A;  1AT1 B;  2DRA A;  1MW7 A;  3IAM 9;  1TL7 A;  3JTP A;  2W8L A;  4N8O A;  5LSL A;  1HI0 P;  4TXS A;  1JXL A;  5J2M B;  2LXU A;  3DMJ B;  2HGM A;  5CAA A;  4HAC A;  3LP1 B;  4ECS A;  2KFZ A;  2J8S A;  3UFC X;  3V4M A;  1S0O A;  3CIM A;  2FTR A;  1KON A;  2OEL A;  1HR0 F;  1PC4 A;  4BC9 A;  5GAE I;  4DR6 F;  1RA6 A;  1WKK A;  1REV B;  2C2D A;  4X2B A;  1VR6 A;  4ZHR A;  4NLG A;  1Y3K A;  5A6P A;  5E5N A;  5HLF A;  4V19 J;  2DY1 A;  1OPI A;  1CJK A;  1HIY A;  2MQN A;  2XB2 D;  2KZM A;  2GIF A;  4Q0B B;  7AT1 B;  2IDL A;  1PC5 A;  3DLB A;  2JH3 A;  3D6M B;  5GAH I;  5E0O A;  4B3M F;  2RT3 A;  4KFB A;  4QWD A;  3SXL A;  1UCN A;  3PFO A;  2IC3 B;  1WEZ A;  1BQM A;  4AL5 A;  2XLJ A;  4LSN A;  3KK3 A;  3TAP A;  2J9E A;  4A8K A;  2PO4 A;  5D78 A;  4I4B A;  2VDI A;  4JI7 J;  4ECU A;  4CLU A;  3VTI A;  3HO1 A;  3EPG A;  4DV4 J;  3BQ1 A;  1XMO J;  2PDA A;  3OTD A;  1S9G A;  1PIE A;  3W8G A;  4J9R A;  1RQ0 A;  1GFW B;  3DOM A;  5D15 A;  4DF8 A;  2ZM6 F;  2CPD A;  1PKU A;  2XZT B;  1REG X;  2WW8 A;  2KFY A;  1YJN S;  4TN2 A;  4KE5 A;  3WC2 A;  3LQV A;  1VRU A;  2JEJ A;  4N41 A;  1W26 A;  2V8V A;  2NXC A;  1QE1 B;  1KVI A;  1HNV B;  3UNG C;  2M70 A;  2RRA A;  1SB6 A;  3SI8 A;  3NGT A;  4RW8 B;  3D3C J;  3HF5 A;  2HSE B;  2CQ3 A;  4IFV A;  5EN1 A;  2BDP A;  3M1V A;  2GJF A;  1Y5I B;  2IYI A;  2RE1 A;  4P7T A;  1KLM B;  4AQY F;  1T03 A;  4WK3 A;  3UI3 A;  3C14 A;  4ED6 A;  4Y6I A;  1TR0 A;  2UU9 J;  1K44 A;  4JV0 A;  2V4J A;  2F40 A;  3KHH A;  2QX0 A;  5KFW A;  2CNN B;  4RUH A;  2ZZM A;  2X51 A;  1Q82 T;  2BAN B;  3R9L A;  4O44 A;  4DN9 A;  2CQP A;  3KJV B;  2GCF A;  3SZ2 A;  1VC6 A;  1RWX B;  4N76 A;  1RT2 A;  4RW7 A;  3NS7 B;  1VBY A;  2XI3 A;  1FRM A;  4ZMM A;  3KK2 B;  3J7A N;  2JC1 A;  4HI1 A;  3FZ2 A;  2DVI A;  4CLS A;  3AXM A;  3GSD A;  1ZTW A;  1SL0 A;  1Q86 T;  1KVJ A;  3RTV A;  1JQG A;  4FYX B;  3PVX A;  2WK4 A;  3FCH A;  3CJK A;  2Z2L A;  3BDP A;  1RT7 A;  2F4F A;  2XS2 A;  2XNR A;  5D6G A;  4LF5 F;  1WI6 A;  1KDN A;  2QLB B;  3K5O A;  4UQG A;  4OV1 A;  5D0H A;  3HHL B;  3JB9 k;  2ZVI A;  4DR4 J;  2PI5 A;  1J2V A;  2DNP A;  4JYA J;  1OQ3 A;  2L9D A;  1G4C A;  4DL3 A;  2FJA B;  3J7Z 5;  3CJT A;  1S4E A;  3GP9 A;  4LQ9 A;  2CNL B;  2E7X A;  3OR1 B;  2FC9 A;  2DXE A;  1UFL A;  3SV3 A;  3MD1 A;  2MKJ A;  1IKW A;  2B51 A;  2OO4 A;  1ZPW X;  2QG9 B;  2CJA A;  4O4G B;  4NLW A;  2MKI A;  2B7B B;  2CUY A;  3PW7 A;  1WKJ A;  2HS0 A;  1HAR A;  3M4X A;  3QJL A;  1MRO A;  1R8A A;  1AYE A;  3QRQ A;  3S8S A;  5JVG Q;  1UKU A;  1S1U A;  4ZJO A;  3NAH A;  3GJQ B;  1LWE A;  3UD3 P;  5C42 A;  4WFA Q;  3NGR A;  2R42 A;  1RKJ A;  4KH0 B;  2BJD A;  4BCA A;  2HMI A;  9RUB A;  4Q44 A;  2HBQ B;  2C3O A;  2QSF A;  1NKE A;  2QO3 A;  3E3X A;  3M8Q A;  1NK7 A;  2DH9 A;  2NZC A;  1WAC A;  4J9M A;  1IKY B;  4K8R A;  5HMX A;  2XO6 A;  3RW7 A;  3AFG A;  4X4V A;  5E3Q A;  3FGV A;  4LUB A;  1JLB B;  3ZC4 A;  2KTQ A;  3NGS A;  3TA1 A;  1OY6 A;  2E7V A;  5AXN A;  2ZHA A;  2Y1I A;  4RUA A;  2ZH8 A;  4K5R A;  1U1M A;  3M2V A;  3LOU A;  5E3A A;  4OZJ A;  1PJ5 A;  3KLF B;  2QT7 A;  3HHL C;  3EM1 A;  2W9C B;  2DR5 A;  2ZH6 A;  2C3Y A;  2VF3 A;  4I7F A;  2IRY A;  4WTO B;  1L5U A;  4EU0 A;  1TEL A;  3B78 A;  2W4P A;  3HZE A;  2AYB A;  2MY8 A;  1M5V C;  3IGN A;  1TK8 A;  2DNN A;  1DFD A;  1YZ7 A;  2LQ9 A;  1TKD A;  1NO8 A;  4NLT A;  1PYT A;  4DX7 A;  2HEK A;  1XJW B;  1P27 B;  3U1M A;  2W7A A;  2IBO A;  3VQS A;  2FJD B;  4R25 A;  2DHS A;  2Q79 A;  1EKS A;  2V69 A;  4IDK B;  4KY3 A;  3CCT A;  1QDU B;  2B43 A;  3A3P B;  5A2Q U;  2BMB A;  2OAU A;  2QTW A;  2NXJ A;  3N6M A;  4ILM A;  4X84 A;  4OJG A;  4BDP A;  3ILO A;  4NOH A;  3O3L A;  4NLQ A;  4LF8 F;  1T9W A;  1GXT A;  3PEH A;  2DNY A;  2RAQ A;  4JI3 J;  4NWB A;  4RZR A;  4USI A;  2ZH9 A;  2QLX A;  2UUB J;  3J81 Y;  1X0P A;  2YQ0 A;  3OV7 A;  1OIA A;  2DR9 A;  1P1L A;  1NDP A;  4F26 A;  3TZZ A;  4DR5 F;  3AOD A;  2H54 B;  2IYG A;  3KK1 A;  1DLO A;  3M8P B;  3PCO B;  2D3Z A;  3D54 A;  4UOG A;  3US5 A;  4PG8 A;  5D8H B;  2NZ4 A;  3VAM A;  5SUH A;  5B0B A;  4EYI B;  2C2O B;  5BJR A;  1ZTT A;  2AJ4 A;  2NQP A;  3H20 A;  4DHV A;  1JJ4 A;  3AAW B;  4ZVO B;  4AFF A;  3M32 B;  1NDC A;  2HHT A;  2B6A A;  3R8Y A;  3Q8U A;  1C4C A;  2WOM A;  5BYQ A;  3UCZ P;  2GFF A;  2H5E A;  3VCD A;  3KXD A;  3I5B A;  3KOA A;  2BAC A;  4RNN A;  5D3G A;  2WSE C;  2E1P A;  2POK A;  5CHC B;  2GGP A;  4QIF A;  5IT4 A;  3FCV A;  1T94 A;  4NEY A;  1RTH B;  4UY8 5;  1W2B R;  3CNQ P;  4B3O B;  3ILI A;  3M30 B;  2M88 A;  3HVT A;  1FDD A;  4ECR A;  1Q0N A;  2IJR A;  1FRL A;  3DM2 B;  2YWW A;  2Z30 B;  4MT1 A;  5CZV A;  4P71 A;  1HR0 J;  2CIM A;  2WTF A;  1SKU B;  4DR6 J;  4DV1 F;  3CCU S;  2KFN A;  1VJQ A;  3M6X A;  3IR7 B;  2XMW A;  1U1R A;  1AFI A;  3W2W B;  2GVZ B;  5IT9 Y;  3HSD A;  1DRZ A;  3QIP A;  4XAK A;  4OI4 A;  3GON A;  2V8G A;  1LKZ A;  4PUO A;  4DSK A;  2XHW A;  1TVR B;  4U67 Q;  3W5Y A;  3WIV A;  3DHX A;  3MOZ A;  3BBC A;  2XHC A;  3S1T A;  3J81 j;  1G6B A;  1S1W B;  1UJ4 A;  4B3M J;  4AL6 A;  3SSQ A;  4M5I A;  4IH5 A;  2C3M A;  3GQC A;  2V34 A;  1B4S A;  5J2Q A;  4KGK A;  2WCX A;  2QFJ A;  3J7A 1;  1RWM B;  4EO6 A;  3M8Y A;  1JKH A;  1FXL A;  3G2X A;  4PXD A;  3T19 A;  2RHQ B;  2W24 A;  3ENA A;  3PHT A;  1FJG F;  3TJ9 A;  4NCG A;  1F5C A;  1TKX B;  2L08 A;  1IJE B;  4PXC A;  1AXQ A;  1H2U X;  4ZVR B;  1C0T B;  1CS4 A;  4C0B A;  1S6Q B;  3CCE S;  4DV6 F;  1NHV A;  1TL4 A;  1KVK A;  1U25 A;  4JV1 A;  2GVD A;  3U02 A;  3R5C A;  2CJK A;  4RNM A;  3LUY A;  4QW9 A;  3R2C J;  2FJE B;  2QL5 B;  4O3O A;  3KHR A;  4WF9 Q;  1DTT A;  2ZBI A;  1EET B;  2LU1 A;  1EP4 A;  3PNI A;  2J0Q D;  1KKH A;  2YKQ A;  1SKS A;  2HQ3 A;  1TKT B;  1NBE B;  2BAB A;  3BM7 A;  3W61 A;  1DZ5 A;  1VBK A;  2F8E X;  2G0J A;  2C2M B;  4HL9 A;  2N82 B;  2BJ1 A;  4YS2 A;  1AB8 A;  2XCA A;  1E6Y B;  2OSR A;  1CC8 A;  3EVW A;  4W90 B;  4NA3 A;  4AQY J;  2BJ7 A;  4TYB A;  4LFB F;  2B9X A;  4H4K A;  3MAH A;  1Z4U A;  1AZS A;  2BVZ A;  3DFE A;  4TLQ A;  1Q4R A;  4DSI A;  5KG4 A;  1RKI A;  1NPR A;  1U45 A;  3HXM A;  4P75 A;  2ZNZ A;  1OS5 A;  3GR1 A;  2B4V A;  4LT6 A;  1CQM A;  1RAD B;  2VIH A;  2FLN A;  1EAY C;  1RP5 A;  2IM3 A;  4KYZ A;  2PFD A;  1A7G E;  4ED2 A;  5EWE A;  2BE9 B;  1GEH A;  2DHH A;  5D4N A;  1I51 B;  1YKW A;  1VQN S;  2NPI A;  3DU6 A;  1WOR A;  2IM2 A;  1SUQ B;  4C8Y A;  1Y10 A;  1E6V A;  2IPO B;  1H2V Z;  1F9F A;  1S59 A;  4OJ3 A;  4ZCM A;  4ZVU B;  4O4R A;  4LF5 J;  4O3Q A;  3T9N A;  4DFK A;  1X0F A;  1HYS A;  2J8A A;  3G96 A;  2YPY A;  3NNH A;  5IWA F;  1RWV B;  4HAC B;  1PO6 A;  4LFC F;  1D09 B;  3FJ2 A;  2JFD A;  5IV3 A;  5HMY A;  4B3R F;  3MFI A;  5HP1 B;  2Z2Z A;  2WRM A;  1FXR A;  1NK9 A;  4I67 A;  1KS2 A;  1S6P A;  5F8M A;  4DQQ A;  2XYP B;  3Q23 A;  3PJX A;  1SXL A;  4ZHR B;  3OTE A;  3DXS X;  4DX8 H;  4ZJQ A;  4NA1 A;  3NMR A;  2KG0 A;  1CJK B;  3IP0 A;  3EZO A;  3FMB A;  5ETL A;  2DNG A;  5KFM A;  3GJT B;  2BEF A;  1VIO A;  4KFB B;  1BQM B;  3UE2 A;  1TK0 A;  2BBE A;  5HK4 A;  3DI6 A;  3M9M B;  3DRX A;  3KK3 B;  3GFY A;  1NPP A;  2HG4 A;  1F6T A;  1UTA A;  2DGS A;  4JI1 F;  2AU0 A;  3IA0 A;  1WEY A;  3CPW R;  2IA6 A;  1ZA2 B;  1JB0 C;  3EZ5 A;  1EQM A;  1S9G B;  3A4T A;  3I0S A;  2N7C A;  1TP7 A;  4N8N A;  1O6X A;  3DOM B;  4E0D A;  2UXB F;  4OQJ A;  1H7W A;  1JLA B;  1I3O B;  1RUS A;  4W98 A;  5C7P A;  2EFN A;  2VKZ G;  1VQK S;  4ZLP A;  4B02 A;  2F9J A;  1TKZ A;  4UUW A;  3MF5 A;  3TVK A;  4DL4 A;  1VRU B;  3RRK A;  4PCQ A;  4RW4 A;  5HI7 A;  1CJV B;  2E44 A;  1H73 A;  5KFS A;  4EBE A;  1MMN A;  4ALZ A;  4NI2 B;  4CQ1 A;  2W9A A;  1FRK A;  4LF4 J;  4X65 F;  2MST A;  5L1I A;  1Q8I A;  2P6S A;  4QWB A;  2V94 A;  1SQG A;  5CD4 A;  4IFV B;  1PBU A;  5HJX A;  4F50 A;  2WB4 A;  2ZWO A;  5HRO A;  4GRS A;  2JNJ A;  2MQO A;  3C14 B;  4NZ7 A;  3I87 A;  4B08 A;  2V4J B;  3QID A;  5FDL A;  3QWU A;  4MKA A;  4O44 B;  1VQM S;  1C4A A;  1HNI A;  4U7U D;  2WHO A;  2ZD1 A;  2XBP A;  1RT2 B;  4K4V A;  4RW7 B;  3BQ0 A;  1GNK A;  4X4R A;  3HSG A;  2XSJ B;  1RE1 B;  3UCG A;  1C2P A;  1NLK L;  1B0T A;  4CM0 A;  2LQB A;  4B9U A;  1X4E A;  3MR7 A;  4U8V A;  3L3C A;  3PV8 A;  4K2J A;  4YP3 A;  2HHQ A;  3SSS A;  5ETK A;  4LF8 J;  4NCB A;  3WX8 A;  5C2C A;  1RT7 B;  3TQ1 A;  3GB0 A;  2IRU A;  3FRZ A;  2RVJ A;  2ALY B;  2A1B A;  1IBK F;  3FMW A;  4ZP9 A;  3MZI A;  3N79 A;  1FK9 B;  2U2F A;  2W2M P;  3BJY A;  4DR5 J;  2H51 B;  2V4Q A;  3NKY A;  3ONQ A;  3C6U B;  1F1B B;  2DRB A;  4DUY F;  3MPV A;  3CCW A;  5A8W A;  2K3I A;  2HRU A;  1KQS R;  2D3U A;  1M1K T;  2QRR A;  1SIW B;  1LWF A;  1SJQ A;  1FWL A;  3M6U A;  2DH8 A;  1V5I B;  2DR6 A;  1IKW B;  4EZ9 A;  1OYE A;  4X64 F;  1URR A;  1R0C B;  1OSD A;  2GAH C;  4NL5 A;  4M5D A;  1Z2Z A;  1M1H A;  4OIX A;  1PGZ A;  2MKH A;  1QY7 A;  3TX0 A;  3ITH A;  4FP9 A;  1XN9 A;  1BMQ B;  2QV6 A;  1F5A A;  2P9G A;  3OHA A;  2EEY A;  4PWU A;  3KWM A;  3NWG A;  2VQF F;  1I1G A;  1LWE B;  5C42 B;  3X1L B;  2XM3 A;  2IJN A;  1MSW D;  3GYG A;  2HMI B;  4PPD A;  2C2K B;  2A2C A;  5K8P A;  3CF5 Q;  5KFX A;  4DPX A;  3UN5 A;  3OVA A;  4V1A k;  1XBW A;  1WJ9 A;  3M8Q B;  3CDE A;  1HWJ A;  1LNQ A;  1WC0 A;  2YH0 A;  5KT2 A;  4DV1 J;  1TU0 B;  2MZR A;  1HKA A;  3HM9 A;  2DK2 A;  5F0U A;  1XER A;  2JEF A;  2JHE A;  3RR7 A;  4WK1 A;  2GQQ A;  3FBC A;  3KLI B;  3H5Y A;  3N6N A;  4DV0 F;  2Q43 A;  4USV A;  3OLA A;  3FKB A;  3RW6 A;  4DR7 F;  4ZVS B;  4ED4 A;  5KFO A;  2XGP A;  1ZOT A;  1T3O A;  3AA8 A;  3ENW A;  1S79 A;  2BJ8 A;  3M2V B;  3PR5 B;  2OIH A;  1XMQ J;  4I7F B;  3LO3 A;  5GAE U;  3N0V A;  3HVA A;  2GQC A;  3IRX A;  1HBU A;  3H59 A;  2V4R A;  2MQL A;  1X5T A;  4WYW A;  4P52 A;  3TW0 A;  1MU2 A;  3JAM U;  4ED3 A;  3FEX B;  4DBQ A;  3TAN A;  4DV6 J;  2Y1L B;  4DV3 F;  2XMV A;  1HNW J;  1YDL A;  2B9W A;  5GAH U;  5AXL A;  3LTO A;  2R8K A;  1Q1K A;  3K7R A;  5KFK A;  4DLG A;  3DLK A;  2DD8 S;  1WOO A;  3L7P A;  1RAE B;  2D1C A;  4CO0 A;  2ZBP A;  1B7F A;  4JV5 F;  2DGW A;  2DGQ A;  1FFW B;  1C0U A;  2OGU A;  2B4O A;  1CG2 A;  1QTM A;  2E5L F;  4N56 A;  1OY8 A;  1VFJ A;  2ERR A;  3R3T A;  2FJW A;  1N32 F;  3AXK A;  4OYI A;  5T7L A;  4DX5 A;  1YX2 A;  4S0M A;  4LFB J;  2M8H A;  3KK1 B;  1DLO B;  1S48 A;  1NH7 A;  2YNG A;  2CQ2 A;  4KHR A;  4IUF A;  2P9C A;  2B8P A;  2CPH A;  2D74 B;  2O67 A;  2OSQ A;  4KTQ A;  4GMK A;  5DZ7 A;  3T5H A;  3RB6 A;  3R7S B;  4C0O C;  2ABY A;  1TL1 A;  5KFA A;  2FHO B;  3JQK A;  2DY9 A;  3T1Y J;  2XLK A;  4ED5 A;  2KI2 A;  4HR2 A;  3SCJ E;  4ZPA A;  3CED A;  2GC8 A;  2VOO A;  3C6T A;  1L3S A;  3PYG A;  3KMS A;  2WOM B;  1DQ8 A;  4LF9 F;  3G4S S;  2UXC F;  4ZN3 A;  2GV1 A;  3W5X A;  2DNL A;  4F2S A;  5G0R B;  3PHE A;  4ICL B;  3K8V A;  3SBM A;  5D3G B;  1I5O B;  4WYL A;  3N5F A;  4Y2M A;  1UVK A;  5CYQ A;  4NRT A;  2MHN A;  1TMM A;  5LJ5 Y;  5IWA J; 
#chains in the Genus database with same CATH homology
 2VIC A;  2VJU A;  2XMA A;  4ER8 A;  2A6M A;  2F5G A;  2XM3 A;  2VHG A;  2VJV A;  2A6O A;  2FYX A;  2F4F A;  2VIH A;  2XQC A;  2EC2 A;  2XO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...