2VHWA

Crystal structure of holo l-alanine dehydrogenase from mycobacterium tuberculosis in the open and closed conformation
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
371
structure length
371
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords ALANINE DEHYDROGENASE
total genus 126
structure length 371
sequence length 371
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhwA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhwA02
1DFGA 5CDGA 3U4IA 1ISFA 3TWOA 3ZW9A 1ENZA 1HE4A 2Y67A 4G2NA 2P91A 5IZ4A 3PJFA 2PD6A 2NV6A 4E5PA 1YJQA 2BH9A 4M89A 2X22A 3O38A 4O0LA 3U9LA 4RPHA 3Q2IA 4LGVA 4BB6A 1EVIA 4UEJA 4YCAA 4HWKA 3RBXA 4XJSA 3ZV3A 5F5LA 2JJYA 3W4IA 3NRCA 2GGSA 3WQQA 5L4SA 1K6JA 3I9JA 1VSVA 1EK6A 3DTYA 1X1EA 3HQ4O 2DTDA 3WG9A 4IZHA 3PYLA 2ZK7A 4UUOA 2VWGA 2GN9A 3FSRA 2XAAA 1W6UA 5HRUA 4NQZA 4YJHA 2CVZA 3VZPA 2HK8A 4BMNA 4PIVA 1QYWA 3PYMA 1A4IA 2JKVA 1PZHA 2D2IA 1DRWA 3WB9A 1YDEA 2Q1WA 1EK5A 4J2HA 1CETA 2PY6A 1ZK0A 2Z1MA 2VWPA 1OFGA 3PP8A 1DAOA 2CMDA 4II2A 4XYEA 2NVBA 4HV4A 4MKXA 4BQPA 2IEBA 3CTMA 3C8MA 1QP8A 1X1TA 1PSDA 4JK3A 3WLFA 5JYEA 1V8BA 4NR0A 1PQWA 3WICA 3AM5A 3H9UA 3L0DA 3FD8A 1VJ1A 3LLSA 4XEHA 3SLKA 5JDIA 4IJKA 1HLPA 2W90A 3GG9A 1AHIA 1DJQA 1HTBA 3GHHA 4FC7A 3W8EA 1PZEA 3WTBA 4EITA 4PG8A 5ICSA 2X1HA 3TSCA 4CM7A 4FCCA 4DYDA 1AXEA 4J90A 4WOJA 5A4DA 3BYZA 1RYEA 5KKAA 4Q3EA 3TPCA 4W9NA 4XKJA 4YT5A 3E9QA 3GNQA 1ZSNA 4QXMA 1OMOA 2ZB7A 2YFHA 4IS3A 2IODA 4QUKA 3WSWA 4TZTA 5DBGA 3TZCA 2D3TA 1T2CA 3JQAD 3PFWO 4L73A 4HNHA 3ZWYA 3D1LA 2E82A 3DBLA 3D7LA 3I23A 3SBOA 3N58A 4GX0A 3DBRA 2A94A 4IXTA 3PVZA 5IG2A 1DJNA 1N5DA 2FRDA 2HMWA 3F46A 4XR9A 1E3IA 1IHXA 3G1TA 5F3RA 3WQSB 2WYWA 2X23A 2O3UA 4RLSA 2BFOA 4JROA 1E7RA 1E7YA 4WK6A 1AUPA 3IMFA 2IE0A 3PYXA 5JPIA 3F4BA 4R51A 3RJ5A 3ZV6A 5TQVA 2B83A 2WD7A 4ND4A 1Y81A 4EYEA 3UICA 3D5QA 4FFMA 1W0CA 5AQ1A 4IJWA 3VTZA 1Z7EA 2DKNA 2VOEA 4PLWA 2YV3A 4BKRA 3ZW8A 2O2SA 3JQFA 1P9LA 2W4QA 3NGXA 1HEUA 1R4NB 4Q3NA 4KQWA 4BGUA 1P1KA 4BO2A 1Y7TA 2PZLA 4XGKA 2H63A 2IZZA 4HUJA 5FFFA 1LQUA 2XOXA 4DPLA 5BQFA 5IAAA 2GZ1A 2NU6A 1B8UA 4WNIA 1IB6A 4MP6A 4ZRMA 3I6QA 4P4GA 5COBA 4I5GA 4RVDA 5EQDA 4CUJA 1C0KA 4A0SA 2O4UX 3O03A 4BO9A 5L3ZA 1PZFA 1CIVA 1YXMA 2NTNA 4HY3A 4JBIA 5DDIP 3DEYX 1NQTA 3DBHA 2NVUA 3NT5A 5EERA 4AJ4A 5CDYA 2VYVD 4EW6A 1ZXLA 3WBFA 3WIEA 1EDOA 2GN6A 2D1YA 4BNLA 3NGLA 5L95A 1KIFA 2P9CA 1XIVA 1ZKMA 2NTJA 2YDXA 3V2HA 3QWHA 2H9IA 3BTOA 3ZWCA 1E5QA 1E3JA 3JQDA 1R15A 4ALNA 2QQ5A 4QT0A 4NBWA 1RM0A 4A5OA 1GU7A 1SZJG 1U28A 1UP4A 4WASA 1C3VA 2W8ZA 3K2BA 4WJZA 4QX6A 1P1HA 2J6IA 4QECA 3BMCB 3TZQA 2R00A 1MXFA 3CZRA 1B3BA 1WNTA 1NQ5A 4YXFA 3AY7A 2JHFA 1ONNA 3DMYA 3VH2A 2B37A 2QZ9A 2AEJA 3ST7A 1IOLA 3KVOA 1YDWA 5DCUA 4BMSA 4MJLA 3GZNA 3S1LA 4NZ9A 4TROA 1J0XO 1M2WA 4I1IA 3CIFA 2AE2A 1PEDA 2X9NA 3QVWA 4FW8A 4P22A 1SC6A 1BW9A 2HDHA 3GVIA 1C14A 4OYRA 3TQHA 2EJWA 1ADCA 3LC7O 3NDJA 4ZJUA 8ADHA 1N92A 3U3XA 1FMCA 2ZYDA 2X8LA 1PWZA 4YB8A 3VZSA 1A4UA 4CL8A 2DFDA 4D42A 2C29D 3EAGA 2YHUA 3PWZA 2Q1TA 4NIMA 1J5PA 4BUCA 3I52A 4GWKA 1E1KA 3NDRA 1JW9B 1NFRA 4HFNA 4ZHSA 4GPD1 5JNLA 3GDFA 4GX1A 1PJ3A 3QIVA 5IDQA 1WDMA 2E4AA 1ZK2A 3RUFA 4BGVA 4MO2A 2CDCA 4XZ3A 5TF4A 4TWRA 1DC4A 4EGFA 3VZRA 2JCVA 1FK8A 1UJMA 5C37A 2J8ZA 1F17A 1B7GO 3IS3A 1MXHA 5I7VA 4YJHB 2FR0A 2VNSA 4KUHA 3ZWBA 4L0QA 3PK0A 3HDYA 4INAA 4RLHA 1D8AA 4IMRA 3K96A 4BV9A 2CSUA 1GV1A 5IXYA 3RCBA 2OP1A 3ASUA 5C7IO 4CR6A 2NM0A 1KEPA 1Q0LA 1E3SA 4ID9A 3IJPA 3WMXA 4CL3A 3BAZA 2WYVA 3CH6A 4TKLA 1GEEA 4JBHA 3IP1A 2P4HX 4YBZA 2JL1A 3RSHA 5IFLA 1LLQA 1WZEA 3AJRA 1TA4A 5TJHA 2B4TO 3NV9A 2C5EA 2HCTA 1BTOA 2QYSA 3ROMA 1X0XA 1B0AA 4PLTA 4CODB 4DQXA 1VKOA 3I6IA 2BHLA 1R4NA 4E6PA 4D43A 4JGBA 1DRUA 2C5AA 4N18A 1U5CA 2GF2A 4NJMB 1M75A 3A14A 4ESOA 2VHXA 4F6CA 3KOUA 4RVGA 4J1QA 5EN4A 4OAQA 2B4QA 4TRJA 3QY9A 4YAEA 1FDVA 1H6DA 1PWXA 3INGA 4FFRA 2ZTLA 3WGTA 1HYEA 3T7CA 3OM9A 4B4WA 1Y9AA 3PEFA 4WLNA 1RWBA 3DZIA 1A9YA 2PGDA 3VKUA 3ZHBA 4NFSA 5JFOA 2Q99A 3ASVA 3TOZA 3PHLA 3X2FA 3NUGA 4EUHA 1L7DA 1X7DA 3Q11A 1I3MA 1HT0A 4UVDA 2UYYA 4N54A 3KRTA 4FD3A 1ADBA 4L4XA 1F8FA 3S55A 2NQTA 3KZVA 5COAA 1OI7A 1R6DA 5TLSA 3A1NA 6ADHA 5CEJA 4JP3A 4BGEA 3EUWA 5CEFA 3AW9A 1ZNQO 4IGFA 3KUXA 2H1SA 1SNYA 4PLPA 4Z0HO 4RPGA 5ER9A 4KUGA 4UUMA 1VJTA 3ZWAA 3RKUA 1PGOA 3OP4A 2YJZA 4J7XA 3WGOA 4E12A 3GHYA 3RUEA 9LDTA 3L9XA 4ITUA 2PK3A 3U4HA 1PS8A 3RWBA 4JBGA 3OJLA 2X4GA 1I01A 3DFZA 2VN8A 4TRRA 3QWFA 2Q1SA 5CAEA 4IGEA 1KOLA 3WLEA 5CDSA 4DIFA 1DLJA 4AJPA 2RCYA 3PGJA 4M1QA 2Y1FA 1GCUA 3I9OA 2AG5A 4R4JA 3E9MA 4CQMD 3AM4A 3PHHA 4RJTA 2NNLD 2R00C 3KYCB 3R3SA 1V0JA 1ARZA 3H6KA 4KTTE 1F8GA 3ZNOA 2HO5A 3H5AA 3HHPA 2JFGA 1YBMA 4CM4A 1T4BA 4PLYA 3OJ0A 4DRYA 4KWHA 1CQJA 5DN9A 4NG5A 5JLAA 1DIGA 4CQLA 1KC1A 3DOCA 2F00A 2EXXA 3PHGA 3CINA 4BKPA 1KS9A 4XGIA 4BO1A 1T24A 3BMQB 1VSUA 3AK4A 1LRLA 3G49A 3FR8A 4TKMA 4TRNA 3OICA 1U9JA 4CUZA 3ONEA 2LDXA 1P1RA 1T1SA 5U9CA 2HU2A 3K30A 5LCXA 1QYCA 4FFPA 5JC8A 2FY8A 1H2HA 1DIAA 2JD2A 4TRMA 3WGYA 1GTMA 3LU1A 3I9KA 4MVJI 5JY1A 1A7KA 1P44A 1ZBQA 2GDZA 3W1VA 4BKQA 1U4SA 5MDHA 5K6AC 3H8VA 5BSFA 1BHSA 4YWJA 3U62A 1NQOA 5DOZA 5KJFA 4BNYA 5EPOA 2QW8A 3WJAA 3GFBA 1O9BA 1QYVA 1MC4A 3CE6A 1GAEO 3ZI0A 1LDEA 2B35A 2BFAA 4ALLA 1EDZA 2EW8A 1WMBA 2EKPA 1NVTA 3ZU5A 2NUAA 1IULA 4R1TA 5L45A 4TQGA 3ZN2A 2FWMX 5TT1A 2EJVA 5JMPA 1LLCA 3B20A 3TZKA 2BGLA 2BRUA 3EYWA 4TZKA 1E1NA 4DLAA 1ZZEA 2HUNA 1P1FA 1IE3A 2AQ8A 3JTMA 1YONA 2OMEA 5A9TA 4DIOA 3ENNA 5ENVA 5A1TA 3V1TC 4CV0A 1YBAA 1QG6A 3ADOA 3PXXA 4FFNA 4FGWA 4D45A 4FJ2A 4IQ8A 4CV3A 2DVMA 1NPYA 1YL5A 1G0OA 1XWFA 1NXQA 2GNAA 4NU6A 3R0IA 4CMIB 5CDUA 2O3QA 3D4PA 1R4MB 3QSGA 1DIHA 4NBUA 1ZEMA 2OFPA 1A7AA 4J4BA 4ND2A 3Q1LA 4LCJA 3RROA 5DCWA 4Z3DA 4CM8B 5JAZA 3HB4X 4EJ6A 1PS0A 4XB2A 3ONFA 4WCFC 3WSVA 4WLVA 4L74A 3H5RA 4G5HA 2J5RA 2GASA 1OAAA 2WTBA 4IIUA 3ZU4A 1XEAA 2WD7B 1D3AA 3PLNA 4GBJA 4DVJA 4CLDA 2X0IA 1WMAA 2XXJA 1NAHA 4B7CA 1YRLA 4DC1A 2PGJA 1W4ZA 2WJPA 3FHLA 4UEOA 1K6IA 2YZ7A 3MJSA 4J16A 5FYDA 2Y05A 2PWZA 2YYYA 3D5TA 4RPLA 3ZV4A 2P5YA 2WWRA 1LDYA 3JQ8A 1E0DA 3FTNA 1WAMA 3NT2A 2VYND 3W8DA 1EFLA 3OJFA 3M2PA 1MP0A 3WYEA 3MOGA 4GGPA 3VZQA 2EF1A 4PLHA 1RPNA 2I66A 3NJ8A 4O59O 1HDGO 3HFGA 5T6BA 3OIFA 3S2EA 4GKBA 1ZSYA 4OJNA 1EBUA 4GLOA 3PIIA 5TSDA 3W8FA 4A73A 1RM3A 3ORFA 4JIGA 4PLZA 3O26A 4RZHA 1PJCA 3F5QA 4OGWA 4ALJA 1AN9A 3ZH2A 1KERA 3IUSA 1E7QA 2X0JA 1UAGA 1BVRA 3PQDA 1VPDA 3JD0A 3PHJA 3TF5A 1XLTA 1T2FA 1DAPA 3FPCA 2CUKA 5DP1A 3RC7A 1HDOA 2VRBA 5A5EA 3INTA 3ROPA 3HN7A 1I3NA 1N7HA 4PRLA 3N7UA 1MX3A 1EQ2A 3K31A 4DGSA 1O89A 5G4KA 1BXGB 4OOEA 2UUPA 2Q2WA 4FS3A 3D64A 4NHEA 1GQQA 3NTOA 4IPTA 1YQDA 1DFHA 4RVFA 5F5NA 1I3LA 3K6JA 3BMCA 4KMSA 1SB9A 1XQ6A 2EV9A 4AL4A 3MOIA 3FPLA 4U7WA 3GRPA 3IAHA 1D7OA 4B4OA 3CZMA 5JBIA 1PJTA 1QSGA 3A9WA 1UAYA 5T57A 2GRAA 3UKOA 3WFJA 4MPDA 3KLPX 3C1AA 3PQFA 2DQ4A 4H7PA 4I5EA 4EI2A 1ZFNA 2FSVA 3VPFA 2C54A 1F12A 3BMOB 3COSA 3LT1A 1V3TA 1JKIA 2I3AA 4FDAA 2NQ8A 2QYTA 4Q3CA 1H94A 1XSEA 4JN6B 4ZD6A 2IDZA 3OFSA 2NVUB 4ALKA 1ENPA 1G1AA 2AEFA 4YAIA 3OETA 4LRSB 1DFIA 2AG8A 5GMOA 2ZYGA 4DTIA 4E5MA 4RF3A 1DC6A 2I5PO 4R5MA 2VTDA 3K8ZA 2NACA 1H0KA 1PJ4A 3GQVA 5G0WA 4QO7A 3G1UA 3DWFA 5AXAA 3WS7A 1OC2A 3PHIA 4BIIA 1HZZA 1M67A 1P0FA 2JD1A 4QQRA 4TMFA 5EJ2A 2EGHA 3UF0A 1ISGA 2ZTVA 3HUDA 1PGQA 3SVTA 4CMCA 4OXNA 5FF9A 5ES3A 4OKNA 3S2FA 3UUWA 1OZAA 1YL7A 3RBVA 2FHSA 4GI2A 3K92A 2C7VA 3HDQA 1BXGA 3R3JA 4BMVA 5HA5A 1UDAA 1EE2A 3PWKA 3OECA 2VZ8A 1BRMA 1W73A 4K6FA 4BGIA 3EC7A 1MB4A 1PJLA 2CD9A 1H6CA 4U0KA 1H6BA 3F1KA 3QE3A 3W6ZA 2HK9A 1PU2A 4JQCA 3RC1A 3W4KA 1XELA 3OF2A 4W7HA 4JP2A 3CSDA 1ZSVA 4EUEA 3FBTA 1Y5MA 1BXKA 1NAIA 3DBLB 4CJXA 3MJ4A 3QP9A 3GDGA 3DZFA 3F6YA 3LT2A 1H6AA 3F4LA 4PZDA 3GF4A 3IQDB 1YOVA 1DXYA 4MDHA 1ISJA 2PZJA 4UEKA 4EUFA 3JD4A 2PR2A 1NWHA 2G17A 2AQIA 1ORRA 4L4SA 1DDOA 1WVGA 4Q3DA 5KOIA 2DBZA 3ZWVA 1F06A 1LDGA 3ICPA 2E48A 3H5NA 4MIYA 4DUPA 2ZCVA 5GY7A 1DC3A 1HZJA 1MC5A 2Y93A 2HK7A 1CERA 1H2BA 5H82A 4BO6A 1NNUA 2J3IA 4XYGA 3JYQA 4WUVA 5A3JA 2W2LD 5JSFA 3JQ7A 3PGXA 5A05A 2GN4A 1LTHR 2FZWA 3PZRA 2G1UA 3DL2A 3MJEA 3QWAA 1R12A 2R2GA 5L4LA 1PJSA 2O3RA 3DZGA 4B4VA 4Y98A 1VM6A 2PZMA 3MZ0A 3HZZA 3B70A 2UV8A 4R41A 3ZHXA 1E7SA 2QIOA 1C1XA 1XR3A 3WX0A 3VTFA 4HNGA 4XQCA 2EEZA 2X7HA 3GPDG 4R3WA 1XGKA 5JS6A 4WGGA 5AXBA 3U4CA 5AXDA 4CM5A 5KTKA 4Y6RA 3U4DA 3UXYA 1TLTA 1PJBA 4EEXA 3WDSA 2CNBA 3I3OA 2ET6A 5A9RA 4FC6A 1YO6A 3D3WA 3ZDFA 3KEOA 4CR8A 4II3A 4CM4B 4R68A 5BSHA 2GSDA 2FMUA 2Q3EA 1HDRA 4HFRA 2A92A 3RBZA 1PGNA 1LC0A 4A03A 2C7GA 5I8ZA 4XD2A 5A9SB 3MTJA 2ILTA 1LI4A 3L4SO 4J6FA 3FNEA 4A2CA 1JAYA 2FPIA 2C59A 5LC1A 4BB5A 4BNHA 4G81A 4YJGA 3KB6A 2EHDA 1ONPA 3RIHA 2GPTA 2Z95A 1XDWA 1PX0A 3F9IA 4S3MA 5A5FA 4CMEC 4F45A 4BNFA 4GH5A 2Y0CA 1KVQA 1CQIA 1DLIA 1EBFA 4PLFA 1YWGO 5JW6A 1E3WB 3AUAA 4BNXA 1XYGA 3EGOA 3W4JA 3GNSA 4Y6SA 4J0FA 2PGLA 1EQUA 3GMSA 3ITDA 3MTGA 3PI7A 4QFDA 4DMMA 1H9BA 1KETA 1ZIDA 4H3VA 3LF1A 1ONOA 3E5RA 4HKTA 1EE9A 1R4MA 1U5AA 2RBEA 4B7UA 3MJVA 3ETDA 2P5UA 1M76A 1UDBA 2HKIA 2C20A 5C7OO 1PQPA 1A71A 5A3VA 5BT9A 5KVCA 3RFTA 3E6AA 2OO5A 1YBVA 3F1LA 3JQ9C 3OJOA 4ZQHA 1GQYA 2F1KA 3ZCXA 3D0OA 4IXWA 5A02A 2O23A 2AHRA 1A72A 1U3TA 3JYNA 3ULKA 5A06A 1TT5A 3KLMX 3FF4A 4Y9DA 4BNUA 3WGGA 4L76A 1GYPA 5GZ1A 2I65A 2BKAA 1U8FO 2VT3A 1Z82A 1ZH8A 3BMOA 3JQAA 5ICMA 1HDZA 4KUEA 3VDRA 2Q1UA 4I08A 1GADO 4AICA 3TZ6A 1XCBA 4J91A 1JQBA 2VHVA 4NJMA 2CVQA 5COQA 5KVQA 2HMSA 5A03A 1ZW1A 3DAFA 3TOXA 5DP2A 1JA9A 4Z9FA 3NTRA 4YACA 4ZGWA 1N9GA 4G65A 5BR7A 3UH1A 3F47A 2JHGA 2ZKLA 1Q0QA 3SLGA 2ZTMA 4LSWA 1U3UA 3T4EA 5C3MA 4J7UA 5I7FA 1EVJA 3FRJA 5EL0A 3AI2A 4CLHA 3QA9A 2CZCA 3C7DB 4YRAA 1WDKA 1P0CA 4D44A 3H4VA 5F1OA 1TEHA 3WGQA 4M8SA 1LRJA 3BMQA 4XB1A 4FB5A 4RDIA 2PH5A 2DBVO 4MVJF 2HRZA 3S2IA 1X13A 1W8DA 3UW3A 3VC7A 1UZNA 4FOOA 4JX8A 1X7GA 2WYUA 1BGVA 3KHUA 2NADA 1SO8A 3H2ZA 4RDHA 1IYZA 4CMKA 3GFGA 3AUTA 5DCYA 1B15A 1XU9A 3QVXA 1EVZA 4P8RA 1PIWA 1UXHA 2VT2A 4O63O 3PQEA 4XRRA 3LYLA 1MLDA 3ZWMA 2AMFA 3RUCA 5ILGA 5AVOA 3W6UA 3VPXA 4CM8A 4PZEA 4R54A 3AUSA 5EMHA 3MWDB 2YDYA 4D46A 1LNQA 2Y0EA 4NBTA 4P4LA 4R3NA 4P38A 2X0NA 4I5FA 3V2GA 2Q2QA 3AOGA 1E6EA 4B3IA 4MVJE 1PL8A 3VVBA 3GVXA 4HFJA 4R5HA 5H83A 4NFYA 4H15A 1I2CA 4WECA 1T2EA 3KSZO 5JAQA 3FNFA 2C0CA 1I2BA 3GEDA 1EVYA 3GY0A 4GLLA 1WDLA 4OL9A 4WCFB 5B4UA 3DQPA 5TJ9A 3EHEA 2OL4A 2OUIA 5IF3A 2Y1EA 1O8CA 1OOEA 4F46A 1EEHA 4DMLA 2D4AA 3GDOA 4BNNA 3MJCA 5CDTA 1X7HA 1LDBA 5B4VA 1Q7GA 4EZBA 1I32A 3UCEA 2VZ0A 4OH1A 2VUUA 3U49A 3FNGA 3GNTA 4D3DA 4TSKA 3MWEB 3G79A 3JD2A 1O95A 2PA3A 4LMPA 1HE3A 4GQAA 4PG4A 3TRIA 5FI3A 4R69A 5J23A 1Z74A 2AW5A 2Z5LA 5TRTA 4B7XA 1UP7A 4RF4A 4A26A 1YKFA 1LSSA 1PL6A 4AJIA 2O3SA 3CUKA 1EUZA 3CKYA 3QVOA 4DL9A 4PVDA 2DBQA 4JXKA 4ZRNA 2HAEA 1MFPA 4MKZA 5G0UA 1PJQA 2YHIB 3SX2A 5JCXA 1JKJA 3CPSA 3Q9NA 3ZWOA 1IPFA 1N8KA 5JY6A 3LC2O 3PDUA 3PPIA 1H5QA 3LT4A 2VCYA 3G17A 3BA1A 2WEKA 1P74A 5I8WA 2RH4A 3FR7A 3PFFA 2JCXA 4ND1A 4RORA 3C85A 2OORA 4NK5A 2E37A 4ZQFA 3P19A 1ISHA 2HMUA 1Q7CA 4BNMA 3O9ZA 3V2UA 4ZA2A 2A9FA 2OHXA 3Q2KA 3OEYA 4E5YA 4ROSA 2W2LA 2NLOA 3VOSA 2IEDA 1WXDA 1HRDA 2PTGA 3JD1A 1A9ZA 1BWSA 4DA9A 4NMHA 1LSOA 4YTEA 5HTOA 5L40A 4YVFA 1ZVMA 5F1KA 3E18A 4EJ0A 1CDOA 2I76A 2I67A 1GL3A 2W2KA 4WCFA 3EMKA 2HSDA 4JJIA 3RJ9A 4R9SA 3RVDA 1V3VA 4K28A 4MVJH 4U6QA 1YB4A 2VTEA 2WM3A 3HDJA 3PTZA 1B2LA 1E7WA 1U2GA 2XXBA 3CEAA 3IIEA 2AQHA 4IS2A 3EDMA 2DUWA 3DOJA 3GUYA 5IZCA 4BO4A 1KYQA 1K2WA 3RUDA 4FN4A 4I9NA 3IDSA 4NBVA 1LRKA 1VL6A 4NJOA 4R16A 2G82A 2NSDA 5K0ZA 4J3FA 2EG9A 4BHTA 3NTQA 4GGOA 1C1DA 4XYBA 5CEEA 2YUTA 3KYCA 1TT5B 3ZHYA 1IZ0A 1PJ2A 1LQTA 3AM3A 1GEGA 3JD3A 4AJ1A 4BNTA 1LA2A 2WD8A 1J49A 2AXQA 2Q4EA 4R1UA 1HSZA 3ZWWA 4B79A 1Z73A 2B4RO 3UFXA 4CM1A 2GERA 3E03A 1I24A 4OO3A 3GEGA 4MVJM 1DHRA 5KJ1A 2O2YA 2B0JA 4XA8A 2EKQA 2JAHA 4W9NC 3GA0A 2YHIA 4R1SA 4TVBA 4HBGA 3CXRA 3L9WA 3E9NA 1SOVA 2J3HA 3OMLA 4Z6KA 3ON5A 1GYRA 4IDCA 1VKNA 1B8VA 3WNVA 4BO3A 2ZQZA 4Y8VA 4BKUA 1DO8A 1P3DA 2O3JA 2ZB8A 3L6OO 2G0TA 3JQ8B 3DBRB 3IKTA 2HMTA 4IDGA 2Y68A 3H7AA 2XPCA 1QORA 3QQPA 4PFJA 3T7EA 1FJHA 4OKIA 4YAGA 2HJSA 2VWHA 1R0SA 2Z1NA 1NQAO 3NKLA 5KJ6A 4C7KA 2OXIA 3OH8A 3IKVA 5B12A 1DRVA 1QR6A 4WEQA 1EUCA 1HDCA 3S8MA 1B16A 2VUSA 3OJEA 4IM7A 4RPKA 1ZMOA 4DXHA 1ADFA 2RIRA 3QV1A 4W82A 3RD5A 3HADA 1Y9EA 3L4BA 1B3RA 1C1DB 3GPIA 3OSUA 1PGJA 1R66A 2PH3A 2EKLA 2RHCA 1XG5A 3HJAA 3Q0EA 1GPDG 4E4YA 5I9LA 2EIHA 5G4LA 1KC3A 2X5JO 4AJNA 4NK4A 5G0SA 3GZ4A 5I9NA 3AY6A 4PLGA 3ZWPA 3DR3A 4CLEA 2TMDA 3I9MA 3P2YA 5GZ6A 3NX4A 4PG6A 4DREA 3I9LA 3ZWXA 3RQSA 3KXDA 2OGUA 1T2DA 2YY7A 4CR7A 4QTZA 4NH4A 3HE3A 1LLDA 3GAZA 3L77A 3AUUA 3WOHA 1U8XX 1LSJA 1LSUA 2OZPA 4Z0TA 3WTCA 4ZQGA 3V5NA 3K5PA 1VC2A 3BHJA 2HLPA 4PG5A 1KEWA 1V9LA 1CEQA 1X14A 4RVUA 4YPOA 4BVAA 4YJGB 2DM6A 4UVEA 5G2OA 3BZUA 1JVBA 2WMDA 4XDYA 1CJCA 4YT8A 3JCZA 4EBFA 4AJEA 1FDUA 4CM3A 4WOKA 2PD3A 2B69A 1I2ZA 2DPHA 1LDMA 1ID1A 1F14A 3H65A 2EWMA 4KWIA 4DQVA 2WE8A 4ONEA 1O0SA 1UXJA 1S6YA 2I9PA 2ZB4A 1YE3A 3IL2A 1Z7BA 2VYVA 3RU9A 4MVJA 4YDRA 4IMPA 2OBNA 3GR6A 1PGPA 1X0VA 1P33A 5TT0A 2ZJ1A 3V8BA 1NFQA 1IUKA 1QLJA 4J9UE 1UXIA 4M86A 4WLUA 1GZ3A 1PQUA 4N5NA 4E21A 1JDJA 3X2EA 1LLUA 3V1UA 1DHTA 2CDBA 4U5QA 2X9VA 3QHAA 4E30A 3KYDA 3JQFC 1CF2O 3A06A 3JQGB 4DBZA 1C1XB 3BMNA 2ZATA 3OBBA 4FPXA 2JCYA 4HP8A 4A7PA 4Z3KA 1E77A 3RKRA 2JFFA 4ILKA 3TZHA 4E33A 1BXZA 5TX7A 4ALIA 1NHWA 2VRCA 1N9GB 2FPGA 4OM8A 5KCZA 1EUDA 1DPGA 3HG7A 5KVVA 1HYGA 2V6BA 3C24A 4CPDA 1TI7A 1ULUA 2PKQP 3GGGA 4YRBA 4J1TA 3SJ7A 1ISMA 4PLVA 4YAJA 2VRCD 5B1YA 4IY1A 5L51A 4DC0A 4HFMA 3HNPA 3U09A 3Q6IA 3NJ4A 1HXHA 1SAYA 2C2XA 2X58A 3PLRA 3FBGA 1YS4A 2ZYAA 2POQX 3KV3O 4MIEA 4UVIA 4YJFB 1C0IA 5EIOA 1UZMA 1SOWA 3SJUA 3WFIA 2UUOA 2BI7A 3H3JA 3BMNB 1R37A 2HQ1A 3JQGA 1ULSA 1A27A 1XA0A 5H81A 1SCUA 4M54A 1O94A 3F5SA 4NU5A 1NX6A 2BFMA 1GY8A 2EGGA 3GAFA 4PZCA 3DC2A 3R1IA 2D8AA 2E6UX 3H9EO 2DLDA 1Q7BA 1HYHA 3I83A 3DBVO 4J9VA 2ZB3A 4D41A 1RYDA 2JD0A 3Q3CA 1DBVO 5DOVA 4YRDA 4CQLB 3VH4A 4EDFA 2JAPA 1NASA 3PIDA 4GMFA 4RZIA 1VJ0A 1GD1O 3DZKA 1Z6ZA 2RAFA 3ADPA 3NDIA 4IUYA 1H9AA 1Q2XA 4PGFA 2CFCA 1NR7A 3GN2A 2BFPA 3AI3A 5IJZA 4WLFA 3RC9A 3FCOA 4IJUA 4IINA 2NWQA 4D3SA 4CMGA 3V1YA 4NFHA 1J4AA 3L6EA 4AJHA 4GKVA 5JCJA 2FR1A 4UULA 2GYYA 3AFMA 3EVNA 3GEMA 4MOWA 3EVTA 4CM9D 1JKFA 3GC6A 3QW2A 3DMTA 1UR5A 1I0ZA 5GZ3A 3CMMA 1CRWG 5CG2A 1K3TA 4ALMA 1XQ1A 2YQ4A 3JYPA 1NPDA 2BMAA 2I6TA 1ZK1A 2VNAA 1U3WA 2Y0DA 1DB3A 3OQBA 4J43A 4BNIA 4KQXA 4AFNA 1ADGA 1IPEA 1SPXA 4MKRA 3JQ7B 5C7LO 3GRKA 1FDTA 3KSDO 3MCVA 2PKRA 4WCDA 4H16A 5K6AA 3I9NA 1QMGA 3VKVA 1CYDA 1AXGA 1AHHA 1Y1PA 3M2TA 3KETA 4DYVA 5HWSA 2AE1A 1T1RA 2J3JA 3HDHA 4E32A 2E49A 4O1MA 5CG1A 4DPKA 3B1JA 4BS9A 4E3ZA 5IN4A 1N1GA 4IQGA 3FTPA 4M49A 2FN7A 1YVEI 3H9JA 3C7AA 4KZPA 3EZYA 2Y1GA 3WIDA 1ML3A 5JO9A 1O5IA 1Q1NA 4MVJG 4E0BA 2IZ0A 3UHAA 5JAIA 3A4VA 5I7SA 4RQUA 1PR9A 1I8TA 2DTEA 4HX5A 1GDHA 1GPJA 4JJGA 3SEFA 4K6CA 4TVOA 5T64A 4YQZA 3MEQA 1J6UA 3F3SA 2FPPA 1QXSA 1NM5A 3GG2A 3JQCA 4IIVA 4XX0A 1NFFA 4UVHA 2IZ1A 4CMAA 4E2XA 1FXSA 3EK2A 1QRRA 2VHYA 2J3KA 3G0OA 3DMTC 1T4DA 4BNJA 1GUFA 4B3JA 2Q49A 3ONDA 4R1NA 3WBBA 1UXKA 3QRWA 4CMIA 1UUFA 5L4NA 1PL7A 4J49A 2Q2VA 5A04A 4IJVA 1LJ8A 4XR4A 5KJEA 4IDBA 1EFKA 2VQ3A 4C4OA 5KVSA 3RUIA 3WGZA 3H9QA 4IDEA 1O6ZA 2C2YA 4K26A 3RC2A 4OSOA 1T26A 4EEZA 2CF5A 4GVXA 3WWYA 4L8VA 4YQYA 5BSGA 3RFXA 5BSEA 1IZ9A 2VOJA 2AQKA 2CY0A 1GV0A 2DFVA 4I9UA 1V3UA 3DFUA 5DBFA 3EY4A 1HDYA 1TT7A 3I5MA 4E2ZA 1RM5A 4BL5A 5T8KC 5A9SA 3OA0A 3ROKA 5I7EA 4EJMA 3I4FA 5BNTA 3INRA 3IOYA 1R0LA 4AJ2A 1KY4A 3P7MA 3BTSA 1LDNA 4WNCA 1WZIA 4XYLA 4XIYA 4XQEA 4K1LA 2G5CA 2TMGA 3VH3A 2BGMA 2D5AA 5JDCC 4DIBA 1D1TA 5KJCA 4GVLA 1KVUA 1A5ZA 1Q0HA 2QZZA 3GVPA 1YB1A 3MJTA 4LN1A 3GK3A 5L53A 1HE2A 4E2WA 5CFZA 3GVCA 1T25A 5KIAA 3D3EA 1I3KA 1E92A 2O3TA 1IHYA 3TFOA 3AOEC 1DOHA 3HSKA 4CV2A 2CF6A 3TL2A 1E1LA 4FGSA 1LX6A 5F1PA 3D4NA 3U5TA 1XU7A 1Z45A 3UCFA 6LDHA 1RKXA 5DT9A 4NDNE 4GMGA 4LK3A 2ZQYA 4KP7A 3ZNQA 4FIZA 2QRLA 2ZIZA 3ETGA 1NBOA 1WLYA 5U1PA 4XDZA 3DZJA 3WQRA 3GZNB 3PJGA 1V6AA 4N7RA 1XKQA 2P9EA 3AFNA 1N7GA 5DULA 4YYZA 1QLHA 1PZGA 2Q46A 1GUYA 3OIGA 2IYPA 1AGNA 3JQBA 1ZCJA 4FQ8A 4OQYA 1KVTA 4Q9NA 1P1JA 3ANLA 2H5LA 3JQ6A 4I8XA 1HLDA 3GGOA 2RHRA 3DXFA 4QSMA 3ANMA 4GAEA 1KY5A 3QLJA 5B4TA 2P4QA 4AVYA 1KBZA 4A10A 2PZKA 1GR0A 3NYWA 4URFA 4A27A 4AJKA 1ENOA 4XYMA 1GUZA 2VHWA 5JXWA 1UZLA 3ZHZA 2GUGA 4WE3A 4ZICA 4BKOA 1DIRA 3R6DA 4J1NA 5CPFA 3H2SA 3ITKA 4IBOA 3GT0A 1Y5RA 1WPQA 5JMWA 1LBEA 4MIOA 1FDSA 2DAPA 3PJDA 4RV9A 4GX2A 2ZTUA 1VL8A 3FWZA 1ZK4A 1VI2A 2NU9A 2DU8A 1GQ2A 3TFQA 5TS3A 2O50A 4MP8A 4M87A 4OOFA 1QYDA 3ABIA 1MUUA 3C1OA 2D59A 4BOYA 4CLOA 1E5LA 1UXGA 2IRWA 3WYCA 5MGBA 4U6SA 1KEUA 5JO0A 3KO8A 2EERA 4RF2A 5L7YA 4B4UA 3WWZA 4KDFA 3SC4A 1MA0A 4J4TA 1NHGA 3BTVA 7MDHA 4Y6PA 1BDMA 1K0UA 5CHEA 1NTOA 3U0BA 4CQMB 3TN7A 3UOGA 2I3GA 3DAGA 1JWBB 1M6HA 5JC1A 2BGKA 1KVRA 4UVGA 4B8ZA 2VYNA 1ZJYA 4LRTB 2GO1A 2Y66A 5EQFA 5G0TA 3JYOA 5I9MA 4I5DA 4MP3A 4YT2A 2IXBA 1JVSA 4XQGA 4E5KA 2GLXA 1WP4A 1B26A 2Y1DA 3KYDB 3DONA 4OSPA 4KOAA 3UVEA 2GR9A 4WLOA 1ZJZA 2DPGA 3SC6A 4B3HA 2VZ9A 3LDHA 3AU9A 3GLQA 4X54A 3ANNA 3O8QA 4LW8A 2VUTA 4Z9XA 1YB5A 3ETEA 5DF1A 4PCVA 4BV8A 3FI9A 5JCJD 3LT0A 1ZMTA 1VL0A 1MV8A 3HWRA 2GZ3A 4LCEA 1I10A 3DTTA 2P2SA 4BO7A 2X86A 5LDGA 3NT4A 2H6EA 3IC5A 4WEOA 2W2KB 3JV7A 4CV1A 3QWIA 4KTVE 3OQ6A 4HXYA 5DBIA 2BELA 3PZBA 2NU8A 4FJ1A 3RASA 5LDHA 3C3XA 4XGNA 2PLAA 1FF9A 4XCVA 5T67A 2PNFA 4W4TA 1TVEA 4BQRA 4FR5A 1DEHA 2G76A 3AI1A 2BLLA 3M1AA 3HB5X 3N74A 4LSMA 4GX5A 2Q50A 4ZU3A 7ADHA 4LMRA 4C7JA 5IXSA 4AG3A 1JU9A 3B6ZA 3ENKA 4JCOA 4MINA 4CUKA 4D3FA 1SEVA 1JAXA 2EP5A 2X5OA 3PWSA 4IDAA 1D4FA 3LZ6A 3H3FA 3E48A 3KTDA 5AYVA 4O6VA 1RJWA 2V6MA 5EESA 4NI5A 3WGHA 4L4RA 2UAGA 4CQMA 1BVUA 4XRGA 5FI5A 2JFHA 1DSSG 2V65A 3FNHA 1K89A 5JAMA 3IP3A 4CM6A 3OHSX 4E2YA 2GCGA 4W6ZA 3RU7A 4U0JA 3E1KA 5BNIA 2IYOA 5KNLA 1E3EA 2DC1A 1E6WA 1HDXA 5CP8A 2AA3A 5C5IA 4ZQEA 1NP3A 1AE1A 2NU7A 1QV6A 4MVJD 1G6KA 4ZQBA 1HWYA 4YAKA 5IDYA 3AU8A 3CMCO 4M55A 3RUHA 1R16A 1BW9B 4DBVO 1L7EA 1P45A 3FWNA 5CPBA 3T4XA 2LDBA 5B37A 3UGKA 1K5HA 2Q4BA 2HRBA 5ILOA 3VAZA 4BNKA 4XIJA 4QEDA 4ZN6A 3ZWNA 2RH8A 2WE7A 1VLLA 2NTVA 4LVUA 5K9ZA 5BNFA 1I30A 4FFLA 1IY8A 1VE9A 3ICCA 2PV7A 4RVSA 5DZSA 3IUPA 2QHXA 5THQA 3L6DA 3NEPX 4JJFA 3ZU2A 1OBFO 1TXGA 3A28A 3JSAA 3B1KA 2EW2A 3UN1A 3HFSA 4BO8A 2GD1O 1YJ8A 2YFQA 2Y1OA 1HSOA 3WNQA 1N2SA 4UUNA 1YQXA 4DLLA 2C82A 1WWKA 1ZO8A 3OEWA 3OA2A 3AWDA 3O4RA 2B5WA 2YW9A 2O48X 1Y8RA 1LUAA 2DUUA 3VDQA 1M66A 3ZNNA 4CLRA 2IXAA 5ENDA 1LXCA 4AJOA 2X5KO 4K9DA 1SB8A 1YL6A 3BHIA 5THKA 4CMHA 3I1JA 4PG7A 4FBGA 4L75A 1JLLA 1SBYA 1GCOA 1BG6A 1TB4A 3DB2A 1GZ4A 4N5LA 1YQGA 3M6IA 2X6TA 2FOIA 3IJRA 1U4OA 4QFCA 1RM4A 2FSSA 2B5VA 2P9GA 3JQ9A 4RF5A 1NVGA 4NPCA 4DWVA 4RGBA 4PRKA 3AY3A 5EINA 1P31A 4LVCA 3LC1O 1SEPA 1HETA 3FN4A 3GUCA 3QJ5A 1E3WA 2A35A 1E6UA 4DLBA 4JLWA 4BNZA 3O8QB 3LLVA 1C0LA 1Y8QB 1Y8RB 4BNGA 1QV7A 1U3VA 4R01A 3QWBA 3K73O 2YV1A 4IZIA 3STHA 3GMDA 4XQ9A 1YH3A 5JE8A 3L07A 4GSKA 5ITWA 3C7CB 1E7MA 4P4NA 3L4BC 2DTXA 4D79A 5KKCA 1BSVA 5ITVA 3Q9UA 2UVDA 1DC5A 3UCXA 2DT5A 5L9AA 1MFZA 3SXPA 3OIDA 2PFGA 3TL3A 2ZJ0A 1P1IA 1OC4A 1B14A 2QRJA 2SCUA 1NWCA 5TGDA 3NAQA 1JWAB 4ZVVA 1R0KA 4CM9A 3LVFO 3D3WB 4YR9A 3PRJA 2Q45A 1XHLA 2O7QA 4FFOA 3TNLA 2R6JA 2V7PA 1ZXBA 3JQAB 4YJFA 3VPSA 1LU9A 3WR5A 4CLXA 4NNJA 3GVHA 3BTUA 2V6GA 1NVMB 4XWYA 4D0RA 4D0SA 2D5CA 4WLEA 4UUPA 1LC3A 1G0NA 4Z0PA 3KYBA 3TJRA 1IL0A 1I33A 3RFVA 5HBRA 4PLCA 4OIMA 1WW8A 4CMJA 2X9GA 3B1FA 2B36A 1LEHA 3M1LA 4GWGA 1PS9A 3QVSA 3VPGA 4YA6A 1L1FA 3BHMA 2P68A 1U1IA 1HL3A 1I36A 4DQUA 5U4QA 3GGPA 1HE5A 3DDNA 4MVJP 3KSUA 3K2EA 3P5SA 2V6FA 3VH1A 1U2DA 3BIOA 3DZHA 5JYDA 4DPMA 1VRWA 4UREA 1UH5A 4S1VA 1GYQA 1PTJA 1K6XA 1GFSA 2UDPA 1U7TA 4WKGA 9LDBA 4YJDA 4E31A 4OMUA 4W99A 4E5NA 1F0YA 4F6LA 5T5QA 3S2GA 3UAGA 4J7CA 3VHRA 3DHNA 4IDDA 1M6WA 1D1SA 3LK7A 5TIIA 4CLOB 2VHZA 5KWEA 4PVCA 4F3YA 2CVOA 1NPTO 2OOSA 3EZLA 1N1EA 4XJTA 1Y6JA 3DAPA 5IZCC 3WYBA 3RI3A 1ZUD1 4Q39A 4RVHA 3ZU3A 2FR8A 3LF2A 3GOHA 3ZGYA 2QX7A 3E82A 5AOVA 4Z9YA 2CDAA 4Y67A 1HF3A 2HJRA 1Y8QA 4J0EA 3D4OA 3VVCA 3HN2A 2QRKA 3DO5A 2NVWA 3C1TA 5JDCA 2DBRA 4AJLA 2XF8A 1EZ4A 1ZEJA 3ZNPA 5HS4A 2GZ2A 1CWUA 2C07A 3TDKA 3DHEA 3QVTA 3KEQA 4QO8A 4O5OA 1SMKA 2Y99A 4J2OA 1QKIA 1U7HA 3DBHB 4RO0A 5T8KA 5HS6A 3WXBA 4E13A 3G3EA 3K9QO 4NBRA 1QYXA 3AOEA 5IDXA 2FP4A 4Q3AA 1E3LA 1JN0A 1V35A 3PJEA 4BO5A 2EP7A 2J5KA 1UP6A 4ND5A 5HM8A 5JDIC 1NYTA 4I9HA 4FOSA 3I4CA 1ISIA 5IN5A 4CLRB 4KDEA 4OQZA 3OQ1A 2D0IA 4AJJA 4PN3A 5TC4A 2W98A 4U8GA 3E5MA 5L7WA 1DIBA 3E8XA 3RAJA 2WDZA 1YGYA 3ZZNA 2VWQA 4LISA 2BD0A 5ER6A 5TNXA 2HMVA 4J4HA 5G0VA 1KEVA 4RQTA 4W7IA 1YOVB 3ZV5A 4B8WA 2GN8A 3DHYA 2O4CA 2BI8A 3KM0A 3EW7A 1MG0A 4N5MA 2I99A 5AXCA 4YT4A 1S7CA 2YQ5A 1ZK3A 4FJ0A 4BO0A 4Q3BA 1H93A 4UAGA 1UDCA 2X0RA 3WGIA 4GL4A 1PR3A 1HKUA 2QG4A 3BXXA 1EMDA 3GN1A 4YEDA 5FWNA 2YV2A 2WSBA 4J1SA 4IDFA 1Z75A 4L9RA 4GSLA 3DOOA 3PDJA 1GZ6A 5F21A 1P77A 1BDBA 4JNKA 5IDWA 4RPJA 5G4KB 2FZEA 5FEUA 3JYLA 2OBYA 4OHUA 4D7AA 3P2OA 4WPGA 4CMEA 3ROQA 1MG5A 5DNAA 2Y1CA 1E1MA 4OXYA 3KBOA 5L7TA 2BF7A 1B8PA 3WMWA 2O7SA 1MGOA 4IQ0A 2J5QA 2PD4A 4CMBA 1JTVA 3DZBA 4HADA 4RL6A 1BMDA 2ZCUA 3VPHA 4OXKA 1C0PA 2AEMA 1X15A 4RCVA 1FDWA 4R9RA 1I5RA 1T2AA 5ADHA 8LDHA 3WJ7A 3RUAA 1ENYA 4FSHA 4ND3A 3JQEA 4BNWA 3JQBC 1KVSA 2PKQO 4BNVA 3GH3A 3LQFA 2A4KA 3H9GA 1NR1A 2OP0A 3LSYA
chains in the Genus database with same CATH superfamily
1OU4A 5CDGA 1ZUWA 4XARA 1ISFA 2HSWA 3DYBA 3IGFA 3CRNA 1YFZA 3PGLA 4IXDA 5AM5A 5C34B 3ZU6A 5CD9A 5IZ4A 3NS7A 3DDCA 4JUCA 2VUHB 4E5PA 4EG1A 4DLRA 2ZXEA 3ZHUA 2BH9A 4ZVPA 5E4JA 1T5DX 3A1TA 3CO0S 1AZLA 4LGVA 1KMHA 4LJ9A 4RJJA 4NENB 1X86B 3U3MA 3DJFA 1U0FA 4HWKA 1WABA 1L5WA 5F5LA 4ZMSA 5JAPA 1TM1E 1U2QA 2GQ0A 3NRCA 1VFPA 1MABA 5FHRA 4D5GA 2QRZA 4X44A 4YCDA 1RC1A 3H86A 4ZOBA 3I9JA 4K81B 2JEOA 1NW7A 1YC5A 4WA8A 4AY3A 1N6HA 1X1EA 3UG7A 3PYLA 5AW2A 5IVKA 4UUOA 1H9CA 1XOIA 2YBDA 1TD1A 2XAAA 4PNEA 1SKMA 4I19A 3C4QA 2ERCA 4NQZA 4YJHA 1PJ8A 2CVZA 2HK8A 3F5MA 4RH3A 3TNDA 3VMMA 3VOBA 3DKRA 1QYWA 3NG1A 4BTLA 4MUYA 4DUYB 1HYQA 1JSZA 1T9CA 4Q5IA 4R9VA 4W8GA 1QO9A 4WXEA 4J2HA 2AKYA 4DCJA 1AVTA 1ZUNB 2FQYA 3N8IA 4KSYA 4MW0A 2Z1MA 4OA8A 4RA9A 4RXTA 3O3CA 5GVSA 3PP8A 1WXQA 5AP9A 5LP6B 4KJXA 4F2WA 1S8AA 4MKXA 3W2EA 1ODTC 1FE8A 4G0QA 1BDIA 4YBRA 1E2DA 3ZCUA 2H48A 1UFQA 2BEWB 3B3JA 4YN3A 2FZLA 3HBMA 1XMXA 1G8YA 3E9DA 5CAEB 5J2TB 3O2NA 1N75A 1RKVA 2GBPA 3AM5A 3EGDA 3L0DA 4M53A 3DO6A 4PANA 4XEHA 3LE8A 3GG9A 1AHIA 3IUYA 1YHZA 3D6FA 4EO7A 4O4JF 1HTBA 2OMKA 4Z4FA 2B7LA 1PZEA 4EITA 4ZVNA 4OXXA 3TSCA 2O2XA 4PC2A 1MQ9A 4FCCA 4I50F 4CM7A 1L7QA 3GFSA 3OQMA 4ZVSA 5A4DA 3U4QA 4MUHA 2PPLA 3T3GA 5DBOA 1E62A 5KKAA 3TAUA 1TKAA 2ZBDA 4FEYA 3BORA 3DVRX 4V0KA 3CRQA 4LHYA 1RRMA 1AKNA 1K2VN 1P4HA 4EJSB 1NUTA 2NSLA 5EJ8A 3I6MA 3DQQA 2IZ7A 3GNQA 2C7OA 4P58A 1N2IA 3WSWA 3OBIA 3MJHA 2ZSFA 1TGYA 1HOTA 3LCMA 1AKVA 2H7YA 3F0TA 5J4LA 3QNUA 1VPVA 2OB1A 1T2CA 2EARA 4RD2A 2DH6A 4I4CA 3UYKA 3VX4A 4E15A 2E82A 1GCIA 2VJAA 3I23A 4MYCA 3SBOA 4CEIA 2RHDA 5FBHA 4C03A 1YOBA 1DQNA 2A94A 5HIKA 4DUZB 1ZYUA 2FZ5A 2PU7A 3PVZA 2GCEA 1DJNA 1G3IA 1C9KA 1N5DA 1FP2A 1H42A 2FRDA 2XMCA 2ZJ7A 3OPQA 4FDUA 4EATA 3F46A 3ZV7A 1Z25A 2BMFA 2VH1A 4LV6A 4PX9A 4Z4QA 2IS6A 3ZC3A 5F3RA 3ZGOA 1L5GB 1Z7YA 3ZHCA 4JQYA 2O3UA 1BQEA 1AO3A 1L6IA 3LX5A 2BFOA 2VSFA 3AP2A 3LA8A 4OP3A 1E7YA 4WK6A 1AUPA 4QUHA 2H18A 1GL6A 3JZAA 3CNBA 2J7KA 2G83A 3MBOA 1H66A 3UJ8A 2JFUA 4GS5A 3PYXA 5JPIA 3GJ5A 1N34B 4OLJA 1J9ZA 4ND4A 1P80A 2OK7A 3PC2A 3D5QA 4J8PA 3SS8A 5AK6A 1Z62A 2WKPA 3KEFA 4AUNA 1VPEA 1JNYA 2YV3A 1R3UA 2A7XA 2IH2A 1FIUA 3DF7A 1AUOA 4R2MA 3M6MD 1P9LA 2Q3JA 2YL2A 4LUCA 1X9HA 3VU9B 1O0BA 1FZTA 2P9ZA 2QTLA 2GVDC 2ONYA 4NULA 4M0UA 3OX4A 1W1IA 2W43A 4FYIA 4HH0A 4XPZA 2X1MA 1MR3F 4QBHA 3ZE8A 4HOYA 3B2NA 3GBSA 5IAAA 4R9NA 1Y3IA 1X38A 1SC9A 2NT4A 2NU6A 1HDEA 2QRQA 1ECBA 3A10A 3L8EA 4WNIA 4DLTA 5K03A 1V6CA 4DSOA 4CQJA 1L7VC 1XLTC 3FZQA 2OLJA 4I5GA 3IVAA 1YB7A 3F6PA 3KZNA 4PO8A 4OXQA 4I0WB 3THSA 1EXMA 1M6NA 1T10A 1OASA 1PZFA 1CIVA 1OQAA 4QYMA 5IULC 4RTMA 2HOQA 2OM6A 3BF7A 1BRTA 3DEYX 4HY3A 2BEJA 5CDYA 4OLAA 1TZCA 1L5MA 4YJ2A 5E0KB 5TB5A 1IUNA 4UTVA 2W2OA 5HXAA 4G09A 1KIFA 2RGWA 3HRHA 4P7GA 4Y2RA 5JXJA 1O77A 4MUAA 4H6VA 1A8PA 2X8AA 1SIBE 2H9IA 4URWR 1SD5A 1E5QA 1XTKA 2FN9A 2IUFA 3JQDA 4ALNA 2HSGA 3CB2A 1QG4A 1Z15A 2FN4A 2BMJA 2V4MA 2CMFA 4QASA 3J81k 1U8CB 5FT9A 3E9ZA 3QXSA 2FWJA 3VHXB 3P97A 5EWJB 3RQIA 4FX2A 4LJ5A 3W79A 1UP4A 2IU3A 4WASA 1MZPA 1EX9A 3K2BA 4M7OA 4CT4B 4Z4GA 1W94A 4QX6A 4F0JA 2QD3A 3OZCA 4CL2A 1P1HA 2OD9A 2EP8A 3HY3A 1UBFA 1PUXA 3INNA 4KNWA 4KXYA 4QECA 3CZRA 1TC1A 2OV8A 3TZQA 5E3HA 3K6RA 4HNVA 4YASA 3RWMB 1OPRA 2ONZA 4HNAB 4IAOA 1BVHA 1VSTA 1JJ7A 3NAGA 3AEUB 5LYJA 2B37A 4O3FA 3VO8A 2OE2A 4PN7A 3ST7A 4E7OA 1MA3A 1J42A 1GFIA 4QYSA 3HUUA 1Z35A 1W7AA 2JIMA 3IEXA 2OORC 3VR0A 4BMSA 3N5CA 3D8BA 2M6RA 4PRYA 3S1LA 4NZ9A 5DVZA 4HF7A 1J0XO 1M2WA 3ZE1B 3NBYC 3PXCX 5DB4A 4ARZB 5ECYA 2WIGA 3C3BA 3FF1A 3ENZA 1N8SA 4P22A 1RP1A 1GGFA 4GKAA 1YZLA 5MGNA 2JIZA 4PE5B 1L5KA 4A5SA 3TQHA 4ECEA 4WK2B 3WLRA 3EQ7A 4ZJUA 2J41A 2BDTA 2YXDA 3LC7O 2OAP1 3OM0A 1Z56C 4DQKA 4TXLA 3U3XA 2W6NA 2P2CA 1C41A 4DMKA 2ACWA 4WY8A 1A4UA 5F76A 3OWXA 2IYNA 3BWVA 3G2QA 1EJ6A 3BM5A 3HU2A 4JJ8A 3MJFA 2Q1TA 4K87A 3RTGA 2I2BA 3LW8A 2DHQA 4QQKA 2WU0A 3I42A 1ZOPA 1J0AA 2KWIA 4TOIA 3OEEA 4C0QC 2FXVA 4LYGA 2OFFA 2PV0A 1KJ8A 3VGJA 3WO1A 2I6SA 4GPD1 5IDQA 5IBCA 2XD4A 1N2HA 3BE8A 3OPXA 1NI4B 3RUFA 2BCEA 3MB8A 4QULA 3VAYA 4BGVA 1AKMA 3EIQA 4MO2A 3UJ6A 3R3HA 3PUJA 5TF4A 2ZYVX 4CG2A 5TE9A 4AMYA 1ZG3A 1YS1X 3QVKA 4TKUB 4UU1A 3VZRA 1BH6A 4LHVA 3NUZA 3AR2A 2XUDA 4C0AC 1HNZB 1U2DC 1EFPB 1KI4A 2QLFA 3O90A 3IS3A 4DDTA 4DA0A 5I4BA 5E7MA 1XZLA 2FLWA 4MARA 2FR0A 1K9VF 3BL8A 4YJHB 3IPLA 4NEQA 5HMLA 3FIUA 1EVEA 1W5AA 4EHBA 1BS1A 4NL4H 3WK9A 4C4YA 1XXLA 5CCXA 2OBXA 5JWHA 1Z5WA 5EJIA 2AUNA 3EXHA 1E6MA 5HIMA 4AKTA 1TM7E 3NIWA 4LYFA 1ZLYA 3WOVA 4H7IA 4TV8F 4B80A 3TUIC 5IXYA 3TD2A 3RRNA 3VZBA 1UBJS 3JQPA 4LDZA 3ZI4A 3TLAA 3ERCA 3HEAA 5DLPA 1KEPA 1AHPA 2F9MA 1E3SA 3W7AA 2OCDA 2E18A 3CH6A 4JBHA 3IP1A 4YBZA 5BXYA 4RA6B 3QX9A 2AN3A 1WZEA 3G9ZA 3GCZA 2B4TO 3LXXA 3TI7A 1BTOA 2EKDA 5FJJA 3ROMA 3F71A 1D1QA 1B0AA 4MKHA 1G9SA 1G7SA 1SBNE 3ZDRA 4CODB 5HQ3B 1VKOA 3SIWA 1U1DA 4PO1A 1X80A 2FB9A 1EGHA 4N18A 1SCQA 2C5AA 1J06A 1U5CA 1VE6A 1D2NA 1WUIS 3A14A 1ZMXA 3PG5A 1OX4B 3JWIA 2VHXA 4JZKA 3KOUA 4KQHA 4RVGA 1EDDA 3HPQA 1E4OA 4J1QA 5CT6A 5AKKA 1LK5A 4HGYA 3EMDA 5JZOA 3OEHA 1JKJB 5GGXA 3WIBA 5LR6A 3EGEA 3UJCA 1H6DA 4Z3OA 3WL7A 2QGNA 3D4IA 1KWKA 4HDKA 5TMEA 1F0KA 2VTKA 4PGHA 1KBOA 3T7CA 3O1HB 5SY9A 3PPWA 3T9FA 3T1OA 4D4KA 3DZIA 1KZYC 2WHRA 4MXDA 1P7CA 3ASVA 3MBIA 3T7IA 4LZAA 3X2FA 1FTGA 2MTBA 3Q11A 3PKJA 2GPAA 1WXHA 2UYYA 4C22A 4CTJA 1ZGCA 3X1JA 4F96A 1F8FA 4FX5A 2A33A 3G8BA 4K6OA 4NVRA 3KZVA 2DQZA 4MTLA 5COAA 1GA6A 1R6DA 5FUMA 2HA3A 2ESRA 1ADJA 2G8NA 5CEJA 3ZQ4A 4JP3A 4EVRA 2ZBQA 3QVGA 2JB9A 1AC5A 3OKAA 3ZBTA 4GIBA 4AI6A 2FSUA 4W1PA 3G1WA 4ZEOA 4Z49A 2P79A 2WFAA 5SYNA 3KUXA 2H1SA 1JVNA 3D7RA 4YQEA 1SNYA 3KYJB 4PLPA 3T5DA 1COWA 4B2PA 2WSYB 5ER9A 4H1VA 2P7IA 3ABQB 3IOBA 1VJTA 3D6UA 3ZWAA 4HQ0A 1JX6A 1SWWA 1UT8A 4OAPA 3UT5B 4QSHA 3AKZA 2QGZA 3BSFA 2SCUB 2A9KA 4YROA 4ITUA 2PK3A 2WVHA 4QFMA 2IHBA 1ZH0A 2X4GA 2OXTA 4OHBA 2VDNB 4ZEVA 3LP5A 1QZ3A 2VF2A 2FMIA 3QWFA 4ME6A 4TRRA 5AJWA 1KOLA 4GKKB 2IYSA 3WP0A 2OV4A 2WABA 5CDSA 2FPIB 1PWEA 1DLJA 2XWPA 4M1QA 1NURA 2LV8A 3B6MA 3TW8B 1KJYA 1MAWA 1R18A 2AG5A 4W5JA 1YCDA 3IE2A 4ZI7A 4ZVTA 2VAMA 3AM4A 1L4NA 4WZAB 3U7FB 3PGKA 4JUIA 3PHHA 2NNLD 2R00C 3KYCB 4GOLD 1CF9A 3H17A 4DSTA 4DNQA 2Q4RA 3K1ZA 3N39C 4GP6A 1PFVA 2DB3A 3HHPA 4EX7A 3U3DA 1T4BA 1XEXB 2RGCA 3QVLA 1WEHA 1GO2A 4MQFA 3CLSC 4DCNA 4RADA 5SV2A 1OXTA 3CW2A 3NBZC 1CQJA 4KWHA 1JI3A 5BQXA 5DNYB 1PT6A 4I50B 3K4PA 1KC1A 2WMYA 1EFHA 2R11A 2F00A 3ESRA 3CINA 3PHGA 1RTTA 4P34A 4BKPA 2PLNA 5E38A 5H4GA 1T24A 4TLEA 4TKMA 3CF2A 1DTWB 3QOFA 2ONJA 5DSZA 2Y1WA 1Z5UA 1AU9A 4AWAA 3IERA 3CVWA 3HCCA 3UTCA 3ONEA 4HUQA 1GPUA 2LDXA 2JGJA 5EJ4A 1XDUA 4N40A 4NWIA 1B8NA 2VS1A 2HWYA 5J4HA 1BGXT 1ZITA 5LP6F 1U3FA 2FY8A 5EEGA 1DIAA 2JD2A 4G5SA 5LFAA 4TRMA 4FZVA 2ORED 2QLLA 4UHKA 1NJ6A 4BKQA 5B2EA 1PAUA 2ZUBA 5CYOA 3H19A 3KTFA 4PEVA 1SZPA 4YFYA 5JWRA 3ELUA 5BSFA 5KTTA 4YWJA 4PWYA 3U62A 3G7NA 2J3MA 4BNYA 3WJAA 4V2UA 4Z8XA 1NKVA 2GLTA 2RHJA 4HLCA 3TNYA 2GZSA 3DMPA 1XZGA 3QA3E 1DKRA 1GAEO 2B35A 1V5IA 1ZD1A 3ESBA 1EDZA 3JQRA 4YO7A 3ZI0A 4ALLA 5C8YF 3KDAA 3ZU5A 4R1TA 2C0QA 3JARB 1KO8A 2WD9A 1L7AA 3IBYA 3UAVA 3QYAA 3C5EA 1CNEA 1V6SA 2QL7A 3I1YA 3TIIA 3ZN2A 3EWIA 2N3ZA 1T8SA 2B94A 5CK4A 1E9FA 2Q3HA 2J5BA 1GSIA 1LLCA 3TZKA 1KJNA 3KPWA 4CKCA 2BRUA 2W8BB 3EYWA 3M9WA 3N8GA 4INPA 3TPFA 1M0TA 2I34A 1JIJA 4G5OA 4WXMA 2CUZA 2O8EA 4E03A 3OURA 1IE3A 2AQ8A 1JLLB 4IIDA 5J1TB 1OSNA 4DIOA 2QTMA 4DR6B 5DYTA 2PH7A 4DV6B 2V4UA 4MICA 5ENVA 4XUEA 5LQNA 3AR5A 4DZZA 1YBAA 1ACJA 1QG6A 4GD3Q 4C89A 4B8YA 1NONA 1ABBA 2CL6X 3PXXA 4FFNA 5LBTA 4FMCB 4A0QA 3D4BA 4FJ2A 3UEOA 4F3CA 4N6GA 4IQ8A 1YFLA 2DVMA 5IF9A 5KNBA 1WS6A 1YL5A 4DLYA 4OMFG 3X1MA 1XWFA 4XGRA 1K4MA 2GNAA 3TLGB 5FWYA 3R0IA 4CMIB 1CQPA 4N7BA 3BGSA 1KYVA 1DIHA 4NBUA 4GR4A 2OFPA 4Q1CA 2BFNA 4LCJA 3MWEA 5BV1A 1IBRA 2BT4A 4NU0A 5EWMA 4BX2A 2NO4A 2X6RA 3Q15C 4XB2A 3LKBA 4AM8A 4BZXA 1WP9A 2BJWA 4KR6A 3ZDXB 4YCMA 3IEVA 4IXMA 2OCGA 4Z99A 4GEGA 2Z4RA 2GASA 1MHPA 2WTBA 2WTXA 3IE1A 1XEAA 4BASA 1D3AA 1KI6A 1UDRA 1XCLA 4GI1A 2D1RA 1S8NA 3NBFA 4RH0A 3ZKAA 2C9DA 3CE9A 5LMZA 1YRLA 2PR7A 2YVAA 1N6IA 1VMEA 1TJPB 3I01M 2PGJA 5BORA 5BUCA 5E6UB 4YUAA 2RKOA 4J16A 2M9MA 5FYDA 2PWZA 3GNLA 1PR2A 2WWRA 3V4SA 1LDYA 3JQ8A 3DUWA 1JQDA 2IDKA 3R6LA 4JT2A 1DG1G 4R0NA 4MPRA 3EFBA 1W2WB 1EB8A 1B73A 1K98A 1T9DA 4G0MA 3UMFA 2C2BA 2AZDA 2VDJA 4FYMA 1XVIA 3UMYA 2A58A 3C3AA 4XAQA 1JHPA 1K06A 5HK8A 1KZ4A 3IT3A 3B3FA 2PUGA 4V1CA 1X6VA 3ET5A 4P7BA 5K3BA 3SS9X 1P0MA 2F67A 3OIFA 1QP4A 4B31A 5H59A 3V4VB 2W6QA 5TSDA 1W48A 3Q41A 2GEKA 4F4IA 3EWNA 3RH0A 3O26A 5D3QA 1JFFB 1HNXB 3GEHA 5TPWA 1H3EA 4LYHA 5C8XA 2JJ2D 1KERA 1E7QA 2V7VA 1ECJA 2B61A 1SR8A 1I13A 2XTAA 3PHJA 2ZIWB 3H2YA 4V3BA 3TF5A 3VKFA 1JHYA 2QVYX 3R0ZA 3MWYW 5GONF 1MIHA 1M8KA 1T3SA 3RC7A 2GHTA 1Y4UA 4L2IB 3SI7A 3N0XA 5FL7A 1E3TA 2CKMA 2DUJA 1K5DA 3HN7A 1BNCA 4YAOA 2FJUA 2P11A 1SFRA 4Y9UA 1MX3A 3V46A 2P67A 3WKCA 5DGXA 3AQIA 3M4JA 1H2AS 2BFCA 2HJHA 1STOA 4MRAA 5G1NA 3ZDEA 1YDMA 1ZESA 4DTCA 4EFKA 2UUPA 1RJFA 3OOWA 1KYYA 2VT6A 4FS3A 5G40A 3UJ3X 3ZY4A 3D64A 2AH5A 2VYFA 1YQDA 1G7TA 1FU8A 2WSIA 3H4TA 3RSZA 3FZEA 4YRCA 1Z0DA 4COKA 2XE4A 4AL4A 1GNQA 1KGDA 1YRHA 2ZIUB 3AHCA 3MOIA 4DS3A 3DDHA 2CXHA 3ZHTA 4RNCA 1R5OA 1JUDA 1VKZA 2WF6A 4Q7QA 1QSGA 2DGDA 2Y4OA 3CLUD 2WYOA 1A8HA 1GUDA 2BBOA 1AQYA 2GRAA 4IOJA 3WFJA 1BYUA 1KI1A 1G5QA 3NTVA 1R8QA 3KQHA 2B9EA 5T6MA 3ROGA 5FH9A 5JROA 4PPGA 1UM9B 1SKYB 1HK7A 1A04A 1BCSB 1K7FB 3A1UA 3VPFA 1MC8A 2C54A 5A4IS 4KL8S 4BQIA 2PZEA 3OIWA 4N01A 4S12A 4HDNB 4I81A 3LT1A 1VYUA 2HI0A 1JKIA 3OP1A 5KYYA 3L46A 4RNDB 2NQ8A 4ENRA 3GLFA 4E11A 2BE9A 1XSEA 4ZD6A 4N65A 1BROA 2Q9AA 2NVUB 3ORSA 5IBQA 3M4ZA 1UOEA 2MSKA 4MQ6A 2GKSA 3OETA 3R6TA 2AG8A 1VPLA 1U1FA 2ZYGA 4PTYA 3VNBA 1IQRA 5SY6A 4E22A 2M1XA 3T7AA 2WKSA 1NBAA 2OAGA 2VTDA 2ZE7A 3K8ZA 2NACA 2YRWA 4R5MA 4ZV7A 2OYCA 3ICOA 4EPVA 1H0KA 5A0VA 5I7OA 1X3LA 4YMGA 2LIVA 4Q3KA 4LOJA 2BI4A 4P9NA 1J21A 1FUIA 2JGEA 3WS7A 1K08A 5KWVA 2JZNA 4LAFA 3ZK9A 4BIIA 3KKPA 1G3UA 3HJGA 3REFA 4JT4A 4OHPA 3HXOA 3FUVA 2EGHA 3MTAA 3TRDA 4ABTA 3ZLBA 1GTSA 4R8KA 2G9QA 5KTSA 4OXNA 2P7HA 4JGIA 3T15A 1Z0AA 4FYWA 1QF6A 3RBVA 4Z51A 2I87A 3DE1X 3FYDA 3VSDA 1YI0A 1KK0A 1BXGA 2H4HA 4ZOEA 3KQVA 3S8EA 3TPZA 3U3RA 3AETA 4DSZA 5IHXA 4O0MA 2ZU0C 4A2PA 1S01A 2BGJA 1R74A 3GLIB 3CF4A 4HWTA 4EI7A 5ALOA 4N03A 1JR3D 5F1YA 5K4HA 4W1RA 1GAQA 3CR7A 1H6BA 3W3AD 3F1KA 3QE3A 1KRHA 1U9ZA 3TUJC 2HK9A 2PN1A 1IH8A 3RC1A 3WL6A 1AKRA 3RARA 3R4VA 1QV9A 1ZSVA 4DR3B 1O96A 1P4SA 4U39A 3F98A 3MJ4A 1UMBA 5EIBC 1R5BA 1II8B 4ZYTA 5TMPA 1Q0UA 3OTOB 3A58B 2IY9A 5DFAA 1M3SA 4MZXA 4IRUB 3W5SA 4E94A 3HDVA 1ISJA 3BWMA 3HA2A 2VJNA 1FFHA 1OWPA 3JD4A 4HGQA 4DG8A 2G17A 4FHGA 1CY4A 1ORRA 2PSDA 3MWLA 5JNUA 3FPSA 4Q3DA 4DSAA 3QFHA 5BSUA 1KMHB 4GWLA 5JWOA 4JFAA 1P19A 3FMPB 5ALQA 3OUTA 4XUDA 4BE7B 5BR1A 4RVCA 2PGNA 1FDOA 1MDFA 6ABPA 1DC3A 4ZDKA 1CERA 4II7A 5TPZA 4BO6A 3L7DA 4PYNA 2DR2A 5A3JA 1K6MA 1U28C 4HI0E 2FZWA 2P9HA 3KOWA 1NN3A 4QTXA 3I2IA 5FADA 1BZYA 5HHTA 5FUWA 1NJ5A 5AW3A 3PNKA 4ETWA 2WWWA 2C9CA 2D0DA 2ZUVA 3DZGA 2P9BA 1M83A 2R6R1 3GRAA 1QNFA 1VM6A 1XNJA 2ECPA 2PZMA 3K0AA 4J03A 4XIIA 4OLBA 4EGCB 2APJA 4JYCA 3ZOZA 1SG0A 6YASA 4HNGA 4XQCA 4R2IA 3GPDG 5JS6A 1U8AA 1YI8A 5TR9A 3P4XA 3ANXA 4Y6RA 2CHGA 3UXYA 1X1RA 4NCAA 3ILHA 3KZCA 1Q11A 5G53C 3RU2A 4Q24A 1RC0A 2XHEA 3WDSA 3IJ5A 4HRAA 3LW7A 3I3OA 4E5SA 2J87A 4FC6A 4DNXA 5DNDA 2Q0XA 4Z9BA 4HH3C 3AVTA 1HC7A 4JENA 5BSTA 1FJXA 2NSHA 1QRTA 3KEMA 1EM6A 1G3QA 1UBNA 3M5CA 5GJVC 5AK0A 5EMNA 2Q3EA 4LXHA 1L8LA 4DC9A 5I8ZA 4CXMA 4RKEA 4XD2A 3K09A 2PVSA 5DM1A 3D7KA 4LSGA 3KKQA 1NV8A 2Q4OA 4Q03A 4QUGA 4PGAA 2H1FA 5AVRA 2IS1A 2C59A 4KPUA 2P1RA 1WHSB 2HIGA 2QG6A 4EW2A 2EHDA 1ONPA 4MGIR 3IAS1 3Q6NA 4YH1A 4HQFA 1PX0A 4EGQA 2R6GA 1Q1ZA 1ULBA 2F3UA 3MVEA 3K0CC 3OZSA 3S2ZA 3JZFA 2EYUA 5D3KA 5IMSA 2JBHA 1GZ7A 1DLIA 1W4BA 2Y0BA 2FOLA 4EMTA 3CYFA 1XYGA 1Z6TA 2CBGA 4Y6SA 621PA 3ITDA 1LY1A 2QENA 3MTGA 2K6GA 2V7TA 4AO7A 1W8IA 2O0LA 2OCLA 1SHKA 1E89A 1GKIA 4NYMR 4QFDA 5FI1B 1U6IA 3V1LA 3TB4A 5JNVA 1ZIDA 1IN5A 4H3VA 2Y77A 5FO1A 3UT6A 3VR5H 3E5RA 1CUBA 1TJYA 1CU1A 2RGBA 4HKTA 4NTZA 5ERGB 1VGVA 3ETDA 3BHNA 3TIXB 1C0EA 1JB1A 1XD2A 1PQPA 1A71A 1V9CA 1Q6YA 3LLCA 3E6AA 3F1LA 1L5HA 3RREA 2F1KA 3L0ZA 4C4ZA 4Y9RA 2O23A 1EXWA 2RGNA 1RLIA 1A72A 3COYA 4X90A 4CIAA 1DQPA 1U3TA 4DUGA 4ZVKA 1CEEA 1YGPA 3WLNA 5HJ5A 1ZISA 3PTLA 5FEMA 4BNDB 5BUQA 4QATA 5B7NA 1XUOA 2FZVA 4BNUA 4AZVA 4L76A 2C99A 2FCAA 3LCVB 2BKAA 2VT3A 2W48A 3IQZA 3MPUA 3TIGA 4D9FA 5AKEA 5E6RA 3PPXA 3PQ5A 5ICMA 3NOXA 1M1NA 2I29A 4NCIA 4F1WA 4EY3A 4QPCA 1L4YA 4RS3A 2NP6A 2CGEA 1YK1A 4HDMB 5CK5A 5EGSA 2VF5X 5GJBA 4MW4A 4Q47A 2AJLI 2VHVA 1XAIA 1TMKA 1EJ2A 2EGUA 3EDRA 3QK7A 1ZGGA 4OUDB 1RXIA 2HMSA 5A03A 1ZW1A 2CLIB 1JHZA 4QLAA 1OWLA 2XWJI 1NN1A 4N8DA 5FPQA 3RE1A 5DP2A 1SQ0A 2LUOA 1X1QA 3NTRA 4ZGWA 4G65A 4AZWA 2X4IA 4TMKA 2XF2A 3GAAA 1QBGA 2I2DA 4LX0A 4WKOA 4ZT3A 3SDBA 1GNSA 2FFBA 2BIFA 3EEIA 3BEDA 3EEQA 4AZSA 4J7UA 4IVQA 2FQXA 3FRJA 1PR4A 1RHQA 3A6EA 5TEVA 1RS0A 2PUBA 3J81A 4D44A 3CS3A 1D0SA 2O05A 4NH0A 3LGSA 3UB2A 2EHJA 3WGQA 3T1HB 1OLSA 2EZTA 3F49S 2HF8A 3WGNA 2PH5A 5EQJB 4BQNA 3OIYA 1DCMA 4EQ6B 4TTRA 2Z4SA 4AZTA 5EE3A 1UZNA 2XB6A 4F8JA 1RPAA 1X7GA 1N5OX 1JDBC 3Q5GA 3SHWA 3EZGA 1XKTA 1SO8A 1DGQA 5DASA 4HTFB 1H1DA 3AUTA 3NWJA 1WCYA 5DCYA 4RENA 5B2ZA 4C3VA 1JBQA 4M7RA 4PXYA 3QYFA 5CB4A 1FL9A 4BX8A 5ETJA 3ETNA 1D03A 4HG2A 1KFKB 2AMFA 1JEEA 3AHGA 2JGNA 2PU5A 4EYSA 2CKDA 1SZDA 3RUCA 4BQEA 5HGXA 5AVOA 4YMHA 3VGPA 4TTAA 2EU8A 3EC2A 5P8WA 4MDYA 1XK6A 4AZ0B 4PZEA 3AUSA 1ZRSA 2J4DA 2ZRPA 3RNOA 3ZWQA 2N46A 1AQUA 1LNQA 5JTUA 4CG0A 1NIPA 4NBTA 3U4MA 3OCYA 4Z2YA 1CY0A 5LQKA 1F2UB 5F35A 4EKNB 3V2GA 2Q2QA 1YZHA 1FPQA 2ZW9A 3VRHA 4XOUA 3SJBA 1Z22A 4G23A 1PL8A 3X1ZA 4N7MA 1KL7A 3DVQX 1NDHA 3E9YA 5T3YA 2DETA 1XZFA 1ZC4A 2XEXA 4NFYA 3RRYA 4H15A 1OFIA 4TLBA 4WECA 2OZEA 4LCBA 1FP7A 2PPVA 5HKAA 1Z17A 4HRXA 1FSSA 1XDSA 2GNOA 1J23A 2DYKA 3B7GA 3PRKE 5K01A 5K6TA 3QU9A 3UPTA 3Q3VA 4MZDA 4HAWA 1WDLA 4WCFB 3T38A 4CIBA 3DQPA 3KQPA 4KAXA 2OL4A 2OUIA 1MD9A 4O2LA 4RHCA 1PHPA 1O8CA 1OOEA 2Y1EA 2FF5A 4CZ2A 4DBLE 2D4AA 3GDOA 4MROA 3TAHA 4BNNA 1LDBA 1YR3A 1XEFA 2XI4A 3K15A 4JP1A 1C3OA 4TL9A 2H9AA 2VZ0A 5DSXA 3UCEA 4P7FA 3EZXA 3UZUA 4NOLA 3GQBA 2X2FA 2CCGA 3TLCA 5LSAA 4K8OA 4TSKA 1TGVA 4NMLA 5HZHA 3JD2A 2BN4A 5C0OE 2IPXA 2PA3A 3QIAA 3QEMA 4M98A 3LKZA 1V48A 4PG4A 2VPQA 3P71T 3HJTA 4HAZA 3B3GA 2X0EA 3RBAA 5D8DA 4ZYYA 1Z74A 4MW5A 1FRZA 2CLCX 4N76A 5B3JC 5BYKA 2YWJA 5E2AA 3PEYA 3BDVA 1HX7A 1AO0A 1LSSA 4P3NA 2AFVA 4H27A 2XXAA 3KWLA 3CKYA 2XUZA 2PGOA 3SYMA 1KI6B 3Q5DA 4DL9A 2F9LA 2DBQA 2QMOA 3HVUA 4HGZA 4MULA 4Y2XA 1SXJB 3RRZA 4IZ6A 5LKAA 2GEUA 4BXOA 4B3DA 1PJQA 2NXCA 2PTHA 2XJ4A 4OHXA 2D74A 1Z2OX 3LC2O 4W1QA 3TLEA 3DKIA 4G84A 5F7ZA 3ZGLA 3ZY3A 5K8TA 3TFWA 2VCYA 3G17A 4C76A 3FKQA 4UBJA 3BA1A 1SXIA 1NOKA 2C9ZA 2RH4A 1CDDA 2JCXA 4ND1A 1IUPA 1O9HA 3KR2A 4NK5A 2R6DA 2VP6A 1FX1A 2HMUA 2QGFA 4M7WA 3TXAA 2CEKA 3UMBA 3V7NA 1GCAA 4JS0A 3RFCA 1K1EA 5EOVA 3M70A 3H1FA 5ADWA 5EVJA 5BVGB 4ZT4A 3K32A 4Q9NA 3FHCB 3UK7A 4ROSA 3HO6A 2GEFA 4EAQA 1QK4A 5LOVA 3JD1A 3EWSA 1A9ZA 1BWSA 2GHRA 2PJDA 3LGXA 4KLRA 5C51B 2CXPA 4RK1A 1WZNA 4OHRA 1AV7A 4GC5A 4KSBA 4P4UA 4EJ0A 4U1RA 5SYAA 1SKQA 4ZCMA 3LBAA 2BHNA 2I76A 3PR3A 3IB3A 2G3YA 2XNCA 5FLYA 2QY6A 1BOOA 1GL3A 3CW8X 1VDZA 1OGIA 2HL6A 4LFAB 1CJVC 2PSHA 2Z57A 3A37A 4K6MA 1L7XA 1LFDB 4Z4HA 2JAOA 2KMLA 2W2MA 1IZ7A 3OOJA 4R9SA 4W7SA 5DWVA 4EYQA 1WG8A 1YKGA 3CF4G 1YF3A 1FFCA 1ICIA 1YB4A 1J07A 2VTEA 2ZUUA 3B6KA 4ND8A 4FBLA 1Y4SA 3RRXA 3AXTA 4CHTA 1Q2UA 4W9RA 3E05A 3PTZA 1JIKA 2JGDB 3CEAA 2AQHA 2VBFA 1YZTA 1ZY2A 3DOJA 4DDHA 3GUYA 1HNWB 2GM9A 3FWKA 4COOA 4DQDA 3IDSA 4QM6A 1DDIA 3JVIA 2B8NA 4Y1GA 1E2HA 3NTQA 4DEVA 4XYBA 1MOQA 3FSJX 2YUTA 2P2LA 3ZHYA 4U2BA 3A4MA 4R8VA 3AM3A 1GEGA 2D5BA 3LY9A 4F06A 2WWFA 1LA2A 1R8YA 2E7ZA 4MYTA 1XJWA 3LBNA 4UMVA 4HQNA 3K7EA 4R1UA 1HSZA 2NZJA 5I5EA 3Q8KA 1G16A 3UFXA 4CM1A 2GERA 3E03A 2QZ4A 4AQYB 1GZDA 1RJEA 2W37A 3DMGA 1FFXA 4DV1B 1T0HB 3V8RA 4J0KA 4F6RB 3L2OB 1ZD4A 4HDOB 5CA1F 1MEOA 2MSWA 4HLQB 3LBHA 4TKVA 4OA5A 3I32A 2O2YA 2DXIA 3FJYA 2EKQA 1LV7A 3E3LA 3HHEA 4G2TA 2HYIC 3PDWA 2Q4DA 4MS1A 3LBIA 4R1SA 2VA9A 4MLCA 1UJ5A 1N5MA 1AK9A 3UHOA 3E7FA 3CXRA 3E9NA 5LU9A 1WLSA 2R44A 4FW9A 3DCIA 3F6BX 3PI6A 4K46A 4X6UA 5TVGA 3ZZ0A 5MN5A 1FNBA 5LZ2A 3P0JA 3ON5A 5DMXA 3QENA 2BSXA 2VRNA 1WSDA 1B8VA 2NZUG 5KYTA 1GKLA 2JH3A 2BH2A 3ESDA 1AZWA 2ZQZA 4FGLA 3C74A 4I46A 2GSWA 4ZI2A 1DO8A 4PSDA 2FOXA 1P3DA 1UADA 2BGUA 2V7WA 1KMNA 1Q77A 2F9FA 2R5WA 2YNMC 3H2HA 4MK4A 4C87A 2QR2A 4YAWA 4UDNA 4HVAA 1O94D 2WIAA 2Y68A 3JTEA 3KZKA 4TWAA 2XPCA 4BY9E 4ILEA 1PE0A 1QORA 3E7PA 3IUEA 3QQPA 4PFJA 4TTTS 3VMFA 2G88A 2HXYA 3DLCA 3DFIA 1UBUS 2DWCA 2HJSA 1ES9A 4CKZA 3Q9SA 4C7KA 3VKHA 1NX9A 3AFIA 1E4VA 2PJZA 3G5LA 3H4IA 4G6ZA 4DLPA 1Q44A 5F9MA 3H7IA 1EUCA 1IOZA 3K8YA 4MS4B 3CNEA 3TCXB 5KYWA 3TQFA 1YUBA 2FH5B 2XT0A 5CJ2A 4KXXA 1DRKA 3QV1A 1NN5A 4Z1MD 3F8SA 1COZA 4M8NE 2JJ1D 3DE3X 3PNMA 4MW6A 1DV1A 2FEAA 4KCGA 4L0MA 5JISA 1RAGA 1B3RA 1C1DB 2F3TA 2Y2UA 5IH3A 2D1FA 5G3ZA 5K3AA 3AVXA 1AH2A 4C6RA 4F38A 3JY6A 1DKPA 2RHCA 3WLKX 1SUEA 2J3LA 3D8TA 1GPDG 3HJAA 3P2JA 2EIHA 2W0SA 3Q0EA 2X5JO 4HHEA 4BRWA 5EJFA 1MX9A 4AJNA 3R76A 1SBTA 1JHOA 4PS0A 1VPWA 3K6KA 3ZWPA 4QPNA 1S2IA 2CUNA 3VTKA 2TMDA 2A30A 4F8EA 3NX4A 1VKJA 3MFQA 1HLFA 3QPUA 4D99A 2R6ZA 3IALA 4U7PB 3TKYA 5M2QA 4LQDA 3KXDA 2OGUA 1CJSA 2A9JA 1T2DA 1HQYE 2QP9X 3OLVA 4RVOA 3BXZA 2NZXA 4P80A 3X1XA 2C8JA 3AUUA 1AQLA 3WOHA 1WPXA 4EG3A 3IOCA 3I5AA 4EY6A 1SXJE 4H3KB 1IJFA 1NVUQ 1PDOA 1TYEB 2DULA 3AHHA 4OGKA 2QI9F 4ZQGA 3WTCA 4EI9A 3V5NA 1J8YF 3VPAA 4NXMB 3MS2A 2WPNA 4BUZA 4BYGA 1YR2A 3KL2A 4BAUA 3PGA1 1KEWA 1NXOA 4CYMA 1RWKA 2V54A 2G1KA 5HR5A 3VJMA 3PD0A 3N28A 4MA5A 1W581 1QZZA 5JD6A 4KIJA 4K5QA 4YJGB 3O2JA 3WGUA 5AM2A 2WMDA 3VAAA 2PRSA 4LJ7A 4INOA 3RU3A 1N57A 4X65B 3HZRA 4RJLA 4XFKA 4HX9A 3U2QA 3NWPA 3ONNA 2R62A 4MWZA 3B9QA 4NPHA 4ZOLA 1HV8A 2EWMA 4KWIA 2IYRA 5AOCA 5EMJA 2FJPA 2WE8A 4DQVA 1IIRA 1BJRE 2FSFA 3B1ZA 4EG8A 1KZ9A 2QM3A 2XE8A 4FINA 5BOVA 4JHXA 1YQUA 1YJXA 4M9RA 1KJJA 1NY6A 2VYVA 1AXRA 4MVJA 13PKA 1IBKB 4YLYA 3QZUA 1C2YA 1X0VA 1WD7A 1OWNA 1TA9A 3GLGA 2ZJ1A 3EA5A 1NFQA 3H8JA 3V8BA 4LY3A 3F7MA 2XUKA 4M86A 4WLUA 2ZU6A 1Y7LA 3LLUA 1XPUA 1UDXA 2CDBA 2PO5A 3HP7A 1GCGA 1YR6A 1S9HA 2X9VA 1B41A 1XQYA 1NKSA 2HO4A 3CR3C 4KR0A 1CF2O 5K0TA 4G1CA 1NJGA 2ZATA 3MM4A 2IL1A 2JCYA 4I1RA 5DW3A 3TS1A 4A7PA 3AMVA 1IRXA 4Q1BA 4U7HA 1T15A 1E77A 4TL8A 3TZHA 1I1OA 3EIEA 4Y18A 3SN6A 1BXZA 1J56A 4KVGA 4OFBA 5TX7A 2VP9A 1RLJA 1Q3TA 2FPGA 3ACBA 3RF6A 3TRKA 4FU0A 3BX1A 2J0UB 1RZRA 1C9EA 4DLWA 3Q6MA 1ZRHA 1DG3A 4JDPA 5C4GB 1ULZA 2BZGA 1L4MA 1QH1B 2QD5A 2QRVB 3CLKA 5BW5A 1ULUA 1Y1RA 2RI0A 4IVPA 4J1TA 3SJ7A 4JVNA 5FNVB 4HQ6A 4LGMA 4M9CA 4YAJA 5IEBA 1DINA 4Q0MA 4HDCA 5B1YA 4PAGA 5L51A 4LPSA 4PBSA 4HFMA 1GOTA 3U09A 3QKSA 3Q6IA 5KPJA 1U7WA 3NJ4A 1E9AA 1SAYA 2C2XA 2X58A 3TEMA 1RQNA 4YJFB 4XH9B 4UVIA 5EIOA 1I94B 2KE5A 3UMGA 2QIPA 5EJGA 4MDEA 3FIJA 1KQOA 3SJZA 3FLBA 1DELA 4CG1A 4NPAA 1VE3A 2WHYA 3H3JA 3LQ2A 3PKIA 3ZH9B 4QXQA 4RDCA 5B1HA 1IB0A 1E2NA 2W00A 3EDCA 2FUCA 3JQGA 5AIAA 1EGAA 3IXLA 4M54A 1BO6A 1BCSA 4ZYLA 2QSUA 2PHZA 4X00A 2BFMA 3GAFA 1OD6A 2V5AA 1QIIA 1MZVA 3ZDDA 2DLDA 2O7VA 5IM4A 3A0UA 1HYHA 3MHPA <