2VI7A

Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
164
structure length
163
Chain Sequence
b'TIRLERYSERHVEGLTALYNDPAVARQVLQMPYQSVEQRRKRLHDSDDDRLLILVALHQGDVIGSASLEQHPRIRRSHSGSIGMGVAVAWQGKGVGSRLLGELLDIADNWMNLRRVELTVYTDNAPALALYRKFGFETEGEMRDYAVRDGRFVDVYSMARLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE PA1377
publication title Structure of a Putative Acetyltransferase (Pa1377) from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 45
structure length 163
sequence length 164
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vi7A00
4KVXA 4I49A 3DR6A 5HMNA 3SXOA 2B4DB 4UA3A 1U6MA 2B3VA 3I3GA 3FB3A 2PR8A 2QIRA 1WWZA 3V8IA 4KOSA 1P0HA 3C26A 2PSWA 2I00A 2BL1A 1K4JA 2P6EA 1YLEA 4E0AA 4E8OA 1QSTA 1QSNA 3I9SA 4R3LA 2OZUA 3TOAA 3P2HA 1B87A 5IB0A 3LD2A 3IWGA 3S6FA 3F8KA 3WR7A 3JUWA 4IF5A 4E2AA 4R87A 2RC4A 2VBQA 3OWCA 3S6HA 4H6UA 1BOBA 1VHSA 4KUAA 2Q44A 4EVYA 1LRZA 4KOUA 2J8NA 1N71A 3D8PA 1KUXA 5DWNA 5EBVA 4CRYB 2Q4YA 1YK3A 1S7LA 2H5MA 1Q2CA 2QMLA 4KZTA 3BJ8A 3VWDA 2CY2A 2NMTA 2Z0ZA 3DSBA 4AVCA 4JXRA 2P6FA 2WPWA 3JVNA 3N7ZA 3QB8A 2ZW5A 4AVAA 2X7BA 4NCZA 1J4JA 2CNMA 2B3UA 1QSRA 4H89A 4U5YA 4X5KA 2G3AA 4CAXA 1NSLA 2AE6A 4F0YA 1Q2YA 3PGPA 3EFAA 4Y49B 2FL4A 4KOTA 4R57A 3D2PA 4HKFA 4M85A 4JJXA 5KTAA 2OZGA 2GE3A 4LUAA 1QSOA 1S60A 2FT0A 3P2FA 3IGRA 5F48A 3CXSA 3TE4A 1RXTA 5IX3A 1XEBA 4M3SA 2GIVA 2B5GA 1WK4A 5C88A 2BEIA 5JPHA 2HV2A 4B5PB 3PP9A 4PV6A 4XPDB 4KVME 4JXQA 2FE7A 2HUZA 4JWPA 3D2MA 1XE4A 3TO9A 2DXQA 2QECA 3BJ7A 4ZBGA 3W6SA 2G0BA 2A4NA 2PC1A 2B4DA 1YVOA 4DNCA 2J8RA 4F6AA 3CXPA 1I1DA 2Q0YA 2ATRA 5F49A 2VQYA 4J3GA 1Y9KA 2D4OA 4FD4A 1MJBA 4U9YA 1NE9A 2KCWA 3R95A 2Z10A 1YR0A 2FXFA 1YGHA 4CAVA 1TIQA 3B8GA 4KOXA 2PQ8A 3R1KA 3DDDA 5J8CA 2ARHA 1Y7RA 2FSRA 1IYLA 4KLVA 4UWIA 1NMTA 2OZHA 4NEXA 1S7FA 5KTDA 1M1DA 2D4PA 2PDOA 1YREA 3W91A 4XPKA 3NE7A 4RI1A 4MBUA 2B4BA 1B6BA 4ORFA 4MY0A 1Z9UA 2R8VA 3ZZIA 3FBUA 4XPLA 4FD5A 3KKWA 1CJWA 4R3KA 4KOVA 1R57A 2O28A 5FVJA 4KORA 3H4QA 1SQHA 4IUSA 1CM0A 3FNCA 3GYAA 1IIDA 5F47A 2Z11A 5H86A 5HH1A 5I0CA 5J8FA 3T9YA 2VEZA 3D3SA 2R98A 2EUIA 2PR1A 2CNSA 4HNWB 2VI7A 4B5OA 1YVKA 1V0CA 4KLWA 1M44A 2K5TA 4KUBA 3EY5A 3TTHA 2OB0A 5F46A 1OZPA 1Q2DA 1YX0A 4XNHB 2ZW7A 4H6ZA 4YRHA 1XIXA 2ZW4A 4FD7A 1I21A 4MJ8A 1KZFA 1PUAA 3TO7A 2JDCA 2VZZA 4KOYA 2P0WA 4PK3A 3EO4A 1Y9WA 2P6GA 3TOBA 4L89A 4Y49C 2Q4VA 2Q04A 1S3ZA 3MGDA 3LODA 4ONUA 4HNXB 4CAWA 1Z4EA 3VWEA 3S6KA 1QSMA 2B5GB 3EC4A 3DNSA 3TFYA 3F5BA 4MI4A 4FD6A 3W6XA 1IB1E 2WPXA 2ZXVA 3FIXA 3T90A 2AJ6A 2IL4A 3QAHA 1RO5A 4JD6A 2REEA 4AG7A 3CXQA 4KVOE 2R1IA 5CNPA 2F5IA 4HNYB 1S7NA 4OAEA 4XPDC 1XF8A 4QVTA 5H84A 1UFHA 4MY3A 3S6GA 4K30A 3K9UA 2B58A 4UWJA 3F0AA 5JQ4A 3ZJ0A 1P4NA 1KUVA 2FCKA 3UY5A 2VXKA 1I12A 5E96A 4QUSA 4KOWA 1IICA 3R9FA 2Y0MA 1MJ9A 5ISVA 4U9ZA 5GCNA 4L8AA 2BSWA 1ON0A 1MK4A 3GY9A 3G3SA 4QBJA 2FS5A 3FXTA 4JLYA 2EVNA 2I79A 4YGOA 4CS0B 2GANA 4NXYA 1S5KA 4YFJA 3R9GA 2JEVA 3FYNA 4PSXA 4R9MA 2OH1A 4NF1A 4OLLA 5DWMA 5IV0A 2VZYA 3G8WA 1Z4RA 3GKRA 1VKCA 1KUYA 3TO6A 2J8MA 4UBRA 4QC6A 2JLMA 3R9EA 4PK2A 2ZW6A 3TT2A 2C27A 4LX9A 3RYOA 1XMTA 3R96A 3TCVA 2G3TA 2FIWA 1L0CA 1BO4A 1IYKA 3DR8A 4BMHA 4GS4A 3SHPA 1S7KA 4MHDA 4B5PA 5C82A 1MJAA 2FIAA 1M4GA 3E0KA 2PRBA 1M4DA 4AB7A 2BUEA 3SXNA 2CNTA 2ZPAA 1FY7A 1PU9A 4NSQA 2R7HA 2Q7BA 3EXNA 3PZJA 5KTCA 4PSWA 2HQYA 2REFA 4AG9A 4II9A 3FRMA 4AVBA 5EC4A 4OADA 1GHEA 1M4IA 2OU2A 2JDDA 4QB9A 4RS2A 3BLNA 4XNHC 4CRZB
chains in the Genus database with same CATH superfamily
2JBKA 1YLOA 3CPXA 4KVXA 4I49A 3FMCA 4ZX8A 1TXRA 3RO0A 3DR6A 5HMNA 2Q7SA 1ZLIA 3SXOA 4MFZA 2B4DB 4UA3A 1U6MA 2G9DA 1CX8A 2B3VA 2YNCA 2AFZA 3FB3A 2PR8A 1CPXA 3I3GA 2PJAA 2QIRA 2PJ9A 1JWQA 2FVGA 4P10A 4CYOA 3JTKA 1WWZA 3V8IA 1YQEA 4KOSA 1P0HA 3C26A 2PSWA 2I00A 5AG7A 3FEEA 4MHNA 2BL1A 4A31A 1K4JA 2ZENA 2GFQA 2P6EA 5K8PA 1YLEA 4F9UA 3H8EA 4Z65A 4E0AA 4E8OA 5K8OA 1QSTA 5LYDA 2PVWA 1F2PA 1QSNA 2PJ5A 2WUUA 3I9SA 4Q38A 3B3TA 4YWYA 4UEEA 3KQZA 2ZEPA 2OZUA 4NGQA 3NH8A 4R3LA 3TOAA 3P2HA 4LQGA 5HXDA 1B87A 4PXBA 1XBUA 5IB0A 3LD2A 3IWGA 3S6FA 3F8KA 1FNOA 3SI0A 3K9TA 3WR7A 4CGNA 3JUWA 4IF5A 4E2AA 4UEZA 5F09A 5I4MA 5AGEA 4R87A 1CBXA 2RC4A 2BO9A 2VBQA 3OWCA 2F8HA 3S6HA 2CTBA 4Q36A 4EWTA 4B11A 4H6UA 1BOBA 1BPNA 1R3NA 3B2YA 4P4DA 4CYQA 4MHZA 2GLFA 3PBEA 1VHSA 4KUAA 4OC0A 2Q44A 3KR5A 4EVYA 1LRZA 2JBJA 5JM6A 4KOUA 2AFUA 4OMEA 2J8NA 1N71A 3D8PA 1KUXA 3KQXA 3PRTA 3VARA 4UF4A 2AFMA 1XOVA 5DWNA 5EBVA 2PRQA 4CRYB 4K3NA 4P44A 2Q4YA 4P45A 4GXHA 1LANA 1YK3A 1S7LA 2H5MA 3DLJA 1Q2CA 1Z2LA 2QMLA 1VHOA 3PFEA 3BJ8A 4KZTA 3SI1A 3VWDA 1ZLHA 2CY2A 2NMTA 1BAVA 4MCRA 2Z0ZA 3DSBA 4AVCA 4BBHA 4JXRA 2P6FA 2NSMA 2WPWA 4FAIA 3JVNA 3N7ZA 4H2KA 5D29A 3QB8A 2ZW5A 3A9LA 4AVAA 2RFHA 2X7BA 2ZEHA 2ZEGA 1VGYA 4NCZA 1J4JA 3D7HA 4RN7A 2CNMA 4CGLA 1Y0YA 2B3UA 1QSRA 3CPAA 3B3SA 3FECA 4H89A 3S9MA 4U5YA 4X5KA 3SJEA 1Y7EA 4C2ZA 2G3AA 4CGMA 2QVPA 4CAXA 3PB7X 1NSLA 2EK8A 2AE6A 4F0YA 3PFOA 1Q2YA 3PGPA 3EFAA 4NJRA 2FL4A 4Y49B 4YU9A 3SJGA 2J9AA 2QJ8A 4KOTA 4R57A 3D2PA 2IJZA 4HKFA 5CBMA 2PVVA 4M85A 4JJXA 4B12A 5KTAA 2OZGA 2GE3A 4LUAA 1QSOA 1S60A 3QNVA 2FT0A 3P2FA 3IGRA 5F48A 4CAFA 3CXSA 2EWBA 1AYEA 4R7MA 1IOIA 1YSJA 4WJBA 3TE4A 1RXTA 2RB7A 5LYIA 1NSAA 2WZNA 5IX3A 1XEBA 4M3SA 3WABA 2GIVA 2ZEEA 3SJXA 1A2ZA 3K2KA 3GUXA 2B5GA 1WK4A 5AG6A 2Z3MA 4OIDA 3IWEA 4OP4A 3FEDA 1TF8A 5C88A 3NE8A 4M6GA 2BEIA 3LMSA 1CG2A 5LRGA 5JPHA 2HV2A 4B5PB 2GLJA 3D7FA 1ARMA 3PP9A 1H8LA 2AFOA 4ONWA 2ODFA 4JWPA 4KVME 4PV6A 4XPDB 4JXQA 4P6YA 3CZXA 2FE7A 2HUZA 2O53A 3IEHA 2EK9A 2PJ0A 1XE4A 2WSAA 3D2MA 3NH5A 4FWUA 2DXQA 2GREA 2QECA 2YNEA 4NGRA 3BJ7A 3TO9A 3MN8A 4ZBGA 5LRJA 3W6SA 2Q51A 2G0BA 2A4NA 4TWEA 3SJFA 2Z3NA 4UEFA 2PC1A 2B4DA 5G20A 1QQ9A 3V38A 1YVOA 4PPZA 4DNCA 1CP6A 4ZI6A 5IB9A 4C7HA 2J8RA 4F6AA 5JGFA 1CPSA 3CXPA 1I1DA 2Q0YA 1XFOA 2EO8A 2ATRA 4NGTA 4FBEA 2PCUA 4MHPA 4C2YA 3IWWA 5F49A 2VQYA 4J3GA 1QMUA 1Y9KA 2D4OA 4FD4A 1MJBA 4U9YA 3ISXA 1NE9A 2KCWA 3IU1A 4BINA 1AMPA 3R95A 3MRUA 1VIXA 2DPTA 2Z10A 1YR0A 2FXFA 2Z3KA 2PJBA 1YGHA 4CAVA 4TNUA 3VH9A 2ZEMA 5G1ZA 4B10A 4A37A 1TIQA 3B8GA 1PYTB 4KOXA 1KWMA 4A2ZA 2PQ8A 4ZY2A 2PE3A 3R1KA 3DDDA 5J8CA 1DTDA 2ARHA 3FJUA 3PB6X 3NFZA 1Y7RA 3HLPA 4OC4A 2FSRA 1IYLA 1ELMP 4M6HA 4KLVA 4OC3A 4UFVA 4A95A 4UWIA 3KL9A 1NMTA 3B7IA 2OZHA 4NEXA 1S7FA 3D7DA 5KTDA 2ANPA 3GB0A 1LCPA 1M1DA 5HVHA 2D4PA 2PDOA 3QAYA 5A28A 2CXAA 1YREA 3W91A 3BI0A 4XPKA 1XJOA 2BOAA 3NE7A 5D8NA 3FF3A 2ZELA 4OC5A 4RI1A 4LQ6A 5LYFA 4MBUA 1EE3P 2B4BA 1Z8XA 1Z8LA 1B6BA 3KASA 4ORFA 1GYTA 4UCMA 1AUGA 4MY0A 1Z9UA 1Q7LA 2R8VA 3IJ3A 4JZ0A 1ARLA 1FT7A 1TKJA 4X8IA 3ZZIA 3FBUA 4AXVA 2VL1A 4M6IA 4XPLA 4FD5A 2Q43A 3KKWA 3L2NA 1CJWA 2XEJA 4DUKA 1X10A 4R3KA 4MFQA 5BWAB 3JRUA 3S9NA 4UIAA 4KOVA 1R57A 2O28A 1YW4A 4MXUA 5FVJA 3H8GA 3FH4A 3GLJA 4KORA 1IU8A 3H4QA 1SQHA 4PXDA 2F7VA 4IUSA 2YGWA 4A38A 4F0XA 1CM0A 3KGQA 3FNCA 4ZY0A 3GYAA 1IIDA 5F47A 2Z11A 5H86A 5HH1A 4P4IA 4X2TA 5LYLA 5I0CA 2ZOGA 5J8FA 3T9YA 2VEZA 2Q4ZA 3HUVA 3D3SA 2XEGA 1ZG9A 1OBRA 2R98A 2EUIA 2PR1A 3WT4A 4OC2A 2CNSA 3BXMA 4R6TA 3S9LA 3NH4A 4HNWB 1TF9A 4C7IA 4C2XA 5EMIA 2VI7A 3CDXA 3KZWA 4B5OA 1YVKA 1V0CA 4KLWA 2POKA 1M44A 2K5TA 4KUBA 1VHEA 3EY5A 3RZAA 3PB9X 1IY7A 3B3CA 3TTHA 3D68A 2BCOA 2OB0A 1LAPA 2PJ4A 2PJ1A 5F46A 3RNZA 2PJ7A 1OZPA 3TC8A 4ZY1A 1Q2DA 1YX0A 2HC9A 3PB4X 4XNHB 4EFDA 4MCQA 2ZW7A 4H6ZA 2HB6A 4P4EA 5AG4A 4YRHA 1XIXA 2ZW4A 4FD7A 1I21A 2V8VA 2C6PA 4MJ8A 4MFKA 1KZFA 3KHXA 1PUAA 3TO7A 4UFXA 2JDCA 2PJ6A 2VZZA 2PJ8A 4KOYA 5J1QA 2YNDA 4JYWA 2P0WA 4PK3A 3EO4A 1M4LA 1Y9WA 2P6GA 2ZEFA 4R8FA 4L89A 4Y49C 5G22A 2DPSA 3TOBA 6CPAA 2Q4VA 2PJ2A 2Q04A 4MFLA 1BLLE 1S3ZA 3KHZA 2Z3LA 3LODA 3MGDA 3PB8X 4ONUA 4OC1A 4HNXB 4CAWA 1Z4EA 3VWEA 3IU2A 3S6KA 1QSMA 4CGPA 1TKFA 2B5GB 4A94A 4CYNA 4ZGYB 2O4HA 3EC4A 4UCPA 5HVFA 3DNSA 4KS9A 3TFYA 3F5BA 4KSFA 2PIZA 4MI4A 4FD6A 4NFRA 3W6XA 2DF5A 1IB1E 2WPXA 2DEAA 2ZXVA 3RAMA 3FIXA 2AFXA 3T90A 2AJ6A 2IL4A 3QAHA 1RO5A 2Z3PA 3T8WA 4JD6A 3FVLA 2REEA 4AG7A 4P4BA 3CXQA 2GU2A 4KVOE 2R1IA 1HDQA 5CNPA 2F5IA 4F9VA 4EMEA 1CP7A 1S7NA 4GM5A 2CF4A 4HNYB 4OAEA 4XPDC 1XF8A 4ZX9A 4KSAA 2V8HA 4P4JA 4QVTA 3WC6A 4A33A 4F8ZA 5H84A 1YMEA 1UFHA 4MY3A 2I3CA 4MHYA 4NGNA 3S6GA 4MCSA 4K30A 3KI9A 1Z5RA 3K9UA 2B58A 2IMOA 4UWJA 4C68A 2Z3OA 5CPAA 1UWYA 3F0AA 4B13A 2ZOFA 3SI2A 5JQ4A 3ZJ0A 1P4NA 4R76A 4MFJA 4P4FA 1KUVA 4BD9A 3KR4A 2FCKA 3UY5A 2VXKA 2PIYA 1I12A 2QYVA 5E96A 3D7GA 4QUSA 4ZYQA 4KOWA 3IC1A 2OOTA 1IICA 4Q7AA 1F57A 3R9FA 2Y0MA 4B14A 1MJ9A 5ISVA 3H8FA 2ABZA 4U9ZA 1BPMA 5GCNA 4L8AA 4O23A 2BSWA 1LAMA 1ON0A 3LACA 1MK4A 3B3WA 1X12A 4OKOA 2YNCC 5AG5A 4HPSA 3GY9A 1LOKA 3G3SA 4QBJA 2FS5A 3FXTA 3TX8A 4JLYA 1XMBA 2EVNA 4CGOA 1R43A 2I79A 4YGOA 3WC7A 4CS0B 2AFSA 1IOFA 2IQ6A 5JH9A 2GANA 3H5ZA 4NXYA 1S5KA 2V8DA 1XRYA 4YFJA 7CPAA 1ZO0A 3FX6A 3BI1A 3R9GA 2JEVA 3IFEA 3FYNA 4PSXA 4R9MA 2OH1A 4NF1A 3IO1A 1DE4C 4OLLA 5DWMA 2PJCA 5IV0A 3PBBA 2VZYA 4NGMA 4RUHA 3G8WA 1Z4RA 4CAEA 1Z8TA 3GKRA 1VKCA 1KUYA 1ZG7A 3TO6A 2EBJA 3D4UA 2J8MA 4IAVA 4UBRA 4WWVA 5ELYA 2CIJA 4PQAA 3IIBA 4QC6A 4DJLA 2PJ3A 3ISZA 4X3RA 2JLMA 4G1PA 4IHMA 2ZW6A 4PK2A 2C27A 3R9EA 3GIUA 4LX9A 3RYOA 1XMTA 4UCNA 3TT2A 1HDUA 5A27A 3CT9A 4NGSA 5K8MA 4FUUA 3R96A 3TCVA 4UIBA 3B3VA 2G3TA 2XEFA 2FIWA 2ZEOA 2ZEDA 1L0CA 4OIWA 1BO4A 1IYKA 1ZG8A 3DR8A 4BMHA 4GS4A 3SHPA 1HEEA 3N5FA 5DS0A 3PEIA 4NJQA 1S7KA 4MHDA 3RBUA 3NA6A 3VATA 4B5PA 1IGBA 4DYOA 5C82A 1MJAA 2FIAA 4PXCA 1Z8WA 1M4GA 2C6CA 3E0KA 4A30A 2PRBA 1M4DA 4AB7A 1PCAA 3WC5A 1YW6A 2BUEA 3SXNA 4B6ZA 2V77A 3BHXA 2C6GA 3LWUA 4UFWA 3D66A 5THWA 2XEIA 5HVGA 2CNTA 4MFPA 2ZPAA 4PXEA 1FY7A 4A39A 4MCPA 1F2OA 1PU9A 4NSQA 2C1CA 2CTCA 2JEWA 3D67A 2R7HA 2Q7BA 3EXNA 3PZJA 5KTCA 4PSWA 2HQYA 2REFA 3V7ZA 4AG9A 4CYPA 8CPAA 4II9A 5LRKA 3FRMA 3DGVA 1JQGA 2AFWA 5EC4A 1ELLP 4OADA 1TKHA 4AVBA 5K8NA 4NGPA 1LFWA 2V8GA 4A32A 1GHEA 1M4IA 2OU2A 4IK2A 4MRIA 2JDDA 2NYQA 5G21A 4QB9A 3B35A 4RS2A 3BLNA 1RTQA 1Y0RA 4KSIA 4MMOA 4CPAA 4XNHC 2OR4A 4CRZB 2WYRA 3I1UA 4W9YA
chains in the Genus database with same CATH topology
4KVXA 4I49A 3DR6A 5HMNA 3SXOA 4MFZA 2B4DB 4UA3A 1U6MA 2B3VA 2YNCA 3I3GA 3FB3A 2PR8A 2QIRA 4CYOA 3JTKA 1WWZA 3V8IA 4KOSA 1P0HA 3C26A 2PSWA 2I00A 5AG7A 2BL1A 4A31A 1K4JA 2P6EA 1YLEA 4E0AA 4E8OA 1QSTA 1QSNA 2WUUA 3I9SA 4Q38A 4R3LA 2OZUA 3TOAA 3P2HA 1B87A 5IB0A 3LD2A 3IWGA 3S6FA 3F8KA 3WR7A 4CGNA 3JUWA 4IF5A 4E2AA 5AGEA 4R87A 2RC4A 2VBQA 3OWCA 3S6HA 4Q36A 4B11A 4H6UA 1BOBA 4CYQA 1VHSA 4KUAA 2Q44A 4EVYA 1LRZA 4KOUA 2J8NA 1N71A 3D8PA 1KUXA 5DWNA 5EBVA 4CRYB 2Q4YA 1YK3A 1S7LA 2H5MA 1Q2CA 2QMLA 4KZTA 3BJ8A 3VWDA 2CY2A 2NMTA 2Z0ZA 3DSBA 4AVCA 4BBHA 4JXRA 2P6FA 2WPWA 3JVNA 3N7ZA 3QB8A 2ZW5A 3A9LA 4AVAA 2X7BA 4NCZA 1J4JA 2CNMA 4CGLA 2B3UA 1QSRA 4H89A 4U5YA 4X5KA 4CGMA 4C2ZA 2G3AA 4CAXA 1NSLA 2AE6A 4F0YA 1Q2YA 3PGPA 3EFAA 4Y49B 2FL4A 4KOTA 4R57A 3D2PA 4HKFA 4M85A 4B12A 4JJXA 5KTAA 2OZGA 2GE3A 4LUAA 1QSOA 1S60A 2FT0A 3P2FA 3IGRA 5F48A 4CAFA 3CXSA 3TE4A 1RXTA 5IX3A 1XEBA 4M3SA 2GIVA 2B5GA 1WK4A 2Z3MA 3IWEA 5C88A 2BEIA 5JPHA 2HV2A 4B5PB 3PP9A 4PV6A 5AG6A 4XPDB 4KVME 4JXQA 2FE7A 2HUZA 4JWPA 2WSAA 1XE4A 3D2MA 3TO9A 2DXQA 2QECA 2YNEA 3BJ7A 4ZBGA 3W6SA 2G0BA 2A4NA 2Z3NA 2PC1A 2B4DA 5G20A 1YVOA 4DNCA 4C7HA 2J8RA 4F6AA 3CXPA 1I1DA 2Q0YA 2ATRA 4C2YA 5F49A 2VQYA 4J3GA 1Y9KA 2D4OA 4FD4A 1MJBA 4U9YA 1NE9A 2KCWA 3IU1A 3R95A 2Z10A 2DPTA 1YR0A 2FXFA 2Z3KA 1YGHA 4CAVA 5G1ZA 4B10A 1TIQA 3B8GA 4KOXA 4A2ZA 2PQ8A 3R1KA 3DDDA 5J8CA 2ARHA 1Y7RA 2FSRA 1IYLA 4KLVA 4UFVA 4A95A 4UWIA 1NMTA 2OZHA 4NEXA 1S7FA 5KTDA 1M1DA 2D4PA 2PDOA 2CXAA 1YREA 3W91A 4XPKA 3NE7A 4RI1A 4MBUA 4UCMA 2B4BA 1B6BA 4ORFA 4MY0A 1Z9UA 2R8VA 3ZZIA 3FBUA 4XPLA 4FD5A 3KKWA 1CJWA 4R3KA 4MFQA 5BWAB 4KOVA 1R57A 2O28A 5FVJA 4KORA 3H4QA 1SQHA 4IUSA 2YGWA 4F0XA 1CM0A 3FNCA 3GYAA 1IIDA 5F47A 2Z11A 5H86A 5HH1A 5I0CA 5J8FA 3T9YA 2VEZA 3D3SA 2R98A 2EUIA 2PR1A 2CNSA 4HNWB 4C7IA 4C2XA 2VI7A 4B5OA 1YVKA 1V0CA 4KLWA 1M44A 2K5TA 4KUBA 3EY5A 3TTHA 2OB0A 5F46A 1OZPA 1Q2DA 1YX0A 4XNHB 2ZW7A 4H6ZA 5AG4A 4YRHA 1XIXA 2ZW4A 4FD7A 1I21A 4MJ8A 4MFKA 1KZFA 1PUAA 3TO7A 4UFXA 2JDCA 2VZZA 4KOYA 2YNDA 2P0WA 4PK3A 3EO4A 1Y9WA 2P6GA 3TOBA 4L89A 4Y49C 5G22A 2DPSA 2Q4VA 2Q04A 4MFLA 1S3ZA 3MGDA 3LODA 2Z3LA 4ONUA 4HNXB 4CAWA 1Z4EA 3VWEA 3IU2A 3S6KA 1QSMA 4CGPA 2B5GB 4CYNA 4ZGYB 3EC4A 4UCPA 3DNSA 4KS9A 3TFYA 3F5BA 4KSFA 4MI4A 4FD6A 3W6XA 1IB1E 2WPXA 2ZXVA 3FIXA 3T90A 2AJ6A 2IL4A 3QAHA 1RO5A 2Z3PA 4JD6A 2REEA 4AG7A 3CXQA 4KVOE 2R1IA 5CNPA 2F5IA 4HNYB 1S7NA 4OAEA 4XPDC 1XF8A 4KSAA 4A33A 4QVTA 5H84A 1UFHA 4MY3A 3S6GA 4K30A 3K9UA 2B58A 4UWJA 4C68A 2Z3OA 3F0AA 4B13A 5JQ4A 3ZJ0A 1P4NA 4MFJA 1KUVA 2FCKA 3UY5A 2VXKA 1I12A 5E96A 4QUSA 4KOWA 1IICA 3R9FA 2Y0MA 4B14A 1MJ9A 5ISVA 4U9ZA 5GCNA 4L8AA 2BSWA 1ON0A 1MK4A 2YNCC 5AG5A 3GY9A 3G3SA 4QBJA 2FS5A 3FXTA 4JLYA 2EVNA 4CGOA 2I79A 4YGOA 4CS0B 2GANA 3H5ZA 4NXYA 1S5KA 4YFJA 1ZO0A 3R9GA 2JEVA 3FYNA 4PSXA 4R9MA 2OH1A 4NF1A 4OLLA 5DWMA 5IV0A 2VZYA 3G8WA 1Z4RA 4CAEA 3GKRA 1VKCA 1KUYA 3TO6A 2J8MA 4UBRA 4QC6A 2JLMA 3R9EA 4PK2A 2ZW6A 3TT2A 2C27A 5A28A 4LX9A 3RYOA 5A27A 1XMTA 4UCNA 3R96A 3TCVA 2G3TA 2FIWA 1L0CA 1BO4A 1IYKA 3DR8A 4BMHA 4GS4A 3SHPA 1S7KA 4MHDA 4B5PA 5C82A 1MJAA 2FIAA 1M4GA 3E0KA 4A30A 2PRBA 1M4DA 4AB7A 2BUEA 3SXNA 4UFWA 2CNTA 4MFPA 2ZPAA 1FY7A 1PU9A 4NSQA 2R7HA 2Q7BA 3EXNA 3PZJA 5KTCA 4PSWA 2HQYA 2REFA 4CYPA 4AG9A 4II9A 3FRMA 4AVBA 5EC4A 4OADA 4A32A 1GHEA 1M4IA 2OU2A 5G21A 2JDDA 4QB9A 4RS2A 3BLNA 4XNHC 4CRZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVX A;  4I49 A;  3DR6 A;  5HMN A;  3SXO A;  2B4D B;  4UA3 A;  1U6M A;  2B3V A;  3I3G A;  3FB3 A;  2PR8 A;  2QIR A;  1WWZ A;  3V8I A;  4KOS A;  1P0H A;  3C26 A;  2PSW A;  2I00 A;  2BL1 A;  1K4J A;  2P6E A;  1YLE A;  4E0A A;  4E8O A;  1QST A;  1QSN A;  3I9S A;  4R3L A;  2OZU A;  3TOA A;  3P2H A;  1B87 A;  5IB0 A;  3LD2 A;  3IWG A;  3S6F A;  3F8K A;  3WR7 A;  3JUW A;  4IF5 A;  4E2A A;  4R87 A;  2RC4 A;  2VBQ A;  3OWC A;  3S6H A;  4H6U A;  1BOB A;  1VHS A;  4KUA A;  2Q44 A;  4EVY A;  1LRZ A;  4KOU A;  2J8N A;  1N71 A;  3D8P A;  1KUX A;  5DWN A;  5EBV A;  4CRY B;  2Q4Y A;  1YK3 A;  1S7L A;  2H5M A;  1Q2C A;  2QML A;  4KZT A;  3BJ8 A;  3VWD A;  2CY2 A;  2NMT A;  2Z0Z A;  3DSB A;  4AVC A;  4JXR A;  2P6F A;  2WPW A;  3JVN A;  3N7Z A;  3QB8 A;  2ZW5 A;  4AVA A;  2X7B A;  4NCZ A;  1J4J A;  2CNM A;  2B3U A;  1QSR A;  4H89 A;  4U5Y A;  4X5K A;  2G3A A;  4CAX A;  1NSL A;  2AE6 A;  4F0Y A;  1Q2Y A;  3PGP A;  3EFA A;  4Y49 B;  2FL4 A;  4KOT A;  4R57 A;  3D2P A;  4HKF A;  4M85 A;  4JJX A;  5KTA A;  2OZG A;  2GE3 A;  4LUA A;  1QSO A;  1S60 A;  2FT0 A;  3P2F A;  3IGR A;  5F48 A;  3CXS A;  3TE4 A;  1RXT A;  5IX3 A;  1XEB A;  4M3S A;  2GIV A;  2B5G A;  1WK4 A;  5C88 A;  2BEI A;  5JPH A;  2HV2 A;  4B5P B;  3PP9 A;  4PV6 A;  4XPD B;  4KVM E;  4JXQ A;  2FE7 A;  2HUZ A;  4JWP A;  3D2M A;  1XE4 A;  3TO9 A;  2DXQ A;  2QEC A;  3BJ7 A;  4ZBG A;  3W6S A;  2G0B A;  2A4N A;  2PC1 A;  2B4D A;  1YVO A;  4DNC A;  2J8R A;  4F6A A;  3CXP A;  1I1D A;  2Q0Y A;  2ATR A;  5F49 A;  2VQY A;  4J3G A;  1Y9K A;  2D4O A;  4FD4 A;  1MJB A;  4U9Y A;  1NE9 A;  2KCW A;  3R95 A;  2Z10 A;  1YR0 A;  2FXF A;  1YGH A;  4CAV A;  1TIQ A;  3B8G A;  4KOX A;  2PQ8 A;  3R1K A;  3DDD A;  5J8C A;  2ARH A;  1Y7R A;  2FSR A;  1IYL A;  4KLV A;  4UWI A;  1NMT A;  2OZH A;  4NEX A;  1S7F A;  5KTD A;  1M1D A;  2D4P A;  2PDO A;  1YRE A;  3W91 A;  4XPK A;  3NE7 A;  4RI1 A;  4MBU A;  2B4B A;  1B6B A;  4ORF A;  4MY0 A;  1Z9U A;  2R8V A;  3ZZI A;  3FBU A;  4XPL A;  4FD5 A;  3KKW A;  1CJW A;  4R3K A;  4KOV A;  1R57 A;  2O28 A;  5FVJ A;  4KOR A;  3H4Q A;  1SQH A;  4IUS A;  1CM0 A;  3FNC A;  3GYA A;  1IID A;  5F47 A;  2Z11 A;  5H86 A;  5HH1 A;  5I0C A;  5J8F A;  3T9Y A;  2VEZ A;  3D3S A;  2R98 A;  2EUI A;  2PR1 A;  2CNS A;  4HNW B;  2VI7 A;  4B5O A;  1YVK A;  1V0C A;  4KLW A;  1M44 A;  2K5T A;  4KUB A;  3EY5 A;  3TTH A;  2OB0 A;  5F46 A;  1OZP A;  1Q2D A;  1YX0 A;  4XNH B;  2ZW7 A;  4H6Z A;  4YRH A;  1XIX A;  2ZW4 A;  4FD7 A;  1I21 A;  4MJ8 A;  1KZF A;  1PUA A;  3TO7 A;  2JDC A;  2VZZ A;  4KOY A;  2P0W A;  4PK3 A;  3EO4 A;  1Y9W A;  2P6G A;  3TOB A;  4L89 A;  4Y49 C;  2Q4V A;  2Q04 A;  1S3Z A;  3MGD A;  3LOD A;  4ONU A;  4HNX B;  4CAW A;  1Z4E A;  3VWE A;  3S6K A;  1QSM A;  2B5G B;  3EC4 A;  3DNS A;  3TFY A;  3F5B A;  4MI4 A;  4FD6 A;  3W6X A;  1IB1 E;  2WPX A;  2ZXV A;  3FIX A;  3T90 A;  2AJ6 A;  2IL4 A;  3QAH A;  1RO5 A;  4JD6 A;  2REE A;  4AG7 A;  3CXQ A;  4KVO E;  2R1I A;  5CNP A;  2F5I A;  4HNY B;  1S7N A;  4OAE A;  4XPD C;  1XF8 A;  4QVT A;  5H84 A;  1UFH A;  4MY3 A;  3S6G A;  4K30 A;  3K9U A;  2B58 A;  4UWJ A;  3F0A A;  5JQ4 A;  3ZJ0 A;  1P4N A;  1KUV A;  2FCK A;  3UY5 A;  2VXK A;  1I12 A;  5E96 A;  4QUS A;  4KOW A;  1IIC A;  3R9F A;  2Y0M A;  1MJ9 A;  5ISV A;  4U9Z A;  5GCN A;  4L8A A;  2BSW A;  1ON0 A;  1MK4 A;  3GY9 A;  3G3S A;  4QBJ A;  2FS5 A;  3FXT A;  4JLY A;  2EVN A;  2I79 A;  4YGO A;  4CS0 B;  2GAN A;  4NXY A;  1S5K A;  4YFJ A;  3R9G A;  2JEV A;  3FYN A;  4PSX A;  4R9M A;  2OH1 A;  4NF1 A;  4OLL A;  5DWM A;  5IV0 A;  2VZY A;  3G8W A;  1Z4R A;  3GKR A;  1VKC A;  1KUY A;  3TO6 A;  2J8M A;  4UBR A;  4QC6 A;  2JLM A;  3R9E A;  4PK2 A;  2ZW6 A;  3TT2 A;  2C27 A;  4LX9 A;  3RYO A;  1XMT A;  3R96 A;  3TCV A;  2G3T A;  2FIW A;  1L0C A;  1BO4 A;  1IYK A;  3DR8 A;  4BMH A;  4GS4 A;  3SHP A;  1S7K A;  4MHD A;  4B5P A;  5C82 A;  1MJA A;  2FIA A;  1M4G A;  3E0K A;  2PRB A;  1M4D A;  4AB7 A;  2BUE A;  3SXN A;  2CNT A;  2ZPA A;  1FY7 A;  1PU9 A;  4NSQ A;  2R7H A;  2Q7B A;  3EXN A;  3PZJ A;  5KTC A;  4PSW A;  2HQY A;  2REF A;  4AG9 A;  4II9 A;  3FRM A;  4AVB A;  5EC4 A;  4OAD A;  1GHE A;  1M4I A;  2OU2 A;  2JDD A;  4QB9 A;  4RS2 A;  3BLN A;  4XNH C;  4CRZ B; 
#chains in the Genus database with same CATH topology
 2JBK A;  1YLO A;  3CPX A;  4KVX A;  4I49 A;  3FMC A;  4ZX8 A;  1TXR A;  3RO0 A;  3DR6 A;  5HMN A;  2Q7S A;  1ZLI A;  3SXO A;  4MFZ A;  2B4D B;  4UA3 A;  1U6M A;  2G9D A;  1CX8 A;  2B3V A;  2YNC A;  2AFZ A;  3FB3 A;  2PR8 A;  1CPX A;  3I3G A;  2PJA A;  2QIR A;  2PJ9 A;  1JWQ A;  2FVG A;  4P10 A;  4CYO A;  3JTK A;  1WWZ A;  3V8I A;  1YQE A;  4KOS A;  1P0H A;  3C26 A;  2PSW A;  2I00 A;  5AG7 A;  3FEE A;  4MHN A;  2BL1 A;  4A31 A;  1K4J A;  2ZEN A;  2GFQ A;  2P6E A;  5K8P A;  1YLE A;  4F9U A;  3H8E A;  4Z65 A;  4E0A A;  4E8O A;  5K8O A;  1QST A;  5LYD A;  2PVW A;  1F2P A;  1QSN A;  2PJ5 A;  2WUU A;  3I9S A;  4Q38 A;  3B3T A;  4YWY A;  4UEE A;  3KQZ A;  2ZEP A;  2OZU A;  4NGQ A;  3NH8 A;  4R3L A;  3TOA A;  3P2H A;  4LQG A;  5HXD A;  1B87 A;  4PXB A;  1XBU A;  5IB0 A;  3LD2 A;  3IWG A;  3S6F A;  3F8K A;  1FNO A;  3SI0 A;  3K9T A;  3WR7 A;  4CGN A;  3JUW A;  4IF5 A;  4E2A A;  4UEZ A;  5F09 A;  5I4M A;  5AGE A;  4R87 A;  1CBX A;  2RC4 A;  2BO9 A;  2VBQ A;  3OWC A;  2F8H A;  3S6H A;  2CTB A;  4Q36 A;  4EWT A;  4B11 A;  4H6U A;  1BOB A;  1BPN A;  1R3N A;  3B2Y A;  4P4D A;  4CYQ A;  4MHZ A;  2GLF A;  3PBE A;  1VHS A;  4KUA A;  4OC0 A;  2Q44 A;  3KR5 A;  4EVY A;  1LRZ A;  2JBJ A;  5JM6 A;  4KOU A;  2AFU A;  4OME A;  2J8N A;  1N71 A;  3D8P A;  1KUX A;  3KQX A;  3PRT A;  3VAR A;  4UF4 A;  2AFM A;  1XOV A;  5DWN A;  5EBV A;  2PRQ A;  4CRY B;  4K3N A;  4P44 A;  2Q4Y A;  4P45 A;  4GXH A;  1LAN A;  1YK3 A;  1S7L A;  2H5M A;  3DLJ A;  1Q2C A;  1Z2L A;  2QML A;  1VHO A;  3PFE A;  3BJ8 A;  4KZT A;  3SI1 A;  3VWD A;  1ZLH A;  2CY2 A;  2NMT A;  1BAV A;  4MCR A;  2Z0Z A;  3DSB A;  4AVC A;  4BBH A;  4JXR A;  2P6F A;  2NSM A;  2WPW A;  4FAI A;  3JVN A;  3N7Z A;  4H2K A;  5D29 A;  3QB8 A;  2ZW5 A;  3A9L A;  4AVA A;  2RFH A;  2X7B A;  2ZEH A;  2ZEG A;  1VGY A;  4NCZ A;  1J4J A;  3D7H A;  4RN7 A;  2CNM A;  4CGL A;  1Y0Y A;  2B3U A;  1QSR A;  3CPA A;  3B3S A;  3FEC A;  4H89 A;  3S9M A;  4U5Y A;  4X5K A;  3SJE A;  1Y7E A;  4C2Z A;  2G3A A;  4CGM A;  2QVP A;  4CAX A;  3PB7 X;  1NSL A;  2EK8 A;  2AE6 A;  4F0Y A;  3PFO A;  1Q2Y A;  3PGP A;  3EFA A;  4NJR A;  2FL4 A;  4Y49 B;  4YU9 A;  3SJG A;  2J9A A;  2QJ8 A;  4KOT A;  4R57 A;  3D2P A;  2IJZ A;  4HKF A;  5CBM A;  2PVV A;  4M85 A;  4JJX A;  4B12 A;  5KTA A;  2OZG A;  2GE3 A;  4LUA A;  1QSO A;  1S60 A;  3QNV A;  2FT0 A;  3P2F A;  3IGR A;  5F48 A;  4CAF A;  3CXS A;  2EWB A;  1AYE A;  4R7M A;  1IOI A;  1YSJ A;  4WJB A;  3TE4 A;  1RXT A;  2RB7 A;  5LYI A;  1NSA A;  2WZN A;  5IX3 A;  1XEB A;  4M3S A;  3WAB A;  2GIV A;  2ZEE A;  3SJX A;  1A2Z A;  3K2K A;  3GUX A;  2B5G A;  1WK4 A;  5AG6 A;  2Z3M A;  4OID A;  3IWE A;  4OP4 A;  3FED A;  1TF8 A;  5C88 A;  3NE8 A;  4M6G A;  2BEI A;  3LMS A;  1CG2 A;  5LRG A;  5JPH A;  2HV2 A;  4B5P B;  2GLJ A;  3D7F A;  1ARM A;  3PP9 A;  1H8L A;  2AFO A;  4ONW A;  2ODF A;  4JWP A;  4KVM E;  4PV6 A;  4XPD B;  4JXQ A;  4P6Y A;  3CZX A;  2FE7 A;  2HUZ A;  2O53 A;  3IEH A;  2EK9 A;  2PJ0 A;  1XE4 A;  2WSA A;  3D2M A;  3NH5 A;  4FWU A;  2DXQ A;  2GRE A;  2QEC A;  2YNE A;  4NGR A;  3BJ7 A;  3TO9 A;  3MN8 A;  4ZBG A;  5LRJ A;  3W6S A;  2Q51 A;  2G0B A;  2A4N A;  4TWE A;  3SJF A;  2Z3N A;  4UEF A;  2PC1 A;  2B4D A;  5G20 A;  1QQ9 A;  3V38 A;  1YVO A;  4PPZ A;  4DNC A;  1CP6 A;  4ZI6 A;  5IB9 A;  4C7H A;  2J8R A;  4F6A A;  5JGF A;  1CPS A;  3CXP A;  1I1D A;  2Q0Y A;  1XFO A;  2EO8 A;  2ATR A;  4NGT A;  4FBE A;  2PCU A;  4MHP A;  4C2Y A;  3IWW A;  5F49 A;  2VQY A;  4J3G A;  1QMU A;  1Y9K A;  2D4O A;  4FD4 A;  1MJB A;  4U9Y A;  3ISX A;  1NE9 A;  2KCW A;  3IU1 A;  4BIN A;  1AMP A;  3R95 A;  3MRU A;  1VIX A;  2DPT A;  2Z10 A;  1YR0 A;  2FXF A;  2Z3K A;  2PJB A;  1YGH A;  4CAV A;  4TNU A;  3VH9 A;  2ZEM A;  5G1Z A;  4B10 A;  4A37 A;  1TIQ A;  3B8G A;  1PYT B;  4KOX A;  1KWM A;  4A2Z A;  2PQ8 A;  4ZY2 A;  2PE3 A;  3R1K A;  3DDD A;  5J8C A;  1DTD A;  2ARH A;  3FJU A;  3PB6 X;  3NFZ A;  1Y7R A;  3HLP A;  4OC4 A;  2FSR A;  1IYL A;  1ELM P;  4M6H A;  4KLV A;  4OC3 A;  4UFV A;  4A95 A;  4UWI A;  3KL9 A;  1NMT A;  3B7I A;  2OZH A;  4NEX A;  1S7F A;  3D7D A;  5KTD A;  2ANP A;  3GB0 A;  1LCP A;  1M1D A;  5HVH A;  2D4P A;  2PDO A;  3QAY A;  5A28 A;  2CXA A;  1YRE A;  3W91 A;  3BI0 A;  4XPK A;  1XJO A;  2BOA A;  3NE7 A;  5D8N A;  3FF3 A;  2ZEL A;  4OC5 A;  4RI1 A;  4LQ6 A;  5LYF A;  4MBU A;  1EE3 P;  2B4B A;  1Z8X A;  1Z8L A;  1B6B A;  3KAS A;  4ORF A;  1GYT A;  4UCM A;  1AUG A;  4MY0 A;  1Z9U A;  1Q7L A;  2R8V A;  3IJ3 A;  4JZ0 A;  1ARL A;  1FT7 A;  1TKJ A;  4X8I A;  3ZZI A;  3FBU A;  4AXV A;  2VL1 A;  4M6I A;  4XPL A;  4FD5 A;  2Q43 A;  3KKW A;  3L2N A;  1CJW A;  2XEJ A;  4DUK A;  1X10 A;  4R3K A;  4MFQ A;  5BWA B;  3JRU A;  3S9N A;  4UIA A;  4KOV A;  1R57 A;  2O28 A;  1YW4 A;  4MXU A;  5FVJ A;  3H8G A;  3FH4 A;  3GLJ A;  4KOR A;  1IU8 A;  3H4Q A;  1SQH A;  4PXD A;  2F7V A;  4IUS A;  2YGW A;  4A38 A;  4F0X A;  1CM0 A;  3KGQ A;  3FNC A;  4ZY0 A;  3GYA A;  1IID A;  5F47 A;  2Z11 A;  5H86 A;  5HH1 A;  4P4I A;  4X2T A;  5LYL A;  5I0C A;  2ZOG A;  5J8F A;  3T9Y A;  2VEZ A;  2Q4Z A;  3HUV A;  3D3S A;  2XEG A;  1ZG9 A;  1OBR A;  2R98 A;  2EUI A;  2PR1 A;  3WT4 A;  4OC2 A;  2CNS A;  3BXM A;  4R6T A;  3S9L A;  3NH4 A;  4HNW B;  1TF9 A;  4C7I A;  4C2X A;  5EMI A;  2VI7 A;  3CDX A;  3KZW A;  4B5O A;  1YVK A;  1V0C A;  4KLW A;  2POK A;  1M44 A;  2K5T A;  4KUB A;  1VHE A;  3EY5 A;  3RZA A;  3PB9 X;  1IY7 A;  3B3C A;  3TTH A;  3D68 A;  2BCO A;  2OB0 A;  1LAP A;  2PJ4 A;  2PJ1 A;  5F46 A;  3RNZ A;  2PJ7 A;  1OZP A;  3TC8 A;  4ZY1 A;  1Q2D A;  1YX0 A;  2HC9 A;  3PB4 X;  4XNH B;  4EFD A;  4MCQ A;  2ZW7 A;  4H6Z A;  2HB6 A;  4P4E A;  5AG4 A;  4YRH A;  1XIX A;  2ZW4 A;  4FD7 A;  1I21 A;  2V8V A;  2C6P A;  4MJ8 A;  4MFK A;  1KZF A;  3KHX A;  1PUA A;  3TO7 A;  4UFX A;  2JDC A;  2PJ6 A;  2VZZ A;  2PJ8 A;  4KOY A;  5J1Q A;  2YND A;  4JYW A;  2P0W A;  4PK3 A;  3EO4 A;  1M4L A;  1Y9W A;  2P6G A;  2ZEF A;  4R8F A;  4L89 A;  4Y49 C;  5G22 A;  2DPS A;  3TOB A;  6CPA A;  2Q4V A;  2PJ2 A;  2Q04 A;  4MFL A;  1BLL E;  1S3Z A;  3KHZ A;  2Z3L A;  3LOD A;  3MGD A;  3PB8 X;  4ONU A;  4OC1 A;  4HNX B;  4CAW A;  1Z4E A;  3VWE A;  3IU2 A;  3S6K A;  1QSM A;  4CGP A;  1TKF A;  2B5G B;  4A94 A;  4CYN A;  4ZGY B;  2O4H A;  3EC4 A;  4UCP A;  5HVF A;  3DNS A;  4KS9 A;  3TFY A;  3F5B A;  4KSF A;  2PIZ A;  4MI4 A;  4FD6 A;  4NFR A;  3W6X A;  2DF5 A;  1IB1 E;  2WPX A;  2DEA A;  2ZXV A;  3RAM A;  3FIX A;  2AFX A;  3T90 A;  2AJ6 A;  2IL4 A;  3QAH A;  1RO5 A;  2Z3P A;  3T8W A;  4JD6 A;  3FVL A;  2REE A;  4AG7 A;  4P4B A;  3CXQ A;  2GU2 A;  4KVO E;  2R1I A;  1HDQ A;  5CNP A;  2F5I A;  4F9V A;  4EME A;  1CP7 A;  1S7N A;  4GM5 A;  2CF4 A;  4HNY B;  4OAE A;  4XPD C;  1XF8 A;  4ZX9 A;  4KSA A;  2V8H A;  4P4J A;  4QVT A;  3WC6 A;  4A33 A;  4F8Z A;  5H84 A;  1YME A;  1UFH A;  4MY3 A;  2I3C A;  4MHY A;  4NGN A;  3S6G A;  4MCS A;  4K30 A;  3KI9 A;  1Z5R A;  3K9U A;  2B58 A;  2IMO A;  4UWJ A;  4C68 A;  2Z3O A;  5CPA A;  1UWY A;  3F0A A;  4B13 A;  2ZOF A;  3SI2 A;  5JQ4 A;  3ZJ0 A;  1P4N A;  4R76 A;  4MFJ A;  4P4F A;  1KUV A;  4BD9 A;  3KR4 A;  2FCK A;  3UY5 A;  2VXK A;  2PIY A;  1I12 A;  2QYV A;  5E96 A;  3D7G A;  4QUS A;  4ZYQ A;  4KOW A;  3IC1 A;  2OOT A;  1IIC A;  4Q7A A;  1F57 A;  3R9F A;  2Y0M A;  4B14 A;  1MJ9 A;  5ISV A;  3H8F A;  2ABZ A;  4U9Z A;  1BPM A;  5GCN A;  4L8A A;  4O23 A;  2BSW A;  1LAM A;  1ON0 A;  3LAC A;  1MK4 A;  3B3W A;  1X12 A;  4OKO A;  2YNC C;  5AG5 A;  4HPS A;  3GY9 A;  1LOK A;  3G3S A;  4QBJ A;  2FS5 A;  3FXT A;  3TX8 A;  4JLY A;  1XMB A;  2EVN A;  4CGO A;  1R43 A;  2I79 A;  4YGO A;  3WC7 A;  4CS0 B;  2AFS A;  1IOF A;  2IQ6 A;  5JH9 A;  2GAN A;  3H5Z A;  4NXY A;  1S5K A;  2V8D A;  1XRY A;  4YFJ A;  7CPA A;  1ZO0 A;  3FX6 A;  3BI1 A;  3R9G A;  2JEV A;  3IFE A;  3FYN A;  4PSX A;  4R9M A;  2OH1 A;  4NF1 A;  3IO1 A;  1DE4 C;  4OLL A;  5DWM A;  2PJC A;  5IV0 A;  3PBB A;  2VZY A;  4NGM A;  4RUH A;  3G8W A;  1Z4R A;  4CAE A;  1Z8T A;  3GKR A;  1VKC A;  1KUY A;  1ZG7 A;  3TO6 A;  2EBJ A;  3D4U A;  2J8M A;  4IAV A;  4UBR A;  4WWV A;  5ELY A;  2CIJ A;  4PQA A;  3IIB A;  4QC6 A;  4DJL A;  2PJ3 A;  3ISZ A;  4X3R A;  2JLM A;  4G1P A;  4IHM A;  2ZW6 A;  4PK2 A;  2C27 A;  3R9E A;  3GIU A;  4LX9 A;  3RYO A;  1XMT A;  4UCN A;  3TT2 A;  1HDU A;  5A27 A;  3CT9 A;  4NGS A;  5K8M A;  4FUU A;  3R96 A;  3TCV A;  4UIB A;  3B3V A;  2G3T A;  2XEF A;  2FIW A;  2ZEO A;  2ZED A;  1L0C A;  4OIW A;  1BO4 A;  1IYK A;  1ZG8 A;  3DR8 A;  4BMH A;  4GS4 A;  3SHP A;  1HEE A;  3N5F A;  5DS0 A;  3PEI A;  4NJQ A;  1S7K A;  4MHD A;  3RBU A;  3NA6 A;  3VAT A;  4B5P A;  1IGB A;  4DYO A;  5C82 A;  1MJA A;  2FIA A;  4PXC A;  1Z8W A;  1M4G A;  2C6C A;  3E0K A;  4A30 A;  2PRB A;  1M4D A;  4AB7 A;  1PCA A;  3WC5 A;  1YW6 A;  2BUE A;  3SXN A;  4B6Z A;  2V77 A;  3BHX A;  2C6G A;  3LWU A;  4UFW A;  3D66 A;  5THW A;  2XEI A;  5HVG A;  2CNT A;  4MFP A;  2ZPA A;  4PXE A;  1FY7 A;  4A39 A;  4MCP A;  1F2O A;  1PU9 A;  4NSQ A;  2C1C A;  2CTC A;  2JEW A;  3D67 A;  2R7H A;  2Q7B A;  3EXN A;  3PZJ A;  5KTC A;  4PSW A;  2HQY A;  2REF A;  3V7Z A;  4AG9 A;  4CYP A;  8CPA A;  4II9 A;  5LRK A;  3FRM A;  3DGV A;  1JQG A;  2AFW A;  5EC4 A;  1ELL P;  4OAD A;  1TKH A;  4AVB A;  5K8N A;  4NGP A;  1LFW A;  2V8G A;  4A32 A;  1GHE A;  1M4I A;  2OU2 A;  4IK2 A;  4MRI A;  2JDD A;  2NYQ A;  5G21 A;  4QB9 A;  3B35 A;  4RS2 A;  3BLN A;  1RTQ A;  1Y0R A;  4KSI A;  4MMO A;  4CPA A;  4XNH C;  2OR4 A;  4CRZ B;  2WYR A;  3I1U A;  4W9Y A; 
#chains in the Genus database with same CATH homology
 4KVX A;  4I49 A;  3DR6 A;  5HMN A;  3SXO A;  4MFZ A;  2B4D B;  4UA3 A;  1U6M A;  2B3V A;  2YNC A;  3I3G A;  3FB3 A;  2PR8 A;  2QIR A;  4CYO A;  3JTK A;  1WWZ A;  3V8I A;  4KOS A;  1P0H A;  3C26 A;  2PSW A;  2I00 A;  5AG7 A;  2BL1 A;  4A31 A;  1K4J A;  2P6E A;  1YLE A;  4E0A A;  4E8O A;  1QST A;  1QSN A;  2WUU A;  3I9S A;  4Q38 A;  4R3L A;  2OZU A;  3TOA A;  3P2H A;  1B87 A;  5IB0 A;  3LD2 A;  3IWG A;  3S6F A;  3F8K A;  3WR7 A;  4CGN A;  3JUW A;  4IF5 A;  4E2A A;  5AGE A;  4R87 A;  2RC4 A;  2VBQ A;  3OWC A;  3S6H A;  4Q36 A;  4B11 A;  4H6U A;  1BOB A;  4CYQ A;  1VHS A;  4KUA A;  2Q44 A;  4EVY A;  1LRZ A;  4KOU A;  2J8N A;  1N71 A;  3D8P A;  1KUX A;  5DWN A;  5EBV A;  4CRY B;  2Q4Y A;  1YK3 A;  1S7L A;  2H5M A;  1Q2C A;  2QML A;  4KZT A;  3BJ8 A;  3VWD A;  2CY2 A;  2NMT A;  2Z0Z A;  3DSB A;  4AVC A;  4BBH A;  4JXR A;  2P6F A;  2WPW A;  3JVN A;  3N7Z A;  3QB8 A;  2ZW5 A;  3A9L A;  4AVA A;  2X7B A;  4NCZ A;  1J4J A;  2CNM A;  4CGL A;  2B3U A;  1QSR A;  4H89 A;  4U5Y A;  4X5K A;  4CGM A;  4C2Z A;  2G3A A;  4CAX A;  1NSL A;  2AE6 A;  4F0Y A;  1Q2Y A;  3PGP A;  3EFA A;  4Y49 B;  2FL4 A;  4KOT A;  4R57 A;  3D2P A;  4HKF A;  4M85 A;  4B12 A;  4JJX A;  5KTA A;  2OZG A;  2GE3 A;  4LUA A;  1QSO A;  1S60 A;  2FT0 A;  3P2F A;  3IGR A;  5F48 A;  4CAF A;  3CXS A;  3TE4 A;  1RXT A;  5IX3 A;  1XEB A;  4M3S A;  2GIV A;  2B5G A;  1WK4 A;  2Z3M A;  3IWE A;  5C88 A;  2BEI A;  5JPH A;  2HV2 A;  4B5P B;  3PP9 A;  4PV6 A;  5AG6 A;  4XPD B;  4KVM E;  4JXQ A;  2FE7 A;  2HUZ A;  4JWP A;  2WSA A;  1XE4 A;  3D2M A;  3TO9 A;  2DXQ A;  2QEC A;  2YNE A;  3BJ7 A;  4ZBG A;  3W6S A;  2G0B A;  2A4N A;  2Z3N A;  2PC1 A;  2B4D A;  5G20 A;  1YVO A;  4DNC A;  4C7H A;  2J8R A;  4F6A A;  3CXP A;  1I1D A;  2Q0Y A;  2ATR A;  4C2Y A;  5F49 A;  2VQY A;  4J3G A;  1Y9K A;  2D4O A;  4FD4 A;  1MJB A;  4U9Y A;  1NE9 A;  2KCW A;  3IU1 A;  3R95 A;  2Z10 A;  2DPT A;  1YR0 A;  2FXF A;  2Z3K A;  1YGH A;  4CAV A;  5G1Z A;  4B10 A;  1TIQ A;  3B8G A;  4KOX A;  4A2Z A;  2PQ8 A;  3R1K A;  3DDD A;  5J8C A;  2ARH A;  1Y7R A;  2FSR A;  1IYL A;  4KLV A;  4UFV A;  4A95 A;  4UWI A;  1NMT A;  2OZH A;  4NEX A;  1S7F A;  5KTD A;  1M1D A;  2D4P A;  2PDO A;  2CXA A;  1YRE A;  3W91 A;  4XPK A;  3NE7 A;  4RI1 A;  4MBU A;  4UCM A;  2B4B A;  1B6B A;  4ORF A;  4MY0 A;  1Z9U A;  2R8V A;  3ZZI A;  3FBU A;  4XPL A;  4FD5 A;  3KKW A;  1CJW A;  4R3K A;  4MFQ A;  5BWA B;  4KOV A;  1R57 A;  2O28 A;  5FVJ A;  4KOR A;  3H4Q A;  1SQH A;  4IUS A;  2YGW A;  4F0X A;  1CM0 A;  3FNC A;  3GYA A;  1IID A;  5F47 A;  2Z11 A;  5H86 A;  5HH1 A;  5I0C A;  5J8F A;  3T9Y A;  2VEZ A;  3D3S A;  2R98 A;  2EUI A;  2PR1 A;  2CNS A;  4HNW B;  4C7I A;  4C2X A;  2VI7 A;  4B5O A;  1YVK A;  1V0C A;  4KLW A;  1M44 A;  2K5T A;  4KUB A;  3EY5 A;  3TTH A;  2OB0 A;  5F46 A;  1OZP A;  1Q2D A;  1YX0 A;  4XNH B;  2ZW7 A;  4H6Z A;  5AG4 A;  4YRH A;  1XIX A;  2ZW4 A;  4FD7 A;  1I21 A;  4MJ8 A;  4MFK A;  1KZF A;  1PUA A;  3TO7 A;  4UFX A;  2JDC A;  2VZZ A;  4KOY A;  2YND A;  2P0W A;  4PK3 A;  3EO4 A;  1Y9W A;  2P6G A;  3TOB A;  4L89 A;  4Y49 C;  5G22 A;  2DPS A;  2Q4V A;  2Q04 A;  4MFL A;  1S3Z A;  3MGD A;  3LOD A;  2Z3L A;  4ONU A;  4HNX B;  4CAW A;  1Z4E A;  3VWE A;  3IU2 A;  3S6K A;  1QSM A;  4CGP A;  2B5G B;  4CYN A;  4ZGY B;  3EC4 A;  4UCP A;  3DNS A;  4KS9 A;  3TFY A;  3F5B A;  4KSF A;  4MI4 A;  4FD6 A;  3W6X A;  1IB1 E;  2WPX A;  2ZXV A;  3FIX A;  3T90 A;  2AJ6 A;  2IL4 A;  3QAH A;  1RO5 A;  2Z3P A;  4JD6 A;  2REE A;  4AG7 A;  3CXQ A;  4KVO E;  2R1I A;  5CNP A;  2F5I A;  4HNY B;  1S7N A;  4OAE A;  4XPD C;  1XF8 A;  4KSA A;  4A33 A;  4QVT A;  5H84 A;  1UFH A;  4MY3 A;  3S6G A;  4K30 A;  3K9U A;  2B58 A;  4UWJ A;  4C68 A;  2Z3O A;  3F0A A;  4B13 A;  5JQ4 A;  3ZJ0 A;  1P4N A;  4MFJ A;  1KUV A;  2FCK A;  3UY5 A;  2VXK A;  1I12 A;  5E96 A;  4QUS A;  4KOW A;  1IIC A;  3R9F A;  2Y0M A;  4B14 A;  1MJ9 A;  5ISV A;  4U9Z A;  5GCN A;  4L8A A;  2BSW A;  1ON0 A;  1MK4 A;  2YNC C;  5AG5 A;  3GY9 A;  3G3S A;  4QBJ A;  2FS5 A;  3FXT A;  4JLY A;  2EVN A;  4CGO A;  2I79 A;  4YGO A;  4CS0 B;  2GAN A;  3H5Z A;  4NXY A;  1S5K A;  4YFJ A;  1ZO0 A;  3R9G A;  2JEV A;  3FYN A;  4PSX A;  4R9M A;  2OH1 A;  4NF1 A;  4OLL A;  5DWM A;  5IV0 A;  2VZY A;  3G8W A;  1Z4R A;  4CAE A;  3GKR A;  1VKC A;  1KUY A;  3TO6 A;  2J8M A;  4UBR A;  4QC6 A;  2JLM A;  3R9E A;  4PK2 A;  2ZW6 A;  3TT2 A;  2C27 A;  5A28 A;  4LX9 A;  3RYO A;  5A27 A;  1XMT A;  4UCN A;  3R96 A;  3TCV A;  2G3T A;  2FIW A;  1L0C A;  1BO4 A;  1IYK A;  3DR8 A;  4BMH A;  4GS4 A;  3SHP A;  1S7K A;  4MHD A;  4B5P A;  5C82 A;  1MJA A;  2FIA A;  1M4G A;  3E0K A;  4A30 A;  2PRB A;  1M4D A;  4AB7 A;  2BUE A;  3SXN A;  4UFW A;  2CNT A;  4MFP A;  2ZPA A;  1FY7 A;  1PU9 A;  4NSQ A;  2R7H A;  2Q7B A;  3EXN A;  3PZJ A;  5KTC A;  4PSW A;  2HQY A;  2REF A;  4CYP A;  4AG9 A;  4II9 A;  3FRM A;  4AVB A;  5EC4 A;  4OAD A;  4A32 A;  1GHE A;  1M4I A;  2OU2 A;  5G21 A;  2JDD A;  4QB9 A;  4RS2 A;  3BLN A;  4XNH C;  4CRZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...