2VI7A

Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
164
structure length
163
Chain Sequence
TIRLERYSERHVEGLTALYNDPAVARQVLQMPYQSVEQRRKRLHDSDDDRLLILVALHQGDVIGSASLEQHPRIRRSHSGSIGMGVAVAWQGKGVGSRLLGELLDIADNWMNLRRVELTVYTDNAPALALYRKFGFETEGEMRDYAVRDGRFVDVYSMARLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Putative Acetyltransferase (Pa1377) from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords ACETYLTRANSFERASE PA1377
total genus 45
structure length 163
sequence length 164
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vi7A00
1K4JA 3DSBA 4KORA 4XPKA 4ZBGA 2FS5A 4F0YA 4X5KA 1Q2DA 1M4IA 2I79A 4CAXA 1S7KA 2H5MA 4HNXB 1P4NA 3FB3A 2G3TA 4YRHA 4H6UA 4KLVA 1M44A 4UA3A 3PP9A 1Y9WA 4OAEA 2ZW7A 2PRBA 3TOBA 1MJBA 4ONUA 1PUAA 4K30A 2PR8A 1Q2YA 2D4OA 4IF5A 4U9ZA 2PC1A 3EY5A 4HKFA 4CRYB 1IYKA 4KVME 4U5YA 3EO4A 3H4QA 2I00A 4XPLA 1B6BA 4FD4A 4LX9A 2AJ6A 5KTAA 2R8VA 4KVXA 1XEBA 5ISVA 2G0BA 2PQ8A 3KKWA 1CJWA 2Q4YA 3W6XA 1Y7RA 2DXQA 1S3ZA 2QIRA 3CXQA 4NSQA 3TFYA 3C26A 2J8MA 3EC4A 3D2MA 3PZJA 3G3SA 1YVKA 1VHSA 3IGRA 5H84A 1PU9A 2RC4A 3R9GA 5IB0A 2J8NA 1YK3A 3E0KA 4R9MA 3ZZIA 4MY3A 2Z0ZA 2GIVA 1S60A 4YGOA 1SQHA 1IICA 4UWJA 4R3LA 4H89A 2R7HA 4FD6A 2GE3A 1YR0A 4Y49C 2D4PA 1IB1E 4NXYA 2ZPAA 2FXFA 4IUSA 1NE9A 1RO5A 2OU2A 2K5TA 2B4DA 2JEVA 2CNMA 4J3GA 1KUYA 2P6EA 2HQYA 2VEZA 4AB7A 1NMTA 1XIXA 4MBUA 1N71A 4KOYA 4NEXA 5EBVA 3D3SA 4OADA 3BJ7A 2Q7BA 3R9EA 2BEIA 1I21A 4LUAA 4XNHB 3G8WA 1YREA 5HH1A 1RXTA 2OZUA 4JWPA 4R57A 3ZJ0A 2B3VA 1S5KA 4JXRA 3F0AA 4RS2A 1YGHA 2EVNA 2BUEA 3D8PA 1Q2CA 5J8CA 2G3AA 4PV6A 4KOVA 1WK4A 2CNSA 4OLLA 2KCWA 3TO9A 2ARHA 3W91A 5KTDA 5I0CA 1CM0A 2FL4A 3GYAA 4JD6A 2B4DB 3S6GA 3TCVA 5C82A 1M1DA 3I9SA 4XNHC 4E0AA 4AG9A 1Y9KA 4KOWA 3EFAA 1FY7A 1KZFA 2B5GA 5F49A 4AVCA 2FSRA 2ZW5A 2F5IA 4MI4A 3TE4A 4PSXA 1OZPA 3QAHA 3FRMA 4XPDC 4AG7A 2A4NA 2QECA 3FXTA 4AVBA 3K9UA 3TO7A 3R96A 3P2HA 4PSWA 4R3KA 3FBUA 3PGPA 4MHDA 2O28A 4KOSA 4QUSA 1IYLA 3I3GA 2PDOA 2Q0YA 5DWMA 2JDDA 1YVOA 4HNWB 2ATRA 2Q44A 5JPHA 2Y0MA 4XPDB 5C88A 4FD5A 1ON0A 2HV2A 1Z9UA 1QSMA 1VKCA 2VZYA 2B5GB 2B58A 2GANA 1L0CA 2PR1A 2WPWA 3W6SA 4E8OA 4QC6A 5IX3A 3S6HA 2REEA 2FE7A 3D2PA 4EVYA 2AE6A 2FCKA 3VWDA 1M4DA 2P6FA 5H86A 3TOAA 4U9YA 2VI7A 4L8AA 2EUIA 3FIXA 4M3SA 2HUZA 1IIDA 4CAWA 2NMTA 4NF1A 3CXPA 4FD7A 1LRZA 3UY5A 1XF8A 2P0WA 3EXNA 2B4BA 2OH1A 4YFJA 4AVAA 3RYOA 4JLYA 3S6KA 1KUVA 2FIWA 4MJ8A 3TO6A 1MK4A 3DR6A 2OB0A 2VBQA 3DR8A 4CAVA 5F47A 3R1KA 1NSLA 2Q4VA 3F8KA 5HMNA 1M4GA 2FT0A 5KTCA 5FVJA 3T9YA 2VZZA 1KUXA 3LD2A 3QB8A 1GHEA 1WWZA 3BLNA 4II9A 3B8GA 1I1DA 2IL4A 4CS0B 4DNCA 2ZW6A 1R57A 2REFA 3CXSA 2QMLA 3SHPA 3DDDA 3P2FA 4KUBA 1BOBA 4B5PB 2VQYA 4QB9A 5JQ4A 4KZTA 1QSOA 2WPXA 4MY0A 3N7ZA 1UFHA 2Z11A 4KOUA 4NCZA 1BO4A 3JVNA 1B87A 3BJ8A 1YX0A 4KVOE 4E2AA 4UWIA 3GKRA 4B5OA 2VXKA 5J8FA 2OZHA 4KLWA 4KUAA 3R9FA 3TT2A 1XE4A 5E96A 5IV0A 2CY2A 1P0HA 2BL1A 4GS4A 1QSTA 3S6FA 2CNTA 2JDCA 3JUWA 4H6ZA 2R98A 3DNSA 2C27A 1U6MA 1S7FA 4I49A 5F48A 3FYNA 1I12A 1Z4RA 4PK2A 4B5PA 3GY9A 5GCNA 2JLMA 4UBRA 2BSWA 3NE7A 1V0CA 4PK3A 3SXOA 4JXQA 2ZW4A 4JJXA 4RI1A 5EC4A 1J4JA 3MGDA 4KOXA 5F46A 4R87A 1QSNA 3T90A 3LODA 2B3UA 3SXNA 1MJ9A 3F5BA 5DWNA 2ZXVA 4BMHA 4KOTA 5CNPA 2Z10A 3V8IA 3OWCA 3FNCA 1QSRA 2Q04A 4CRZB 4L89A 2OZGA 2P6GA 2R1IA 2X7BA 4ORFA 2FIAA 1YLEA 1Z4EA 1TIQA 3VWEA 3WR7A 4QBJA 4M85A 3TTHA 2J8RA 4Y49B 2PSWA 1S7NA 1XMTA 1S7LA 1MJAA 4F6AA 4HNYB 3IWGA 4QVTA 3R95A
chains in the Genus database with same CATH superfamily
1K4JA 3DSBA 4MFPA 5LRJA 2QVPA 4KORA 4XPKA 4ZBGA 4CYQA 3GIUA 2FS5A 4F0YA 4X5KA 4ZGYB 1Q2DA 1CPXA 1M4IA 2I79A 3B3CA 4M6IA 1S7KA 4CAXA 2H5MA 2XEIA 4HNXB 3CPAA 3B3WA 2ZEGA 2FVGA 1P4NA 3FB3A 2G3TA 4YRHA 2Z3PA 4H6UA 4KLVA 1M44A 3V7ZA 1QMUA 4UA3A 4ZY1A 3PP9A 1Y9WA 4OAEA 2ODFA 4IHMA 4UEFA 2ZW7A 4X2TA 2PRBA 3A9LA 3TOBA 1QQ9A 5JH9A 1MJBA 4ONUA 1PUAA 4K30A 2PR8A 2PJ7A 1Q2YA 3IWWA 3WC6A 4G1PA 4C68A 2G9DA 2D4OA 3KI9A 4IF5A 4CYPA 4U9ZA 2ZEDA 4CPAA 2PC1A 5AG5A 3EY5A 4HKFA 4CRYB 1IYKA 6CPAA 2AFMA 1ELMP 4KVME 1BPNA 2JBJA 3EO4A 2ZEHA 3H4QA 4U5YA 5D8NA 2QJ8A 4XPLA 4MCSA 3V38A 1B6BA 3B3TA 4FD4A 4LX9A 2AJ6A 4NJQA 5KTAA 3VH9A 1IGBA 3DLJA 3IEHA 2R8VA 3FH4A 4KVXA 5LYIA 1XEBA 5ISVA 2G0BA 2PQ8A 3KKWA 3NH8A 3TC8A 1YQEA 1CJWA 2Q4YA 4LQ6A 3W6XA 1Y7RA 2O4HA 2DXQA 4A32A 1S3ZA 2ZEPA 1VHEA 2QIRA 1BPMA 1Z2LA 5K8MA 4M6HA 3CXQA 5HVGA 2BOAA 4NSQA 3TFYA 1Z8WA 3C26A 5K8OA 1FNOA 2YGWA 4PXBA 5G20A 4UF4A 2J8MA 2V8HA 4OC0A 5LYDA 1TF9A 2AFZA 2DF5A 2IQ6A 2YNCC 2PVWA 3EC4A 3D2MA 3PZJA 3G3SA 4MHNA 1YVKA 4NGSA 3TX8A 1BLLE 1VHSA 3IGRA 4WJBA 5H84A 1PU9A 5LRGA 4A39A 1ZLHA 2RC4A 3QNVA 2YNCA 5AGEA 3RBUA 4YU9A 3R9GA 2ZEMA 5IB0A 2J8NA 1A2ZA 1Y0YA 1YK3A 3E0KA 3PBBA 2F7VA 4R9MA 3ZZIA 4MY3A 2Z0ZA 1R43A 1Y0RA 2GIVA 1S60A 4YGOA 1SQHA 1IICA 1Z8XA 4UWJA 4R3LA 5G1ZA 3H8FA 3RAMA 3D66A 1TKHA 4H89A 4UEEA 2R7HA 4FD6A 5HVHA 2GE3A 1NSAA 1YR0A 2ZOGA 4Y49C 4KSAA 2D4PA 2EK9A 2PJCA 2WYRA 1IB1E 4B13A 3KQXA 2PCUA 4NXYA 5I4MA 1F2OA 1VIXA 2ZPAA 3RNZA 2FXFA 4IK2A 1YLOA 2GLFA 3FEDA 4IUSA 1NE9A 1RO5A 4NGNA 4PXDA 2OU2A 2K5TA 5ELYA 2B4DA 2JEVA 5LYLA 4P4IA 3FVLA 2AFOA 2CNMA 4J3GA 1KUYA 2P6EA 2HQYA 5DS0A 3IU1A 2DPTA 2VEZA 3R95A 4BINA 2GFQA 4AB7A 4F9VA 1NMTA 1PCAA 2PJ8A 1XIXA 2PJBA 4RN7A 3GUXA 4MBUA 1N71A 4KOYA 2RB7A 3PB6X 4NEXA 1YSJA 3BI1A 4ONWA 5D29A 4ZX8A 5EBVA 3D3SA 3FJUA 4GM5A 4A2ZA 4B11A 4OP4A 1IOFA 3ISZA 4OADA 3BJ7A 2Q7BA 3R9EA 4CGPA 2BEIA 1I21A 4LUAA 4XNHB 3G8WA 7CPAA 1YREA 2C1CA 4NGQA 1RXTA 1M4LA 5HH1A 2CTCA 2VL1A 2OZUA 2ABZA 3D7DA 3FEEA 3L2NA 4JWPA 2B3VA 1S5KA 4JXRA 4R57A 3ZJ0A 3F0AA 3D7GA 4RS2A 4ZI6A 3D67A 1YGHA 4WWVA 2EVNA 3LMSA 2BUEA 3D8PA 1Q2CA 3FMCA 4MHZA 4RUHA 5J8CA 2G3AA 4P4EA 4PV6A 3D4UA 4KOVA 3KZWA 2Z3KA 3VATA 2GLJA 2PRQA 1WK4A 2CNSA 3GB0A 4UCNA 2PJAA 4OLLA 4LQGA 5IB9A 2IJZA 2KCWA 2HC9A 2WSAA 3TO9A 3NFZA 2YNEA 2ARHA 4CAEA 3W91A 2PJ1A 1AYEA 4M6GA 2ZEEA 5KTDA 5I0CA 1CM0A 3BHXA 3D7FA 3PFEA 3SI0A 2FL4A 3GYAA 4JD6A 1ELLP 2B4DB 4X3RA 1TF8A 3S6GA 2CXAA 3TCVA 5C82A 1DE4C 1LAMA 1M1DA 2AFUA 3SI2A 3PEIA 3H8EA 2PJ2A 2ZEFA 3I9SA 3VARA 4XNHC 3IFEA 3IWEA 4E0AA 1CG2A 2ZENA 4MFLA 4YWYA 4AG9A 1Y9KA 2Q43A 4KOWA 3NH4A 3EFAA 3IU2A 4A31A 5G21A 3B3SA 1FY7A 3WT4A 1EE3P 2NSMA 1KZFA 2B5GA 5F49A 4AVCA 2FSRA 3BXMA 4C2XA 4EWTA 4P4DA 2ZW5A 2F5IA 4MI4A 2RFHA 3B7IA 3TE4A 4B6ZA 4PSXA 5LYFA 2CIJA 2BCOA 1OZPA 2XEGA 3CZXA 3KQZA 3FRMA 3QAHA 1HEEA 4XPDC 4AG7A 2A4NA 4PPZA 2JBKA 2QECA 3FXTA 4AVBA 3K9UA 3TO7A 4K3NA 1FT7A 2AFXA 3R96A 3P2HA 3RO0A 4PSWA 4R8FA 4R3KA 1ZLIA 3FBUA 4C2YA 3PGPA 4CYNA 1CP6A 4MHDA 2O28A 2ANPA 1RTQA 4C2ZA 4MFQA 4MXUA 4A94A 4AXVA 4KOSA 2PE3A 4QUSA 4W9YA 1IYLA 1Y7EA 4H2KA 1KWMA 3I3GA 2ZEOA 2PDOA 4NGPA 2Q0YA 5DWMA 4B14A 4OC5A 2CF4A 3MRUA 2JDDA 1YVOA 4HNWB 4P4JA 4ZX9A 5JGFA 3IWGA 2ATRA 2Q44A 5JPHA 2Y0MA 3H8GA 4XPDB 1JWQA 5C88A 4FD5A 1ON0A 2HV2A 3WC5A 5A28A 3IJ3A 3KR5A 4A37A 1Z9UA 1F2PA 1QSMA 5G22A 4B12A 1VKCA 2VZYA 3S9NA 4CAFA 5A27A 3D7HA 2B5GB 2B58A 2GANA 2OR4A 4R76A 1HDUA 2EO8A 4B10A 1L0CA 2PR1A 2WPWA 3KHXA 3W6SA 2C6PA 4E8OA 4ZY0A 4QC6A 5IX3A 1CP7A 3S6HA 3B35A 2REEA 2FE7A 5JM6A 3D2PA 4EVYA 3PRTA 2AE6A 3H5ZA 1R3NA 2FCKA 1M4DA 2P6FA 5H86A 3VWDA 2AFSA 5HXDA 2Q51A 3TOAA 2JEWA 4BD9A 3KASA 4U9YA 3BI0A 4PQAA 2VI7A 4F9UA 4L8AA 4TWEA 2GREA 1VGYA 2EUIA 4DUKA 3FIXA 4M3SA 4MFZA 4MCPA 4F6AA 2PIYA 3FX6A 3N5FA 1ZG8A 2HUZA 2PVVA 3CT9A 1IIDA 4EFDA 4OMEA 4IAVA 2EK8A 1Z5RA 2NMTA 2PJ6A 4CAWA 4CGLA 5AG6A 2QYVA 4P4BA 4NF1A 3CXPA 3ISXA 4FD7A 1LRZA 3UY5A 1XF8A 2P0WA 3EXNA 3IC1A 5CBMA 4P44A 1JQGA 2B4BA 2OH1A 4P4FA 4YFJA 4AVAA 4OC1A 4CGNA 4MFKA 3RYOA 8CPAA 1DTDA 1F57A 3KR4A 4OC4A 4R7MA 1Z8LA 4JLYA 3IIBA 3PB9X 3S6KA 1KUVA 1GYTA 2FIWA 4C7HA 4MJ8A 3TO6A 1MK4A 4P45A 4A38A 4UFWA 3NE8A 3DR6A 2OB0A 2VBQA 3DR8A 4CAVA 4FAIA 5F47A 3KHZA 3R1KA 4NGMA 1NSLA 2Q4VA 5F09A 3F8KA 3SI1A 1M4GA 5HMNA 2FT0A 3PB7X 4UFVA 1TKJA 5KTCA 1BAVA 5FVJA 4MCQA 2VZZA 4MCRA 3T9YA 2I3CA 4DJLA 4UCMA 1KUXA 1ZG7A 3LD2A 3QB8A 1GHEA 1WWZA 3BLNA 4OIDA 4II9A 3B8GA 1CX8A 1I1DA 1IU8A 2IL4A 4CS0B 2ZW6A 1Z8TA 4JYWA 1R57A 4DNCA 2Z3MA 4GXHA 1X10A 1H8LA 2REFA 3CXSA 1XJOA 2QMLA 2V77A 3SHPA 2OOTA 1X12A 5CPAA 4FBEA 3DDDA 4UIAA 4ZYQA 3P2FA 3HUVA 4KUBA 1BOBA 1LOKA 4C7IA 4B5PB 2Q7SA 4UEZA 1LANA 2VQYA 4QB9A 5EMIA 5JQ4A 1XFOA 1XBUA 4KZTA 1QSOA 4FWUA 2WPXA 3QAYA 5BWAB 4MY0A 3N7ZA 4OC2A 3WABA 4BBHA 4KSIA 3PFOA 1HDQA 1UFHA 2Z11A 1TKFA 1AMPA 3CPXA 4TNUA 1XRYA 3FF3A 4KOUA 1BO4A 4NCZA 3JVNA 4R6TA 5J1QA 2Z3OA 3PBEA 1B87A 3BJ8A 1YX0A 5AG4A 4KVOE 1ZO0A 4E2AA 4UWIA 3RZAA 3GKRA 1ARMA 2EBJA 2PJ3A 2CTBA 2VXKA 4NJRA 2DEAA 4B5OA 5J8FA 3IO1A 2OZHA 4KLWA 4KUAA 3B2YA 2WZNA 3R9FA 3TT2A 3PB4X 3SJFA 3K9TA 2Z3LA 1XE4A 5E96A 4MMOA 5IV0A 5K8PA 2J9AA 2CY2A 1IOIA 1P0HA 4CYOA 2PJ5A 4A33A 3D68A 2BL1A 4GS4A 1QSTA 1TXRA 3DGVA 3LWUA 2CNTA 3S6FA 1YW6A 4UIBA 1CPSA 4DYOA 2GU2A 3T8WA 3FECA 2JDCA 2AFWA 4Q7AA 3JUWA 4H6ZA 2R98A 4P6YA 3SJXA 1IY7A 3DNSA 2C27A 1U6MA 4OKOA 1S7FA 4NGTA 4I49A 4UFXA 5F48A 4ZY2A 3FYNA 1I12A 1Z4RA 4PK2A 4F8ZA 1ARLA 2NYQA 4B5PA 3GY9A 2WUUA 3MN8A 1AUGA 3NH5A 5GCNA 2JLMA 3CDXA 3KGQA 4Z65A 4CGMA 4UBRA 4NGRA 3I1UA 4MRIA 2BSWA 5THWA 4HPSA 3NE7A 1V0CA 3JRUA 4PK3A 4JXQA 3SXOA 2ZW4A 4JJXA 2C6GA 1CBXA 1OBRA 4RI1A 5EC4A 1J4JA 4OIWA 1XMBA 4MHYA 3MGDA 2V8VA 5HVFA 2V8DA 2PJ9A 3PB8X 4CGOA 4MHPA 3LACA 1YW4A 3NA6A 4KOXA 4PXEA 3WC7A 5F46A 2Q4ZA 4FUUA 4R87A 1QSNA 2DPSA 3GLJA 3T90A 2PJ0A 3B3VA 3K2KA 3LODA 4KSFA 4PXCA 2IMOA 2ZELA 2POKA 2PIZA 1ZG9A 2B3UA 4NFRA 5K8NA 2F8HA 2C6CA 3JTKA 1Q7LA 2HB6A 3SXNA 1MJ9A 1UWYA 2PJ4A 3F5BA 1LAPA 5AG7A 4OC3A 4A30A 2Z3NA 2YNDA 2XEFA 5LRKA 4JZ0A 5DWNA 4A95A 2ZXVA 4BMHA 4KOTA 4P10A 5CNPA 2Z10A 4MFJA 3OWCA 2BO9A 3FNCA 3V8IA 1QSRA 2Q04A 2V8GA 4CRZB 4L89A 2OZGA 2P6GA 2R1IA 4X8IA 3SJGA 2X7BA 4EMEA 4ORFA 3SJEA 3S9LA 2FIAA 1YLEA 1Z4EA 1TIQA 2XEJA 3VWEA 4KS9A 2O53A 3WR7A 4QBJA 4M85A 4Q38A 3TTHA 1LCPA 3KL9A 4O23A 1VHOA 2EWBA 3S9MA 2J8RA 4Y49B 2PSWA 2ZOFA 1S7NA 4UCPA 1XOVA 1YMEA 4Q36A 4F0XA 1XMTA 3HLPA 1S7LA 1MJAA 1PYTB 4HNYB 2I00A 4QVTA 1LFWA
chains in the Genus database with same CATH topology
1K4JA 3DSBA 4MFPA 4KORA 4XPKA 4ZBGA 4CYQA 4ZGYB 2FS5A 4F0YA 4X5KA 1Q2DA 1M4IA 2I79A 4CAXA 1S7KA 2H5MA 4HNXB 1P4NA 3FB3A 2G3TA 4YRHA 2Z3PA 4H6UA 4KLVA 1M44A 4UA3A 3PP9A 1Y9WA 4OAEA 2ZW7A 2PRBA 3A9LA 3TOBA 1MJBA 4ONUA 1PUAA 4K30A 2PR8A 1Q2YA 4C68A 2D4OA 4IF5A 4CYPA 4U9ZA 2PC1A 5AG5A 3EY5A 4HKFA 4CRYB 1IYKA 4KVME 4U5YA 3EO4A 3H4QA 4XPLA 1B6BA 4FD4A 4LX9A 2AJ6A 5KTAA 2R8VA 4KVXA 1XEBA 5ISVA 2G0BA 2PQ8A 3KKWA 1CJWA 2Q4YA 3W6XA 1Y7RA 2DXQA 4A32A 1S3ZA 2QIRA 3CXQA 4NSQA 3TFYA 3C26A 2YGWA 5G20A 2J8MA 3EC4A 2YNCC 3D2MA 3PZJA 3G3SA 1YVKA 1VHSA 3IGRA 5H84A 1PU9A 2RC4A 5AGEA 2YNCA 3R9GA 5IB0A 2J8NA 1YK3A 3E0KA 4R9MA 3ZZIA 4MY3A 2Z0ZA 2GIVA 1S60A 4YGOA 1SQHA 1IICA 4UWJA 4R3LA 5G1ZA 4H89A 2R7HA 4FD6A 2GE3A 1YR0A 4Y49C 4KSAA 2D4PA 1IB1E 4B13A 4NXYA 2ZPAA 2FXFA 4IUSA 1NE9A 1RO5A 2OU2A 2K5TA 2B4DA 2JEVA 2CNMA 4J3GA 1KUYA 2P6EA 2HQYA 3IU1A 2VEZA 2DPTA 4AB7A 1NMTA 1XIXA 4MBUA 1N71A 4KOYA 4NEXA 5EBVA 3D3SA 4A2ZA 4B11A 4OADA 3BJ7A 2Q7BA 3R9EA 4CGPA 2BEIA 1I21A 4LUAA 4XNHB 3G8WA 1YREA 5HH1A 1RXTA 5A27A 2OZUA 4JWPA 4R57A 3ZJ0A 2B3VA 1S5KA 4JXRA 3F0AA 4RS2A 1YGHA 2EVNA 2BUEA 3D8PA 1Q2CA 5J8CA 2G3AA 4PV6A 4KOVA 2Z3KA 1WK4A 2CNSA 4UCNA 4OLLA 2KCWA 2WSAA 3TO9A 2YNEA 2ARHA 4CAEA 3W91A 5KTDA 5I0CA 1CM0A 2FL4A 3GYAA 4JD6A 2B4DB 3S6GA 3TCVA 2CXAA 5C82A 1M1DA 3I9SA 4XNHC 3IWEA 4E0AA 4AG9A 4MFLA 1Y9KA 4KOWA 3EFAA 3IU2A 4A31A 5G21A 1FY7A 1KZFA 2B5GA 5F49A 4AVCA 2FSRA 4C2XA 2ZW5A 2F5IA 4MI4A 3TE4A 4PSXA 1OZPA 3QAHA 3FRMA 4XPDC 4AG7A 2A4NA 2QECA 3FXTA 4AVBA 3K9UA 3TO7A 3R96A 3P2HA 4PSWA 4R3KA 3FBUA 4C2YA 3PGPA 4CYNA 4MHDA 2O28A 4C2ZA 4MFQA 4KOSA 4QUSA 1IYLA 3I3GA 2PDOA 2Q0YA 5DWMA 4B14A 2JDDA 1YVOA 4HNWB 3IWGA 2ATRA 2Q44A 5JPHA 2Y0MA 4XPDB 5C88A 4FD5A 1ON0A 2HV2A 5A28A 1Z9UA 1QSMA 5G22A 4B12A 1VKCA 2VZYA 4CAFA 2B5GB 2B58A 2GANA 4B10A 1L0CA 2PR1A 2WPWA 3W6SA 4E8OA 4QC6A 5IX3A 3S6HA 2REEA 2FE7A 3D2PA 4EVYA 2AE6A 3H5ZA 2FCKA 3VWDA 1M4DA 2P6FA 5H86A 3TOAA 4U9YA 2VI7A 4L8AA 2EUIA 3FIXA 4M3SA 4MFZA 2HUZA 1IIDA 4CAWA 2NMTA 4CGLA 5AG6A 4NF1A 3CXPA 4FD7A 1LRZA 3UY5A 1XF8A 2P0WA 3EXNA 2B4BA 2OH1A 4YFJA 4AVAA 4CGNA 4MFKA 3RYOA 4JLYA 3S6KA 1KUVA 2FIWA 4C7HA 4MJ8A 3TO6A 1MK4A 4UFWA 3DR6A 2OB0A 2VBQA 3DR8A 4CAVA 5F47A 3R1KA 1NSLA 2Q4VA 3F8KA 5HMNA 1M4GA 2FT0A 4UFVA 5KTCA 5FVJA 3T9YA 2VZZA 4UCMA 1KUXA 3LD2A 3QB8A 1GHEA 1WWZA 3BLNA 4II9A 3B8GA 1I1DA 2IL4A 4CS0B 4DNCA 2ZW6A 1R57A 2Z3MA 2REFA 3CXSA 2QMLA 3SHPA 3DDDA 3P2FA 4KUBA 1BOBA 4C7IA 4B5PB 2VQYA 4QB9A 5JQ4A 4KZTA 1QSOA 2WPXA 5BWAB 4MY0A 3N7ZA 4BBHA 1UFHA 2Z11A 4KOUA 1BO4A 4NCZA 3JVNA 2Z3OA 1B87A 3BJ8A 1YX0A 5AG4A 4KVOE 1ZO0A 4E2AA 4UWIA 3GKRA 4B5OA 2VXKA 5J8FA 2OZHA 4KLWA 4KUAA 3R9FA 3TT2A 2Z3LA 1XE4A 5E96A 5IV0A 2CY2A 1P0HA 4CYOA 4A33A 2BL1A 4GS4A 1QSTA 3S6FA 2CNTA 2JDCA 3JUWA 4H6ZA 2R98A 3DNSA 2C27A 1U6MA 1S7FA 4I49A 4UFXA 5F48A 3FYNA 1I12A 1Z4RA 4PK2A 4B5PA 3GY9A 2WUUA 5GCNA 2JLMA 4CGMA 4UBRA 2BSWA 3NE7A 1V0CA 4PK3A 3SXOA 4JXQA 2ZW4A 4JJXA 4RI1A 5EC4A 1J4JA 3MGDA 4CGOA 4KOXA 5F46A 4R87A 1QSNA 2DPSA 3T90A 3LODA 4KSFA 2B3UA 3SXNA 3JTKA 1MJ9A 3F5BA 5AG7A 4A30A 2Z3NA 2YNDA 5DWNA 4A95A 2ZXVA 4BMHA 4KOTA 5CNPA 2Z10A 4MFJA 3OWCA 3FNCA 3V8IA 1QSRA 2Q04A 4CRZB 4L89A 2OZGA 2P6GA 2R1IA 2X7BA 4ORFA 2FIAA 1YLEA 1Z4EA 1TIQA 3VWEA 4KS9A 3WR7A 4QBJA 4M85A 4Q38A 3TTHA 2J8RA 4Y49B 2PSWA 4UCPA 1S7NA 4Q36A 4F0XA 1XMTA 1S7LA 1MJAA 4F6AA 4HNYB 2I00A 4QVTA 3R95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4J A;  3DSB A;  4KOR A;  4XPK A;  4ZBG A;  2FS5 A;  4F0Y A;  4X5K A;  1Q2D A;  1M4I A;  2I79 A;  4CAX A;  1S7K A;  2H5M A;  4HNX B;  1P4N A;  3FB3 A;  2G3T A;  4YRH A;  4H6U A;  4KLV A;  1M44 A;  4UA3 A;  3PP9 A;  1Y9W A;  4OAE A;  2ZW7 A;  2PRB A;  3TOB A;  1MJB A;  4ONU A;  1PUA A;  4K30 A;  2PR8 A;  1Q2Y A;  2D4O A;  4IF5 A;  4U9Z A;  2PC1 A;  3EY5 A;  4HKF A;  4CRY B;  1IYK A;  4KVM E;  4U5Y A;  3EO4 A;  3H4Q A;  2I00 A;  4XPL A;  1B6B A;  4FD4 A;  4LX9 A;  2AJ6 A;  5KTA A;  2R8V A;  4KVX A;  1XEB A;  5ISV A;  2G0B A;  2PQ8 A;  3KKW A;  1CJW A;  2Q4Y A;  3W6X A;  1Y7R A;  2DXQ A;  1S3Z A;  2QIR A;  3CXQ A;  4NSQ A;  3TFY A;  3C26 A;  2J8M A;  3EC4 A;  3D2M A;  3PZJ A;  3G3S A;  1YVK A;  1VHS A;  3IGR A;  5H84 A;  1PU9 A;  2RC4 A;  3R9G A;  5IB0 A;  2J8N A;  1YK3 A;  3E0K A;  4R9M A;  3ZZI A;  4MY3 A;  2Z0Z A;  2GIV A;  1S60 A;  4YGO A;  1SQH A;  1IIC A;  4UWJ A;  4R3L A;  4H89 A;  2R7H A;  4FD6 A;  2GE3 A;  1YR0 A;  4Y49 C;  2D4P A;  1IB1 E;  4NXY A;  2ZPA A;  2FXF A;  4IUS A;  1NE9 A;  1RO5 A;  2OU2 A;  2K5T A;  2B4D A;  2JEV A;  2CNM A;  4J3G A;  1KUY A;  2P6E A;  2HQY A;  2VEZ A;  4AB7 A;  1NMT A;  1XIX A;  4MBU A;  1N71 A;  4KOY A;  4NEX A;  5EBV A;  3D3S A;  4OAD A;  3BJ7 A;  2Q7B A;  3R9E A;  2BEI A;  1I21 A;  4LUA A;  4XNH B;  3G8W A;  1YRE A;  5HH1 A;  1RXT A;  2OZU A;  4JWP A;  4R57 A;  3ZJ0 A;  2B3V A;  1S5K A;  4JXR A;  3F0A A;  4RS2 A;  1YGH A;  2EVN A;  2BUE A;  3D8P A;  1Q2C A;  5J8C A;  2G3A A;  4PV6 A;  4KOV A;  1WK4 A;  2CNS A;  4OLL A;  2KCW A;  3TO9 A;  2ARH A;  3W91 A;  5KTD A;  5I0C A;  1CM0 A;  2FL4 A;  3GYA A;  4JD6 A;  2B4D B;  3S6G A;  3TCV A;  5C82 A;  1M1D A;  3I9S A;  4XNH C;  4E0A A;  4AG9 A;  1Y9K A;  4KOW A;  3EFA A;  1FY7 A;  1KZF A;  2B5G A;  5F49 A;  4AVC A;  2FSR A;  2ZW5 A;  2F5I A;  4MI4 A;  3TE4 A;  4PSX A;  1OZP A;  3QAH A;  3FRM A;  4XPD C;  4AG7 A;  2A4N A;  2QEC A;  3FXT A;  4AVB A;  3K9U A;  3TO7 A;  3R96 A;  3P2H A;  4PSW A;  4R3K A;  3FBU A;  3PGP A;  4MHD A;  2O28 A;  4KOS A;  4QUS A;  1IYL A;  3I3G A;  2PDO A;  2Q0Y A;  5DWM A;  2JDD A;  1YVO A;  4HNW B;  2ATR A;  2Q44 A;  5JPH A;  2Y0M A;  4XPD B;  5C88 A;  4FD5 A;  1ON0 A;  2HV2 A;  1Z9U A;  1QSM A;  1VKC A;  2VZY A;  2B5G B;  2B58 A;  2GAN A;  1L0C A;  2PR1 A;  2WPW A;  3W6S A;  4E8O A;  4QC6 A;  5IX3 A;  3S6H A;  2REE A;  2FE7 A;  3D2P A;  4EVY A;  2AE6 A;  2FCK A;  3VWD A;  1M4D A;  2P6F A;  5H86 A;  3TOA A;  4U9Y A;  2VI7 A;  4L8A A;  2EUI A;  3FIX A;  4M3S A;  2HUZ A;  1IID A;  4CAW A;  2NMT A;  4NF1 A;  3CXP A;  4FD7 A;  1LRZ A;  3UY5 A;  1XF8 A;  2P0W A;  3EXN A;  2B4B A;  2OH1 A;  4YFJ A;  4AVA A;  3RYO A;  4JLY A;  3S6K A;  1KUV A;  2FIW A;  4MJ8 A;  3TO6 A;  1MK4 A;  3DR6 A;  2OB0 A;  2VBQ A;  3DR8 A;  4CAV A;  5F47 A;  3R1K A;  1NSL A;  2Q4V A;  3F8K A;  5HMN A;  1M4G A;  2FT0 A;  5KTC A;  5FVJ A;  3T9Y A;  2VZZ A;  1KUX A;  3LD2 A;  3QB8 A;  1GHE A;  1WWZ A;  3BLN A;  4II9 A;  3B8G A;  1I1D A;  2IL4 A;  4CS0 B;  4DNC A;  2ZW6 A;  1R57 A;  2REF A;  3CXS A;  2QML A;  3SHP A;  3DDD A;  3P2F A;  4KUB A;  1BOB A;  4B5P B;  2VQY A;  4QB9 A;  5JQ4 A;  4KZT A;  1QSO A;  2WPX A;  4MY0 A;  3N7Z A;  1UFH A;  2Z11 A;  4KOU A;  4NCZ A;  1BO4 A;  3JVN A;  1B87 A;  3BJ8 A;  1YX0 A;  4KVO E;  4E2A A;  4UWI A;  3GKR A;  4B5O A;  2VXK A;  5J8F A;  2OZH A;  4KLW A;  4KUA A;  3R9F A;  3TT2 A;  1XE4 A;  5E96 A;  5IV0 A;  2CY2 A;  1P0H A;  2BL1 A;  4GS4 A;  1QST A;  3S6F A;  2CNT A;  2JDC A;  3JUW A;  4H6Z A;  2R98 A;  3DNS A;  2C27 A;  1U6M A;  1S7F A;  4I49 A;  5F48 A;  3FYN A;  1I12 A;  1Z4R A;  4PK2 A;  4B5P A;  3GY9 A;  5GCN A;  2JLM A;  4UBR A;  2BSW A;  3NE7 A;  1V0C A;  4PK3 A;  3SXO A;  4JXQ A;  2ZW4 A;  4JJX A;  4RI1 A;  5EC4 A;  1J4J A;  3MGD A;  4KOX A;  5F46 A;  4R87 A;  1QSN A;  3T90 A;  3LOD A;  2B3U A;  3SXN A;  1MJ9 A;  3F5B A;  5DWN A;  2ZXV A;  4BMH A;  4KOT A;  5CNP A;  2Z10 A;  3V8I A;  3OWC A;  3FNC A;  1QSR A;  2Q04 A;  4CRZ B;  4L89 A;  2OZG A;  2P6G A;  2R1I A;  2X7B A;  4ORF A;  2FIA A;  1YLE A;  1Z4E A;  1TIQ A;  3VWE A;  3WR7 A;  4QBJ A;  4M85 A;  3TTH A;  2J8R A;  4Y49 B;  2PSW A;  1S7N A;  1XMT A;  1S7L A;  1MJA A;  4F6A A;  4HNY B;  3IWG A;  4QVT A;  3R95 A; 
#chains in the Genus database with same CATH topology
 1K4J A;  3DSB A;  4MFP A;  5LRJ A;  2QVP A;  4KOR A;  4XPK A;  4ZBG A;  4CYQ A;  3GIU A;  2FS5 A;  4F0Y A;  4X5K A;  4ZGY B;  1Q2D A;  1CPX A;  1M4I A;  2I79 A;  3B3C A;  4M6I A;  1S7K A;  4CAX A;  2H5M A;  2XEI A;  4HNX B;  3CPA A;  3B3W A;  2ZEG A;  2FVG A;  1P4N A;  3FB3 A;  2G3T A;  4YRH A;  2Z3P A;  4H6U A;  4KLV A;  1M44 A;  3V7Z A;  1QMU A;  4UA3 A;  4ZY1 A;  3PP9 A;  1Y9W A;  4OAE A;  2ODF A;  4IHM A;  4UEF A;  2ZW7 A;  4X2T A;  2PRB A;  3A9L A;  3TOB A;  1QQ9 A;  5JH9 A;  1MJB A;  4ONU A;  1PUA A;  4K30 A;  2PR8 A;  2PJ7 A;  1Q2Y A;  3IWW A;  3WC6 A;  4G1P A;  4C68 A;  2G9D A;  2D4O A;  3KI9 A;  4IF5 A;  4CYP A;  4U9Z A;  2ZED A;  4CPA A;  2PC1 A;  5AG5 A;  3EY5 A;  4HKF A;  4CRY B;  1IYK A;  6CPA A;  2AFM A;  1ELM P;  4KVM E;  1BPN A;  2JBJ A;  3EO4 A;  2ZEH A;  3H4Q A;  4U5Y A;  5D8N A;  2QJ8 A;  4XPL A;  4MCS A;  3V38 A;  1B6B A;  3B3T A;  4FD4 A;  4LX9 A;  2AJ6 A;  4NJQ A;  5KTA A;  3VH9 A;  1IGB A;  3DLJ A;  3IEH A;  2R8V A;  3FH4 A;  4KVX A;  5LYI A;  1XEB A;  5ISV A;  2G0B A;  2PQ8 A;  3KKW A;  3NH8 A;  3TC8 A;  1YQE A;  1CJW A;  2Q4Y A;  4LQ6 A;  3W6X A;  1Y7R A;  2O4H A;  2DXQ A;  4A32 A;  1S3Z A;  2ZEP A;  1VHE A;  2QIR A;  1BPM A;  1Z2L A;  5K8M A;  4M6H A;  3CXQ A;  5HVG A;  2BOA A;  4NSQ A;  3TFY A;  1Z8W A;  3C26 A;  5K8O A;  1FNO A;  2YGW A;  4PXB A;  5G20 A;  4UF4 A;  2J8M A;  2V8H A;  4OC0 A;  5LYD A;  1TF9 A;  2AFZ A;  2DF5 A;  2IQ6 A;  2YNC C;  2PVW A;  3EC4 A;  3D2M A;  3PZJ A;  3G3S A;  4MHN A;  1YVK A;  4NGS A;  3TX8 A;  1BLL E;  1VHS A;  3IGR A;  4WJB A;  5H84 A;  1PU9 A;  5LRG A;  4A39 A;  1ZLH A;  2RC4 A;  3QNV A;  2YNC A;  5AGE A;  3RBU A;  4YU9 A;  3R9G A;  2ZEM A;  5IB0 A;  2J8N A;  1A2Z A;  1Y0Y A;  1YK3 A;  3E0K A;  3PBB A;  2F7V A;  4R9M A;  3ZZI A;  4MY3 A;  2Z0Z A;  1R43 A;  1Y0R A;  2GIV A;  1S60 A;  4YGO A;  1SQH A;  1IIC A;  1Z8X A;  4UWJ A;  4R3L A;  5G1Z A;  3H8F A;  3RAM A;  3D66 A;  1TKH A;  4H89 A;  4UEE A;  2R7H A;  4FD6 A;  5HVH A;  2GE3 A;  1NSA A;  1YR0 A;  2ZOG A;  4Y49 C;  4KSA A;  2D4P A;  2EK9 A;  2PJC A;  2WYR A;  1IB1 E;  4B13 A;  3KQX A;  2PCU A;  4NXY A;  5I4M A;  1F2O A;  1VIX A;  2ZPA A;  3RNZ A;  2FXF A;  4IK2 A;  1YLO A;  2GLF A;  3FED A;  4IUS A;  1NE9 A;  1RO5 A;  4NGN A;  4PXD A;  2OU2 A;  2K5T A;  5ELY A;  2B4D A;  2JEV A;  5LYL A;  4P4I A;  3FVL A;  2AFO A;  2CNM A;  4J3G A;  1KUY A;  2P6E A;  2HQY A;  5DS0 A;  3IU1 A;  2DPT A;  2VEZ A;  3R95 A;  4BIN A;  2GFQ A;  4AB7 A;  4F9V A;  1NMT A;  1PCA A;  2PJ8 A;  1XIX A;  2PJB A;  4RN7 A;  3GUX A;  4MBU A;  1N71 A;  4KOY A;  2RB7 A;  3PB6 X;  4NEX A;  1YSJ A;  3BI1 A;  4ONW A;  5D29 A;  4ZX8 A;  5EBV A;  3D3S A;  3FJU A;  4GM5 A;  4A2Z A;  4B11 A;  4OP4 A;  1IOF A;  3ISZ A;  4OAD A;  3BJ7 A;  2Q7B A;  3R9E A;  4CGP A;  2BEI A;  1I21 A;  4LUA A;  4XNH B;  3G8W A;  7CPA A;  1YRE A;  2C1C A;  4NGQ A;  1RXT A;  1M4L A;  5HH1 A;  2CTC A;  2VL1 A;  2OZU A;  2ABZ A;  3D7D A;  3FEE A;  3L2N A;  4JWP A;  2B3V A;  1S5K A;  4JXR A;  4R57 A;  3ZJ0 A;  3F0A A;  3D7G A;  4RS2 A;  4ZI6 A;  3D67 A;  1YGH A;  4WWV A;  2EVN A;  3LMS A;  2BUE A;  3D8P A;  1Q2C A;  3FMC A;  4MHZ A;  4RUH A;  5J8C A;  2G3A A;  4P4E A;  4PV6 A;  3D4U A;  4KOV A;  3KZW A;  2Z3K A;  3VAT A;  2GLJ A;  2PRQ A;  1WK4 A;  2CNS A;  3GB0 A;  4UCN A;  2PJA A;  4OLL A;  4LQG A;  5IB9 A;  2IJZ A;  2KCW A;  2HC9 A;  2WSA A;  3TO9 A;  3NFZ A;  2YNE A;  2ARH A;  4CAE A;  3W91 A;  2PJ1 A;  1AYE A;  4M6G A;  2ZEE A;  5KTD A;  5I0C A;  1CM0 A;  3BHX A;  3D7F A;  3PFE A;  3SI0 A;  2FL4 A;  3GYA A;  4JD6 A;  1ELL P;  2B4D B;  4X3R A;  1TF8 A;  3S6G A;  2CXA A;  3TCV A;  5C82 A;  1DE4 C;  1LAM A;  1M1D A;  2AFU A;  3SI2 A;  3PEI A;  3H8E A;  2PJ2 A;  2ZEF A;  3I9S A;  3VAR A;  4XNH C;  3IFE A;  3IWE A;  4E0A A;  1CG2 A;  2ZEN A;  4MFL A;  4YWY A;  4AG9 A;  1Y9K A;  2Q43 A;  4KOW A;  3NH4 A;  3EFA A;  3IU2 A;  4A31 A;  5G21 A;  3B3S A;  1FY7 A;  3WT4 A;  1EE3 P;  2NSM A;  1KZF A;  2B5G A;  5F49 A;  4AVC A;  2FSR A;  3BXM A;  4C2X A;  4EWT A;  4P4D A;  2ZW5 A;  2F5I A;  4MI4 A;  2RFH A;  3B7I A;  3TE4 A;  4B6Z A;  4PSX A;  5LYF A;  2CIJ A;  2BCO A;  1OZP A;  2XEG A;  3CZX A;  3KQZ A;  3FRM A;  3QAH A;  1HEE A;  4XPD C;  4AG7 A;  2A4N A;  4PPZ A;  2JBK A;  2QEC A;  3FXT A;  4AVB A;  3K9U A;  3TO7 A;  4K3N A;  1FT7 A;  2AFX A;  3R96 A;  3P2H A;  3RO0 A;  4PSW A;  4R8F A;  4R3K A;  1ZLI A;  3FBU A;  4C2Y A;  3PGP A;  4CYN A;  1CP6 A;  4MHD A;  2O28 A;  2ANP A;  1RTQ A;  4C2Z A;  4MFQ A;  4MXU A;  4A94 A;  4AXV A;  4KOS A;  2PE3 A;  4QUS A;  4W9Y A;  1IYL A;  1Y7E A;  4H2K A;  1KWM A;  3I3G A;  2ZEO A;  2PDO A;  4NGP A;  2Q0Y A;  5DWM A;  4B14 A;  4OC5 A;  2CF4 A;  3MRU A;  2JDD A;  1YVO A;  4HNW B;  4P4J A;  4ZX9 A;  5JGF A;  3IWG A;  2ATR A;  2Q44 A;  5JPH A;  2Y0M A;  3H8G A;  4XPD B;  1JWQ A;  5C88 A;  4FD5 A;  1ON0 A;  2HV2 A;  3WC5 A;  5A28 A;  3IJ3 A;  3KR5 A;  4A37 A;  1Z9U A;  1F2P A;  1QSM A;  5G22 A;  4B12 A;  1VKC A;  2VZY A;  3S9N A;  4CAF A;  5A27 A;  3D7H A;  2B5G B;  2B58 A;  2GAN A;  2OR4 A;  4R76 A;  1HDU A;  2EO8 A;  4B10 A;  1L0C A;  2PR1 A;  2WPW A;  3KHX A;  3W6S A;  2C6P A;  4E8O A;  4ZY0 A;  4QC6 A;  5IX3 A;  1CP7 A;  3S6H A;  3B35 A;  2REE A;  2FE7 A;  5JM6 A;  3D2P A;  4EVY A;  3PRT A;  2AE6 A;  3H5Z A;  1R3N A;  2FCK A;  1M4D A;  2P6F A;  5H86 A;  3VWD A;  2AFS A;  5HXD A;  2Q51 A;  3TOA A;  2JEW A;  4BD9 A;  3KAS A;  4U9Y A;  3BI0 A;  4PQA A;  2VI7 A;  4F9U A;  4L8A A;  4TWE A;  2GRE A;  1VGY A;  2EUI A;  4DUK A;  3FIX A;  4M3S A;  4MFZ A;  4MCP A;  4F6A A;  2PIY A;  3FX6 A;  3N5F A;  1ZG8 A;  2HUZ A;  2PVV A;  3CT9 A;  1IID A;  4EFD A;  4OME A;  4IAV A;  2EK8 A;  1Z5R A;  2NMT A;  2PJ6 A;  4CAW A;  4CGL A;  5AG6 A;  2QYV A;  4P4B A;  4NF1 A;  3CXP A;  3ISX A;  4FD7 A;  1LRZ A;  3UY5 A;  1XF8 A;  2P0W A;  3EXN A;  3IC1 A;  5CBM A;  4P44 A;  1JQG A;  2B4B A;  2OH1 A;  4P4F A;  4YFJ A;  4AVA A;  4OC1 A;  4CGN A;  4MFK A;  3RYO A;  8CPA A;  1DTD A;  1F57 A;  3KR4 A;  4OC4 A;  4R7M A;  1Z8L A;  4JLY A;  3IIB A;  3PB9 X;  3S6K A;  1KUV A;  1GYT A;  2FIW A;  4C7H A;  4MJ8 A;  3TO6 A;  1MK4 A;  4P45 A;  4A38 A;  4UFW A;  3NE8 A;  3DR6 A;  2OB0 A;  2VBQ A;  3DR8 A;  4CAV A;  4FAI A;  5F47 A;  3KHZ A;  3R1K A;  4NGM A;  1NSL A;  2Q4V A;  5F09 A;  3F8K A;  3SI1 A;  1M4G A;  5HMN A;  2FT0 A;  3PB7 X;  4UFV A;  1TKJ A;  5KTC A;  1BAV A;  5FVJ A;  4MCQ A;  2VZZ A;  4MCR A;  3T9Y A;  2I3C A;  4DJL A;  4UCM A;  1KUX A;  1ZG7 A;  3LD2 A;  3QB8 A;  1GHE A;  1WWZ A;  3BLN A;  4OID A;  4II9 A;  3B8G A;  1CX8 A;  1I1D A;  1IU8 A;  2IL4 A;  4CS0 B;  2ZW6 A;  1Z8T A;  4JYW A;  1R57 A;  4DNC A;  2Z3M A;  4GXH A;  1X10 A;  1H8L A;  2REF A;  3CXS A;  1XJO A;  2QML A;  2V77 A;  3SHP A;  2OOT A;  1X12 A;  5CPA A;  4FBE A;  3DDD A;  4UIA A;  4ZYQ A;  3P2F A;  3HUV A;  4KUB A;  1BOB A;  1LOK A;  4C7I A;  4B5P B;  2Q7S A;  4UEZ A;  1LAN A;  2VQY A;  4QB9 A;  5EMI A;  5JQ4 A;  1XFO A;  1XBU A;  4KZT A;  1QSO A;  4FWU A;  2WPX A;  3QAY A;  5BWA B;  4MY0 A;  3N7Z A;  4OC2 A;  3WAB A;  4BBH A;  4KSI A;  3PFO A;  1HDQ A;  1UFH A;  2Z11 A;  1TKF A;  1AMP A;  3CPX A;  4TNU A;  1XRY A;  3FF3 A;  4KOU A;  1BO4 A;  4NCZ A;  3JVN A;  4R6T A;  5J1Q A;  2Z3O A;  3PBE A;  1B87 A;  3BJ8 A;  1YX0 A;  5AG4 A;  4KVO E;  1ZO0 A;  4E2A A;  4UWI A;  3RZA A;  3GKR A;  1ARM A;  2EBJ A;  2PJ3 A;  2CTB A;  2VXK A;  4NJR A;  2DEA A;  4B5O A;  5J8F A;  3IO1 A;  2OZH A;  4KLW A;  4KUA A;  3B2Y A;  2WZN A;  3R9F A;  3TT2 A;  3PB4 X;  3SJF A;  3K9T A;  2Z3L A;  1XE4 A;  5E96 A;  4MMO A;  5IV0 A;  5K8P A;  2J9A A;  2CY2 A;  1IOI A;  1P0H A;  4CYO A;  2PJ5 A;  4A33 A;  3D68 A;  2BL1 A;  4GS4 A;  1QST A;  1TXR A;  3DGV A;  3LWU A;  2CNT A;  3S6F A;  1YW6 A;  4UIB A;  1CPS A;  4DYO A;  2GU2 A;  3T8W A;  3FEC A;  2JDC A;  2AFW A;  4Q7A A;  3JUW A;  4H6Z A;  2R98 A;  4P6Y A;  3SJX A;  1IY7 A;  3DNS A;  2C27 A;  1U6M A;  4OKO A;  1S7F A;  4NGT A;  4I49 A;  4UFX A;  5F48 A;  4ZY2 A;  3FYN A;  1I12 A;  1Z4R A;  4PK2 A;  4F8Z A;  1ARL A;  2NYQ A;  4B5P A;  3GY9 A;  2WUU A;  3MN8 A;  1AUG A;  3NH5 A;  5GCN A;  2JLM A;  3CDX A;  3KGQ A;  4Z65 A;  4CGM A;  4UBR A;  4NGR A;  3I1U A;  4MRI A;  2BSW A;  5THW A;  4HPS A;  3NE7 A;  1V0C A;  3JRU A;  4PK3 A;  4JXQ A;  3SXO A;  2ZW4 A;  4JJX A;  2C6G A;  1CBX A;  1OBR A;  4RI1 A;  5EC4 A;  1J4J A;  4OIW A;  1XMB A;  4MHY A;  3MGD A;  2V8V A;  5HVF A;  2V8D A;  2PJ9 A;  3PB8 X;  4CGO A;  4MHP A;  3LAC A;  1YW4 A;  3NA6 A;  4KOX A;  4PXE A;  3WC7 A;  5F46 A;  2Q4Z A;  4FUU A;  4R87 A;  1QSN A;  2DPS A;  3GLJ A;  3T90 A;  2PJ0 A;  3B3V A;  3K2K A;  3LOD A;  4KSF A;  4PXC A;  2IMO A;  2ZEL A;  2POK A;  2PIZ A;  1ZG9 A;  2B3U A;  4NFR A;  5K8N A;  2F8H A;  2C6C A;  3JTK A;  1Q7L A;  2HB6 A;  3SXN A;  1MJ9 A;  1UWY A;  2PJ4 A;  3F5B A;  1LAP A;  5AG7 A;  4OC3 A;  4A30 A;  2Z3N A;  2YND A;  2XEF A;  5LRK A;  4JZ0 A;  5DWN A;  4A95 A;  2ZXV A;  4BMH A;  4KOT A;  4P10 A;  5CNP A;  2Z10 A;  4MFJ A;  3OWC A;  2BO9 A;  3FNC A;  3V8I A;  1QSR A;  2Q04 A;  2V8G A;  4CRZ B;  4L89 A;  2OZG A;  2P6G A;  2R1I A;  4X8I A;  3SJG A;  2X7B A;  4EME A;  4ORF A;  3SJE A;  3S9L A;  2FIA A;  1YLE A;  1Z4E A;  1TIQ A;  2XEJ A;  3VWE A;  4KS9 A;  2O53 A;  3WR7 A;  4QBJ A;  4M85 A;  4Q38 A;  3TTH A;  1LCP A;  3KL9 A;  4O23 A;  1VHO A;  2EWB A;  3S9M A;  2J8R A;  4Y49 B;  2PSW A;  2ZOF A;  1S7N A;  4UCP A;  1XOV A;  1YME A;  4Q36 A;  4F0X A;  1XMT A;  3HLP A;  1S7L A;  1MJA A;  1PYT B;  4HNY B;  2I00 A;  4QVT A;  1LFW A; 
#chains in the Genus database with same CATH homology
 1K4J A;  3DSB A;  4MFP A;  4KOR A;  4XPK A;  4ZBG A;  4CYQ A;  4ZGY B;  2FS5 A;  4F0Y A;  4X5K A;  1Q2D A;  1M4I A;  2I79 A;  4CAX A;  1S7K A;  2H5M A;  4HNX B;  1P4N A;  3FB3 A;  2G3T A;  4YRH A;  2Z3P A;  4H6U A;  4KLV A;  1M44 A;  4UA3 A;  3PP9 A;  1Y9W A;  4OAE A;  2ZW7 A;  2PRB A;  3A9L A;  3TOB A;  1MJB A;  4ONU A;  1PUA A;  4K30 A;  2PR8 A;  1Q2Y A;  4C68 A;  2D4O A;  4IF5 A;  4CYP A;  4U9Z A;  2PC1 A;  5AG5 A;  3EY5 A;  4HKF A;  4CRY B;  1IYK A;  4KVM E;  4U5Y A;  3EO4 A;  3H4Q A;  4XPL A;  1B6B A;  4FD4 A;  4LX9 A;  2AJ6 A;  5KTA A;  2R8V A;  4KVX A;  1XEB A;  5ISV A;  2G0B A;  2PQ8 A;  3KKW A;  1CJW A;  2Q4Y A;  3W6X A;  1Y7R A;  2DXQ A;  4A32 A;  1S3Z A;  2QIR A;  3CXQ A;  4NSQ A;  3TFY A;  3C26 A;  2YGW A;  5G20 A;  2J8M A;  3EC4 A;  2YNC C;  3D2M A;  3PZJ A;  3G3S A;  1YVK A;  1VHS A;  3IGR A;  5H84 A;  1PU9 A;  2RC4 A;  5AGE A;  2YNC A;  3R9G A;  5IB0 A;  2J8N A;  1YK3 A;  3E0K A;  4R9M A;  3ZZI A;  4MY3 A;  2Z0Z A;  2GIV A;  1S60 A;  4YGO A;  1SQH A;  1IIC A;  4UWJ A;  4R3L A;  5G1Z A;  4H89 A;  2R7H A;  4FD6 A;  2GE3 A;  1YR0 A;  4Y49 C;  4KSA A;  2D4P A;  1IB1 E;  4B13 A;  4NXY A;  2ZPA A;  2FXF A;  4IUS A;  1NE9 A;  1RO5 A;  2OU2 A;  2K5T A;  2B4D A;  2JEV A;  2CNM A;  4J3G A;  1KUY A;  2P6E A;  2HQY A;  3IU1 A;  2VEZ A;  2DPT A;  4AB7 A;  1NMT A;  1XIX A;  4MBU A;  1N71 A;  4KOY A;  4NEX A;  5EBV A;  3D3S A;  4A2Z A;  4B11 A;  4OAD A;  3BJ7 A;  2Q7B A;  3R9E A;  4CGP A;  2BEI A;  1I21 A;  4LUA A;  4XNH B;  3G8W A;  1YRE A;  5HH1 A;  1RXT A;  5A27 A;  2OZU A;  4JWP A;  4R57 A;  3ZJ0 A;  2B3V A;  1S5K A;  4JXR A;  3F0A A;  4RS2 A;  1YGH A;  2EVN A;  2BUE A;  3D8P A;  1Q2C A;  5J8C A;  2G3A A;  4PV6 A;  4KOV A;  2Z3K A;  1WK4 A;  2CNS A;  4UCN A;  4OLL A;  2KCW A;  2WSA A;  3TO9 A;  2YNE A;  2ARH A;  4CAE A;  3W91 A;  5KTD A;  5I0C A;  1CM0 A;  2FL4 A;  3GYA A;  4JD6 A;  2B4D B;  3S6G A;  3TCV A;  2CXA A;  5C82 A;  1M1D A;  3I9S A;  4XNH C;  3IWE A;  4E0A A;  4AG9 A;  4MFL A;  1Y9K A;  4KOW A;  3EFA A;  3IU2 A;  4A31 A;  5G21 A;  1FY7 A;  1KZF A;  2B5G A;  5F49 A;  4AVC A;  2FSR A;  4C2X A;  2ZW5 A;  2F5I A;  4MI4 A;  3TE4 A;  4PSX A;  1OZP A;  3QAH A;  3FRM A;  4XPD C;  4AG7 A;  2A4N A;  2QEC A;  3FXT A;  4AVB A;  3K9U A;  3TO7 A;  3R96 A;  3P2H A;  4PSW A;  4R3K A;  3FBU A;  4C2Y A;  3PGP A;  4CYN A;  4MHD A;  2O28 A;  4C2Z A;  4MFQ A;  4KOS A;  4QUS A;  1IYL A;  3I3G A;  2PDO A;  2Q0Y A;  5DWM A;  4B14 A;  2JDD A;  1YVO A;  4HNW B;  3IWG A;  2ATR A;  2Q44 A;  5JPH A;  2Y0M A;  4XPD B;  5C88 A;  4FD5 A;  1ON0 A;  2HV2 A;  5A28 A;  1Z9U A;  1QSM A;  5G22 A;  4B12 A;  1VKC A;  2VZY A;  4CAF A;  2B5G B;  2B58 A;  2GAN A;  4B10 A;  1L0C A;  2PR1 A;  2WPW A;  3W6S A;  4E8O A;  4QC6 A;  5IX3 A;  3S6H A;  2REE A;  2FE7 A;  3D2P A;  4EVY A;  2AE6 A;  3H5Z A;  2FCK A;  3VWD A;  1M4D A;  2P6F A;  5H86 A;  3TOA A;  4U9Y A;  2VI7 A;  4L8A A;  2EUI A;  3FIX A;  4M3S A;  4MFZ A;  2HUZ A;  1IID A;  4CAW A;  2NMT A;  4CGL A;  5AG6 A;  4NF1 A;  3CXP A;  4FD7 A;  1LRZ A;  3UY5 A;  1XF8 A;  2P0W A;  3EXN A;  2B4B A;  2OH1 A;  4YFJ A;  4AVA A;  4CGN A;  4MFK A;  3RYO A;  4JLY A;  3S6K A;  1KUV A;  2FIW A;  4C7H A;  4MJ8 A;  3TO6 A;  1MK4 A;  4UFW A;  3DR6 A;  2OB0 A;  2VBQ A;  3DR8 A;  4CAV A;  5F47 A;  3R1K A;  1NSL A;  2Q4V A;  3F8K A;  5HMN A;  1M4G A;  2FT0 A;  4UFV A;  5KTC A;  5FVJ A;  3T9Y A;  2VZZ A;  4UCM A;  1KUX A;  3LD2 A;  3QB8 A;  1GHE A;  1WWZ A;  3BLN A;  4II9 A;  3B8G A;  1I1D A;  2IL4 A;  4CS0 B;  4DNC A;  2ZW6 A;  1R57 A;  2Z3M A;  2REF A;  3CXS A;  2QML A;  3SHP A;  3DDD A;  3P2F A;  4KUB A;  1BOB A;  4C7I A;  4B5P B;  2VQY A;  4QB9 A;  5JQ4 A;  4KZT A;  1QSO A;  2WPX A;  5BWA B;  4MY0 A;  3N7Z A;  4BBH A;  1UFH A;  2Z11 A;  4KOU A;  1BO4 A;  4NCZ A;  3JVN A;  2Z3O A;  1B87 A;  3BJ8 A;  1YX0 A;  5AG4 A;  4KVO E;  1ZO0 A;  4E2A A;  4UWI A;  3GKR A;  4B5O A;  2VXK A;  5J8F A;  2OZH A;  4KLW A;  4KUA A;  3R9F A;  3TT2 A;  2Z3L A;  1XE4 A;  5E96 A;  5IV0 A;  2CY2 A;  1P0H A;  4CYO A;  4A33 A;  2BL1 A;  4GS4 A;  1QST A;  3S6F A;  2CNT A;  2JDC A;  3JUW A;  4H6Z A;  2R98 A;  3DNS A;  2C27 A;  1U6M A;  1S7F A;  4I49 A;  4UFX A;  5F48 A;  3FYN A;  1I12 A;  1Z4R A;  4PK2 A;  4B5P A;  3GY9 A;  2WUU A;  5GCN A;  2JLM A;  4CGM A;  4UBR A;  2BSW A;  3NE7 A;  1V0C A;  4PK3 A;  3SXO A;  4JXQ A;  2ZW4 A;  4JJX A;  4RI1 A;  5EC4 A;  1J4J A;  3MGD A;  4CGO A;  4KOX A;  5F46 A;  4R87 A;  1QSN A;  2DPS A;  3T90 A;  3LOD A;  4KSF A;  2B3U A;  3SXN A;  3JTK A;  1MJ9 A;  3F5B A;  5AG7 A;  4A30 A;  2Z3N A;  2YND A;  5DWN A;  4A95 A;  2ZXV A;  4BMH A;  4KOT A;  5CNP A;  2Z10 A;  4MFJ A;  3OWC A;  3FNC A;  3V8I A;  1QSR A;  2Q04 A;  4CRZ B;  4L89 A;  2OZG A;  2P6G A;  2R1I A;  2X7B A;  4ORF A;  2FIA A;  1YLE A;  1Z4E A;  1TIQ A;  3VWE A;  4KS9 A;  3WR7 A;  4QBJ A;  4M85 A;  4Q38 A;  3TTH A;  2J8R A;  4Y49 B;  2PSW A;  4UCP A;  1S7N A;  4Q36 A;  4F0X A;  1XMT A;  1S7L A;  1MJA A;  4F6A A;  4HNY B;  2I00 A;  4QVT A;  3R95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...