2VI7A

Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
164
structure length
163
Chain Sequence
TIRLERYSERHVEGLTALYNDPAVARQVLQMPYQSVEQRRKRLHDSDDDRLLILVALHQGDVIGSASLEQHPRIRRSHSGSIGMGVAVAWQGKGVGSRLLGELLDIADNWMNLRRVELTVYTDNAPALALYRKFGFETEGEMRDYAVRDGRFVDVYSMARLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Putative Acetyltransferase (Pa1377) from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords ACETYLTRANSFERASE PA1377
total genus 45
structure length 163
sequence length 164
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vi7A00
2BSWA 3LODA 1BO4A 1GHEA 2REEA 2I79A 4KOYA 4KLVA 1M1DA 2BUEA 1OZPA 3D2MA 4JWPA 5FVJA 4JLYA 4U9ZA 1XEBA 3W6XA 2PRBA 1R57A 1M4IA 4QBJA 4KOUA 4CRYB 4PV6A 3DR6A 1U6MA 3CXQA 4U5YA 5JPHA 1K4JA 1P0HA 3F8KA 3S6FA 2BL1A 4F6AA 5EBVA 4B5OA 2G3TA 1S7FA 5KTAA 1V0CA 4Y49B 4JXRA 2REFA 1IYLA 3EFAA 4II9A 2OZGA 3FIXA 2B58A 2J8MA 1LRZA 2P6EA 4XPDC 2HUZA 4R57A 2AJ6A 2Y0MA 1XF8A 4FD6A 5GCNA 2PQ8A 3FNCA 2OZUA 4FD4A 1RXTA 1B6BA 3VWDA 4NCZA 2G3AA 1J4JA 4MY0A 3TT2A 2VXKA 2ZPAA 5J8FA 3PZJA 3H4QA 3FRMA 2ZW6A 4CAWA 2JEVA 3KKWA 5F46A 5F47A 2FE7A 3UY5A 4J3GA 2J8RA 4YRHA 1S60A 1NE9A 2B3UA 4FD7A 4HKFA 5JQ4A 4OADA 2A4NA 3D8PA 3TFYA 2EVNA 2I00A 1IICA 1PU9A 4XNHB 4QC6A 3R9EA 3R9FA 3CXPA 3PP9A 4L89A 2B4BA 3W91A 2OU2A 3V8IA 4NEXA 1XMTA 2Z0ZA 2QIRA 3PGPA 1S3ZA 2IL4A 2GE3A 2FIAA 2ZW7A 2PR8A 4KLWA 2WPXA 2JDDA 1YK3A 1UFHA 4KOSA 2R7HA 2VQYA 3SHPA 2ZXVA 1I21A 4XNHC 3BLNA 2Q04A 2R1IA 2VZZA 3FXTA 4OAEA 4QUSA 4ZBGA 4EVYA 4LX9A 1BOBA 3RYOA 2ZW4A 2FS5A 2VEZA 5IB0A 1XE4A 2GIVA 3TTHA 4OLLA 1WK4A 1KZFA 3R95A 1P4NA 4KVME 4HNYB 4CAXA 4H89A 4UA3A 4KORA 5J8CA 4KVOE 2FIWA 3MGDA 2ARHA 3TO6A 4HNXB 2CNTA 3ZJ0A 2Q4YA 1L0CA 4JJXA 3DR8A 2J8NA 3G8WA 5H84A 1YLEA 1TIQA 3R96A 1PUAA 4NSQA 4JD6A 4KUBA 3T90A 3K9UA 1ON0A 3DDDA 4K30A 2Q0YA 2QECA 4KZTA 2P6FA 1VHSA 4LUAA 2G0BA 4KOXA 3LD2A 2CNMA 4UWJA 1Y9WA 2ZW5A 4E8OA 1YVKA 5DWNA 4ONUA 1XIXA 1I1DA 4CAVA 2PSWA 3S6KA 2D4OA 1CJWA 2CNSA 2Q44A 3EXNA 4F0YA 5F48A 2B4DA 5KTDA 4YGOA 1QSOA 2EUIA 2NMTA 4RI1A 3SXOA 5DWMA 1IB1E 4NXYA 1CM0A 1Z4RA 4MJ8A 3BJ7A 1B87A 4KOWA 5IV0A 5EC4A 1QSNA 3R1KA 4JXQA 5F49A 4R3KA 2AE6A 3TE4A 4L8AA 1QSRA 3WR7A 5I0CA 4X5KA 4KOVA 1YR0A 2CY2A 2RC4A 4KOTA 1YX0A 3FB3A 5KTCA 4Y49C 3TOAA 3I3GA 3EY5A 1MJBA 3TOBA 4AVCA 1Q2YA 4I49A 2B4DB 4AB7A 4XPDB 2OH1A 2Z11A 4R3LA 3W6SA 1IYKA 2O28A 3BJ8A 4KUAA 4HNWB 1M44A 3D3SA 4PK2A 5HMNA 3P2HA 3TCVA 5CNPA 2VI7A 4XPKA 5IX3A 1Q2DA 1IIDA 2B5GA 4KVXA 2JDCA 4M3SA 3DNSA 1KUXA 3C26A 3T9YA 3TO7A 4M85A 2R98A 2B3VA 5ISVA 4R9MA 2OZHA 5C82A 2QMLA 3N7ZA 3GKRA 3F0AA 1N71A 1Z4EA 3ZZIA 3F5BA 4AVBA 1Q2CA 1Z9UA 4CS0B 1S7NA 3FYNA 1MJ9A 2ATRA 4NF1A 4AVAA 3S6HA 3SXNA 4H6ZA 4PK3A 1QSMA 2X7BA 4IUSA 1Y9KA 3VWEA 3I9SA 2D4PA 2DXQA 3G3SA 3GY9A 4MBUA 3S6GA 3JUWA 4MY3A 3GYAA 1YVOA 4AG9A 2KCWA 3EC4A 3EO4A 4YFJA 2PDOA 4QB9A 2B5GB 4QVTA 3CXSA 1M4DA 4B5PA 1M4GA 4R87A 1FY7A 4BMHA 4H6UA 1Y7RA 4FD5A 2PR1A 1WWZA 4U9YA 4PSWA 2VBQA 2OB0A 2FSRA 4E0AA 4GS4A 3D2PA 3P2FA 1KUVA 2F5IA 2HQYA 2K5TA 2FCKA 4CRZB 3OWCA 2H5MA 1S7LA 2JLMA 4MHDA 3FBUA 4UBRA 5C88A 3B8GA 1I12A 2PC1A 1YGHA 3IWGA 2Q7BA 3NE7A 3TO9A 4AG7A 2VZYA 2Z10A 2Q4VA 2P0WA 1QSTA 3QAHA 3R9GA 1VKCA 4ORFA 3DSBA 3QB8A 5HH1A 4MI4A 1NSLA 2FT0A 1NMTA 2HV2A 4B5PB 1MK4A 2WPWA 2BEIA 4IF5A 1SQHA 4DNCA 1S5KA 4E2AA 3IGRA 3JVNA 1RO5A 2P6GA 2C27A 5E96A 4XPLA 4RS2A 2FL4A 1YREA 2R8VA 1S7KA 1KUYA 2GANA 1MJAA 4UWIA 2FXFA 3E0KA 5H86A 4PSXA
chains in the Genus database with same CATH superfamily
1CP6A 2BSWA 3LODA 1TF8A 4TNUA 1BO4A 1GHEA 1AYEA 2REEA 2I79A 4KOYA 4NGMA 5HXDA 4KLVA 5THWA 1M1DA 2BUEA 3IIBA 4KSFA 2C1CA 1OZPA 3D2MA 4BINA 4JWPA 4UF4A 5LRGA 5FVJA 4JLYA 4U9ZA 1XEBA 4EWTA 1HEEA 3VATA 3W6XA 4NJRA 2PRBA 1R57A 5AGEA 4PXCA 4P4FA 3D7DA 3NH5A 1M4IA 3FF3A 1LFWA 1ZG7A 3FECA 4QBJA 2YNDA 2PJAA 3KGQA 4KOUA 4CRYB 2ZEOA 3DR6A 4PV6A 5K8MA 1U6MA 3RAMA 3BXMA 3CXQA 2CF4A 4ZYQA 2BO9A 2ZELA 4U5YA 5JPHA 1VHOA 2C6CA 1K4JA 3LWUA 1P0HA 1FNOA 3F8KA 4OIDA 2ZOFA 3NFZA 3S6FA 4CYPA 3B3CA 2BL1A 4F6AA 5K8NA 5EBVA 4B5OA 2G3TA 1DTDA 1Z8TA 1S7FA 1TKFA 3VARA 5KTAA 4C2YA 1V0CA 1VIXA 4Q7AA 4Y49B 3B3TA 2IMOA 2REFA 3IWEA 4JXRA 4UFVA 1IYLA 1Q7LA 3EFAA 4TWEA 4EFDA 4II9A 2OZGA 2JBKA 3FIXA 3WT4A 2Z3KA 1IY7A 3QNVA 2B58A 2J8MA 4IHMA 3PBEA 3RNZA 1LRZA 3HLPA 2P6EA 4XPDC 2EK9A 2HUZA 3H8EA 1Z5RA 4IAVA 3B3WA 2BCOA 3CDXA 4R57A 3CT9A 2AJ6A 2Y0MA 1XF8A 3PB7X 4A32A 4FD6A 5GCNA 1CX8A 1F57A 2PQ8A 3FNCA 5AG6A 4B14A 2OZUA 4FD4A 1RXTA 3FVLA 1VHEA 1B6BA 3VWDA 4NCZA 2G3AA 1J4JA 4MY0A 1A2ZA 4MHYA 3TT2A 2VXKA 2GU2A 2ZPAA 3B35A 3KI9A 4A94A 4R6TA 4C68A 2O53A 5J8FA 3PB6X 3PZJA 3H4QA 3FRMA 2ZW6A 4CAWA 1AMPA 4OC4A 4Q38A 2JEVA 1X10A 2Z3NA 3B3SA 3IEHA 2YNCC 3IWWA 3KKWA 4CGMA 2PJ9A 2ANPA 5LYLA 2OOTA 4FWUA 2WSAA 5F47A 5F46A 4ZX9A 4UFWA 2FE7A 3UY5A 4J3GA 2ZENA 4EMEA 2J8RA 4MCSA 4YRHA 1S60A 1NE9A 2B3UA 1VGYA 2YNEA 4HKFA 4MCRA 4BBHA 4MRIA 5JQ4A 4X8IA 4OADA 2A4NA 1IOFA 4ONWA 2IJZA 3D8PA 4FBEA 5JM6A 4KSIA 2EVNA 3TFYA 4P6YA 2I00A 1YSJA 3SJFA 5IB9A 1IICA 2PJ4A 3SJXA 1PU9A 4XNHB 4MFKA 4OC0A 4P4JA 4QC6A 3R9EA 1CG2A 3CXPA 3GB0A 2ZEHA 3R9FA 2V8GA 1CPSA 2IQ6A 3PP9A 3PB8X 4L89A 3RZAA 2B4BA 3W91A 5LRKA 2OU2A 3NH4A 2Q4ZA 1ZG8A 4O23A 3V8IA 4PPZA 7CPAA 4X3RA 3NH8A 4NEXA 1XMTA 2Z0ZA 2PIZA 2QIRA 3PGPA 1S3ZA 2IL4A 2GE3A 2FIAA 2ZW7A 4B13A 2RB7A 3D67A 2AFZA 2PR8A 4CAFA 1YLOA 4KLWA 4B12A 3TX8A 2WPXA 2JDDA 1UWYA 1YK3A 1XOVA 2PIYA 1UFHA 4KOSA 1HDQA 1XRYA 5JH9A 2R7HA 2VQYA 3B7IA 5ELYA 3BI0A 3JRUA 3SHPA 2ZXVA 4C7HA 1I21A 4XNHC 3BLNA 2ZEFA 2PJ1A 4IK2A 5LYIA 2FVGA 2Q04A 2R1IA 4A30A 3HUVA 2VZZA 3FXTA 4OMEA 4B10A 4K3NA 4OAEA 4QUSA 1Z8LA 4ZBGA 1F2PA 1JQGA 4UCMA 2DPTA 4WWVA 4AXVA 4PSXA 1LCPA 4EVYA 1HDUA 4LX9A 1BOBA 4P10A 1LAMA 3RYOA 2Z3LA 3PFEA 2ZW4A 2FS5A 2VEZA 3H5ZA 5IB0A 1XE4A 2PRQA 4NGNA 2GIVA 1BAVA 3TTHA 4OLLA 1WK4A 5HVHA 2PJ7A 1KZFA 3R95A 4OC3A 1PCAA 4MFJA 1P4NA 4MHZA 5G21A 4KVME 1CP7A 3D7GA 1QMUA 4HNYB 2BOAA 4CAXA 2EWBA 3NA6A 4MMOA 2WYRA 3H8FA 4H89A 4UA3A 4KORA 5J8CA 4KVOE 4A95A 3BHXA 4CGPA 5F09A 2FIWA 3MGDA 2ABZA 2ARHA 3TO6A 3KQXA 3PB4X 2PJCA 3PFOA 4HNXB 2J9AA 4UEFA 1ZO0A 3PBBA 2CNTA 3ZJ0A 2Q4YA 1L0CA 2DEAA 4JJXA 3DR8A 2J8NA 3G8WA 5H84A 1FT7A 1YLEA 2AFSA 4Z65A 1M4LA 1YQEA 3D7FA 1TIQA 3R96A 3H8GA 2OR4A 3QAYA 4MHNA 4H2KA 1PUAA 5A28A 2F7VA 4NSQA 4JD6A 4M6HA 4KS9A 4M6IA 4KUBA 4UEZA 4CS0B 2ZEPA 4ZY2A 3A9LA 3T90A 1IGBA 2AFOA 3K9UA 4C2XA 2CXAA 2RFHA 4ZY0A 1ON0A 3DDDA 4P45A 3SI0A 4F8ZA 4K30A 4NFRA 2Q0YA 2QECA 4KZTA 2P6FA 1VHSA 4LUAA 2ZEEA 2G0BA 3PB9X 4KOXA 3MRUA 3LD2A 5G20A 4A37A 3K9TA 5G1ZA 3IU2A 2CNMA 3IFEA 3K2KA 4UWJA 1Y9WA 2ZW5A 4A39A 2NYQA 1YVKA 4PXBA 5DWNA 4ONUA 4E8OA 1XIXA 1I1DA 3S9MA 2PSWA 3I1UA 4PXEA 3S6KA 4CAVA 3LACA 2GLJA 4PQAA 4PXDA 2D4OA 1TXRA 1BPNA 2EBJA 4MHPA 1CJWA 4OC1A 3GIUA 2CIJA 4CYQA 1Y0YA 5AG4A 2CNSA 2Q44A 3IU1A 3EXNA 4ZY1A 5CBMA 2HC9A 3KHXA 4ZGYB 4F0YA 3FJUA 2PJ2A 3KASA 2O4HA 5EMIA 5F48A 2B4DA 2PVWA 1R43A 4A38A 4CYNA 5KTDA 4YGOA 4P4BA 2PJ0A 3ISXA 5AG7A 5K8OA 1QSOA 4CPAA 5AG5A 2EUIA 4MFLA 2NMTA 4ZX8A 4RI1A 3KL9A 4P4EA 4UFXA 2V8HA 5D29A 3SXOA 5DWMA 1IB1E 4UIBA 5DS0A 4NXYA 1CM0A 1Z4RA 4MJ8A 3V38A 4CGOA 1OBRA 3BJ7A 3FEDA 4BD9A 1B87A 4HPSA 4UCPA 5J1QA 4ZI6A 4KOWA 3V7ZA 1ZLIA 5IV0A 3RBUA 5EC4A 2JBJA 1QSNA 3R1KA 4R8FA 3CPXA 4JXQA 5I4MA 5F49A 4R3KA 1X12A 5LYDA 2AE6A 1AUGA 3TE4A 1XJOA 2V8VA 4L8AA 1NSAA 4DYOA 1QSRA 2PE3A 3WR7A 4NGPA 4CAEA 5I0CA 4UIAA 4C2ZA 4X5KA 3GLJA 2XEJA 2Q51A 4KOVA 4UCNA 4P4IA 4OP4A 4P44A 1YR0A 2CY2A 2F8HA 4CGNA 2RC4A 4KOTA 1YX0A 4FAIA 4Q36A 1QQ9A 3FB3A 4NJQA 5KTCA 4Y49C 4A31A 1ARLA 2XEIA 3TOAA 2JEWA 5K8PA 1XFOA 4P4DA 3I3GA 5BWAB 3EY5A 1MJBA 3TOBA 4AVCA 1Q2YA 1XBUA 4I49A 2B4DB 4AB7A 3LMSA 4XPDB 5G22A 1LAPA 2OH1A 2Z11A 2POKA 2EK8A 4R3LA 3NE8A 3W6SA 2AFXA 2O28A 1IYKA 2XEGA 3BJ8A 3D7HA 4OC2A 3KQZA 4KUAA 4HNWB 1M44A 2C6PA 3D3SA 4PK2A 5HMNA 3P2HA 3TCVA 4UEEA 5CNPA 1Y7EA 2VI7A 4XPKA 3WC7A 5IX3A 3SJGA 1Q2DA 1IIDA 2B5GA 3ISZA 4KSAA 5JGFA 4KVXA 2JDCA 4M3SA 4YU9A 2YGWA 1LANA 3DNSA 4OKOA 3S9NA 1KUXA 1BLLE 3C26A 3T9YA 3TO7A 4DJLA 4M85A 4DUKA 2CTBA 1YW4A 3KZWA 2R98A 6CPAA 4C7IA 2B3VA 5ISVA 4R9MA 4CGLA 2OZHA 2Q7SA 5C82A 2Z3OA 2QMLA 3FEEA 3N7ZA 3GKRA 5HVGA 3DGVA 1N71A 1Z4EA 3F0AA 1ZG9A 3ZZIA 5A27A 4GXHA 4CYOA 2QVPA 3F5BA 4AVBA 2PJ5A 1Q2CA 1Z8WA 1Z9UA 1S7NA 1CBXA 1MJ9A 3FYNA 4MFZA 4NGSA 3WABA 4MFPA 3D66A 3WC6A 4A33A 4YWYA 2ATRA 3RO0A 1BPMA 2ZEMA 1RTQA 2EO8A 4LQ6A 4RN7A 4B11A 4NF1A 3MN8A 3VH9A 3S6HA 4AVAA 3SXNA 4H6ZA 1GYTA 3PEIA 2Z3PA 4PK3A 1QSMA 2ZOGA 2X7BA 2NSMA 3KR4A 1PYTB 2PJBA 2PVVA 4IUSA 3SI2A 1IU8A 1Y9KA 3I9SA 1KWMA 2D4PA 3VWEA 4MFQA 2DXQA 3T8WA 1ELLP 3G3SA 3GY9A 4JYWA 2PJ3A 4OIWA 3FMCA 4MBUA 3S6GA 3JUWA 4NGQA 3L2NA 4MY3A 4B6ZA 3GYAA 4MCQA 1YVOA 4X2TA 2Z3MA 4A2ZA 1EE3P 2QYVA 2KCWA 3EC4A 3EO4A 4AG9A 4YFJA 2PCUA 2AFWA 1ARMA 2PDOA 4QB9A 2B5GB 4QVTA 3CXSA 4NGTA 4R76A 1M4DA 3S9LA 4B5PA 3KR5A 1TKJA 1M4GA 5CPAA 4R87A 5LRJA 2PJ8A 3N5FA 1TF9A 3IJ3A 1FY7A 4RUHA 4BMHA 4H6UA 1Y7RA 4FD5A 2ZEGA 2PR1A 1WWZA 4U9YA 2I3CA 1IOIA 4PSWA 2VBQA 3IC1A 2OB0A 3PRTA 2FSRA 4E0AA 2GFQA 3CPAA 4NGRA 3BI1A 4GS4A 3D2PA 3P2FA 1KUVA 2F5IA 2HB6A 2AFMA 2GREA 2HQYA 2K5TA 2FCKA 4CRZB 4F0XA 3B2YA 3OWCA 1TKHA 2H5MA 1S7LA 2JLMA 4WJBA 4MHDA 3FBUA 3GUXA 4UBRA 4F9VA 5C88A 3B8GA 4LQGA 4MCPA 1I12A 2PC1A 1LOKA 1YGHA 1XMBA 1ZLHA 2CTCA 3IWGA 2Q7BA 3NE7A 3D68A 4G1PA 8CPAA 2ZEDA 1JWQA 4MXUA 3FX6A 3TO9A 4AG7A 2VZYA 2Z10A 2Q4VA 2P0WA 5D8NA 1Z8XA 3SI1A 2QJ8A 1QSTA 2G9DA 2V77A 1VKCA 3QAHA 3R9GA 4M6GA 2AFUA 2PJ6A 4ORFA 2WZNA 2YNCA 3DSBA 4OC5A 1Z2LA 4F9UA 2VL1A 3DLJA 2DPSA 3QB8A 5HH1A 4MI4A 1NSLA 1YMEA 2Q43A 3TC8A 3JTKA 2FT0A 1NMTA 1CPXA 2WUUA 2HV2A 4B5PB 1MK4A 2WPWA 2BEIA 4IF5A 1SQHA 4DNCA 1S5KA 4GM5A 4E2AA 2GLFA 3IGRA 1YW6A 2C6GA 3JVNA 2V8DA 1RO5A 1ELMP 3KHZA 2P6GA 4R7MA 3IO1A 1F2OA 3B3VA 4FUUA 2C27A 5E96A 3SJEA 3CZXA 4RS2A 2XEFA 4XPLA 1Y0RA 2FL4A 1H8LA 5LYFA 1YREA 2DF5A 2ODFA 3WC5A 4JZ0A 5HVFA 2R8VA 3FH4A 1S7KA 1KUYA 3D4UA 2GANA 1MJAA 4UWIA 4W9YA 1DE4C 2FXFA 3E0KA 5H86A 1R3NA 4FD7A
chains in the Genus database with same CATH topology
2BSWA 3LODA 1BO4A 1GHEA 2REEA 2I79A 4KOYA 4KLVA 1M1DA 2BUEA 4KSFA 1OZPA 3D2MA 4JWPA 5FVJA 4JLYA 4U9ZA 1XEBA 3W6XA 2PRBA 1R57A 5AGEA 1M4IA 4QBJA 2YNDA 4KOUA 4CRYB 4PV6A 3DR6A 1U6MA 3CXQA 4U5YA 5JPHA 1K4JA 1P0HA 3F8KA 3S6FA 4CYPA 2BL1A 4F6AA 5EBVA 4B5OA 2G3TA 1S7FA 5KTAA 4C2YA 1V0CA 4Y49B 4JXRA 2REFA 3IWEA 4UFVA 1IYLA 3EFAA 4II9A 2OZGA 3FIXA 2Z3KA 2B58A 2J8MA 1LRZA 2P6EA 4XPDC 2HUZA 4R57A 2AJ6A 2Y0MA 1XF8A 4A32A 4FD6A 5GCNA 2PQ8A 3FNCA 5AG6A 4B14A 2OZUA 4FD4A 1RXTA 1B6BA 3VWDA 4NCZA 2G3AA 1J4JA 4MY0A 3TT2A 2VXKA 2ZPAA 4C68A 5J8FA 3PZJA 3H4QA 3FRMA 2ZW6A 4CAWA 4Q38A 2JEVA 2Z3NA 3KKWA 4CGMA 2YNCC 5F46A 2WSAA 5F47A 4UFWA 2FE7A 3UY5A 4J3GA 2J8RA 4YRHA 1S60A 1NE9A 2B3UA 2YNEA 4HKFA 4BBHA 5JQ4A 4OADA 2A4NA 3D8PA 3TFYA 2EVNA 2I00A 1IICA 1PU9A 4XNHB 4MFKA 4QC6A 3R9EA 4CYQA 3R9FA 3CXPA 5AG4A 3PP9A 4L89A 2B4BA 3W91A 2OU2A 3V8IA 4NEXA 1XMTA 2Z0ZA 2QIRA 3PGPA 1S3ZA 2IL4A 2GE3A 2FIAA 2ZW7A 4B13A 2PR8A 4CAFA 4KLWA 4B12A 2WPXA 2JDDA 1YK3A 1UFHA 4KOSA 2R7HA 2VQYA 3SHPA 2ZXVA 4C7HA 1I21A 4XNHC 3BLNA 2Q04A 2R1IA 4A30A 2VZZA 3FXTA 4B10A 4OAEA 4QUSA 4ZBGA 4UCMA 2DPTA 4PSXA 4EVYA 4LX9A 1BOBA 3RYOA 2Z3LA 2ZW4A 2FS5A 2VEZA 3H5ZA 5IB0A 1XE4A 2GIVA 3TTHA 4OLLA 1WK4A 1KZFA 3R95A 4MFJA 1P4NA 5G21A 4KVME 4HNYB 4CAXA 4H89A 4UA3A 4KORA 5J8CA 4KVOE 4A95A 4CGPA 2FIWA 3MGDA 2ARHA 3TO6A 4HNXB 1ZO0A 2CNTA 3ZJ0A 2Q4YA 1L0CA 4JJXA 3DR8A 2J8NA 3G8WA 5H84A 1YLEA 1TIQA 3R96A 1PUAA 5A28A 4NSQA 4JD6A 4KS9A 4KUBA 3T90A 3A9LA 4C2XA 3K9UA 2CXAA 1ON0A 3DDDA 4K30A 2Q0YA 2QECA 4KZTA 2P6FA 1VHSA 4LUAA 2G0BA 4KOXA 5G20A 3LD2A 5G1ZA 3IU2A 2CNMA 4UWJA 1Y9WA 2ZW5A 4E8OA 1YVKA 5DWNA 4ONUA 1XIXA 1I1DA 4CAVA 2PSWA 3S6KA 2D4OA 1CJWA 2CNSA 2Q44A 3IU1A 3EXNA 4ZGYB 4F0YA 5F48A 2B4DA 4CYNA 5KTDA 4YGOA 5AG7A 1QSOA 5AG5A 2EUIA 4MFLA 2NMTA 4RI1A 4UFXA 3SXOA 5DWMA 1IB1E 4NXYA 1CM0A 1Z4RA 4MJ8A 4CGOA 3BJ7A 1B87A 4UCPA 4KOWA 5IV0A 5EC4A 1QSNA 3R1KA 4JXQA 5F49A 4R3KA 2AE6A 3TE4A 4L8AA 1QSRA 3WR7A 4CAEA 5I0CA 4C2ZA 4X5KA 4KOVA 4UCNA 1YR0A 2CY2A 4CGNA 2RC4A 4KOTA 1YX0A 4Q36A 3FB3A 5KTCA 4Y49C 4A31A 3TOAA 3I3GA 5BWAB 3EY5A 1MJBA 3TOBA 4AVCA 1Q2YA 4I49A 2B4DB 4AB7A 4XPDB 5G22A 2OH1A 2Z11A 4R3LA 3W6SA 1IYKA 2O28A 3BJ8A 4KUAA 4HNWB 1M44A 3D3SA 4PK2A 5HMNA 3P2HA 3TCVA 5CNPA 2VI7A 4XPKA 5IX3A 1Q2DA 1IIDA 2B5GA 4KSAA 4KVXA 2JDCA 4M3SA 2YGWA 3DNSA 1KUXA 3C26A 3T9YA 3TO7A 4M85A 2R98A 4C7IA 2B3VA 5ISVA 4R9MA 4CGLA 2OZHA 5C82A 2Z3OA 2QMLA 3N7ZA 3GKRA 3F0AA 1N71A 1Z4EA 3ZZIA 5A27A 4CYOA 3F5BA 4AVBA 1Q2CA 1Z9UA 4CS0B 1S7NA 3FYNA 1MJ9A 4MFZA 4MFPA 4A33A 2ATRA 4B11A 4NF1A 4AVAA 3S6HA 3SXNA 4H6ZA 2Z3PA 4PK3A 1QSMA 2X7BA 4IUSA 1Y9KA 3VWEA 3I9SA 2D4PA 4MFQA 2DXQA 3G3SA 3GY9A 4MBUA 3S6GA 3JUWA 4MY3A 3GYAA 1YVOA 2Z3MA 4A2ZA 4AG9A 2KCWA 3EC4A 3EO4A 4YFJA 2PDOA 4QB9A 2B5GB 4QVTA 3CXSA 1M4DA 4B5PA 1M4GA 4R87A 1FY7A 4BMHA 4H6UA 1Y7RA 4FD5A 2PR1A 1WWZA 4U9YA 4PSWA 2VBQA 2OB0A 2FSRA 4E0AA 4GS4A 3D2PA 3P2FA 1KUVA 2F5IA 2HQYA 2K5TA 2FCKA 4CRZB 4F0XA 3OWCA 2H5MA 1S7LA 2JLMA 4MHDA 3FBUA 4UBRA 5C88A 3B8GA 1I12A 2PC1A 1YGHA 3IWGA 2Q7BA 3NE7A 3TO9A 4AG7A 2VZYA 2Z10A 2Q4VA 2P0WA 1QSTA 3QAHA 3R9GA 1VKCA 4ORFA 2YNCA 3DSBA 2DPSA 3QB8A 5HH1A 4MI4A 1NSLA 3JTKA 2FT0A 1NMTA 2WUUA 2HV2A 4B5PB 1MK4A 2WPWA 2BEIA 4IF5A 1SQHA 4DNCA 1S5KA 4E2AA 3IGRA 3JVNA 1RO5A 2P6GA 2C27A 5E96A 4XPLA 4RS2A 2FL4A 1YREA 2R8VA 1S7KA 1KUYA 2GANA 1MJAA 4UWIA 2FXFA 3E0KA 5H86A 4FD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSW A;  3LOD A;  1BO4 A;  1GHE A;  2REE A;  2I79 A;  4KOY A;  4KLV A;  1M1D A;  2BUE A;  1OZP A;  3D2M A;  4JWP A;  5FVJ A;  4JLY A;  4U9Z A;  1XEB A;  3W6X A;  2PRB A;  1R57 A;  1M4I A;  4QBJ A;  4KOU A;  4CRY B;  4PV6 A;  3DR6 A;  1U6M A;  3CXQ A;  4U5Y A;  5JPH A;  1K4J A;  1P0H A;  3F8K A;  3S6F A;  2BL1 A;  4F6A A;  5EBV A;  4B5O A;  2G3T A;  1S7F A;  5KTA A;  1V0C A;  4Y49 B;  4JXR A;  2REF A;  1IYL A;  3EFA A;  4II9 A;  2OZG A;  3FIX A;  2B58 A;  2J8M A;  1LRZ A;  2P6E A;  4XPD C;  2HUZ A;  4R57 A;  2AJ6 A;  2Y0M A;  1XF8 A;  4FD6 A;  5GCN A;  2PQ8 A;  3FNC A;  2OZU A;  4FD4 A;  1RXT A;  1B6B A;  3VWD A;  4NCZ A;  2G3A A;  1J4J A;  4MY0 A;  3TT2 A;  2VXK A;  2ZPA A;  5J8F A;  3PZJ A;  3H4Q A;  3FRM A;  2ZW6 A;  4CAW A;  2JEV A;  3KKW A;  5F46 A;  5F47 A;  2FE7 A;  3UY5 A;  4J3G A;  2J8R A;  4YRH A;  1S60 A;  1NE9 A;  2B3U A;  4FD7 A;  4HKF A;  5JQ4 A;  4OAD A;  2A4N A;  3D8P A;  3TFY A;  2EVN A;  2I00 A;  1IIC A;  1PU9 A;  4XNH B;  4QC6 A;  3R9E A;  3R9F A;  3CXP A;  3PP9 A;  4L89 A;  2B4B A;  3W91 A;  2OU2 A;  3V8I A;  4NEX A;  1XMT A;  2Z0Z A;  2QIR A;  3PGP A;  1S3Z A;  2IL4 A;  2GE3 A;  2FIA A;  2ZW7 A;  2PR8 A;  4KLW A;  2WPX A;  2JDD A;  1YK3 A;  1UFH A;  4KOS A;  2R7H A;  2VQY A;  3SHP A;  2ZXV A;  1I21 A;  4XNH C;  3BLN A;  2Q04 A;  2R1I A;  2VZZ A;  3FXT A;  4OAE A;  4QUS A;  4ZBG A;  4EVY A;  4LX9 A;  1BOB A;  3RYO A;  2ZW4 A;  2FS5 A;  2VEZ A;  5IB0 A;  1XE4 A;  2GIV A;  3TTH A;  4OLL A;  1WK4 A;  1KZF A;  3R95 A;  1P4N A;  4KVM E;  4HNY B;  4CAX A;  4H89 A;  4UA3 A;  4KOR A;  5J8C A;  4KVO E;  2FIW A;  3MGD A;  2ARH A;  3TO6 A;  4HNX B;  2CNT A;  3ZJ0 A;  2Q4Y A;  1L0C A;  4JJX A;  3DR8 A;  2J8N A;  3G8W A;  5H84 A;  1YLE A;  1TIQ A;  3R96 A;  1PUA A;  4NSQ A;  4JD6 A;  4KUB A;  3T90 A;  3K9U A;  1ON0 A;  3DDD A;  4K30 A;  2Q0Y A;  2QEC A;  4KZT A;  2P6F A;  1VHS A;  4LUA A;  2G0B A;  4KOX A;  3LD2 A;  2CNM A;  4UWJ A;  1Y9W A;  2ZW5 A;  4E8O A;  1YVK A;  5DWN A;  4ONU A;  1XIX A;  1I1D A;  4CAV A;  2PSW A;  3S6K A;  2D4O A;  1CJW A;  2CNS A;  2Q44 A;  3EXN A;  4F0Y A;  5F48 A;  2B4D A;  5KTD A;  4YGO A;  1QSO A;  2EUI A;  2NMT A;  4RI1 A;  3SXO A;  5DWM A;  1IB1 E;  4NXY A;  1CM0 A;  1Z4R A;  4MJ8 A;  3BJ7 A;  1B87 A;  4KOW A;  5IV0 A;  5EC4 A;  1QSN A;  3R1K A;  4JXQ A;  5F49 A;  4R3K A;  2AE6 A;  3TE4 A;  4L8A A;  1QSR A;  3WR7 A;  5I0C A;  4X5K A;  4KOV A;  1YR0 A;  2CY2 A;  2RC4 A;  4KOT A;  1YX0 A;  3FB3 A;  5KTC A;  4Y49 C;  3TOA A;  3I3G A;  3EY5 A;  1MJB A;  3TOB A;  4AVC A;  1Q2Y A;  4I49 A;  2B4D B;  4AB7 A;  4XPD B;  2OH1 A;  2Z11 A;  4R3L A;  3W6S A;  1IYK A;  2O28 A;  3BJ8 A;  4KUA A;  4HNW B;  1M44 A;  3D3S A;  4PK2 A;  5HMN A;  3P2H A;  3TCV A;  5CNP A;  2VI7 A;  4XPK A;  5IX3 A;  1Q2D A;  1IID A;  2B5G A;  4KVX A;  2JDC A;  4M3S A;  3DNS A;  1KUX A;  3C26 A;  3T9Y A;  3TO7 A;  4M85 A;  2R98 A;  2B3V A;  5ISV A;  4R9M A;  2OZH A;  5C82 A;  2QML A;  3N7Z A;  3GKR A;  3F0A A;  1N71 A;  1Z4E A;  3ZZI A;  3F5B A;  4AVB A;  1Q2C A;  1Z9U A;  4CS0 B;  1S7N A;  3FYN A;  1MJ9 A;  2ATR A;  4NF1 A;  4AVA A;  3S6H A;  3SXN A;  4H6Z A;  4PK3 A;  1QSM A;  2X7B A;  4IUS A;  1Y9K A;  3VWE A;  3I9S A;  2D4P A;  2DXQ A;  3G3S A;  3GY9 A;  4MBU A;  3S6G A;  3JUW A;  4MY3 A;  3GYA A;  1YVO A;  4AG9 A;  2KCW A;  3EC4 A;  3EO4 A;  4YFJ A;  2PDO A;  4QB9 A;  2B5G B;  4QVT A;  3CXS A;  1M4D A;  4B5P A;  1M4G A;  4R87 A;  1FY7 A;  4BMH A;  4H6U A;  1Y7R A;  4FD5 A;  2PR1 A;  1WWZ A;  4U9Y A;  4PSW A;  2VBQ A;  2OB0 A;  2FSR A;  4E0A A;  4GS4 A;  3D2P A;  3P2F A;  1KUV A;  2F5I A;  2HQY A;  2K5T A;  2FCK A;  4CRZ B;  3OWC A;  2H5M A;  1S7L A;  2JLM A;  4MHD A;  3FBU A;  4UBR A;  5C88 A;  3B8G A;  1I12 A;  2PC1 A;  1YGH A;  3IWG A;  2Q7B A;  3NE7 A;  3TO9 A;  4AG7 A;  2VZY A;  2Z10 A;  2Q4V A;  2P0W A;  1QST A;  3QAH A;  3R9G A;  1VKC A;  4ORF A;  3DSB A;  3QB8 A;  5HH1 A;  4MI4 A;  1NSL A;  2FT0 A;  1NMT A;  2HV2 A;  4B5P B;  1MK4 A;  2WPW A;  2BEI A;  4IF5 A;  1SQH A;  4DNC A;  1S5K A;  4E2A A;  3IGR A;  3JVN A;  1RO5 A;  2P6G A;  2C27 A;  5E96 A;  4XPL A;  4RS2 A;  2FL4 A;  1YRE A;  2R8V A;  1S7K A;  1KUY A;  2GAN A;  1MJA A;  4UWI A;  2FXF A;  3E0K A;  5H86 A;  4PSX A; 
#chains in the Genus database with same CATH topology
 1CP6 A;  2BSW A;  3LOD A;  1TF8 A;  4TNU A;  1BO4 A;  1GHE A;  1AYE A;  2REE A;  2I79 A;  4KOY A;  4NGM A;  5HXD A;  4KLV A;  5THW A;  1M1D A;  2BUE A;  3IIB A;  4KSF A;  2C1C A;  1OZP A;  3D2M A;  4BIN A;  4JWP A;  4UF4 A;  5LRG A;  5FVJ A;  4JLY A;  4U9Z A;  1XEB A;  4EWT A;  1HEE A;  3VAT A;  3W6X A;  4NJR A;  2PRB A;  1R57 A;  5AGE A;  4PXC A;  4P4F A;  3D7D A;  3NH5 A;  1M4I A;  3FF3 A;  1LFW A;  1ZG7 A;  3FEC A;  4QBJ A;  2YND A;  2PJA A;  3KGQ A;  4KOU A;  4CRY B;  2ZEO A;  3DR6 A;  4PV6 A;  5K8M A;  1U6M A;  3RAM A;  3BXM A;  3CXQ A;  2CF4 A;  4ZYQ A;  2BO9 A;  2ZEL A;  4U5Y A;  5JPH A;  1VHO A;  2C6C A;  1K4J A;  3LWU A;  1P0H A;  1FNO A;  3F8K A;  4OID A;  2ZOF A;  3NFZ A;  3S6F A;  4CYP A;  3B3C A;  2BL1 A;  4F6A A;  5K8N A;  5EBV A;  4B5O A;  2G3T A;  1DTD A;  1Z8T A;  1S7F A;  1TKF A;  3VAR A;  5KTA A;  4C2Y A;  1V0C A;  1VIX A;  4Q7A A;  4Y49 B;  3B3T A;  2IMO A;  2REF A;  3IWE A;  4JXR A;  4UFV A;  1IYL A;  1Q7L A;  3EFA A;  4TWE A;  4EFD A;  4II9 A;  2OZG A;  2JBK A;  3FIX A;  3WT4 A;  2Z3K A;  1IY7 A;  3QNV A;  2B58 A;  2J8M A;  4IHM A;  3PBE A;  3RNZ A;  1LRZ A;  3HLP A;  2P6E A;  4XPD C;  2EK9 A;  2HUZ A;  3H8E A;  1Z5R A;  4IAV A;  3B3W A;  2BCO A;  3CDX A;  4R57 A;  3CT9 A;  2AJ6 A;  2Y0M A;  1XF8 A;  3PB7 X;  4A32 A;  4FD6 A;  5GCN A;  1CX8 A;  1F57 A;  2PQ8 A;  3FNC A;  5AG6 A;  4B14 A;  2OZU A;  4FD4 A;  1RXT A;  3FVL A;  1VHE A;  1B6B A;  3VWD A;  4NCZ A;  2G3A A;  1J4J A;  4MY0 A;  1A2Z A;  4MHY A;  3TT2 A;  2VXK A;  2GU2 A;  2ZPA A;  3B35 A;  3KI9 A;  4A94 A;  4R6T A;  4C68 A;  2O53 A;  5J8F A;  3PB6 X;  3PZJ A;  3H4Q A;  3FRM A;  2ZW6 A;  4CAW A;  1AMP A;  4OC4 A;  4Q38 A;  2JEV A;  1X10 A;  2Z3N A;  3B3S A;  3IEH A;  2YNC C;  3IWW A;  3KKW A;  4CGM A;  2PJ9 A;  2ANP A;  5LYL A;  2OOT A;  4FWU A;  2WSA A;  5F47 A;  5F46 A;  4ZX9 A;  4UFW A;  2FE7 A;  3UY5 A;  4J3G A;  2ZEN A;  4EME A;  2J8R A;  4MCS A;  4YRH A;  1S60 A;  1NE9 A;  2B3U A;  1VGY A;  2YNE A;  4HKF A;  4MCR A;  4BBH A;  4MRI A;  5JQ4 A;  4X8I A;  4OAD A;  2A4N A;  1IOF A;  4ONW A;  2IJZ A;  3D8P A;  4FBE A;  5JM6 A;  4KSI A;  2EVN A;  3TFY A;  4P6Y A;  2I00 A;  1YSJ A;  3SJF A;  5IB9 A;  1IIC A;  2PJ4 A;  3SJX A;  1PU9 A;  4XNH B;  4MFK A;  4OC0 A;  4P4J A;  4QC6 A;  3R9E A;  1CG2 A;  3CXP A;  3GB0 A;  2ZEH A;  3R9F A;  2V8G A;  1CPS A;  2IQ6 A;  3PP9 A;  3PB8 X;  4L89 A;  3RZA A;  2B4B A;  3W91 A;  5LRK A;  2OU2 A;  3NH4 A;  2Q4Z A;  1ZG8 A;  4O23 A;  3V8I A;  4PPZ A;  7CPA A;  4X3R A;  3NH8 A;  4NEX A;  1XMT A;  2Z0Z A;  2PIZ A;  2QIR A;  3PGP A;  1S3Z A;  2IL4 A;  2GE3 A;  2FIA A;  2ZW7 A;  4B13 A;  2RB7 A;  3D67 A;  2AFZ A;  2PR8 A;  4CAF A;  1YLO A;  4KLW A;  4B12 A;  3TX8 A;  2WPX A;  2JDD A;  1UWY A;  1YK3 A;  1XOV A;  2PIY A;  1UFH A;  4KOS A;  1HDQ A;  1XRY A;  5JH9 A;  2R7H A;  2VQY A;  3B7I A;  5ELY A;  3BI0 A;  3JRU A;  3SHP A;  2ZXV A;  4C7H A;  1I21 A;  4XNH C;  3BLN A;  2ZEF A;  2PJ1 A;  4IK2 A;  5LYI A;  2FVG A;  2Q04 A;  2R1I A;  4A30 A;  3HUV A;  2VZZ A;  3FXT A;  4OME A;  4B10 A;  4K3N A;  4OAE A;  4QUS A;  1Z8L A;  4ZBG A;  1F2P A;  1JQG A;  4UCM A;  2DPT A;  4WWV A;  4AXV A;  4PSX A;  1LCP A;  4EVY A;  1HDU A;  4LX9 A;  1BOB A;  4P10 A;  1LAM A;  3RYO A;  2Z3L A;  3PFE A;  2ZW4 A;  2FS5 A;  2VEZ A;  3H5Z A;  5IB0 A;  1XE4 A;  2PRQ A;  4NGN A;  2GIV A;  1BAV A;  3TTH A;  4OLL A;  1WK4 A;  5HVH A;  2PJ7 A;  1KZF A;  3R95 A;  4OC3 A;  1PCA A;  4MFJ A;  1P4N A;  4MHZ A;  5G21 A;  4KVM E;  1CP7 A;  3D7G A;  1QMU A;  4HNY B;  2BOA A;  4CAX A;  2EWB A;  3NA6 A;  4MMO A;  2WYR A;  3H8F A;  4H89 A;  4UA3 A;  4KOR A;  5J8C A;  4KVO E;  4A95 A;  3BHX A;  4CGP A;  5F09 A;  2FIW A;  3MGD A;  2ABZ A;  2ARH A;  3TO6 A;  3KQX A;  3PB4 X;  2PJC A;  3PFO A;  4HNX B;  2J9A A;  4UEF A;  1ZO0 A;  3PBB A;  2CNT A;  3ZJ0 A;  2Q4Y A;  1L0C A;  2DEA A;  4JJX A;  3DR8 A;  2J8N A;  3G8W A;  5H84 A;  1FT7 A;  1YLE A;  2AFS A;  4Z65 A;  1M4L A;  1YQE A;  3D7F A;  1TIQ A;  3R96 A;  3H8G A;  2OR4 A;  3QAY A;  4MHN A;  4H2K A;  1PUA A;  5A28 A;  2F7V A;  4NSQ A;  4JD6 A;  4M6H A;  4KS9 A;  4M6I A;  4KUB A;  4UEZ A;  4CS0 B;  2ZEP A;  4ZY2 A;  3A9L A;  3T90 A;  1IGB A;  2AFO A;  3K9U A;  4C2X A;  2CXA A;  2RFH A;  4ZY0 A;  1ON0 A;  3DDD A;  4P45 A;  3SI0 A;  4F8Z A;  4K30 A;  4NFR A;  2Q0Y A;  2QEC A;  4KZT A;  2P6F A;  1VHS A;  4LUA A;  2ZEE A;  2G0B A;  3PB9 X;  4KOX A;  3MRU A;  3LD2 A;  5G20 A;  4A37 A;  3K9T A;  5G1Z A;  3IU2 A;  2CNM A;  3IFE A;  3K2K A;  4UWJ A;  1Y9W A;  2ZW5 A;  4A39 A;  2NYQ A;  1YVK A;  4PXB A;  5DWN A;  4ONU A;  4E8O A;  1XIX A;  1I1D A;  3S9M A;  2PSW A;  3I1U A;  4PXE A;  3S6K A;  4CAV A;  3LAC A;  2GLJ A;  4PQA A;  4PXD A;  2D4O A;  1TXR A;  1BPN A;  2EBJ A;  4MHP A;  1CJW A;  4OC1 A;  3GIU A;  2CIJ A;  4CYQ A;  1Y0Y A;  5AG4 A;  2CNS A;  2Q44 A;  3IU1 A;  3EXN A;  4ZY1 A;  5CBM A;  2HC9 A;  3KHX A;  4ZGY B;  4F0Y A;  3FJU A;  2PJ2 A;  3KAS A;  2O4H A;  5EMI A;  5F48 A;  2B4D A;  2PVW A;  1R43 A;  4A38 A;  4CYN A;  5KTD A;  4YGO A;  4P4B A;  2PJ0 A;  3ISX A;  5AG7 A;  5K8O A;  1QSO A;  4CPA A;  5AG5 A;  2EUI A;  4MFL A;  2NMT A;  4ZX8 A;  4RI1 A;  3KL9 A;  4P4E A;  4UFX A;  2V8H A;  5D29 A;  3SXO A;  5DWM A;  1IB1 E;  4UIB A;  5DS0 A;  4NXY A;  1CM0 A;  1Z4R A;  4MJ8 A;  3V38 A;  4CGO A;  1OBR A;  3BJ7 A;  3FED A;  4BD9 A;  1B87 A;  4HPS A;  4UCP A;  5J1Q A;  4ZI6 A;  4KOW A;  3V7Z A;  1ZLI A;  5IV0 A;  3RBU A;  5EC4 A;  2JBJ A;  1QSN A;  3R1K A;  4R8F A;  3CPX A;  4JXQ A;  5I4M A;  5F49 A;  4R3K A;  1X12 A;  5LYD A;  2AE6 A;  1AUG A;  3TE4 A;  1XJO A;  2V8V A;  4L8A A;  1NSA A;  4DYO A;  1QSR A;  2PE3 A;  3WR7 A;  4NGP A;  4CAE A;  5I0C A;  4UIA A;  4C2Z A;  4X5K A;  3GLJ A;  2XEJ A;  2Q51 A;  4KOV A;  4UCN A;  4P4I A;  4OP4 A;  4P44 A;  1YR0 A;  2CY2 A;  2F8H A;  4CGN A;  2RC4 A;  4KOT A;  1YX0 A;  4FAI A;  4Q36 A;  1QQ9 A;  3FB3 A;  4NJQ A;  5KTC A;  4Y49 C;  4A31 A;  1ARL A;  2XEI A;  3TOA A;  2JEW A;  5K8P A;  1XFO A;  4P4D A;  3I3G A;  5BWA B;  3EY5 A;  1MJB A;  3TOB A;  4AVC A;  1Q2Y A;  1XBU A;  4I49 A;  2B4D B;  4AB7 A;  3LMS A;  4XPD B;  5G22 A;  1LAP A;  2OH1 A;  2Z11 A;  2POK A;  2EK8 A;  4R3L A;  3NE8 A;  3W6S A;  2AFX A;  2O28 A;  1IYK A;  2XEG A;  3BJ8 A;  3D7H A;  4OC2 A;  3KQZ A;  4KUA A;  4HNW B;  1M44 A;  2C6P A;  3D3S A;  4PK2 A;  5HMN A;  3P2H A;  3TCV A;  4UEE A;  5CNP A;  1Y7E A;  2VI7 A;  4XPK A;  3WC7 A;  5IX3 A;  3SJG A;  1Q2D A;  1IID A;  2B5G A;  3ISZ A;  4KSA A;  5JGF A;  4KVX A;  2JDC A;  4M3S A;  4YU9 A;  2YGW A;  1LAN A;  3DNS A;  4OKO A;  3S9N A;  1KUX A;  1BLL E;  3C26 A;  3T9Y A;  3TO7 A;  4DJL A;  4M85 A;  4DUK A;  2CTB A;  1YW4 A;  3KZW A;  2R98 A;  6CPA A;  4C7I A;  2B3V A;  5ISV A;  4R9M A;  4CGL A;  2OZH A;  2Q7S A;  5C82 A;  2Z3O A;  2QML A;  3FEE A;  3N7Z A;  3GKR A;  5HVG A;  3DGV A;  1N71 A;  1Z4E A;  3F0A A;  1ZG9 A;  3ZZI A;  5A27 A;  4GXH A;  4CYO A;  2QVP A;  3F5B A;  4AVB A;  2PJ5 A;  1Q2C A;  1Z8W A;  1Z9U A;  1S7N A;  1CBX A;  1MJ9 A;  3FYN A;  4MFZ A;  4NGS A;  3WAB A;  4MFP A;  3D66 A;  3WC6 A;  4A33 A;  4YWY A;  2ATR A;  3RO0 A;  1BPM A;  2ZEM A;  1RTQ A;  2EO8 A;  4LQ6 A;  4RN7 A;  4B11 A;  4NF1 A;  3MN8 A;  3VH9 A;  3S6H A;  4AVA A;  3SXN A;  4H6Z A;  1GYT A;  3PEI A;  2Z3P A;  4PK3 A;  1QSM A;  2ZOG A;  2X7B A;  2NSM A;  3KR4 A;  1PYT B;  2PJB A;  2PVV A;  4IUS A;  3SI2 A;  1IU8 A;  1Y9K A;  3I9S A;  1KWM A;  2D4P A;  3VWE A;  4MFQ A;  2DXQ A;  3T8W A;  1ELL P;  3G3S A;  3GY9 A;  4JYW A;  2PJ3 A;  4OIW A;  3FMC A;  4MBU A;  3S6G A;  3JUW A;  4NGQ A;  3L2N A;  4MY3 A;  4B6Z A;  3GYA A;  4MCQ A;  1YVO A;  4X2T A;  2Z3M A;  4A2Z A;  1EE3 P;  2QYV A;  2KCW A;  3EC4 A;  3EO4 A;  4AG9 A;  4YFJ A;  2PCU A;  2AFW A;  1ARM A;  2PDO A;  4QB9 A;  2B5G B;  4QVT A;  3CXS A;  4NGT A;  4R76 A;  1M4D A;  3S9L A;  4B5P A;  3KR5 A;  1TKJ A;  1M4G A;  5CPA A;  4R87 A;  5LRJ A;  2PJ8 A;  3N5F A;  1TF9 A;  3IJ3 A;  1FY7 A;  4RUH A;  4BMH A;  4H6U A;  1Y7R A;  4FD5 A;  2ZEG A;  2PR1 A;  1WWZ A;  4U9Y A;  2I3C A;  1IOI A;  4PSW A;  2VBQ A;  3IC1 A;  2OB0 A;  3PRT A;  2FSR A;  4E0A A;  2GFQ A;  3CPA A;  4NGR A;  3BI1 A;  4GS4 A;  3D2P A;  3P2F A;  1KUV A;  2F5I A;  2HB6 A;  2AFM A;  2GRE A;  2HQY A;  2K5T A;  2FCK A;  4CRZ B;  4F0X A;  3B2Y A;  3OWC A;  1TKH A;  2H5M A;  1S7L A;  2JLM A;  4WJB A;  4MHD A;  3FBU A;  3GUX A;  4UBR A;  4F9V A;  5C88 A;  3B8G A;  4LQG A;  4MCP A;  1I12 A;  2PC1 A;  1LOK A;  1YGH A;  1XMB A;  1ZLH A;  2CTC A;  3IWG A;  2Q7B A;  3NE7 A;  3D68 A;  4G1P A;  8CPA A;  2ZED A;  1JWQ A;  4MXU A;  3FX6 A;  3TO9 A;  4AG7 A;  2VZY A;  2Z10 A;  2Q4V A;  2P0W A;  5D8N A;  1Z8X A;  3SI1 A;  2QJ8 A;  1QST A;  2G9D A;  2V77 A;  1VKC A;  3QAH A;  3R9G A;  4M6G A;  2AFU A;  2PJ6 A;  4ORF A;  2WZN A;  2YNC A;  3DSB A;  4OC5 A;  1Z2L A;  4F9U A;  2VL1 A;  3DLJ A;  2DPS A;  3QB8 A;  5HH1 A;  4MI4 A;  1NSL A;  1YME A;  2Q43 A;  3TC8 A;  3JTK A;  2FT0 A;  1NMT A;  1CPX A;  2WUU A;  2HV2 A;  4B5P B;  1MK4 A;  2WPW A;  2BEI A;  4IF5 A;  1SQH A;  4DNC A;  1S5K A;  4GM5 A;  4E2A A;  2GLF A;  3IGR A;  1YW6 A;  2C6G A;  3JVN A;  2V8D A;  1RO5 A;  1ELM P;  3KHZ A;  2P6G A;  4R7M A;  3IO1 A;  1F2O A;  3B3V A;  4FUU A;  2C27 A;  5E96 A;  3SJE A;  3CZX A;  4RS2 A;  2XEF A;  4XPL A;  1Y0R A;  2FL4 A;  1H8L A;  5LYF A;  1YRE A;  2DF5 A;  2ODF A;  3WC5 A;  4JZ0 A;  5HVF A;  2R8V A;  3FH4 A;  1S7K A;  1KUY A;  3D4U A;  2GAN A;  1MJA A;  4UWI A;  4W9Y A;  1DE4 C;  2FXF A;  3E0K A;  5H86 A;  1R3N A;  4FD7 A; 
#chains in the Genus database with same CATH homology
 2BSW A;  3LOD A;  1BO4 A;  1GHE A;  2REE A;  2I79 A;  4KOY A;  4KLV A;  1M1D A;  2BUE A;  4KSF A;  1OZP A;  3D2M A;  4JWP A;  5FVJ A;  4JLY A;  4U9Z A;  1XEB A;  3W6X A;  2PRB A;  1R57 A;  5AGE A;  1M4I A;  4QBJ A;  2YND A;  4KOU A;  4CRY B;  4PV6 A;  3DR6 A;  1U6M A;  3CXQ A;  4U5Y A;  5JPH A;  1K4J A;  1P0H A;  3F8K A;  3S6F A;  4CYP A;  2BL1 A;  4F6A A;  5EBV A;  4B5O A;  2G3T A;  1S7F A;  5KTA A;  4C2Y A;  1V0C A;  4Y49 B;  4JXR A;  2REF A;  3IWE A;  4UFV A;  1IYL A;  3EFA A;  4II9 A;  2OZG A;  3FIX A;  2Z3K A;  2B58 A;  2J8M A;  1LRZ A;  2P6E A;  4XPD C;  2HUZ A;  4R57 A;  2AJ6 A;  2Y0M A;  1XF8 A;  4A32 A;  4FD6 A;  5GCN A;  2PQ8 A;  3FNC A;  5AG6 A;  4B14 A;  2OZU A;  4FD4 A;  1RXT A;  1B6B A;  3VWD A;  4NCZ A;  2G3A A;  1J4J A;  4MY0 A;  3TT2 A;  2VXK A;  2ZPA A;  4C68 A;  5J8F A;  3PZJ A;  3H4Q A;  3FRM A;  2ZW6 A;  4CAW A;  4Q38 A;  2JEV A;  2Z3N A;  3KKW A;  4CGM A;  2YNC C;  5F46 A;  2WSA A;  5F47 A;  4UFW A;  2FE7 A;  3UY5 A;  4J3G A;  2J8R A;  4YRH A;  1S60 A;  1NE9 A;  2B3U A;  2YNE A;  4HKF A;  4BBH A;  5JQ4 A;  4OAD A;  2A4N A;  3D8P A;  3TFY A;  2EVN A;  2I00 A;  1IIC A;  1PU9 A;  4XNH B;  4MFK A;  4QC6 A;  3R9E A;  4CYQ A;  3R9F A;  3CXP A;  5AG4 A;  3PP9 A;  4L89 A;  2B4B A;  3W91 A;  2OU2 A;  3V8I A;  4NEX A;  1XMT A;  2Z0Z A;  2QIR A;  3PGP A;  1S3Z A;  2IL4 A;  2GE3 A;  2FIA A;  2ZW7 A;  4B13 A;  2PR8 A;  4CAF A;  4KLW A;  4B12 A;  2WPX A;  2JDD A;  1YK3 A;  1UFH A;  4KOS A;  2R7H A;  2VQY A;  3SHP A;  2ZXV A;  4C7H A;  1I21 A;  4XNH C;  3BLN A;  2Q04 A;  2R1I A;  4A30 A;  2VZZ A;  3FXT A;  4B10 A;  4OAE A;  4QUS A;  4ZBG A;  4UCM A;  2DPT A;  4PSX A;  4EVY A;  4LX9 A;  1BOB A;  3RYO A;  2Z3L A;  2ZW4 A;  2FS5 A;  2VEZ A;  3H5Z A;  5IB0 A;  1XE4 A;  2GIV A;  3TTH A;  4OLL A;  1WK4 A;  1KZF A;  3R95 A;  4MFJ A;  1P4N A;  5G21 A;  4KVM E;  4HNY B;  4CAX A;  4H89 A;  4UA3 A;  4KOR A;  5J8C A;  4KVO E;  4A95 A;  4CGP A;  2FIW A;  3MGD A;  2ARH A;  3TO6 A;  4HNX B;  1ZO0 A;  2CNT A;  3ZJ0 A;  2Q4Y A;  1L0C A;  4JJX A;  3DR8 A;  2J8N A;  3G8W A;  5H84 A;  1YLE A;  1TIQ A;  3R96 A;  1PUA A;  5A28 A;  4NSQ A;  4JD6 A;  4KS9 A;  4KUB A;  3T90 A;  3A9L A;  4C2X A;  3K9U A;  2CXA A;  1ON0 A;  3DDD A;  4K30 A;  2Q0Y A;  2QEC A;  4KZT A;  2P6F A;  1VHS A;  4LUA A;  2G0B A;  4KOX A;  5G20 A;  3LD2 A;  5G1Z A;  3IU2 A;  2CNM A;  4UWJ A;  1Y9W A;  2ZW5 A;  4E8O A;  1YVK A;  5DWN A;  4ONU A;  1XIX A;  1I1D A;  4CAV A;  2PSW A;  3S6K A;  2D4O A;  1CJW A;  2CNS A;  2Q44 A;  3IU1 A;  3EXN A;  4ZGY B;  4F0Y A;  5F48 A;  2B4D A;  4CYN A;  5KTD A;  4YGO A;  5AG7 A;  1QSO A;  5AG5 A;  2EUI A;  4MFL A;  2NMT A;  4RI1 A;  4UFX A;  3SXO A;  5DWM A;  1IB1 E;  4NXY A;  1CM0 A;  1Z4R A;  4MJ8 A;  4CGO A;  3BJ7 A;  1B87 A;  4UCP A;  4KOW A;  5IV0 A;  5EC4 A;  1QSN A;  3R1K A;  4JXQ A;  5F49 A;  4R3K A;  2AE6 A;  3TE4 A;  4L8A A;  1QSR A;  3WR7 A;  4CAE A;  5I0C A;  4C2Z A;  4X5K A;  4KOV A;  4UCN A;  1YR0 A;  2CY2 A;  4CGN A;  2RC4 A;  4KOT A;  1YX0 A;  4Q36 A;  3FB3 A;  5KTC A;  4Y49 C;  4A31 A;  3TOA A;  3I3G A;  5BWA B;  3EY5 A;  1MJB A;  3TOB A;  4AVC A;  1Q2Y A;  4I49 A;  2B4D B;  4AB7 A;  4XPD B;  5G22 A;  2OH1 A;  2Z11 A;  4R3L A;  3W6S A;  1IYK A;  2O28 A;  3BJ8 A;  4KUA A;  4HNW B;  1M44 A;  3D3S A;  4PK2 A;  5HMN A;  3P2H A;  3TCV A;  5CNP A;  2VI7 A;  4XPK A;  5IX3 A;  1Q2D A;  1IID A;  2B5G A;  4KSA A;  4KVX A;  2JDC A;  4M3S A;  2YGW A;  3DNS A;  1KUX A;  3C26 A;  3T9Y A;  3TO7 A;  4M85 A;  2R98 A;  4C7I A;  2B3V A;  5ISV A;  4R9M A;  4CGL A;  2OZH A;  5C82 A;  2Z3O A;  2QML A;  3N7Z A;  3GKR A;  3F0A A;  1N71 A;  1Z4E A;  3ZZI A;  5A27 A;  4CYO A;  3F5B A;  4AVB A;  1Q2C A;  1Z9U A;  4CS0 B;  1S7N A;  3FYN A;  1MJ9 A;  4MFZ A;  4MFP A;  4A33 A;  2ATR A;  4B11 A;  4NF1 A;  4AVA A;  3S6H A;  3SXN A;  4H6Z A;  2Z3P A;  4PK3 A;  1QSM A;  2X7B A;  4IUS A;  1Y9K A;  3VWE A;  3I9S A;  2D4P A;  4MFQ A;  2DXQ A;  3G3S A;  3GY9 A;  4MBU A;  3S6G A;  3JUW A;  4MY3 A;  3GYA A;  1YVO A;  2Z3M A;  4A2Z A;  4AG9 A;  2KCW A;  3EC4 A;  3EO4 A;  4YFJ A;  2PDO A;  4QB9 A;  2B5G B;  4QVT A;  3CXS A;  1M4D A;  4B5P A;  1M4G A;  4R87 A;  1FY7 A;  4BMH A;  4H6U A;  1Y7R A;  4FD5 A;  2PR1 A;  1WWZ A;  4U9Y A;  4PSW A;  2VBQ A;  2OB0 A;  2FSR A;  4E0A A;  4GS4 A;  3D2P A;  3P2F A;  1KUV A;  2F5I A;  2HQY A;  2K5T A;  2FCK A;  4CRZ B;  4F0X A;  3OWC A;  2H5M A;  1S7L A;  2JLM A;  4MHD A;  3FBU A;  4UBR A;  5C88 A;  3B8G A;  1I12 A;  2PC1 A;  1YGH A;  3IWG A;  2Q7B A;  3NE7 A;  3TO9 A;  4AG7 A;  2VZY A;  2Z10 A;  2Q4V A;  2P0W A;  1QST A;  3QAH A;  3R9G A;  1VKC A;  4ORF A;  2YNC A;  3DSB A;  2DPS A;  3QB8 A;  5HH1 A;  4MI4 A;  1NSL A;  3JTK A;  2FT0 A;  1NMT A;  2WUU A;  2HV2 A;  4B5P B;  1MK4 A;  2WPW A;  2BEI A;  4IF5 A;  1SQH A;  4DNC A;  1S5K A;  4E2A A;  3IGR A;  3JVN A;  1RO5 A;  2P6G A;  2C27 A;  5E96 A;  4XPL A;  4RS2 A;  2FL4 A;  1YRE A;  2R8V A;  1S7K A;  1KUY A;  2GAN A;  1MJA A;  4UWI A;  2FXF A;  3E0K A;  5H86 A;  4FD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...