2VIKA

Refined structure of the actin-severing domain villin 14t, determined by solution nmr, minimized average structure
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
126
structure length
126
Chain Sequence
VELSKKVTGKLDKTTPGIQIWRIENMEMVPVPTKSYGNFYEGDCYVLLSTRKTGSGFSYNIHYWLGKNSSQDEQGAAAIYTTQMDEYLGSVAVQHREVQGHESETFRAYFKQGLIYKQGGVASGMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of villin 14T and a detailed comparison with other actin-severing domains.
pubmed rcsb
source organism Gallus gallus
molecule tags Actin-binding protein
molecule keywords VILLIN 14T
total genus 18
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 1997-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2vikA00
2KVKA 4CBUG 4PKHB 1AHQA 1PD0A 3CIPG 4CBXG 1NMDG 2NUPB 5L6WC 3A5NS 2MOTA 5KYYA 5KYNA 2LLFA 2MP4A 1NLVG 4BEX1 1D0NA 1VKKA 2FH1A 2NUPA 4Z94G 1YAGG 2D8BA 3A5OS 1SVQA 4JD2H 5IVUA 1T3XA 1VFQA 1T3YA 2NUTB 2FF6G 3L50A 3EGXB 4PKGG 5KYXB 3EFOB 1WM4A 2HD7A 1M2VB 1X67A 1T44G 1CFYA 2FGHA 2VILA 1WFSA 5KYWA 1Q8GA 2QTVA 3A5LS 1D4XG 3EG9B 1F7SA 2FF3A 1YVNG 1SVRA 1Q8XA 1AK6A 4KEEA 1NPHA 2FH4A 3EFOA 1EQYS 2FH3A 3FFNA 1RGIG 1HQZ1 3FG6A 2L72A 1P8XA 1UDMA 1M2OA 5KYWB 1ESVS 3CJBG 2W0IA 4LIZA 4CBWG 3EGDA 5HVKD 2FH2A 5A1MA 1CNUA 3Q2BA 5DD2A 5KYYB 1H1VG 1M2VA 1C0GS 5FAEA 5KYUB 1V6FA 1MDUA 2LXXA 1J72A 3A5MS 3EGXA 5KYXA 1P8ZG 3EH1A 1SVYA 3DAWB 5KYUA 5HVKB 2VACA 2I2QA 1PD1A 3EG9A 4KEDA 1JHWA 4S10C 1TMWA 1WNJA 5FAFA 1C0FS 3CI5G 2XFAA 3FG7A 1M4JA 2MV2A 4PKIG 1TVJA 1AK7A 1KCQA 2LJ8A 1COFA 1QPVA 1NM1G 3FFKA 1DEJS 3EGDB 3CJCG 3TU5B 1T2LA 3EH2A 2NUTA 1PCXA 4KEFA 2VIKA 2XF1A
chains in the Genus database with same CATH superfamily
2KVKA 4CBUG 4PKHB 1AHQA 1PD0A 3CIPG 4CBXG 1NMDG 2NUPB 5L6WC 3A5NS 2MOTA 5KYYA 5KYNA 2LLFA 2MP4A 1NLVG 4BEX1 1D0NA 1VKKA 2FH1A 2NUPA 4Z94G 1YAGG 2D8BA 3A5OS 1SVQA 4JD2H 3DA7A 5IVUA 1T3XA 1VFQA 1T3YA 2NUTB 2FF6G 3L50A 3EGXB 4PKGG 5KYXB 3EFOB 1WM4A 2HD7A 1M2VB 1X67A 1T44G 1CFYA 2FGHA 2VILA 1WFSA 5KYWA 1Q8GA 2QTVA 3A5LS 1D4XG 3EG9B 1F7SA 2FF3A 1YVNG 1SVRA 1Q8XA 1AK6A 4KEEA 1NPHA 2FH4A 3EFOA 1EQYS 2FH3A 3FFNA 1RGIG 1HQZ1 3FG6A 2L72A 1P8XA 1UDMA 1M2OA 5KYWB 1ESVS 3CJBG 2W0IA 4LIZA 4CBWG 3EGDA 5HVKD 2FH2A 5A1MA 1CNUA 3Q2BA 5DD2A 5KYYB 1H1VG 1M2VA 1C0GS 5FAEA 5KYUB 1V6FA 1MDUA 2LXXA 1J72A 3A5MS 3EGXA 5KYXA 1P8ZG 3EH1A 1SVYA 3DAWB 5KYUA 5HVKB 2VACA 2I2QA 1PD1A 3EG9A 4KEDA 1JHWA 4S10C 1TMWA 1WNJA 5FAFA 1C0FS 3CI5G 2XFAA 3FG7A 1M4JA 2MV2A 4PKIG 1TVJA 1AK7A 1KCQA 2LJ8A 1COFA 1QPVA 1NM1G 3FFKA 1DEJS 3EGDB 3CJCG 3TU5B 1T2LA 3EH2A 2NUTA 1PCXA 4KEFA 2VIKA 2XF1A
chains in the Genus database with same CATH topology
2KVKA 4CBUG 4PKHB 1AHQA 1PD0A 3CIPG 4CBXG 1NMDG 2NUPB 5L6WC 3A5NS 2MOTA 5KYYA 5KYNA 2LLFA 2MP4A 1NLVG 4BEX1 1D0NA 1VKKA 2FH1A 2NUPA 4Z94G 1YAGG 2D8BA 3A5OS 1SVQA 4JD2H 3DA7A 5IVUA 1T3XA 1VFQA 1T3YA 2NUTB 2FF6G 3L50A 3EGXB 4PKGG 5KYXB 3EFOB 1WM4A 2HD7A 1M2VB 1X67A 1T44G 1CFYA 2FGHA 2VILA 1WFSA 5KYWA 1Q8GA 2QTVA 3A5LS 1D4XG 3EG9B 1F7SA 2FF3A 1YVNG 1SVRA 1Q8XA 1AK6A 4KEEA 1NPHA 2FH4A 3EFOA 1EQYS 2FH3A 3FFNA 1RGIG 1HQZ1 3FG6A 2L72A 1P8XA 1UDMA 1M2OA 5KYWB 1ESVS 3CJBG 2W0IA 4LIZA 4CBWG 3EGDA 5HVKD 2FH2A 5A1MA 1CNUA 3Q2BA 5DD2A 5KYYB 1H1VG 1M2VA 1C0GS 5FAEA 5KYUB 1V6FA 1MDUA 2LXXA 1J72A 3A5MS 3EGXA 5KYXA 1P8ZG 3EH1A 1SVYA 3DAWB 5KYUA 5HVKB 2VACA 2I2QA 1PD1A 3EG9A 4KEDA 1JHWA 4S10C 1TMWA 1WNJA 5FAFA 1C0FS 3CI5G 2XFAA 3FG7A 1M4JA 2MV2A 4PKIG 1TVJA 1AK7A 1KCQA 2LJ8A 1COFA 1QPVA 1NM1G 3FFKA 1DEJS 3EGDB 3CJCG 3TU5B 1T2LA 3EH2A 2NUTA 1PCXA 4KEFA 2VIKA 2XF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVK A;  4CBU G;  4PKH B;  1AHQ A;  1PD0 A;  3CIP G;  4CBX G;  1NMD G;  2NUP B;  5L6W C;  3A5N S;  2MOT A;  5KYY A;  5KYN A;  2LLF A;  2MP4 A;  1NLV G;  4BEX 1;  1D0N A;  1VKK A;  2FH1 A;  2NUP A;  4Z94 G;  1YAG G;  2D8B A;  3A5O S;  1SVQ A;  4JD2 H;  5IVU A;  1T3X A;  1VFQ A;  1T3Y A;  2NUT B;  2FF6 G;  3L50 A;  3EGX B;  4PKG G;  5KYX B;  3EFO B;  1WM4 A;  2HD7 A;  1M2V B;  1X67 A;  1T44 G;  1CFY A;  2FGH A;  2VIL A;  1WFS A;  5KYW A;  1Q8G A;  2QTV A;  3A5L S;  1D4X G;  3EG9 B;  1F7S A;  2FF3 A;  1YVN G;  1SVR A;  1Q8X A;  1AK6 A;  4KEE A;  1NPH A;  2FH4 A;  3EFO A;  1EQY S;  2FH3 A;  3FFN A;  1RGI G;  1HQZ 1;  3FG6 A;  2L72 A;  1P8X A;  1UDM A;  1M2O A;  5KYW B;  1ESV S;  3CJB G;  2W0I A;  4LIZ A;  4CBW G;  3EGD A;  5HVK D;  2FH2 A;  5A1M A;  1CNU A;  3Q2B A;  5DD2 A;  5KYY B;  1H1V G;  1M2V A;  1C0G S;  5FAE A;  5KYU B;  1V6F A;  1MDU A;  2LXX A;  1J72 A;  3A5M S;  3EGX A;  5KYX A;  1P8Z G;  3EH1 A;  1SVY A;  3DAW B;  5KYU A;  5HVK B;  2VAC A;  2I2Q A;  1PD1 A;  3EG9 A;  4KED A;  1JHW A;  4S10 C;  1TMW A;  1WNJ A;  5FAF A;  1C0F S;  3CI5 G;  2XFA A;  3FG7 A;  1M4J A;  2MV2 A;  4PKI G;  1TVJ A;  1AK7 A;  1KCQ A;  2LJ8 A;  1COF A;  1QPV A;  1NM1 G;  3FFK A;  1DEJ S;  3EGD B;  3CJC G;  3TU5 B;  1T2L A;  3EH2 A;  2NUT A;  1PCX A;  4KEF A;  2VIK A;  2XF1 A; 
#chains in the Genus database with same CATH topology
 2KVK A;  4CBU G;  4PKH B;  1AHQ A;  1PD0 A;  3CIP G;  4CBX G;  1NMD G;  2NUP B;  5L6W C;  3A5N S;  2MOT A;  5KYY A;  5KYN A;  2LLF A;  2MP4 A;  1NLV G;  4BEX 1;  1D0N A;  1VKK A;  2FH1 A;  2NUP A;  4Z94 G;  1YAG G;  2D8B A;  3A5O S;  1SVQ A;  4JD2 H;  3DA7 A;  5IVU A;  1T3X A;  1VFQ A;  1T3Y A;  2NUT B;  2FF6 G;  3L50 A;  3EGX B;  4PKG G;  5KYX B;  3EFO B;  1WM4 A;  2HD7 A;  1M2V B;  1X67 A;  1T44 G;  1CFY A;  2FGH A;  2VIL A;  1WFS A;  5KYW A;  1Q8G A;  2QTV A;  3A5L S;  1D4X G;  3EG9 B;  1F7S A;  2FF3 A;  1YVN G;  1SVR A;  1Q8X A;  1AK6 A;  4KEE A;  1NPH A;  2FH4 A;  3EFO A;  1EQY S;  2FH3 A;  3FFN A;  1RGI G;  1HQZ 1;  3FG6 A;  2L72 A;  1P8X A;  1UDM A;  1M2O A;  5KYW B;  1ESV S;  3CJB G;  2W0I A;  4LIZ A;  4CBW G;  3EGD A;  5HVK D;  2FH2 A;  5A1M A;  1CNU A;  3Q2B A;  5DD2 A;  5KYY B;  1H1V G;  1M2V A;  1C0G S;  5FAE A;  5KYU B;  1V6F A;  1MDU A;  2LXX A;  1J72 A;  3A5M S;  3EGX A;  5KYX A;  1P8Z G;  3EH1 A;  1SVY A;  3DAW B;  5KYU A;  5HVK B;  2VAC A;  2I2Q A;  1PD1 A;  3EG9 A;  4KED A;  1JHW A;  4S10 C;  1TMW A;  1WNJ A;  5FAF A;  1C0F S;  3CI5 G;  2XFA A;  3FG7 A;  1M4J A;  2MV2 A;  4PKI G;  1TVJ A;  1AK7 A;  1KCQ A;  2LJ8 A;  1COF A;  1QPV A;  1NM1 G;  3FFK A;  1DEJ S;  3EGD B;  3CJC G;  3TU5 B;  1T2L A;  3EH2 A;  2NUT A;  1PCX A;  4KEF A;  2VIK A;  2XF1 A; 
#chains in the Genus database with same CATH homology
 2KVK A;  4CBU G;  4PKH B;  1AHQ A;  1PD0 A;  3CIP G;  4CBX G;  1NMD G;  2NUP B;  5L6W C;  3A5N S;  2MOT A;  5KYY A;  5KYN A;  2LLF A;  2MP4 A;  1NLV G;  4BEX 1;  1D0N A;  1VKK A;  2FH1 A;  2NUP A;  4Z94 G;  1YAG G;  2D8B A;  3A5O S;  1SVQ A;  4JD2 H;  3DA7 A;  5IVU A;  1T3X A;  1VFQ A;  1T3Y A;  2NUT B;  2FF6 G;  3L50 A;  3EGX B;  4PKG G;  5KYX B;  3EFO B;  1WM4 A;  2HD7 A;  1M2V B;  1X67 A;  1T44 G;  1CFY A;  2FGH A;  2VIL A;  1WFS A;  5KYW A;  1Q8G A;  2QTV A;  3A5L S;  1D4X G;  3EG9 B;  1F7S A;  2FF3 A;  1YVN G;  1SVR A;  1Q8X A;  1AK6 A;  4KEE A;  1NPH A;  2FH4 A;  3EFO A;  1EQY S;  2FH3 A;  3FFN A;  1RGI G;  1HQZ 1;  3FG6 A;  2L72 A;  1P8X A;  1UDM A;  1M2O A;  5KYW B;  1ESV S;  3CJB G;  2W0I A;  4LIZ A;  4CBW G;  3EGD A;  5HVK D;  2FH2 A;  5A1M A;  1CNU A;  3Q2B A;  5DD2 A;  5KYY B;  1H1V G;  1M2V A;  1C0G S;  5FAE A;  5KYU B;  1V6F A;  1MDU A;  2LXX A;  1J72 A;  3A5M S;  3EGX A;  5KYX A;  1P8Z G;  3EH1 A;  1SVY A;  3DAW B;  5KYU A;  5HVK B;  2VAC A;  2I2Q A;  1PD1 A;  3EG9 A;  4KED A;  1JHW A;  4S10 C;  1TMW A;  1WNJ A;  5FAF A;  1C0F S;  3CI5 G;  2XFA A;  3FG7 A;  1M4J A;  2MV2 A;  4PKI G;  1TVJ A;  1AK7 A;  1KCQ A;  2LJ8 A;  1COF A;  1QPV A;  1NM1 G;  3FFK A;  1DEJ S;  3EGD B;  3CJC G;  3TU5 B;  1T2L A;  3EH2 A;  2NUT A;  1PCX A;  4KEF A;  2VIK A;  2XF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...