2VIRB

Influenza virus hemagglutinin complexed with a neutralizing antibody
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
221
structure length
221
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFLLISNGVHWVRQPPGKGLEWLGVIWAGGNTNYNSALMSRVSISKDNSKSQVFLKMKSLQTDDTAMYYCARDFYDYDVFYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN (IGG1, LAMBDA)
publication title Antigen distortion allows influenza virus to escape neutralization.
pubmed doi rcsb
source organism Influenza a virus (a/x-31(h3n2))
molecule tags Complex (hemagglutinin/immunoglobulin)
total genus 35
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2virB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2virB01
5KVMC 3FB8A 3TBTA 1MCOH 4I8DA 3REVA 4HWNA 1NDGB 4WTZA 2HFGH 4EUPB 1GC1C 3F7PC 1S5IH 3MOAH 4LP4A 3O0RL 4EVNA 1ROWA 4CKVX 4XNMB 3TWCL 2WQRA 4ODVL 2DM4A 4NZJA 1IL1A 3AU1B 3LB6D 1KB9J 4GW5B 1X4ZA 3CK0L 2FD6H 1P7KB 5FO8B 2GFBB 4P46A 3OX8A 2VDQL 5GRYA 4AEHL 3KYNB 1VHPA 5E6IB 1BOYA 3PWNA 4X7DC 4NFDA 4KWUA 5FO7A 2BNUB 4KFZC 5F9OH 5ESAB 1B0GB 4R4NC 1MQKH 4HXAH 2QBWA 3PV6B 1E6OL 3H3PH 5AZEH 1AD0A 3D2UD 1U91A 1N59B 4YHPB 1JTOA 3IU3A 4KROB 5IJKC 3WL9B 4PJDB 1QKZH 1S7QA 1Y0LB 2GY7B 3HUJF 3VE0B 2VRAA 1BQSA 2ZCHL 4MZ3A 3VCLB 2A6KB 2KDGA 3GHEH 1QFUH 1RK0B 2JLLA 3TBSA 3HRZB 3LY6A 1ULVA 2CK0H 1CDUA 5EZOL 5DJYA 2X1OA 1AY1H 3FMGH 1VGKB 4XP5H 1AGDB 1H8OA 1EHNA 1B2WL 3LKRB 4X9FA 3RAJL 4OGAD 4HEME 1U8IB 5E5MA 2MKWA 3BN3B 1GHFL 4KMTH 2Q3ZA 4FRWA 2Z91A 4C56A 5CWSB 4W81A 3AAZA 1JV5A 5DRXA 2HVKA 15C8H 5CZKA 3W5NA 1NC4A 1KB5B 3A6CH 1OW0C 4MNGE 2ADJB 3BWUC 4P2OB 1IGYA 1EAJA 4OZHE 1YNLH 3VXOA 1UB5A 4YPGA 1ZV5A 4R7DB 5I73B 2AJVL 1EX0A 5DJ8B 1H0DA 4JQXC 5GJSH 3F58L 1KPRB 2GTZA 1ZLUH 5JR1H 2AK4E 4QOKA 1NGPL 5LGJA 3FN9A 3V52H 1VESA 4TQEL 4O2FB 3DLQR 4XPBL 4PJBE 3TFKC 3RWGA 3FB6A 2PYEA 1LO5B 1XAUA 3JV6A 4OM1L 3A0OA 4NQVB 2DRUA 3MJ8B 2CJUH 1DBAH 3GSVB 2XIDA 3JV5A 5F89A 3KPSD 4O51A 2X7LA 5H37G 2ZG2A 1JPSL 4N8VG 4M62H 3Q5YA 4JRYD 2OX5A 1SMOA 4PJIA 4RBPH 4B53A 3UPRB 1A22B 1JF5A 1R3JB 4WI7A 2WP3O 4FFYL 4R4FL 1LK2A 1CD9B 3EDFA 3IDGA 2R2BB 4Y19D 3D0VB 5DFTA 3E6HA 4W6YB 2IQAA 4HJGB 4HUUB 2DLGA 1FVCA 3W9DB 4F3FB 2WBJC 2IC2A 3KPRA 4XRCB 3RA7L 1DN2A 2Q6WA 4MDIB 4F15B 2ICES 2VLME 1U58B 4OZHF 2ZOLB 4FQJH 1CXIA 2EXWD 4KDTC 2QHLA 2R39A 2OYPA 1UC6A 3CSYA 1JGVL 3DUHA 1BAFL 2BNRE 1XEDA 3HG1A 1TENA 1N0LA 4OB5H 5IVXE 5I1IH 4PJBF 2CIIB 2WBJA 3EOBB 1UGNA 4MQ7A 3L5WA 5EFIB 1PBYA 1ZAGA 4UV7H 5JO5A 5KAQF 4BK4A 5DUBA 5GGRY 4KDTA 3G6DL 2MKLC 5FOBA 2DI9A 1BFSA 3C60D 5TQ0H 2OR7A 4U6XB 3UZVB 4WFED 3CCHA 3SOBL 2EH8H 2OZ4H 1IGMH 5C0DA 1QBLL 1U8QA 3P3YA 5I76B 4OQTA 4LQFL 3E2HB 3R4DA 2FIKB 3SDXB 5D2LB 1MCOL 3NPSC 4QRPA 4K2UH 4MA3A 5A16A 2EEDA 1S5IL 3MOAL 9CGTA 1FZMA 2IGFH 1GJIA 4FQPA 4RWYL 2ESVD 2R0WH 4DW2L 4Z9KB 4GRMA 4KKNA 3IDXH 5FGRA 2GK0B 3VDCA 1OTTD 5IVXF 4BK5A 2FD6L 5MEQB 4Z5RA 3PF2A 1EA9C 2YR3A 3ARBB 1A9BB 5J12C 1A7RH 1JZ2A 5EPMB 2Z31D 1YPZA 1MQKL 4GRLA 2ICEB 4HXAL 3LIZH 3H3PL 5AZEL 1Z0NA 2VSDA 4QRQA 5EA0H 3RI5K 3T77A 1DUZB 2R23A 4UT9H 2WUBH 1QKZL 4ZSOE 1KJMA 2HJKB 4MAYA 3HAEH 4PGBB 4PR5B 3RVXD 1HEZA 1IC1A 1T0MA 5J6HA 2YN3A 1G1YA 3GHEL 2CGRH 2CK0L 1HK6A 1BFVH 4ODUB 5I1DA 3NCBB 4D9RD 2D0FA 1FDLH 2ZUSA 3UDWC 1AY1L 3FMGL 4XP5L 4LOUC 1I1AD 1MAMH 1S9XA 4Y5YA 1BX2B 3B83A 2UY6A 3NN8A 3C5ZD 5JQ6H 3GSNB 1IC7H 3GSUA 1K8IB 4PRDA 2DM7A 4KMTL 1NEZB 5T5NG 1ZA6A 4JFQA 3VWKD 1T5WA 1S7UA 1J1OH 15C8L 3OG4B 1M05B 3A6CL 3DBXA 1RZJC 1I9IH 1U2CA 1G9MC 1YNLL 1JWMA 2Y7QA 5KSAD 4EDWH 2EXYC 1QD0A 4JHWH 2CLRB 5EO0B 3SCMB 3SY0B 5GJSL 5JR1L 2K1MA 4P0DA 3DI3B 3V52L 1IMHC 5JHDD 2D9QB 1G7IB 1X5AA 1J87A 3L1OH 3BJ91 4XNQA 4U1MB 5IFJA 4JY6B 5ALCH 5FUCC 3IDYB 2CJUL 1IQDA 1DBAL 1I8IB 5GS0D 1XCTA 1T3FA 2X70A 2R2HA 4M62L 1FNLA 1QACA 5B39A 4JG1H 1A6AB 2EYTB 1XF5B 5B21A 3WNKA 5K9OA 5CKAA 3QFDA 3EO9H 1ZHBA 2XTJB 4QRSB 3BH9A 1AXTH 5DFVD 1BMGA 3L95B 3O9WA 4FG6D 5HHPB 2YXMA 3S34H 5C09A 4IHOA 1GOFA 5HI5D 1ZHNA 4RAUB 4M3KB 1NUGA 4HS6A 1ORQA 4FQJL 4KK5D 5HYSA 1Z3GH 4YX2H 5DJ0B 2VLRE 5HHME 1N5AA 1T5XB 5I74C 1AKJD 3FOLA 1XR8A 3MRGA 1MJUH 4XXDA 4U05A 1RZ8B 1F3JB 4LFHG 4NQDE 5DMIH 2AEWA 4OB5L 4Y4KC 1U8PA 5EC1A 3UTTB 5J56B 3OKMA 3VMNA 5LCVH 4J12A 1AH1A 2AABH 5EBMA 1KTDB 3OKOA 4LVOC 3NGBB 4UV7L 1MELA 4DKEH 2FZ3B 4C59B 3BDBA 3IJYA 4ZFOB 2YWYA 1Z2KA 5TQ0L 3RFZC 1EFXA 4IS6A 2ERJB 1F6AB 5F88A 4HH9B 2EH8L 2OZ4L 5CZVL 1IGML 1KELH 3RDTA 3TBVA 5GSRA 4IRZH 1QFHA 1AGEB 4XNZC 5F7WC 1R6VA 5FYKE 3CPLA 5JA8B 1AE6H 4WJ5B 4K2UL 1J18A 3QDGB 3GJFB 3C08H 3LD8C 5E2JA 3QYCA 4PJFF 4P4KB 4CNIB 5C0BD 1ZLVH 1XGUB 2R0WL 1RUAH 4LVNB 1KBGH 1U8KA 4OCXH 2NYYC 3I2CH 1DLFH 3IDXL 3C6SB 3IF1A 4KRPC 5HHQA 3GKWL 2PW1A 3TF7C 2X4RB 4TSCH 4UV4H 3KPPB 5CBEB 5IWLC 4RRPG 4PYGA 4JAMB 4J4PC 3C6LB 3MRQB 1A7RL 2VXTH 4QGTA 4R3SA 1Z9LA 3FAXA 4OCYH 3N1FC 3ET9F 3DWTA 1CT8B 3LIZL 2AV7A 5EA0L 5GSVA 5DYOB 1FFPB 5EORH 4UT9L 3AGVA 2WUBL 4HWEH 3X13B 4YC2C 5D2NB 1XH3B 3FQWA 2CGRL 3DXAE 3P0GB 1IVLA 4J4PA 1KPVB 1MQ8A 1BFVL 4XP1H 1KEMH 3S3SA 5I19H 1TTUA 4JFXA 3GJEB 1Q38A 1FDLL 3O4OB 1WFNA 3ARDB 2APFA 3IRPX 4P5MB 5FB8B 2C3WA 1MAML 2V7HA 3ARZA 1IKFH 3MMEB 4HK3N 4XCEA 4JFDB 5JQ6L 1L0YA 1ZXQA 1JHKH 3BZDA 1JF1A 1I7TA 3CJJA 1IC7L 1S7SB 2BCKA 2J3SA 5H35B 3QEQD 1F2XK 3NFNA 1TQCB 4LNRB 2H26B 1DQJB 4PY7B 4Z6AT 3FQUA 1J1OL 4RGNB 4PPTA 3V7MA 2HMIC 2NY4C 5JLZB 2LVEA 1DR9A 1I9IL 1PAMA 4RAVA 2EDKA 1BFOA 2YUXA 4LSPH 4EDWL 3LDBB 5T5NF 1F58H 3OB0H 4JHWL 2G5BB 1LEIA 2ARWA 3QDME 1TTGA 2XN9D 4GSDH 2F9BT 4X7CC 2FH6A 5F7DB 4ELKA 5F1KC 3OJVC 3B5GA 3NCJH 5ISZD 5H37H 1G0DA 3I6KB 3L1OL 3MV9B 4KQ3H 1QQDA 5EC2A 2PTVA 2BVQA 5ALCL 1D6EA 5HGAB 3SGEH 3FZUD 5TE7H 4P2QD 1G9NC 3WJJA 5DEGB 1U8OA 4UI2A 1R3KB 4FZEH 4JG1L 3UTZB 1QRND 3TH4T 5BOZG 3L3DA 4WUUE 3VXMA 2YC1A 4PRBB 3EO9L 1NMCC 4A6YH 3MRRA 4NIKB 1OWWA 2HLAB 4NPYA 3VFMB 1AXTL 4LARH 4N8CH 2QADB 1TZHB 4X6CE 3OSKA 1U0QA 5T1MA 1E0OB 5J9PA 3LPGA 3S34L 3QXDA 2XZCL 2YPLB 3BD3A 2BSSA 3MNVB 1A6PA 3CIQA 3KLAB 4MJ2A 1X4YA 1IAIM 3QO1B 1Z3GL 2W92A 3C8KA 4YX2L 2VITB 4DVRH 5M7QA 4M5ZL 4I18C 4NN5B 4NP4H 3WS6C 2W38A 1KNOB 2C3GA 5DMIL 1WZKA 1JL8A 2X4NB 3IS1X 4JJ5B 4M93B 4HCRH 5LCVL 4MVBD 2CRYA 4Q9RH 3FO0H 2AABL 1B90A 2D7TH 4ZAKC 1RJLB 4AIZB 4DKEL 4FQHA 4JM2A 3T08A 4RX4D 4NQUA 3F7QA 2F5BH 5IHLB 4I18A 4QXTB 1HNGA 3WS6A 2CO6B 1A21A 1D9KC 1HXYB 2V2XA 5D7JD 5F1IB 1HHIB 5F72S 3QUMB 4OZFB 1CFSB 2YD8A 3NZHH 3S5LA 3FFCD 1BQHB 4WI6A 1KELL 3SJVE 3TZVA 1AXSA 1ZA3B 3SDDD 5C9JB 4UNUA 2O5XH 4IRZL 3B4NA 4QHNA 4X6CF 3BISA 3MRDB 1HHKA 1Z0MA 1BZ9B 1JGLH 5FDWB 4LLDB 4PJCB 3RGHA 3AREB 4OGYH 1IFHH 3ARFA 5AUMB 3F6LA 4CN1A 4Z78A 3C08L 5KZCB 1D9KA 1AD9B 3HMXA 2GJ6D 3C5SA 3VXSA 1A3RH 3OJDB 4Y8AA 1IAOB 4KK6D 2IQ9H 1N6VA 1KBGL 2E3VA 2ZUUA 3EDDA 3IKCB 5DVNA 4OCXL 3S4SA 1MY5A 3TN0B 3I2CL 4DKDC 1DLFL 1V3JA 4L4TE 3D69A 4ZUSA 4H0HB 1A7PH 5KSVB 4M7JH 4TSCL 4UV4L 4LL9A 3BEWA 3GMNB 4WO4B 1H5BC 5CJXC 1BVKB 2HJLA 3MRLA 2PKDA 5FYKH 4UUJB 2CRZA 3BZFB 4GG8A 4OCYL 3S88H 2VDKH 3DV6B 1JGUH 5HGBA 3HZKA 1HDMA 1CFBA 1J05A 3R8QA 4GUPB 5IW1B 1LMKA 4XVUD 5EORL 4HWEL 2XZAH 4L8BA 3UX9B 4GQPH 1VACB 1HCFX 2C9AA 1S7WA 1H5BA 5CJXA 1J8HB 2DMBA 4XP1L 5I19L 1KEML 4L9LC 3GSRB 4CU7A 5I1EH 4BSWB 4W6XB 4JFFD 2QQKL 1HHHA 1LNUA 4FTVA 3JTTB 1IKFL 1T1WB 3UJJL 4PP2A 2LU4A 1A7BA 4OAWB 4G8GB 3MRCB 4NYLA 1JHKL 3QH3A 5D7IB 2R4SH 2X89D 3D39D 1NFDA 3H9HB 3D18B 3HS0B 1ZHKB 2NX5E 4LCUA 4UZGA 1S9VB 3DETC 1QBMH 5CHNB 2WK2A 3HCVB 3EYFB 5T1DH 2OJEB 5INCA 4V1DA 2JELH 3O4LB 3UYRH 4LSPL 3VGDA 1F58L 1ZS8A 1ZVHA 2X1XR 4GSDL 1UZ8B 3B9KC 3R8BB 5C0CD 1H3PH 2ARJB 2ATPA 4Z7UA 3D0LA 3BGFB 1XGPB 3LCYA 1CVRA 4LEXH 4F8TA 1QSVA 3U46B 3QFJA 4KQ3L 1ZLVK 3LV3B 5KS9E 1WBYB 4U49A 1GIGH 1CLOH 4YIQA 1DVFC 5TE7L 4PGDB 5T1KA 3FRPA 1GC1L 5FYJD 3O3DA 4FZEL 4NNYA 5ERWA 3LRHA 3TGXA 3HUJA 1AQDB 2XRAH 1IM9D 3I85A 5ILTH 3MOQA 4MXQD 2A6IB 2OSLA 3MLTB 1FL5A 4P4RA 2Q86B 4LARL 4UNTA 5B22A 3FT3B 1AC6A 4XCFH 5A3ID 2EO9A 1FZKB 5H2BB 4ODWA 4G6MH 5DMGD 4ZXBB 4RGMB 4MHHI 4XZUB 3BRGC 4MNQA 2WIIA 1FPTL 1DVFA 3LPFA 5H94A 4NQEB 3M45A 4ZTOH 3ROLA 1ZGLB 5K59E 4UDUA 5KVGH 4WNQB 1P2CA 3NIDF 1DCLA 5E0QA 5J0BA 4QRUA 1D5MA 3SKOB 3FO2A 4DVRL 4Z0XA 1IM3B 1CE6A 3PL6D 4NP4L 3D85D 2WINB 4X7EC 5IEHA 4HC1H 4PJEE 1NUFA 4N0CC 3EFDH 3C09B 5D1XB 1FORL 5BRZD 2W0FA 1IEBA 1WCBA 3DGGB 1TVDA 25C8H 2VQTA 4HCRL 4MJIB 1UQSB 4LSSH 4KKBD 2YSSA 4Q9RL 5EOTA 3FO0L 3MJ9H 3PXHA 2D7TL 2D3VA 4NO3A 5JUEH 1T1XA 2WIMA 2XXMB 2F5BL 3V8OA 3HI6H 2G60H 4NC1C 5BVPH 3OB0K 6CGTA 5IG7A 1PLGH 3NZHL 5DJZB 1UH4A 1RZKC 2ITCB 4PP1C 2F54B 3GUTA 3RBSA 5IEKA 2O5XL 1RJYA 5E5RB 3CLFH 4FNLL 4ZPTB 4FQXD 1JGLL 1CD0A 3O8XC 3RNQA 3OR7B 4G9FA 4WFGE 3HHRB 4OGYL 1IFHL 7FABH 5K59F 1BPVA 4ONOA 5TDOA 3TIDA 4F7CB 3UTSD 1YMME 3RWFB 2ZUQB 5L2KD 4NWTH 2AXFA 5C08E 2JB6B 3KJ4B 4PRIA 1A3RL 3CH1A 1P4BH 4CJ1A 3FRPG 2E8ZA 1PSKH 4AENB 2CIKB 2IQ9L 2XV6B 2AXJA 3W82A 3ULVC 1U3JA 1BD2D 4PJEF 3ILQD 4OF5A 5C0FA 1BJMA 4N0YL 3WHXA 5EZLB 1A7PL 3RQ3A 3SKMB 3X11A 4M7JL 5HYJD 2ED7A 4X99B 4X6DE 3FT2A 1NC2D 5C0ND 3U7AA 5FYKL 3BZ4B 1U2HA 2XQBL 1A7QH 2VLJB 4CVXB 1YEJH 4P57B 3S88L 3RGVC 2VDKL 3LKSB 5IM7A 5CGYD 1X3DA 2A74B 1WZMA 2NNAB 1ZSDA 4KHXH 4WV1C 2P49B 2G2RA 2XT1B 2VDMH 2XZAL 4XTRD 2FNBA 3LEVH 2XQYG 3LKQA 5DJ6A 2ZJSH 5CEYA 1AC0A 2HT4C 4LLMB 3MGOA 2C4XA 4JKMA 1UWXK 2NXYB 5EOCH 4HKBB 5I1EL 2BNQB 5EU6D 2Y6SC 4Y5XA 2AEIT 4HDIA 2BY0A 3K4ZA 2V7NA 4XCYB 5EIQA 4PREA 43CAB 5HY9B 1CFNA 4ZPVB 3QDAA 4DN3H 2IANB 2R4SL 2PW2A 5I1AA 5AAWA 5BS0B 3HI1B 1QSEB 1P1ZB 2P5ED 2V5YA 1QBML 1QFWM 3QJFB 5C0IB 1II4E 4BFGA 5T1DL 4L1HA 3HZVB 2LU3A 4JY5H 2JELL 1X5JA 1RY7B 3UYRL 1NBYA 3MV8D 2BVEA 2JE8A 1AGCA 3PWPB 3QBTB 4E41B 2UY7A 3PWUB 4MX7B 1F00I 1H3PL 4YDLB 1S7VA 2DLFH 2O5YH 2UWEA 5SWZE 5GRXG 2GAZB 2LU7A 3CUPB 1CQYA 4EI6A 5D5ME 5E70A 5IMLB 4MJ6B 1GIGL 2Z8RA 1CLOL 3FONB 1UKSA 2YA0A 1S78C 3MRMA 1FYTD 5DHVB 1NKOA 2XRAL 2DTMH 4XHJD 1KXQE 5ILTL 5D7SH 5DVLA 3DHMA 4XCFL 1K8DB 3ZDZE 4JPIB 2G75B 4G6ML 5E2VH 2PYFA 1MF2H 5FYLD 3MZGB 3EZ8A 4R0LB 4HKXB 2XWJA 4RSVA 4ZTOL 5KVGL 3AM8C 2N1KA 5JXED 1YY9D 2IADB 2BOCB 4YHKH 1CFTB 2A0LC 4P2RE 1MFNA 4YLQT 1VFBA 1QVOA 3VGEA 1YUHA 4HHAA 3NA9H 2QLVB 4KI5E 2EYRA 4ZDHB 4G8EB 3EFDL 3TLRA 1U93A 4G43B 5DRZB 3RZCC 3T0EB 3T0WA 4QLRA 4HPYL 4IOIA 4Y1AD 1FVDB 25C8L 2NY0C 4PJGA 3OG6B 3FB5A 5HDQH 3WFZA 3VXRA 4LSSL 4LDOB 3MJ9L 3MRIA 3AM8A 3HC3H 3BQUB 2VR9A 4HFUH 3V5KB 3PWVA 4JANA 5EUOB 5JUEL 3ZHKA 2MHAA 1EXUA 1BREA 3INUH 4Q97A 2W65A 1FG2A 3HI6L 1F6LL 3VWJC 2G60L 3QG6A 5BVPL 4R2GD 4JO2H 1S8DA 2FCBA 3DUUA 3D3VD 1PLGL 5BQ7B 2D4FA 5JOEA 1ZLWH 3RZCA 4HFWA 4OZ4A 4KZEH 2DB8A 1IAKA 3QJHA 3VXUD 4I0PD 5HHOA 5GRUH 1M7DB 1QG3A 1DZBA 4M7ZC 3CLFL 3T8XA 1RZJL 1G7HA 3U0PA 1T4KB 3V9FA 1URLA 3OF6D 2GEEA 4IMLA 2RBLA 1RZIB 3H3KA 1D5ZA 7FABL 1EO7A 3QQ4A 1ODAA 2IPUK 4PJ8C 2CKBH 5HHNA 4QWWD 2HT2C 4OIIH 4OLZH 5GRVL 3VWJA 4NWTL 2OL3A 1HXMB 3H2WA 4L3EA 1P4BL 4HWBH 2VAAA 1S3KH 4KI5F 5D9SB 3O6FB 1I3UA 2FR4B 1MCEA 3BGMA 5J13B 1N0XH 4OD2B 3MZTA 5E4IA 1XIWD 5EZJA 4LKCA 3ESUF 5IVZB 1FNAA 1PQZA 2L0DA 3GMOA 2V17H 3OKKA 4M61B 4QO1A 3VFTA 2ZSVB 5ITFB 1A7QL 1XGYH 3N9GL 1YEJL 2E5EA 1KG0B 2ZSWB 2Y1VA 1U3HA 2IFGA 5DD6B 1JGDA 1RJCA 4PRHE 4KHXL 3RL2B 3SGEI 4ZTPH 2GUOB 4HMEA 2VDML 3MRHB 2VXVH 3FJTA 4WI2A 3LEVL 2DIJA 2FWOB 2ZJSL 2L7JA 2PXYD 4XMLH 3FFDB 5EOCL 3LKNB 5AG9A 2EDJA 4IMKC 3QIWB 4EQ2A 4WU5B 3MFGB 5HHXH 4NC1E 4UIMA 2HFFB 1C1EH 4MMZC 4Q2ZB 5E00B 1A14H 3K8KA 4OI8A 2EDQA 5EUKA 5CAYB 1H3GA 3JWNC 2H3NB 1K5NA 5DHYA 1KCLA 5CSZA 4DN3L 1MRDH 3U0WH 4TUJA 3DI2B 3QQ9D 1H3XA 3G6JF 2C1PB 3QP3A 2JKXA 4IMKA 4LSDA 1RJZA 4TNWF 4L4VA 2VN7A 1NCNA 4A2MA 2EDLA 2V2WB 1XF2A 1QLFA 2AJ3A 2DLFL 2O5YL 5C0AA 1OLLA 5T3ZD 5D6CB 3CX5J 1JNHA 3RWHA 2UYLB 1OGAA 4KGLA 1F13A 4NM8H 4PS4H 5SWSB 1INQB 4FXGA 4NO0B 4Q74A 2YN5A 1MWAA 4LCCB 1DEDA 1KIPA 2IBGA 2IH3B 3KYOB 2XFXB 4FMKA 5GRWA 3MC0A 5D96B 5DQJB 1N6QH 1JTPA 1CDJA 1BZ7B 4M03A 4NRXA 3KDMA 3QPXH 1H15B 4M1DH 3SN6N 4M6AA 2N7BA 3SQOH 2DTML 2X5PA 3G5VA 4P59H 5D7SL 4CU6A 2WWMD 5BZWB 3V5HB 3V5DB 5BV7B 5ANME 2BSTA 4X6EB 1CICB 1CYGA 1SJEB 5IGXH 4OQ1A 4FQLH 1CGWA 5E2VL 2R1XB 1PKQE 1MF2L 5L9DH 4J2XA 4LGRB 4N0RA 4K9EC 3QZWA 3QUKA 5C70A 4NC0B 4N9GA 5DC0A 2DKSA 5I16B 3WIFA 2JJUA 3CFDA 4I4WA 3TNNA 4M8QA 5ESVA 4RFEA 4YHKL 2NY2B 2FLRT 1H3TA 5FKPB 5JOFA 3QPQC 3CMGA 1WFUA 2CLZA 3QAZC 3IJHB 4S1QH 5J06A 4ZQKB 2DDQH 4MD0B 3L3GB 5B8CB 3PWJB 2VQ1A 3T65A 2NZ9D 2XI9A 4HWUA 3U4EB 2VLLA 4O2EA 5HDQL 2JK5A 4MGXA 5JPNA 2PF6A 5IB1A 3RWCA 3HC3L 2Z93B 2SEBB 1A47A 4HFUL 5IVNA 3VFWB 1GCFA 1MCKA 3LN4B 2BVYA 1X5YA 3INUL 3DIFB 3IDIB 4U1HA 4U1NB 3RWEB 4FABH 4JFOB 2C3VB 1WIUA 3UBXG 3ULSA 1JZ8A 4U1GC 2P8LA 1J0HA 3D2UA 2FHCA 2Q1EA 3C8HA 5C7XH 4KZEL 4OGAC 2D7PA 1Q9WA 3C9NB 1A2YB 2EIZA 3TT3H 4HIHA 4WHDA 4YBQD 1OF2A 1U3ZA 2M2DA 3VI4E 1C5DA 1H3VA 1M71B 4JZNB 2ENSA 2CKBL 3MA7A 3U9UA 1UWGH 4OIIL 2X9XA 4OLZL 3NBNA 5SX4H 2FO4B 3W9EA 4CVZA 4NNXA 4HWBL 4MZ2A 3ISWA 3NAAH 1S3KL 3WV0A 3RHWF 1SYSA 4FZ8H 3RL1A 2P5WD 3CFCH 4I0CC 4JFHE 3WO3B 1N0XL 3G5YB 1EFQA 3GIZH 3PNWA 2AK1H 1EO8H 3O3AB 3ZT7A 1JP5A 4Z7WE 1JK8A 4U1JB 5C0EB 1RK1A 2A83B 4ZOAA 4QT5A 3ZO0A 1XGYL 2F74B 1MCBA 4NC2B 1XF3B 1OTUD 1PJ9A 4JZJA 4XBPB 1LO4H 2HN7A 1K9TA 3A6OA 4XAKD 4Q0XH 3MROB 1I7UB 4U1IB 1EBPA 3DUSB 1JZ7A 3DROB 5D7LB 2L4OA 4ZTPL 1HZHH 1T1ZA 2X4OB 2I9TA 1KJ2H 2VXVL 1TJHH 4LPCA 2FRGP 1JFQH 2X4SA 3S36X 3OXSA 4UAOC 4XMLL 1JMZA 4HC1A 1G6RA 5A40E 4UQ2B 5D1QB 3QIBB 4WW1B 5HHXL 3VI4F 3BX7C 1C1EL 2DS4A 3KPSA 1A14L 1IGIH 1QEWA 1U9KA 1OD9A 4JRYA 5L2JA 3QNXA 4E5XA 3QXUA 1VA9A 1QBBA 5CP3H 5D93B 5T1LA 3I6LD 3FB8B 4WIQA 5F6HI 2EXWC 1JZ4A 5F7KC 3REVB 1MRDL 5E8PA 4HUMB 3U4AA 4UDTA 3U0WL 5K9QG 3H7BA 5AWNH 1XCQA 5FA4A 1FZJA 4Y19A 3WHE1 3KXFD 2HWZH 5J3HD 3NABH 2QSVA 1MRCH 4HIJA 1XF4B 4EVNB 4ZUUA 4WI9A 2DKMA 3I50H 3PQYD 4XAWH 1IL1B 4Z7WF 1G7MA 2HLFC 2AJSH 4N8VB 1JI2A 2A9MH 4P46B 2Z8VC 3H9SE 5F9DC 2ORBH 4UINH 1FNEA 1HHGA 3GSOA 1RZGA 4YHIB 4KJYB 5FO7B 2XY2A 4NM8L 2YMXH 4PS4L 2XWTB 3QWRD 3LQAC 1ND0A 4GW1B 3RVUD 1AD0B 3QHZH 3IU3B 3RWJA 3EUUA 1N6QL 5FO9A 4R8WH 4P3WA 3QIUD 3HE7D 1LE9A 3CFBA 1S7QB 1FLTX 4ZD3L 3ZE0E 3QPXL 4M1DL 3IFLH 3SQOL 2M26A 3OXRB 1LEGB 3BRFA 4L8CB 1SQ2N 4P59L 3KPQA 2VLKE 3C60A 3B5HA 3WHE0 1A7OH 5DJYB 5IGXL 1N26A 3MUGA 4FQLL 1EPFA 5L9DL 4PRAA 4GRWE 2EICA 4PJ5E 2QTEA 3RTQA 3MLRH 5C07D 4G7YL 5A1AA 1BQLH 1JPFA 1YEFH 2EKSB 2H6PA 1JPST 1J1PH 4J3WA 1NMBH 1SM3H 1JV5B 3B5TA 1JBJA 1LGVA 2HVKB 1NCTA 2MQ0A 1NC4B 2Z31C 1F8TH 2K9UA 1NLBL 4HXBH 2LTQC 4WHTA 4S1QL 1IGYB 2DDQL 3RX7A 5INDA 1Q9LA 2NCMA 3O6LH 2ESVA 5KSUA 3VU2A 1XGRA 4JB9L 5F1OB 4AH2B 2R1YA 3HPLA 1JNNH 2GTZB 1FCGA 1ETZB 4XNYH 3RVXC 5EB9A 1UACH 2FECL 5I1LA 1HSAA 3IDNA 3FB6B 5AAMA 3JV6B 1ES0B 2Z31A 3LH2H 4FABL 3QDJD 4F8QA 3ZE0F 3FTGB 1JVKA 3P9LB 1HH6A 3FQXA 5F89B 4O51B 3C5ZC 5F6HJ 5C7XL 4FFZH 4H1LG 1FV1A 4PJIB 1IGJA 3GM0A 4LHUD 4G8IA 1JTTA 2DYPB 1YNTB 4GRWF 4JDZA 4JR9H 3VWKC 4ZO7A 1LK2B 1WIOA 2DBJA 1MAKA 2XWBA 3IDGB 4JGJA 5FDYA 3E6HB 2IQAB 3DYPA 3M1BA 3WSQH 1UWGL 4J3XA 1GXEA 4YK4C 2O5ZH 4DZBA 4HGWA 1I1AA 4K3GA 3KPRB 4ZFFA 3E3QE 3C5ZA 2Q6WB 5IB5A 5GGTH 5IQ9A 3NAAL 1A1NA 1ZANH 4FZ8L 3X14A 3CFCL 2AXGA 3VWKA 3GIZL 4ODXA 2AK1L 1EO8L 5JW4R 4C56D 4ELMA 4HIEB 1IE5A 3VMPA 8CGTA 3MUJA 4G6JH 1G0YR 5GS0C 2W1NA 4K55A 4RWHA 5B38A 1KF9B 5KSAA 3SHSA 4PJHA 1LO4L 2WBJB 1OOAA 4Q0XL 4MQ7B 3JVGA 5EBLA 2ADIA 1DDHA 3GMRA 1HHJA 1HZHL 1NQBA 3BHBA 5DUBB 3TESA 1KJ2L 4TSBH 4BQ9A 4Y16D 1YEDA 4QOKD 4BQBA 4KKLD 1TJHL 4X7SH 5FOBB 3SKJL 1JFQL 3K4DA 1V3MA 4FG6C 5F7EH 2PYED 2X10A 1B3JA 5AYUH 1NH6A 4OF7A 2ITDA 1U8QB 3ZE2E 4JN2A 3CDFA 1N8ZA 2YD9A 1IGIL 3QHFH 3F6IA 5HI5C 1WBXB 4HWZA 1F6FB 3EOAB 4GBXC 4XVTH 1F90H 5E8DL 1I8MA 5TGBA 1W72A 3W0WE 1S9YA 2IAMD 3HC0A 4BFBD 3IVKA 5AWNL 4MA3B 5CMAA 3HA0A 3UTPE 2HWZL 3GSXB 1FZMB 4MNHA 3NABL 4JKWA 2Z92A 2CMRH 4KK8D 3I50L 1BF8A 4XAWL 4L1DA 3K7UA 2AJSL 3BIBX 2VMFA 5LBSH 2A9ML 3I02A 1I1FA 3LQZA 3SDAD 4Z5RB 2ORBL 5L7XH 3NPSB 2AP2A 4WDIA 5CZXD 4NCDA 1J10A 1AKJA 4NM4H 4APQA 3B2VH 4LASH 2YMXL 1YPZB 1ITCA 4Z7NE 3M07A 4JG0H 5EOCJ 3QHZL 3GSWB 1H8SA 3HG1D 3J8F7 4QRQB 4R4BB 1DQTA 1FBIH 1NFIA 4U1KB 2YUWA 4Y5VC 3T77B 2R23B 5IVOA 4R8WL 1R5WA 1ZLSH 4PJ7E 1KJMB 1HEZB 4LLQA 3ZE2F 3GMMA 4HS3A 2E9IA 5J6HB 3IFLL 3V6OA 3CFJB 3PIQA 3SGKC 3S36L 4NOBA 5J12B 5I1DB 1YDPB 2C4FT 1A7OL 1IBGH 1JN6B 2XQYK 3L5JA 1AO7E 5CSBA 1S9XB 4WFFE 3O45A 3LMJH 4W4OC 5FAAA 1TVBA 3NN8B 3BPOC 4KV5E 4KI1A 4UOW1 3MLRL 1X7QA 4Y5VA 1KLUB 1GGIH 1BQLL 4PRDB 1LD9A 3L7FA 1YEFL 1J1PL 1NMBL 1SM3L 4JFQB 3TYFA 3QT2A 5CD3B 2FIRT 1S7UB 1BEYH 4X6CB 4TNWK 1F8TL 5FK9B 3SGKA 1KIUA 4S1DD 4HXBL 4GG6A 3NACH 5C0BA 1JWMB 3S96A 2VWEC 4QY8A 4W4OA 1NPUA 1Q0XH 4H26A 4GMSH 3ULUD 1JNNL 2V5RA 4Z7NF 1B4JL 4XNYL 4PD4K 4JO3H 4GRWH 1UACL 2WZPD 1F2QA 2YD3A 5C0JA 4XNQB 1HINH 1CDCA 1T03L 5IFJB 1I4FA 4PJ7F 3LH2L 3TJHD 4UIKH 5I8CA 1IQDB 3BKJL 4WI5A 2I07B 2VAJA 2P1YA 2Z4QA 1XCTB 4PJDF 4WFEE 3UXFA 5D7KD 1T3FB 1IJ9A 4QRRD 2X70B 5DJXA 1A5FH 1F5WA 2R2HB 1NANH 4FFZL 5B39B 1Y6MR 4UOW0 3H42H 3RIAF 3Q0HA 5K9OB 3VG0L 4JR9L 1NBQA 1ZHBB 3DPBA 3BH9B 3DX9A 3MODH 4DGIH 2YRPA 3BUYA 4QYOA 3WSQL 3JWDH 3O9WB 3SJVB 5GS2H 5GGVY 4OZGA 4P4KC 2VSCA 5C09B 3EOYG 5GGTL 1Z9SA 4IHOB 1OAUH 5EH1A 1ZANL 4HS6B 3IDMA 1ORQB 1C5CH 2DI8A 3QEQA 5HYSB 3DURA 1X5HA 3MV11 2MCPH 2VERN 1XR8B 3MRGB 4ZOEA 3UJIH 1FGNH 5DC4B 4G6JL 1AJ7H 2X40A 5EC1B 1HH9B 4KDVA 1HQ4A 2DWEB 1QNZH 3OKMB 4KMQA 3WXVH 1ZT1B 5I8KH 4AK1A 2XN9A 4BSVA 5JORA 5EBMB 5DJDB 2YD6A 3OKOB 3BP7B 2UZYB 4TUKH 2ZUVA 5ISZA 4TSBL 2XNAA 4ACPA 5I74B 2JJTC 1BHGA 3IJYB 3ARWA 2BMKA 5DRWA 4MDJA 4LLYA 1X6NA 5SV3A 4NRYA 3FHAA 4HLJA 1UXWA 5F7EL 4IS6B 3LPWA 5F88B 4QRTB 4Y4KB 5AYUL 4P2QA 2H9GA 5GSRB 3QHFL 1VERA 3S6CA 2F19H 1TITA 3CZFB 1VEOA 4NRZB 4XVTL 1F90L 5ICXB 4LVOB 3CPLB 4LRNH 1KJVA 5EO1A 2CDFA 3MRPA 1EEYB 4RMWA 3SDXE 1A6UH 4ORZC 4BSJA 1T7VA 4F2MA 3JTSA 1EZVX 3VFVB 4W4NA 2CMRL 5J6GA 4PV8A 1JHTA 4MVBC 2RFXA 3FL7A 5K9KA 2BXYA 3L3KA 3IF1B 1ZWIA 2OL3L 5LBSL 2FHFA 4KTEH 5HHQB 2PW1B 2NX5B 3OGOE 4NFCA 5JHDE 1QUNA 3CFKA 4NM4L 3B2VL 3T09A 4LASL 4ZUWB 3IYLW 3VH8A 4R3SB 4GAFB 4JG0L 1UKQA 2P42B 5DURD 2ZOKB 3SDDC 4CMMA 3BO8B 1FBIL 5GSVB 3EJZD 1X5GA 4G9DA 1ZLSL 2XKNB 5DGQA 4EUPH 4X0KB 3V4VH 2BFVH 2CO7B 4LCWD 4KRPB 1J8HD 1MI5D 4X4XA 4RX4A 3FQWB 3GMQA 3T0BA 4LPUA 5KS9B 5DA0B 4IRSD 4TPRH 3DV4A 3H3BC 5F9WC 5D7JA 4JFXB 4YHOH 1IBGL 4JQIH 1CXKA 1OB1A 2LABA 4NKIH 2V7HB 4NQSA 2DM2A 4KK6C 3HPJA 3LMJL 3SDDA 2AJXH 2FO1A 3SDXF 4XCEB 4HKZA 2NY5H 1I7TB 1GGIL 2D7OA 2VR5A 4TYUA 3NFNB 3K0WA 4M4RA 4YC2B 3FQUB 1BEYL 3I3DA 1YY8B 2OP4H 4JFED 4GXVL 3PWLA 5IUSA 4N0UA 1VSCA 1S7XA 3AS0A 2GJ6A 3NACL 1MJ8H 1BFOB 3DOSA 1KIRA 3MV7D 4PLOB 1LEIB 1Q0XL 4GMSL 4XVUC 4Z7VA 1EGJH 5I15L 1CGUA 4JO3L 1UB6A 3DTXA 1UM4H 5KSBA 1HINL 3R06B 3DVFA 5HPOA 1QQDB 4H1LH 2BVQB 3U36B 1D6EB 4X9GA 4UIKL 2NY4B 1REIA 3GEWB 3LKOA 1U8OB 2DKUA 1A5FL 2KBGA 2Y23A 3D1MC 3DX6A 3F62A 4K94H 4Y4HA 1HOCB 1P84K 3DRQA 5F9JB 4XT1C 3H42L 1MWAL 1L7TH 3L3DB 1L6XA 5CINH 3VXMB 2YC1B 4ISVA 3BRDA 2JJVA 3MRRB 5DI8B 4ZXBD 2Q7NA 3MFFA 2DOCA 3MODL 5DD5H 4DGIL 5IMMA 2XG4A 5JW4N 4NQED 5F6IC 4YHNA 5T1MB 5DJ2A 3TBWA 5J9PB 2ADFH 5E9DD 2H32B 4P2CG 2BSSB 5JXAH 3AMLA 1OAUL 3LQAH 4MCYA 5FM4A 1KACB 1C5CL 2QQLH 1MCLA 4JM4H 2X89A 3D39A 4F33A 1ZT7A 3C8KB 5HBBA 4NHCH 1CK0H 4GAYA 2MCPL 2NXZD 1NMCB 4HQQH 2A6JA 3NH7H 5JQHC 4PBVC 1RAMA 3P4NA 3UJIL 1FGNL 5C08B 3MTRA 1AJ7L 3DGCR 1A64A 1C12B 2I60H 2X4TB 1QNZL 1R5IA 3WXVL 5I8KL 4ZG1A 3OAZH 5C0CA 2PO6D 4GT7A 3DRTA 3KJ6H 3UTTE 2XA3A 4MXQC 4X6DB 4L9DA 4TUKL 4JM2B 3IGAA 1WF5A 2KUTA 4I18B 3C5JA 5A3IC 3VXTA 3AXLA 1V5JA 2V2XB 1AHWC 1HQRA 5DMGC 3QUXA 1ADQH 3S5LB 4AM0B 2K7PA 1FO0L 1AXSB 3U2SA 2FB4H 2J12B 4W6WB 4P5KA 4PG9B 3RUGA 1A8JH 2F53D 2F19L 1MNUH 3P40A 1HHKB 1QSFD 2KPNA 4ZAKB 3ZDYF 1IM9A 2D4DA 5LVEA 1NDMB 4LRNL 5IHZA 3PL6C 1I7ZB 2BERA 3E6FA 1F42A 3F12A 1A6UL 1D9KB 1C08A 1AHWA 1NGYA 3BKCH 3C5SB 2MOVA 1CWVA 1Z9OA 3VXSB 4WI3A 3WN5C 2K7QA 2UVEA 4GQ9H 4KKAD 4HG4K 1WWBX 2FX8H 4KKBC 3MV01 3S4SB 2UUDH 1NJ9A 2XN9E 1JRHH 3D69B 4ZYKA 4HUVA 4PJ9D 4KTEL 2FYYA 3TO4D 3W39A 12E8H 5C2UB 4XVJH 4J1UB 4CVWA 4YXHH 3BEWB 3PL6A 1AIFA 4KU1A 3D85A 3MRLB 4BFIA 5EDXA 4NNPH 3P0YH 3BYYA 4U6TA 3V6BR 5BRZA 3DX8A 2BX5A 3RU8H 3WN5A 2CDGA 5HGBB 3HZKB 5DTFA 2E27L 1HDMB 1J05B 4LP5A 3ILPA 1BLNB 2XICA 3L7EA 4BKLA 2EDOA 2B1AH 1QRNE 3MO1B 5SWZB 4L8BB 3UO1H 3V4VL 3EBAA 4UTBH 4F9PA 4OFDA 1WJ3A 1AGBB 4JO4L 5D5MB 1H5BB 3OPZH 4PJAE 4TPRL 3MCG1 1QR1A 1YJDH 4PD4J 3MRJA 2CXGA 1T0NB 4YHOL 2AJUH 1QOKA 4JQIL 4MSWA 4XWOD 4O58H 4X9HA 1LNUB 1BIHA 4FTVB 4NKIL 4P5TD 4PP2B 2AJXL 4O9HL 4MJ5B 1OP5H 3WLWD 1QTYT 1K2DB 1E4WH 2NY5L 1LILA 1G6RL 4FQXA 3T0DA 1DQMH 5GS0H 5MEOA 1NFDB 3RKPA 5JIIA 1LHZA 4MB3A 5HPMA 3B9VA 3UZEA 4LCUB 4OKVB 2YUZA 1RHHB 5C0NC 3UTSA 5EBGA 1CL7H 4KHTH 5J57B 5E8EA 4CU8A 3ARFD 4L9LB 5INCB 5CGYC 1MJ8L 3MLWH 4YHLH 3HNTH 4RGNE 4ZS6D 5F8QC 1ZS8B 1BD2A 1CGTA 1OTSD 1EGJL 5TH2A 4EKXA 1KXTB 4KKCD 2ATPB 4Z7UB 3D0LB 1UM4L 3WKMH 5HYJA 2VDOH 4UTAL 4QHKI 1CF8H 5F7HA 3FAWA 4OLYH 1U92A 3EDJA 1J11A 1TCRA 1NAMH 4YIQB 3THMH 1O5DT 1L7IH 1TXKA 2D9CA 1DBMH 3FFCE 4Y2OA 4PJAF 2Q20A 4X7TB 4F57L 3O3DB 4K94L 4NNYB 3B9KB 5ERWB 3H9YA 1Z6JT 3QEHA 4X83A 1L7TL 3U7YL 1AXIB 3VFPB 5CINL 4P4RB 1FL5B 3EYVA 1WSST 3L9RA 5CEZE 5DD5L 1TVHA 5TE4H 5HYQA 1MIEH 2GW5A 5EU6A 4DWHA 3CVHA 2B2XH 3IFOA 1KOAA 3VFGH 1DVFB 2ADFL 3VFOA 4PGCA 2HTKD 1BVZA 4RCAA 3WNOA 4UDUB 4HPOH 1WC7B 2E7BA 2WLYA 5JXAL 3LQAL 4QRUB 2VXUL 2QKIA 1D5MB 4JM4L 1WISA 2EIDA 3AS3A 3FO2B 2VKWA 4NHCL 1CK0L 2YPLE 1EHLH 4BQCA 1F4XH 2P5EA 3N85H 4HQQL 3NH7L 3T0ED 5IEHB 5CIPH 1CTNA 4HH8A 4XGZA 5IIEB 4PFEA 2W0FB 1IEBB 1WCBB 4JY4A 2I60L 4PIRF 6FABH 3UEZA 3KPOA 2YSSB 5EOTB 2XPGA 3QEGH 4K3JH 3KJ6L 4NO3B 1T2XA 2R8SH 3VRLF 1HN1A 2QQNH 4QXUH 3VGBA 5FKAA 1NCWH 2J8UE 3MNWA 2RJMA 3QFJD 1FIGH 5IG7B 3WLBB 1ADQL 2VNCA 3RIAK 4JFFE 3UTOA 4PRHB 5IEKB 2FB4L 1CI5A 5JXEC 1MNUL 1YY9C 5SWQB 2DMKA 3JV4A 2FGWH 3RNQB 3O6KH 1RZ7H 3LKPA 2H1PL 4Q6IC 1HCVA 2V2TA 2DLIA 4PJCE 3BKCL 4LSQH 1R3LA 4PRIB 3SGJC 2GQHA 3WDIA 1I7RB 4GQ9L 3FQNA 2NTFA 4WWID 2FX8L 5F1NB 3T3ME 4QHKJ 5JXEA 1JRHL 3WHXB 3HB3D 1FNFA 12E8L 3X11B 4XVJL 4YEEA 1E4KC 1F11A 4LSUH 4DEPC 3FT2B 2MMXA 4ZO6A 2ZUTA 3PHQB 3BDYH 4Q6IA 4R2GC 3IAQA 3UBXI 1W0WB 1UEYA 4NNPL 5TDPA 3RBGA 5IOPA 4Z77A 3RU8L 3SGJA 4Z0BH 4I0PC 4Y1AA 3UAJD 2J8UF 1ZSDB 2AAVA 4Y2DD 4NQTA 2B1AL 3GJFH 2G2RB 1GGBH 5I8OH 2F5AH 3UO1L 3OR6A 3HI5L 4UTBL 5CEYB 3PG2A 4XP6L 3MGOB 2YXFA 4QWWC 3OPZL 2BY2A 1CLZH 4YDVB 3GM8A 4CMHC 1YEKH 2F58H 2AJUL 5SX5K 3OAZK 3D3VA 1FVEB 4CRPA 4O58L 3VXUA 4I0PA 5IBLD 1EAPA 3TYGH 2V7NB 4PJCF 5IB4A 4PREB 3REWA 1E4WL 4TVPE 4WV1B 1R24B 4OZIE 1DQML 5GS0L 2A73A 5E2WH 1X6LA 3V0AC 4NQCD 2PW2B 3OF6A 5I1AB 2Q7YA 4G8GE 3GIVB 4ZNEE 5ANMB 2DQIH 5D7IE 4B7IA 4G9FD 1CL7L 3NCMA 5IHBA 4KHTL 4BZ1H 1PKQB 3NIFE 1G7QB 4KRLB 3MLWL 1NBYB 4YHLL 3HNTL 1BGXH 5JA9A 5CLWA 3O4LE 1P4IL 1MSPA 2BHYA 5EIIA 2UWEB 1FE8H 2WP3T 1NAKH 1XIWA 5EU5A 1CXLA 4X5XB 4WEMB 2VDOL 2DQCH 3TBYA 1CF8L 1J12A 1VGEH 2JCCA 2PXYC 1D5IL 2DICA 4BM7A 4EDXA 4OLYL 3ARYA 4CN6A 3ABZA 5K33A 1K85A 1IEHA 1NAML 4JN1H 2AK4D 2UUDK 3THML 2J7LA 4KVCH 1L7IL 3BWAA 1DBML 1JMXA 2BHZA 3FO9A 1GGCH 4Q6YA 2B0SH 2DQJH 4MQSB 4L3CB 5K9QI 5MENA 5MERB 1CICD 3QQ9C 1I85A 3P9MA 2VZTA 4W70A 5TE4L 2EDBA 1Q9KA 1MIEL 2PYFB 3NCFB 5L2KE 1SYVA 4EN3D 1HIMH 1TMCB 2XWJB 2B2XL 3VFGL 1N5YH 5D7IF 1CE1H 3PP3K 3EJYD 4HPOL 3NIFF 2VC2H 5LJYH 4H25B 2DQGH 4OBSA 5IW3A 4LHQB 1IEAA 4AG4H 1EHLL 1ZT4B 1F4XL 2NPLX 1TZGH 2R15A 3N85L 4BH8A 1U3YA 1T83C 1YUHB 4HBQA 3BKYH 2EYRB 3GRWA 3P30H 2VLMD 4JO1H 1OP5K 3SBWA 5CEZH 4IOIB 3O2DH 6FABL 3FB5B 3KYNA 5KW9H 5E6IA 4I3RH 1T04A 3MRIB 5F1SA 3QEGL 4PBWD 1YN6A 1LO3H 2Z8SA 2BNRD 2RQ8A 4K3JL 2BNUA 1B0GA 2R8SL 3P77B 3PWVB 4JANB 5D6DC 5GZNC 2MHAB 2QQNL 4Z7WB 3I75A 4FP8H 4QXUL 2W65B 1NCWL 5DD0H 4YHPA 3QG6B 1OY3B 1S8DB 3WL9A 1FIGL 3DUUB 3L3JA 2ICWA 4GKNB 4I2XE 4U33A 3RZCB 4HFWB 3QIWC 2WBKA 4XMKH 4OIBA 1IAKB 3QUZD 4FFVD 2IG2H 2VZUA 4J3OC 4ZUTA 5C6PB 2NY0B 5ESQB 4R97C 1HE7A 3T8XB 1G7HB 2PR4H 3U0PB 2F54E 2FGWL 4IMLB 1D5ZB 5D6DA 5KG9A 3O6KL 1RZ7L 5DO2C 3RI5F 3VRJB 2O93L 3LKRA 2MCG1 3IS0X 1I1YA 2X4PA 3VWJB 4JDTH 2OL3B 4KC3B 2P8PB 3MOBH 5ACMA 4LSQL 1N4XH 2OQJA 1ED3A 3ZKXC 3MV8E 5IHUH 4M1GH 5CWSA 2YPVH 4M7ZB 4ZFOL 4QKXB 1KB5A 2V5SA 4OV5A 4LKCB 3QUMH 2B5IB 4LMQE 2WUCH 1PQZB 4LSUL 4ZFZA 3GMOB 4RISH 4HJJH 3BDYL 4PJ8B 3QUYD 3KPTA 4KJWD 3VW3H 4U3HA 2EEAA 4Z0BL 5J1AA 3ZHDA 3MUZ1 1JGDB 1HKFA 3HZMB 2VLJE 3SDYH 4EI5D 1A02N 1TZIA 2DJSA 1VCAA 1LO5A 4YBQC 1GGBL 5I8OL 1FYTE 4NQVA 4OSUH 2F5AL 3VXRD 2AS5M 3MJ8A 2ZKHH 5E7FA 4EOWH 3ARGC 4QHMB 2VDQH 2ZP0T 1RIVH 2VXQH 1CLZL 1MHCB 1YEKL 2F58L 5BV7C 4UIMB 4JPWH 2OTWA 1BWWA 1PEWA 1R3JA 1E6OH 4DKAA 1NCCH 2BNQE 2H2PC 2HKFH 4XMPH 1QO3A 3ARTA 1DQQA 5EUKB 3TYGL 1V3KA 1K5NB 4R96A 5CSZB 1A7NH 2R2BA 5E2WL 4TUJB 1YA5A 5HVFB 3GBMH 4MXWH 4OCMC 3QA3A 4HJGA 2EC9U 4D3CH 2VLKB 2DQIL 4RMSA 2IANE 1CQKA 3Q3GA 3MNZA 3ZL4H 4JHAH 1QSEE 3QULB 1OTUC 3UBXB 4GRWB 4PJ5B 3G04A 3QXWA 1U58A 1WVZA 1RJZB 2ZOLA 2ZNXA 4PTTA 4L4VB 1HI6B 1BGXL 4WU7B 4Y1AE 4GFTB 3BIKB 4MS8D 1XF2B 2J8OA 2EE6A 2P5WA 3OKLB 3V6ZA 3VRIA 3UYPA 5LAXA 5C0AB 1FE8L 3PDOA 4NO5A 3PWPE 1NAKL 3AS1A 4E41E 1JNHB 3EYSH 1PVHA 4ORGA 1G7LA 4TVPH 2DQCL 1OGAB 1VGEL 1OT2A 4PRPE 1FIEA 2CIIA 4ZUVA 2FATH 1MWAB 1KIPB 5GS1C 3AUVA 4LK4A 5HI3C 4JN1L 4OTXH 1B0WA 3GMPA 2D2OA 4WTXA 5DC9B 4NBYB 2IFFH 4TOYH 4KRNA 4KVCL 5L8KB 1EEZA 4MA7H 3I6GA 1F02I 3GFUA 1GGCL 1U3HD 2H2SC 3I84A 3BIAX 2DQJL 1RUKH 3QWOB 1OAZH 1MIMH 3G5VB 1NGQH 4R4ND 1I3GL 5J3HC 3AC0A 2BSTB 2W60A 4UBDD 4MQXD 5JHLH 3BH8A 5I76A 1IZKA 5B4MD 1HIML 4K8RC 3IAPA 5GS1A 2EO1A 4BZ2H 3OKNA 1N5YL 5D2LA 1CE1L 2OR8A 2Z8WC 2VC2L 1R0AH 2DQGL 4X4MA 1FNGA 3CFDB 4I4WB 4H20L 3TNNB 4LLUA 4YR6B 5ESVB 4AG4L 1GPOH 5JOFB 1BBDH 3Q6FA 1TZGL 2CLZB 1U95A 3U6RA 3KXFA 3MBED 1JRHI 3BKYL 1FGVH 3RVUC 1G7PA 2A77H 4GH7B 2MPAH 4JFPA 3P30L 1CIUA 4JO1L 4K3HA 2VQ1B 3T65B 2C3XA 3QI9D 3ALXA 1T89C 4I0KA 4BH7B 3PQYA 5CEZL 3O2DL 2VLRD 5HHMD 1P7QD 2VLLB 3QIUC 3HE7C 4O2EB 5KW9L 2JJWA 2A9NH 2JK5B 4I3RL 3M17A 5JPNB 3MCKA 5IB1B 4MJ4A 2FJFB 1BBJA 1LO3L 4NQDD 5EPMA 1FO0B 2ICEA 2I27N 4KTDH 3BPCB 3X12A 3BXNB 4U1HB 3QAZB 5DD0L 3QWRA 2GITA 3CGTA 1JGVH 3BN9C 3D2UB 3L5XL 2Z35A 4LKXA 4XP9H 2DYPD 1NMAH 1U8MA 1X4XA 2VISB 5F71A 4DUXA 3HE7A 2EIZB 4HIHB 4AQOA 3TFKD 1LEKA 2GI7A 2PR4L 4AZ8A 2YEZA 4ODUA 5IR1A 2ILLA 4RZCB 1C5DB 5ICZA 4LLWA 4H88H 3MA7B 4WI8A 3U9UB 3MGAA 3U9PH 2AEPH 4JDTL 5T33H 5E6YA 3GSNA 5GISH 3MOBL 5IB2A 4F7PB 1N4XL 4U1GB 1FZOA 1WWCA 3W9EB 1K8IA 4CVZB 4NNXB 5FYKD 5TE6H 3QXAA 3FB7A 5C07A 1CL7I 3QCVH 3DSNA 5IHUL 4M1GL 3VJ6A 5D72H 1SYSB 2YPVL 3WXWH 1MCQA 1YECH 3PNWB 4P46C 3QUML 4KH2A 2WUCL 3EJJX 2Z0BA 1SVZA 3WE6A 4RISL 1RK1B 4HJJL 2LAAA 3V6FB 4QT5B 4NN6C 4JZJB 3VW3L 4HMCA 2HN7B 2UZIH 3N50A 4RWYH 1SY6A 2DJ4A 3SDCD 4DW2H 3SDYL 5EUOF 1T1ZB 4JY6A 4WFHD 2I9TB 5IK3B 4OSUL 5DMKA 3FRUA 4ETQA 2ZKHL 4EOWL 2CD0A 1J7VR 1I8IA 1PZUB 2X4SB 1B88A 3OXSB 4M5YH 1RIVL 2VXQL 3QDJA 1G6RB 1F3RB 2EYTA 5D71H 4JPWL 4LCYB 4JRYB 3VD5A 5L2JB 4PJ7B 4E5XB 1NCCL 5I71C 2HKFL 4XMPL 5EWIH 1I8LC 3DXAD 4LHUA 3OTTA 5D8JH 2EC9T 1A7NL 5E8PB 3L95A 2OLDA 1KV3A 3GBML 3H7BB 4MXWL 1XCQB 5FA4B 4D3CL 1FZJB 2QSTA 4Y19B 4YXKH 5HHPA 4WW2C 4UAOB 1AO7B 3ZL4L 4HIJB 4JHAL 1VADB 4P9HH 4ZUUB 4RAUA 2DIBA 2IH1A 5DD1H 1UKTA 4YNYA 1LDPH 5DJ0A 3K46A 4H1LB 1X5KA 4M7KH 1I8LA 2APTA 4NJAL 4Y16C 1F3JA 1HHGB 1Q0YH 3GSOB 3EYSL 4KKLC 1A9EB 4C55A 1RZGB 1WQVT 1TETH 4TVPL 4NJ9H 5DK2B 4S2SA 1A3LH 3STZA 1ND0B 3MBXH 3QDMD 4GW4B 4WW2A 2FATL 3U48A 1A3QA 3O3BA 4OTXL 5SWSE 4TOYL 2IFFL 3NVQA 4YDIH 4MA7L 1WBZA 2CDEA 3CFBB 1RUKL 4Y4FD 3LSOB 5HI4D 1QA9A 2IAMC 1OAZL 4Y16A 1MIML 1NGQL 1WGOA 3KPQB 4WTZG 4HH9A 3O41A 3C60B 2YA2A 5JHLL 4GKOA 5FHBH 4YE4H 2I26N 3UPCA 3EYOA 5J8OA 1WAAA 4WUUD 4OD1H 4BZ2L 1XZ0A 3K81A 4ZNCD 1JPFB 3OJMB 3SDAC 1R0AL 4JHZA 3QDGA 2H6PB 5EULV 1X44A 3GHBH 4U3XA 2IAMA 5T1LD 1GPOL 1E4XH 1BBDL 1F45A 1FQ9C 5CJ8A 1XGUA 3UCRA 4LCIL 4WHTB 3I3BA 1FGVL 2A77L 2MPAL 4PGEB 4YQXH 5KSUB 2DQEH 1XGRB 2ZG3A 5DHVH 1B0RA 2R1YB 3KHOA 1M7IA 4H8WC 3KPPA 5CBEA 2A9NL 1QHOA 5F7LB 1EO5A 4JAMA 3C6LA 3SDAA 1QPXA 1HSAB 4JE4B 1NGWB 4JKKA 1RFDL 2W9EH 3IDNB 1MY7A 4KTDL 4POZD 3O3UN 2Z31B 1Q94B 2LTQB 3GBNH 2YUVA 3D25A 1ZGLP 5DYOA 4NHUB 3FQXB 1RZFH 4XP9L 2FJHB 3X13A 3IXTB 2HRLA 1NMAL 4NUJB 5D2NA 5DQ9A 1KPVA 3GJEA 4LSVH 2WM0A 2XWBB 4S1DC 3PE9A 2BXZA 4G8FB 4H88L 5IB3A 3M1BB 3U9PL 2AEPL 5T33L 3RVWD 3B43A 1I1AB 5GISL 4S0SD 5TE6L 3QO0A 1OP3K 3PQYE 2X05A 3C5ZB 5IB5B 2ATKA 2DIAA 3ULUC 5IQ9B 5CZVH 3QCVL 1A1NB 3IETA 5D72L 1T7YA 2H26A 4PY7A 4BA8A 4F7TA 3GMLA 3NPZB 2AXGB 3RTQD 3WXWL 1E6JH 2DM3A 3LQMA 1YECL 2DTSA 2P48B 3VWKB 3F8UB 4ODXB 5CBAB 4ELMB 3TJHC 4NKDB 4POYA 4L4TD 4YK4B 5B38B 5EU7E 1L0QA 4GRLC 3WO4C 5FXCH 1RIUH 1DBJH 2L7UA 2UZIL 5F7DA 4F37K 2P7TB 3FQRB 5EBLB 2ADIB 4HMDA 1KN2L 1M7XA 3I6KA 2OK0L 3GMRB 3MV9A 3NZ8A 2C1OA 3BHBB 2YD5A 1KGCE 5JHDB 4MAYC 1YEDB 4J6RH 5BXFA 3GKWH 5D7LE 1CR9H 4HUKB 4N90E 4M5YL 5I18H 4G6FD 5MEPB 3BEVA 3UTZA 3VXQA 4JN2B 4QRRA 5D71L 1N8ZB 2PN5A 5IBTH 2PETA 35C8H 4HWZB 4PRBA 4Y5YC 3MA9H 3QCUH 5EWIL 3LAFA 2V5TA 1FNHA 2E9WA 5D8JL 1I8MB 5TGBB 1W72B 4Z76B 4LHJB 3S3PA 1S9YB 2W91A 4LLAA 3HC0B 5FEBA 3K1DA 4GS7C 4YXKL 3MR9B 1H3WM 4MNHB 5FM8A 3HKFA 4D0DB 4P9HL 2Z92B 1NCAH 2E7HA 3MNVA 4B5EA 3OKYA 3KLAA 1MREH 1UG9A 5CGMA 5DD1L 3QO1A 1OCWH 1LDPL 5AZ2H 2NX5D 4GBXB 4M7KL 3H0TB 5I1CL 3I02B 1I1FB 3LQZB 4ZFGH 1MPAH 1NAMB 2CUHA 1Q0YL 5FM5M 1AKJB 1WTLA 3TT1L 1TETL 4NJ9L 2P8MB 1A3LL 3WYRA 2AQ1A 3MBXL 4OCRH 5ACZA 4I13B 5DK0A 4D9LH 2IMMA 4YGVA 2CPCA 1NFIB 4KJQC 5I17A 4YDIL 4AIZA 3HNVH 2ZUWA 4NBZB 2HVJB 4LLQB 5DUMH 3GMMB 4HS3B 4C58B 2ENYA 3CU7A 4OZFA 3WUZA 3OL2A 3RX8A 5FV1L 4U6HB 4YE4L 5DJCB 5FHBL 4X98A 2VUOA 4NT6A 4O02H 5DS8A 1BZ9A 3O9WC 4OD1L 1X7QB 4Y5VB 4YEFA 3ZKND 2PNDA 5CIPB 2DQDH 3HC4H 1WFTA 1AD9A 3GHBL 3OAYK 1E4XL 2IPUG 1Y6NR 4U1SB 4C56E 4GG6B 1Q72H 5C0BB 3HE6D 5KTEH 3S96B 3RKDD 4YQXL 2DQEL 4QY8B 3O11B 2VQUA 2Y5TA 5BZDA 2J6EA 3EJZC 1S9WB 4H26B 4XNUH 1QYGH 3BPOB 2HG5A 2XZCH 5ID0B 5C3TA 1BVKA 5BV7H 1A1MB 4UUJA 4YUEH 3S8WA 5C0JB 2W9EL 5CJQH 1I4FB 3DV6A 4QOKE 1SBSL 4BYHA 1PYWA 4M5ZH 1KIQA 5EU3A 5I8CB 3GBNL 4APQD 3WIHH 4LBEA 4NOFA 2Z4QB 5IW1A 2PYEE 2P47B 2IEPA 1RZFL 5DJXB 4IRJD 4OLVH 4RMTA 2E7MA 1PKOA 1SHMA 1JZ6A 4PJXA 4EBQH 4FHBD 3RDTC 2AKRA 4U31A 1RPQA 1BJ1H 1VACA 4LCWA 2OS7A 1J8HA 1F3DH 1MI5A 3BP4A 3GSRA 4PJIE 2W0KA 4LSVL 3CC5A 1RV6X 3F5WA 2H8PA 4IRSA 3T2QA 4QYOB 1UADC 3EOTH 1GZPA 4OAWA 4GXUM 3SKNA 4CVUA 4OZGB 5EN2A 4ZO9A 4U1LA 2YWZA 2EKJA 3D18A 1NKRA 1YMHB 1YMMD 1EJ6A 2WWKT 4WGVB 2BSED 3KPRE 4I9WE 1E6JL 1AGFA 4JKPH 3EYFA 5C08D 2QJDA 4JFEA 4CJ0A 3CMOH 3QSKB 5DA4A 1T2QH 2DLTA 2ARJA 3SPVB 5C2BH 3FN0H 1FFOB 3V7AG 1RIUL 1DBJL 3MV7A 5I66B 5I1JH 3HG1E 1W8NA 2XN9B 1XGPA 4BSVB 5JORB 4HD9A 3U46A 1GGTA 4PTUA 5B39G 4YHZL 4K8RH 5ISZB 5GRJH 1O7SA 4J6RL 1S7TA 2YRZA 1CR9L 2BMKB 4MDJB 1MLBB 4LLYB 5I18L 2CR6A 2A1WH 4MYWB 1UXWB 4GAJH 3ZDXE 4PJIF 3TNMA 4P2QB 2NLJA 4B7LA 4KVNH 1AQDA 5IBTL 3LN5B 3EYUH 3UZQA 35C8L 4RNRB 4WUKH 4YH6A 5BO1H 3MA9L 2A6IA 1QRNB 3QCUL 4UQ3A 5ICYA 1FAKT 4ENEC 2NXZC 4EZMA 1FZKA 5IW6A 5HYSG 2CDFB 4PJAB 3MRPB 4ZXBA 1JGEA 3WKNA 4XZUA 5LWYH 4F2MB 3JTSB 4NQEA 4QRPE 5L0QC 1JWSA 3MRKA 4WNQA 1NCAL 4YXLH 5E9DA 3MLYH 1MREL 4TN9A 5J6GB 4PV8B 4CADA 2NZIA 1SVCP 1JHTB 5K9KB 2RFXB 3SKOA 2X4QB 1UVQA 2QQKH 5K93A 1OCWL 5IJVA 1FC1A 2PO6C 3R0NA 4J8RA 5AZ2L 4E9LA 3UJJH 1ZWIB 2Q76A 1LP9A 4ZFGL 1MPAL 3P4LA 2WINA 3ZKMC 5D1XA 4OF3A 2W59A 4LLVA 1V7MH 3VA6A 3N1MC 4QTIH 4KXZI 4MJIA 4X8JB 1UQSA 3T2PA 4OFPA 1YNKH 1R3HA 4OCRL 4D0BB 2GT9B 4N9OB 4URTB 4CMMB 4D9LL 1PZ5B 4LPWA 5SWZD 1YPZE 1JNLH 3WUWA 3WJJC 4OI9A 4G9DB 2PO6A 3HNVL 5DUML 4X4XB 3GMQB 5I6XC 5DJZA 2FX7H 3PABA 1ZMYA 5GGRB 1BVLB 3KHQA 3FFCB 4ZPTA 4O02L 3SDDB 1TDQA 3NIGE 4ODTH 3OR7A 4FN0A 2F53A 2VDPH 1E28B 5IMKA 4PJ9C 1QSFA 4U0RC 5DJAB 2DQDL 1GC1H 2NY3C 3HC4L 3ZSTA 4HKJA 5DRNA 1IAIH 2JB6A 3EGSB 5A43C 3PWLB 3NFSH 5F9WB 1Q72L 4K7PY 2ZUYA 2GJ6B 3G6AA 4C57C 43C9B 5KTEL 4B41A 4P48A 4LVHC 5GPRA 4NCC1 4L29A 3HLAB 4XNUL 5EZLA 1QYGL 4P2RD 3SKMA 4Z7VB 1FPTH 1TIUA 4PJ9A 3DMMD 1KENH 3TO4A 5BV7L 3DETD 4KI5D 5KSBB 2DJUA 1YPZF 4YUEL 3OKDA 4CVXA 4P57A 5CJQL 3DYOA 3LKSA 4JM2C 4YWGH 3HR5B 3S97C 4IDJH 3NCYP 2NNAA 3RNKB 5CEXB 4XWOC 3WIHL 3LKOB 2CRIA 3B9KD 2V9QA 4FMFA 4P5TC 4OLVL 3U7WL 1FORH 3WLWC 4EBQL 1F4HA 1EV2E 1UWXH 2EE9A 2VR4A 3DRQB 2NMSA 4L8SC 3TZVC 3V7AE 4LMQI 1J1XH 3CDGA 3WJLC 1UXSA 5IKCA 4ISVB 3NIGF 2J8UB 3MFFB 2RHEA 5IMMB 3ARFC 2VE6A 3EOTL 3TBWB 5DJ2B 3TA3D 4MD4A 4JFFB 1NGXB 4ZS6C 5HY9A 2B8OT 4P5TA 4OGXH 3EDEA 4N0FA 5FUCE 1OTSC 5IFAH 5BS0A 5L8LB 1NBVH 3TCLB 4KKCC 4MCYB 4L8SA 2VZVA 3D39B 5C09E 3ZTJG 1A1OA 1ZT7B 3WJLA 3RVVC 4UMGA 1FHGA 4FNLH 4JKPL 4GAYB 1MFBH 3GBLA 2A6JB 2DWDA 3N0PB 3P4NB 1OSPH 4MD5A 1UJ3C 4K07A 3CMOL 4NCC2 2LE9A 5F6IB 4MX7A 1T2QL 2VZOA 2IBBA 5C2BL 3FN0L 3H6JA 5I1JL 5C0CB 3R0MA 4OLUH 4FOMA 3DRTB 4K8RL 2NY6D 1AR2A 5GRJL 4N0YH 4C83A 3C5JB 3VXTB 3AXLB 3SE3C 1QZ1A 1R3IH 1HQRB 3FONA 1HYSC 3BUTA 1L9MA 1YYMH 4PRHD 5TF1H 2VDLH 2A1WL 1UJ3A 4GAJL 1C8PA 2XQBH 3IKKA 4EJ1C 3DVGA 4KVNL 1F4YH 3EYUL 4TNVK 2XKUA 2NY1D 5EO9B 4WUKL 5ADOH 5BO1L 2EDEA 1IM9B 1FL3A 4Y4HD 5IHZB 3QNYA 4JPIA 4P49A 3E6FB 3F65A 5CUSL 3SE3A 5LWYL 4JFEE 1C08B 1AHWB 1NGYB 1CN4A 3JUYA 4JPVH 4OBRA 3MJ6A 1XMWA 4YXLL 1E4XI 5DSCA 5KANG 3MLYL 4AMKL 2IADA 3O2VH 5JMOC 2BOCA 3KNBA 3QQ3B 3O8XD 1CFTA 4OZIB 5L8JB 2D0GA 4ZYKB 2YZ8A 2FYYB 3W39B 2X4UA 1KJ3H 4G8EA 2PTTB 3PL6B 1AIFB 2VZ1A 5EZIH 5D1ZD 1V7ML 4G43A 3T0EA 3VD7A 2KKQA 4G5ZH 3P2TA 1FVDA 3ZYIA 4QTIL 3DHJA 4OQTH 1YNKL 3DX8B 2GCYB 2VYRE 3WN5B 2CDGB 4KQ4H 3S5LG 2AQ3A 1JNLL 3ILPB 4XBEL 5JNYB 2JJSC 4W68A 3ARPA 2OZ4A 3L7EB 2E7LC 4BKLB 1PW3A 4U7MA 1ZTXH 3QNZB 5F96H 2WAHA 1S5HA 4ZOBA 3K80A 3PV7A 3RGVD 3ZLQC 1QR1B 2FX7L 3PGCA 3MRJB 2IJ0C 2WQ8A 1T7ZA 1M7DA 5ID1B 4HUNB 3OB8A 3QUXD 4M48H 1T4KA 2G9HB 4ODTL 2VDPL 2JJSA 4P23D 2E7LA 3S4SG 3HB3C 5MEOB 4Y7MA 4DGVH 2AGJH 1IAIL 1HXMA 3E8UH 3UTSB 1PD6A 2Y72A 3NFSL 5E8EB 5L2KB 2ICCA 3BSZH 1MCWM 1K4CB 3QG7H 4X6FA 3ORJA 3UAJC 4S0TD 3LS4H 4P99A 4Y2DC 4V2CB 1Y6KR 5TH2B 3ZHLA 5C0RH 4PYHA 1KENL 5ABDE 4M61A 5HYJB 1VFMA 3IU4H 4KMLB 3HAEA 3EIFA 2D7QA 2ZSWA 4NZDA 4RIRA 1NC2B 1U92B 4XP4H 5DD6A 4YWGL 3RWIB 4IDJL 1TCRB 4O4YH 5IBLC 1FJ1B 5LQBL 4Y2DA 5DT1H 2VIRA 3T04D 2GSGB 4HPYH 3MJ7B 4WWKD 5F21B 2VH5H 3BPNB 3QEHB 1J1XL 1QSFE 3HFMH 5KS9F 5IV2A 5EBWA 3TVMD 1U8HA 3GSQA 4P3DA 5C8JA 3L9RB 4Q2ZA 5E00A 1TVHB 5HYQB 1YEGH 3VXME 5KVDH 4J3VA 4I2XB 1CFVL 1N64H 3CVHB 2E6JA 2GSIA 4OGXL 1V3LA 3VFOB 4PGCB 5IESH 5IFAL 1NBVL 4Y8DC 4FXKA 32C2A 2QKIB 4OV6F 4NQCA 2WBWB 3T4YB 2C1PA 3VFNA 1RZJH 1CDIA 1MFBL 2P5EB 1G9MH 4NSKB 3UTQA 3DO7B 1OSPL 4XGZB 4DOHE 1CDGA 1T20A 5I2IA 4PBXA 3MV8B 3G5ZB 5DWUH 3KPOB 3GO1H 2V9TA 4AEIH 2XPGB 1VEMA 4OLUL 4MNGA 1DEEA 4OZHA 4H0GA 4KJPD 5H8DA 4LCCA 5HVWA 4LRIC 5FKAB 3F7YA 3MNWB 4E0RB 1R3IL 3KYOA 2XFXA 1JI1A 2F8VA 1YYML 5DQJA 1FFNA 1Q8MA 1J0JA 2VDLL 5TF1L 4EN3C 1RSFA 2AK4A 5IMOB 2RR3A 3EJYC 3N9GH 5JW5A 1FL6A 3MYZA 1F4YL 4PJBA 4Y5XC 4XCNB 5ADOL 1NSNH 1FYTB 4EQ3A 2VO5A 3V5DA 3V5HA 5DMJB 5F3HB 1CICA 1SJEA 2ADGA 3LKPB 2WWKO 2OXGA 2V2TB 4LRIA 4U6YB 2R0LH 2FLBT 3PGDB 5E8OA 2VJXA 4JPVL 1QFWH 1R3LB 4EN3A 1I8KB 3ECBA 3FQNB 2K3TA 1XGQA 3O2VL 1DE4A 3T4AA 3VXSE 3QXTA 1SEBB 1CCZA 5FKPA 4XPGH 2P24A 1RUQH 3AMKA 3Q1SH 5B3JE 4PJ8D 4ZQKA 3HNSH 1IKNA 1KJ3L 1F11B 5SV4A 5EZIL 4Q6IB 1MUJA 3BAEH 3VFUA 4X8XA 2CLVA 4G5ZL 5TDPB 1CG9A 1ZHLB 3U4EA 5IOPB 4OQTL 4Z77B 2B7DT 3B9DA 3PJSA 3H9SD 3QUZC 3J7HA 4FFVC 4Y1AB 4KQ4L 4X6DF 2QR0A 2SEBA 4JM2F 3RRQA 3VGAC 1GSMA 3LN4A 2BNRA 1ZTXL 5F96L 5IVXA 4YPJA 4PRPB 4DEPB 1OSZA 2CH8A 2CXKA 1J86A 4R2GB 1XR9A 1P4LB 3D3VB 2GJZB 3C9NA 3IXAA 1CBVH 5EG6C 3VXNA 3AVEA 3QUZA 3VXUB 1PEZA 4I0PB 4M48L 1FFQA 4JLRB 5AG8A 3BW9A 4FTVE 2VLKD 1IGCH 2A73B 3KGRA 5JIPA 1DFBL 5GGSA 4LF3B 1BM3H 4DGVL 1MCCA 4H5SA 2AGJL 1S9KC 2FO4A 3VFSA 3E8UL 4PJ5D 3QUYC 4I3GA 1NFDE 1CDHA 3BJLA 3BSZL 4KJWC 5B3JF 4CMHB 3QG7L 1U8LB 5KVFH 4PB0H 5DHXB 3LS4L 3KVQA 4EI5C 5J89A 4V1DE 5EIIB 5C0RL 4IJ3C 2YBRA 5I1GH 2R2CA 5C0EA 2XACC 3RIFK 3IU4L 3TBYB 2FJGB 2DD8H 2JCCB 3FCTB 4Z7UE 2BRRH 4N1CA 3QUYA 4XP4L 3WNLA 1I7UA 3QFJE 4UU9B 2EE3A 1KCUH 1PG7W 3BWAB 4O4YL 4JCLA 2X4OA 1RULH 5DT1L 4EI5A 5CP7B 5GS2D 1KLFA 3BE1H 2VH5L 2P46B 2QHRH 3HFML 5D5MF 1W8OA 4CBPA 3RY4A 1CS6A 4MXVE 4UQ2A 5EU4A 5E2TL 3P9MB 3HUJE 5FGBC 3N06B 3OHXA 1ONQB 2PXYB 2Q8BH 5JOPE 1Q9KB 1YEGL 5KVDL 3BDXA 3ZZ1A 1SYVB 4I48A 1N64L 1MFAH 3ZTJH 4ZSOA 4WHCA 4LSRH 4WGWB 5IESL 5D70H 1FAIH 1S7RB 4MS8C 1NFDF 1V7NH 1Y18B 4MNQE 3ZDZF 1JNJA 1C16B 1IEAB 2MFNA 1ZK9A 1MJJA 5D4QA 1XF4A 1VKXA 2VB5A 1JUFA 4RGOH 4BH8B 1G9ML 1WTGT 2B5IC 2R9HD 5FGBA 4OGZA 4N8VA 4WEBH 2FEDD 5E2UL 4KPHH 4X80H 5HDOA 4QF1B 4Z7UF 4ALAH 5DWUL 3GO1L 1U3HC 4Z95H 1FN4A 4MB4A 1T04B 3DNKA 4AEIL 3CZJA 4YHIA 1WZ1H 3A67H 1WFOA 3GI8L 1YN6B 4KJYA 3TH2T 5EIVA 4X4ZA 3QPQD 4RMQA 4DUVA 1BJ1J 2XWTA 3W11C 4QXWA 3HZYA 4X6BB 5E5UB 2J6EL 4GW1A 4HULB 1F3DJ 4XH2A 3I75B 3OZ9H 4UBDC 2X9WA 4MQXC 1MVUA 3WCYA 1G9NH 4S1SH 2H32H 2AERT 2GTWA 5B4MC 3QRGH 3ELAT 4A6YA 3L3JB 4JQVC 3UPAA 2ICWB 4MXVF 2JIXD 5HVHC 2VTFA 2X6MA 4FQIH 4F7MA 2R1WB 4ZUTB 4C54A 4MA1C 2ID5A 2AJZA 1LEGA 3OXRA 1NSNL 4L8CA 3BP6B 2R0ZH 1K6QH 3GK8H 4NQCE 3SE8H 5KG9B 3MBEC 1KTKE 1TQBC 3NCYS 3IFPA 4JRXD 4ONFH 4RA0C 5MEND 1I1YB 2R0LL 2X4PB 2YA1A 5GGUB 4G9FE 4FA8A 2J5LC 3QI9C 3QRFM 3STLA 2EZ0C 1EBAA 1QFWL 5IJKA 2OQJB 4JQVA 1ED3B 3C87A 1IAII 1QLRA 1G6VK 3W0WD 4OFVA 2EKSA 2J1KA 4OUUB 5CJ5A 4R97B 2GYSA 4PRIE 3WFBL 4OJFH 5MI0C 3UTPD 4HCRA 3DO3A 1KUMA 4XPGL 5I1KH 1JPTH 5IFHH 1RUQL 3UJTL 4OV5B 3Q1SL 3HNSL 2DQHH 4ZFZB 4J23A 3MBEA 4LAJH 3ZE1E 3BAEL 4G6KH 4AH2A 4WHYG 3OMZA 3QI9A 1ETZA 4PJFA 5J1AB 2GKIA 2EEBA 5HVGB 3V2AR 2VLRA 1P7QA 2HP4A 3ZKXB 5FYJU 1TZIB 4YFLI 5E1AA 3KPLB 4NQDA 2OBGA 1ES0A 5E6ID 1OW0A 3HMXH 3MSPA 3ULVE 3FTGA 3P9LA 4BFEA 2GHWB 1IQWH 4DAGH 4MB5A 5HGHA 4KY1H 3S3JA 4JQXA 1RVFH 4V2BA 3ES6A 1NGZA 2EECA 2OTWB 3FO1A 1CBVL 4KROD 2DYPA 4GKZA 1YNTA 1KCSH 3EFFB 1QO3B 2LVCA 1DQQB 1DN0B 4HF5H 4WI4A 2DI7A 4DCQB 2RGSA 3WEXA 4R96B 1A6ZB 1IGCL 2YPKB 3Q48A 3I3EA 1AO7D 3QA3B 1BM3L 1OHQA 4OFYD 4ZD3H 4WFFD 1H8NA 3ARGB 3OV6A 3Q3GB 3JXAA 5BCAA 3MNZB 1OM3H 3STBA 4G80A 3G04B 5KVFL 4PB0L 4PTTB 1YQ2A 3ZE1F 2BJMH 3SDCC 1CFQA 4IEFB 4RFNC 4XX1G 2P5WB 5CJOH 3V6ZB 3VRIB 2YS4A 3LB6C 1DUYB 5LAXB 3FT4B 3PDOB 4G7YH 4NO5B 4HIEA 3VI3E 5I1GL 2OR9L 1P9MC 4G42A 4ORGB 1G7LB 5JW3L 2DD8L 5ACLA 2UWEE 4ZUVB 2BRRL 4P2OD 5GGVH 5DUPL 2BC4B 2P45B 3TO2B 3RPKA 4FQ1H 2HLFD 1NLBH 1YC8A 2PCPA 3ULVF 1KCUL 3GMPB 4BUGA 5E4EC 1A4KA 2FGZA 1KCRL 1EEZB 1YN7A 3I6GB 3U0TA 1RULL 3SDCA 5AYQA 4JB9H 4R9HA 3BE1L 4LPTA 3BESR 5JW4Q 3IDUA 4YAQA 2QHRL 4NZRH 4DK6A 4DUWA 3WD5H 4AIXA 5MHSD 1P9MA 5L6YH 4OKDA 1YC7A 2HJFB 2Q8BL 2W60B 3BH8B 5DD3H 4NKMA 1WBXA 3EOAA 1MFAL 5DQDH 5GS1B 1DBKH 2B20A 3OKNB 4LSRL 5JMRA 1JE6A 5D70L 1FAIL 4PY8I 1V7NL 4O2CB 3DXAA 4I1NB 2G5RA 1KXVC 1FNGB 2HFGL 3VXPA 4LLUB 5JDSB 2Y06H 3GSXA 3VGFA 1RUMH 3G08A 3Q6FB 1U95B 3U6RB 3KXFB 4RGOL 4JDVA 1G7PB 4JFPB 1HYRC 3VI3F 5JPMA 1Q9OA 4WEBL 3PQYB 1CGXA 4KPHL 4X80L 3X17A 2UWEF 4ALAL 4JZJC 1BIIA 3L6FA 4Z95L 5A2LH 3DX7A 3CFIC 3M17B 5TF0A 3MCKB 1D5BA 1WZ1L 3A67L 4Y4FC 5HI4C 1BBJB 4LPXA 1MJ7H 2IPKA 4PJGE 2BVPA 5F9OL 5I8EB 3VXRE 3LOWA 1C5BH 3BZEB 3OZ9L 3X12B 3L5HA 3GSWA 1G9NL 2I9LB 4S1SL 2GITB 3QDMA 4R4BA 3MRNA 1MCFA 4U1KA 3QRGL 1A6VH 2NR6D 3T0VA 1JYXA 2Z35B 4LKXB 4DN4H 1JYNA 2VL5B 3AS2A 1C7SA 2IBZX 4FQIL 1U8MB 3OGCB 2HKHH 5F97E 3QZWG 3QIUB 3FOMA 3HE7B 2OM5A 1QFUL 3MXVH 1LEKB 3CFJA 5AEAA 2R0ZL 2RCSH 4Y4FA 1K6QL 2YEZB 5IR1B 1YDPA 3GK8L 1JCKA 5HHOE 4CN4A 1WEJH 3SE8L 1JN6A 2Q87A 5ICZB 1F4WH 2YOCA 4LLWB 3B3IA 1GAFH 3NMEA 4ONFL 3TC9A 3P9WB 4JFYB 2D03H 4PV9A 2YHGA 5IB2B 3SKJH 4HV8A 5IF0B 5TDNA 1FZOB 1KLUA 1KPUB 4AJ0A 3PHOA 4WUUA 3P73B 3QXAB 3BVNB 3RPIB 3FB7B 5C07B 4ERSH 3VJ6B 4E42B 5CD3A 4OJFL 3L3IA 4L3EE 4X6CA 4D9QD 5I1KL 1JPTL 5FK9A 5IFHL 5E8DH 3MJ9A 3P4OB 4POZC 3UDWA 2DQHL 3TBTB 3VDAA 5C1MB 3VG9C 3WE6B 3ME0A 2EDXA 4G6KL 1IC5H 2XZQH 4PJGF 3JZ7A 5JZ7D 4HJ0D 3U30C 3RWDA 2BZDA 1T66D 5KJRH 2Q8AH 1OQXA 4XX1E 4KUCD 5DMKB 3FRUB 4ETQB 3HMXL 1AR1D 3ARBD 4KGJA 4KUZH 2LV4A 3ROOA 3KPMA 1R5VA 1T7WA 2I07A 3L3OA 3OX8B 4OCSH 2EDDA 1CGVA 1RZKH 4X5LA 1IQWL 3QR2A 1KTRL 4DAGL 3QDJB 4KY1L 3RVWC 3PWNB 2APWA 4EIGB 3K3QA 1I3VA 3C60C 1RVFL 4PY8J 4LDEB 4NN6B 1KCSL 1J0KA 1U91B 2KZWA 2E9BA 3VGHA 4HF5L 4LHUB 3RTQC 1EHXA 4DTGH 4RRPA 1U41A 4F9LC 4AT6A 3MLVH 3CSPA 4OD3H 4CAGA 1B4RA 2NW2A 4DJMA 3SJVA 4QCIA 5BMFH 3TBSB 3ULVH 1OM3L 3S36H 5T3XE 3KYMA 4GBXD 3EO0A 2IH1B 4PJFE 3BD4A 2BJML 4YNYB 5A2JH 3LS5H 1G7JA 5I71B 1VFUA 5CJOL 4ZOCA 4L4VE 1OTTC 5E5MB 4F9LA 1OPGH 1KC5H 5I1IL 2Z91B 1HH9A 2V9RA 4C56B 5C0AE 4S2SB 2DWEA 3AAZB 3STZB 4WW2B 5DRXB 1ZT1A 5GGVL 1ERNA 4L4TA 3AB0C 4I5BA 4FQ1L 1OGAE 3O3BB 5DJDA 2BRQA 3SCMD 2AV1A 1RQ5A 5FGCB 1UB5B 4YPGB 3BP7A 1SMAA 3VXOB 1E4JA 1WBZB 2CDEB 3BMWA 1H0DB 3SKUD 3VA2C 4KK9D 4WEUD 1QA9B 3DVNA 4NZRL 2IALA 2E9JA 3WD5L 4Y16B 1B4JH 3L5IA 4QOKB 5L6YL 5LGJB 3BOVA 1ZLUK 4QRTA 4Y4KA 5E7BA 2VDNH 3O41B 4NZTH 2WSKA 5DD3L 3RWGB 4NKQB 4X4YA 2PYEB 1T03H 1NCUA 3CZFA 3EYOB 4NRZA 5DQDL 5ICXA 5GIRA 1DBKL 3BKJH 1I1AC 1XZ0B 3ARRA 3K8LA 2B4CC 2X7LB 1QFWI 4K3DH