2VIRB

Influenza virus hemagglutinin complexed with a neutralizing antibody
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
221
structure length
221
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFLLISNGVHWVRQPPGKGLEWLGVIWAGGNTNYNSALMSRVSISKDNSKSQVFLKMKSLQTDDTAMYYCARDFYDYDVFYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN (IGG1, LAMBDA)
publication title Antigen distortion allows influenza virus to escape neutralization.
pubmed doi rcsb
source organism Influenza a virus (a/x-31(h3n2))
molecule tags Complex (hemagglutinin/immunoglobulin)
total genus 35
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2virB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2virB01
1RK0A 3SDCD 1YY8A 1CFBA 1A3RL 2R8SL 1OTUC 3GK8H 5EO1B 1D7FA 5E6ID 4PG9B 2G5BA 1NFDF 1UXWB 1RIHH 2NY0C 1DLFH 4IOIB 5C7XL 1A1NB 1CD9B 3WD5H 4ODTH 2ESVD 5FUZL 1JNNL 4K94C 5EUOA 4HKZB 3G08A 1DDHA 4LDOB 1QSZA 4I8DA 3EHBD 2ZJSH 4X7EC 5HHME 1XGYH 3TZVC 4O51B 3MODH 4KKCD 5B4MC 3VRJB 2R0KH 2GTWB 2RGSA 4KV5E 5D2LE 4M7LL 3IDIB 4LHJB 3KHQA 1IAIL 4GMSH 4X6BA 2OL3B 4HJ0D 1FNFA 5IJKC 1KJ2L 4DW2L 1GGBH 1WBYA 4ONHA 4N0CC 4PGEB 4FMKA 3M17B 3RWFB 3E1F1 4XCYA 4OBRA 4MD5A 3E8UH 5CILL 4TULH 5IMLA 2EO1A 2DQEL 3PNWB 3VMOA 2BCKA 4G9FD 3AB0C 3UPRA 4LSSL 2PETA 3CFCH 2C1PA 4HKBA 2HLAA 3O2VH 4PJDE 3QI9A 2XWTB 5C6WH 5SWSB 3QUYB 4MJ5B 3BPOB 3L9RB 3OB8A 5ESAB 1EMTL 1MFCL 2QQQA 3ZE1F 2B4CL 2WINA 3QIBD 4P48A 5AUMA 3LKRA 4OZIF 4Z7WB 1D6EB 2Z31A 3LHPH 4YK4C 2LABA 1TCRB 1HHKA 1J0YA 3JTSA 2DQUL 3V0WH 1T2QH 3DGGA 3NFNB 5AEAA 3CSYB 3O3BA 1RUAH 4FABL 3MO1B 4QRPA 1A7NL 4OF5A 1ZLSH 1N6UA 5KS9A 4JPWL 3I6GA 5IEKA 4ZD3L 2VQ1A 2MQ3A 5GS3A 1R5IB 2WIMA 5EC2B 3S97C 3U83A 4NZDA 4OLUH 5GS0L 2VL4A 3WHE0 3MOBL 5E03A 1VFBB 1DEEA 1IC5H 1IGCL 2AXJA 1IGIH 4XTRD 3D1MC 1JZ7A 1EFQA 5E99L 3LQZA 4RA0C 5ESVA 5JNYA 3DVGB 4K07A 4I13B 1Z2KA 4U1JB 5D1QD 3VMPA 3U0TA 5IQ7L 2A6IB 1ZANH 2NYYC 4U7KA 3RZCB 3GJEB 3BKJL 3U9PL 2A77H 2R2EA 1CI5A 2F74B 4AEFA 1LO0L 4NC1E 2OXGA 3O3AA 3PABB 3RX7A 1ZKAA 2AJXL 1PG7X 2LFGA 5F9JB 2OTWB 4XMKH 1SM3L 3VDBA 2OTUA 1H0DB 3FO9B 2J88L 3VFTA 1O7VA 4AEHL 1QBAA 4YE4H 3VFMA 2ZOKA 2J5LC 2DLFL 2NXYC 3O6ML 5TFSL 1WFUA 4IOFD 2K3TA 2R23B 2AK4E 1D9KB 2WUCH 5I66B 1U8QA 2NCMA 4GW1A 4HFWB 2P42B 2X4OB 4NBXB 5I9QC 3BQUD 1NJ9B 3KPNA 1LP9B 4ZUWA 1ZGLA 5GGTA 1XFPA 4A6YH 1U41A 4H1LG 1FCGA 3WIHH 3ARGA 2A83A 2BNRA 3QJFA 4WI8A 4P59H 2HFFA 4LQFL 2ILLA 3VFPB 1KGCD 1S9YA 3CD4A 1CFSA 4ORGB 1AGBB 3T4YB 1BBJB 5FIEA 5CD3B 3MLSH 5D8JL 4B7LA 4MNHA 1G1CA 3B2UC 3L3JA 2CO7B 2BHUA 3IVKB 4KDTA 2Y5EA 2ZCHL 3OJ2C 3ULVE 4KHXL 3GJFA 4H26B 3WE6B 4PLKC 3BGAA 3N9GL 4JY5H 2F53A 5F1OB 3CUPB 4RMSA 3RUGF 4OCXL 4PGCB 4WJ5A 4KI5E 2X4RA 1JGLL 3JTTB 2F5BH 1RZJL 4KHTL 4I3SL 1I3RB 3NIFF 5E6YA 5IMOB 2E7BA 5C0BD 5IJVA 2GUOB 4WV1A 5JW5B 5JXEA 4OGZA 2F8VA 2NY6C 3IKCB 5CZXD 1ZLVK 1GZQA 4L5FL 3HPLA 1NPUA 1U3HB 5KVGL 4WFFD 2IBZY 3O8XB 5I1GL 4Y5VB 4M5YL 5DRZB 1NMAH 3MBEC 3OKNA 4FQLH 1QNZH 2YD3A 4PJ8B 5DEZA 1AGEA 1EO5A 2YPKA 3UTPE 5EOCH 1RPQA 3R4DA 4X4ME 3QEQD 5IGXL 1Q0XH 3GBLA 3PXHA 4RWHA 5DK0A 5C0IA 2LQRA 1GC1H 2NY3C 5GJSL 3GFUA 4OZ4B 5E8NB 3WJLA 5I8OL 1BOGA 1DEDA 1PQZB 2FX7H 2FLBT 5DR5H 3BMWA 4PJAF 2HKHL 1J1OL 3W82A 3KPMA 3RGVA 4MA3B 1TXKA 2M8XA 2RFXB 3OG6B 1XGUA 1CGSH 4FFYH 1CXHA 7CGTA 1JRHH 1L0QA 5F6HJ 4K3JL 2VUOA 5JOPE 4BKLB 3P4MB 1WTLA 3WEXB 2WBKA 5C0CE 1TENA 3CX2A 4TPRL 1UM5L 2Y7QA 3OKKA 5CJ8A 4JLRA 1ZWIB 3MRNA 3LS5H 1FNGA 1YNLL 4L4TA 3UAJC 1MHCA 4NQVA 5TQ0H 3M45A 1KIPB 5K9OA 2HMID 3BUTA 5HHNA 5D72H 5HHMB 3HAEG 1XIWC 2W07A 1MFAL 3HC3H 4YXHH 2EYRA 4L3AA 1T3FA 1O7SA 4HH9B 2MWCA 3LKPB 3OG4B 5HDOA 2YD2A 5D2LA 5SWSD 2CKBB 3RKDC 1DP0A 4RQQA 4ODSL 4G6KL 3K4DA 4GAGL 3LEXB 3OX8B 5TH2A 4X6EB 5JQ6H 4YHIA 1NAMB 4HKXA 1YJDL 3E6HB 4G8EA 2D4FA 4X8JB 2P7TA 4O5LH 3OPZL 4LSTH 4RGMC 4PJ5E 4UT7L 3ALPA 1U91B 4QHNA 1U95B 5IIEB 2QTEA 4MAUL 1JGUH 3C60A 2YZ1A 3DV6A 3MZGB 4S2SB 1FVCA 4PJDB 3QDMD 1X5AA 2DMKA 5EBLA 3T0EA 3LY6A 3O4OC 3IU3A 4L3EA 4AZ8A 4KVCL 4ONGH 1GC1C 3V6ZA 2IPTH 4EZMA 3W81A 2YKLL 1MRDL 3KG5A 4NSKB 4OLWH 5CUSL 5DJZA 4C58B 1HKFA 2O93L 1LGVA 4BYHA 4QLRA 5FGSA 2VITA 1NMBL 3B6SB 5A2LH 4AMKH 2P45B 4LASL 3IXAA 4HT1H 1T1WB 3VWJA 3ZE0E 5BQ7B 1AHWB 5DMGD 3QIUA 4WY7H 2OMBA 1ORQB 5I1EL 2NZ9C 1L7TH 5C0FA 3LB6C 1DZBA 3LIZL 2EH8L 5CCKH 2MCG1 1DUZB 1H8SA 1D5BA 32C2A 5L9DL 3W0WA 3BW9B 5E1HB 2VXSH 4NRZA 2UY7A 4OZFA 5C6PB 2GJJA 3RPIA 1Z0NA 4QTHA 2V6HA 4XAWL 1LK3H 2VXQL 4QRTB 2NY5L 3LAFA 1I8IA 5A40E 1D9KD 3D0VA 1UCTA 2HN7B 3RHWF 3LEVL 2IANE 1VFAA 4XP4H 4LCUA 1P84J 4N8VB 5SWZE 4Y5XA 4L8DB 4X6DB 5DTFB 4NO3A 2ERJB 4R4FH 1DL7L 4ZTPH 1S5IH 4ESKA 2XRAL 3PP4H 4YLQT 4HWZB 3QJHA 5EZOL 5HHOE 3MJ7A 3NABH 43CAB 1OGAE 5ALCH 3OHXB 2AK4B 4C4KO 4KKBC 4P46B 1KEGL 1GAFH 3PE9A 1OAQH 3VJ6A 4XWOC 4D0CB 1OTSD 3RL2A 3VXTB 2BOCB 5DD3L 4ZXBD 3PDGA 2CIKA 1MUJA 3G6AA 3UJTL 1JWMB 5AAMA 4QXTA 1QA9B 4JZOA 4ODWA 2HJLB 3GSVA 3PUCA 4KVNL 1J8HA 1ETZA 4ZAKA 3FB6A 3RWHA 1Y6MR 5D2NE 4LFHG 3ARZA 4Y7MA 4UTAH 1IEAB 1T2JA 5I1IH 4Y4HD 3FT2B 1U3HD 1FGVL 1OAKL 4OZGF 4P3CL 3O8XD 4P3DA 3WO4B 2DWEA 4Z7VB 4CL7A 1B6DA 5FF6A 1HQ4B 4NFCA 2OZ4H 4YWGH 5FYKH 1CYGA 1QPPA 1SJHB 2HT2D 3LQMA 3TBYB 2D0FA 3FQUA 4HJGA 2JB5H 1QHPA 1JNHB 2V9RA 4Y19E 1KTLA 4LK4A 3G5XB 3CNKA 2WBJD 3NPSB 1W0YT 1FAIH 1ZHBA 4RFNC 3TYFB 3HTLX 4JFXB 5B39A 3C5ZA 1IGYA 2PTUA 3KLHD 2R4RL 1C1EL 3L3IB 4MHHI 1PD6A 4KMTL 3DETD 2DBLL 1NGPH 3U0PA 5L0QC 1WAAE 4LKXB 2QLVB 3VI4E 1T80A 4G43B 4TSAL 1CICC 4U0RB 1LO3H 4NQXB 2X4SA 5LBSL 4NO2A 4YPGB 4ZOAA 2AJUL 1NDGB 4F7CA 1UZ8B 4CUCA 3ARDD 4I4WB 1Z0MA 2KKQA 2MJWA 1U8NA 1VFUA 4URTB 1CT8A 1K8DA 1II4E 4D8PB 1ZMYA 4ZUUB 2FHFA 5DZOA 3ZDXF 5KG9A 2YPLB 3NMEA 2HRPL 4H88L 4IRSA 4IRJB 5C0CB 2XACC 5FUOH 4ZFOB 1ONQA 2JKXA 2B5IC 4MLIA 1R0AH 1LEGA 4Z7WF 1V7MH 2DLIA 4O9HL 3AVEA 2R0LL 5D1ZC 3OAYH 3OF6A 4PY8I 4O58L 1GOFA 4LBEB 4GS7C 2DTSA 5IBUB 5JXAH 2F54A 4YHOL 1BVKB 2HTLD 5A2JH 5FECA 2Q8AH 4NO5A 4EOWH 5KJRL 4H8WL 3IFNH 1ZVHA 3AM8C 3WLWC 2DQDH 1OB1A 5TE6L 4XC1H 3MTRA 4P2YA 3P73A 3O3EA 1CE6B 3T04D 4YC2C 3RVXC 5E5RB 4PRIE 5I73B 3KNBA 1GL4B 1IGJA 4PJ5B 1A6AB 4HAFA 1I8KA 4UZGA 4DAGH 2EXYC 3V7AE 3FN0L 4F33A 4WUUB 5GRXG 1PZ5A 2X4PA 2BRRL 3K2UL 5CGMA 1EHLH 1G7JA 5B3JE 4W81A 1ZSDA 2NNAA 3HNVL 5BO1H 3OAYK 2FL5B 1R3IH 5T33H 5DJDA 4FQXA 5F89B 4W4OA 4M1CC 4D9RD 1RZ7H 2P5EE 5IROC 2LTQB 1YEJH 4MD0A 4PRAA 2ADJA 2WP3T 1HEZB 4RGOL 4Z8FL 3ZSTA 1WGOA 4JR9L 2OCFD 2AV7B 1YNKH 3T1FB 4YZFE 4NNXB 1K2DA 2YEZB 5JIIA 2PUQT 5F8RC 1JI2A 4D3CH 1FC2D 5MEQB 4MX7B 3E0GA 5H35A 4MHHG 4RISL 1LP9F 2EYSA 4XGZA 5T5FL 3QI9C 4OCWL 4Z76B 1RZFH 4RIRB 1KPVA 3FQXA 5GGTH 4YHZL 1BREA 4K9EL 5I1AA 2A73B 2EIZB 4NRYA 2UWEA 1X5LA 1AGCA 1SY6A 1X5HA 1SYSA 1FVDB 5F6IC 3TYGL 3CSBA 4GJTB 5HYSB 1TJIH 5IVZB 4AQOA 2Z31C 3MUGA 3OAUH 3WFHA 5J11C 5AG9A 2BFVH 4LVNC 3BP5B 5HPMA 3NIGE 1G7PB 4BQ8A 5JHDE 1ZA3B 2IANA 4OM1L 4GXUM 4R2GB 4G7YH 4JPVH 5BS0B 3MRKB 3KLAA 4WO4D 4CN6A 4OD1H 3FQNA 1PYWB 5T1KB 2IPUK 4XX1G 1QFOA 3GJFH 4M1DL 4HDIA 4GLRI 5HGAB 4KUCF 3VXSB 2AABL 2HJFA 1X7QB 5C0AE 4OLEA 1MWAB 3UBXA 5FB8B 2NR6D 4JANB 4NP4H 4O4YL 5C86A 2NLJA 5HHOB 3A6OA 3BH9A 3CPLA 1KPUA 1JHTA 1OGAA 4FP8L 3ULUE 4JM4H 3RWJA 2CJUL 3OZ9H 3X11B 5IB4B 3P11L 2B0SH 2G60L 1RFDL 4JQIL 4XP5H 1LEKA 4AL8H 1LDSA 2YD5A 1S7RB 1J05A 2FYYB 4WHYH 1QRNA 1CWVA 4N5EC 4RGNB 4F57L 5IHZA 4P57A 2BY2A 1UFUA 4PYGA 3S37X 4LSVL 1MHEB 4PJ7B 5ETUB 2XFXA 3O6FA 1KC5H 4RBPK 1FIEA 4JFEB 1WT5A 3IJSB 3M07A 2NZIA 5T3ZD 1AQKH 2IADA 3DMMB 2WUBH 4X7CC 4U6XA 4YNYB 4Q2ZA 5L8KB 1NAKL 1Z9SA 4LIQL 2Q76B 2MSPA 2X44D 5D2NB 1JVKA 4IMLB 1A21A 4QRRE 2GEEA 2AXFB 3K46A 3P0VL 1MFBH 3CZFA 5LGKA 5FYJL 1YC7A 4MLSA 3EOTH 4N0UE 1UKTA 1YQVL 3WIIL 4JKLA 4P5TD 3N85L 2B1HL 2W0FA 4ZMAT 3QXAA 1A4JA 2VO5A 3TBTB 2Z93B 2EEDA 3MV11 4P4KB 3ARGC 3BEVA 4Y19A 1BLNB 4FQIL 3RAJH 2PW2A 4ZS7L 4OT1L 1U92B 2ZKHH 1R3KA 2ICES 1T5WA 2DI8A 3L6FA 3OGCB 4NNYB 4ZQKB 4RNRB 4NQSA 3S96B 5CEYA 4UINH 2EKSA 3QXWA 2VZ3A 4WUKL 5F93C 2QADC 2A74B 3DNKA 5FHBL 4JFQB 3EJZC 1I75A 1E4KA 3PWJA 4KDTC 3WNOA 4XNQA 1N2RA 1D5MB 5C0ND 3PJSB 1SEBB 2ID5A 2YPLD 1WAAA 3V6FA 4M62L 2XKUA 4OCSH 3MLPA 1UM4L 1CLYL 1QOKA 4DOHB 2HA1A 2IALB 5BRZE 3KLDA 1NCTA 1I1AA 2CDGB 3VXOA 2BVPB 1BIHA 2JB6A 4MWFB 3PV6B 1NCWL 3DJ9A 3EJYC 4DZBA 4WV1C 3L5WA 4N1EA 4R4BB 1CGXA 1EGJA 4HWEL 5JXEC 5B38B 1DBAL 2FX9L 3OWEA 1X5JA 4M00A 1NBYB 3SE3A 5ID1A 1BZ7A 2J6EA 4FQJH 1FORL 4PJDF 4EDWH 4YJZL 3NFSL 4GW4A 2YD8A 1G7HB 1BM3L 3ZTNL 4X0KB 4PJ9A 3PWVB 2E9WA 1MRCH 1A7QH 3O81A 5EZIL 2YPVH 3B5HA 4NN7C 5B8CA 5JA9A 2VZSA 3CX5K 3WJLC 3OSKA 5DQDH 5L88L 1FDLH 4KJYA 4UIMB 4N90E 3N06B 1OCWL 1HKLL 4I18B 3GNMH 1XGPA 4WUUD 2E27L 5DD0H 3C09C 3RGVC 1QZ1A 1IM9A 2ITCA 1QQDB 3RA7H 1TVDA 1P7KA 4ZS6C 2C3WA 4MJ6A 5CEZH 3WKMH 1QUNA 3BGFC 5F7KC 3BPLB 1EHNA 4HULB 1T0NA 1UKQA 5ELIA 5IHUL 4WTZA 1WCBB 2EECA 2IH1A 4BQCA 3GMNB 5IW3A 2G75B 2EDFA 3MREB 4PRIB 4KKAC 4MNQD 4OZFH 1M7DA 2EICA 4FXGA 4HS6B 5FM4A 1ZEAH 2PYFB 4D9QE 3T8XA 2IQAA 3KHOA 3D2UB 5FO9B 1Q94A 2VR4A 1TVBB 5AYQA 1P1ZB 1MNUL 4X6DF 2AJYH 2XI9A 4NYLB 3CFDB 4Z77A 3UEZA 1NLDH 4BSJA 2P5EA 1IC4H 2VDKL 1EDQA 5FCSH 2HVKB 1Z9OA 4YEFA 3LV3B 3FOLA 2VLRD 4X80L 1G6RL 3TBVB 1A9EA 4YHYC 3IFPB 4NWUH 4R2GD 3EYUL 3MMEB 5BS0D 3C60C 4GSDL 5HDBE 5D7JA 3RQ3A 3IU4H 2UZIL 4MQSB 4BFIB 4LNRA 2OR9L 3QIBA 4LP5A 2ZSWB 3T0EC 4HV8B 1I1CA 3VXSD 1S8DB 5L8LB 2DM2A 1T1XA 5DJYB 1ZVSB 4TRPH 4WHCA 5MHSE 1LEIB 1BD2E 1Z3GL 3MYJA 4ZFFA 4ELME 1E28A 1KYOK 4C56B 4U1NA 1RJZA 3LCYA 1I7TA 5JHDB 3DXAE 4F7TA 1K4CA 4EI5B 1NC2B 2HTKC 4HIHA 4RGND 5JQHC 3ULVF 3TFKC 5IM7A 1YMHB 4Z7VF 1DQMH 3CC5B 5FOJA 3VFNB 4QT5A 3VWJC 4JREB 3HB3D 3RRQA 5I74C 3QIUC 3ZYOA 2DQFB 3TJEL 4JFED 1AIFA 1BAFH 2CGRH 5F9OH 2CRIA 5M7QA 5C0AB 3DMMD 3HE7D 1T22A 1D5ZA 1TIUA 4WFED 5F70A 5KVFH 3QWRD 5D1QA 5D6DC 2Y36L 3L3OA 4LLQA 1JUFB 2H45A 3VWKD 4FQHB 5IKCA 5ILTL 4HK0B 4N0YH 5EZLA 1K5NB 1U58B 3DTXB 4AENA 3BIAX 1JCKA 4HCRA 4Y5XC 3NGBC 4FTVE 4HUUB 5JMRA 4JO3H 5H94B 3DUSB 1IT9L 3EOAA 5IFHH 5ENWB 3OKLB 4GMTH 3QSKB 4QRRA 3RIAK 4DGYH 3ARED 5BZWB 3D0LB 1JGVL 3UTTE 1SMOA 4POZD 4ODUB 3BQUA 4N0UA 4PJCE 5DJ0B 2CMRH 5GS2H 4EUPB 5GRUL 1N26A 1YQ2A 2FATL 4NCDA 4XPFL 4RMRA 1MRFH 2EE9A 1XT5A 3T4AA 1S7TA 4MCZB 3WFCH 2GITB 4EN3D 5MI0C 3SCMB 1U3JA 3MGOB 3MJ6A 3QQ3A 2GAZB 1OY3B 4F37K 1FO0L 2FJGB 2HG5A 4WEBH 4PJHA 1LE9B 5HDLA 4N0FB 4YHPA 3MR9B 5D6CB 4ZAKC 2C1OA 2D31A 2GSIA 4YHLH 3GMOA 2GJ6D 4JKPH 4KK9C 3TLRA 2ARJQ 5E2UH 4C83B 4LCWE 2X4QB 3NTCL 3WUWA 4DK3A 4OV5A 2DWDB 1FAKT 4L8BB 3QUXB 5TPWL 3DOSA 3ARSA 4KI5C 5BRZA 5C0BA 1A7OH 4RMQA 2W65A 3ECBA 5D7KE 5LWYH 5E08L 4X5XA 3CU7A 5IW1B 1MJJA 2AJSH 1NFIB 3VFGH 3F6IA 4PRHD 5LAXB 5C08E 5JORA 2FH8A 2FLRT 1CDHA 4NWTH 4GRWH 3V4VL 1NH6A 4LGSB 3T0WA 3C5ZC 4IEFB 4MQ7A 4PTUA 2P5WD 1MLBA 3U7WL 4HJJH 5IUSA 3QEQA 2NY4D 3WS3B 5JW4R 3WIFA 4GAYA 3DIFA 3EUUA 4ODVL 4CNIB 5DD5L 3MUY1 3D69B 3KYNB 1KBGH 2J8OA 1FZKB 2WANA 3NN8A 1NCBH 4NQEE 4W68A 4GRMB 3FMGL 3IS0X 4OGYL 5I19L 4U33A 3GI9H 4JVUA 3U7AA 4OGAC 4CVUA 1OSPL 1QLRB 1YEGL 3UZVB 1ADQA 1EEQA 1MSPA 5F71A 4G8GD 1N6VA 1ZV5A 1DVFB 4MB3A 3RGHA 1FL6A 4IRSC 4L1DA 2QHRH 4PTTA 1MCPH 5CMAB 2MCPH 3QZWB 4OIIH 2ATPA 3M1BA 2YXMA 5INDB 2V7HA 1SY6H 4J12A 5HVHC 5I6XB 2IF7A 1LE5B 1I3VA 1KCUH 4UDUA 2R2HA 3TN0A 3EFDH 5E24E 3K4ZA 2XQBH 1QFWM 3BD5A 2XWTA 1WCQA 4HX1B 5KVDH 1F00I 4K2UH 3RVTC 1K8IB 3DYPA 4UQ2B 2I9LB 1OQOA 4OZHE 1VEMA 2DJUA 2R69L 3FT4B 2B2XL 5DQ9B 4NQDE 3MLRL 4U1IB 4XHJD 1HSBB 3BZFB 4JPKH 3ZKND 2JK5A 3ZL4H 3MJ8A 1BZ9A 4J8RB 1KT2A 3LN5A 3UYRH 4C56D 2KQMA 2GJZB 3VXRE 4PJEA 2Z4QA 3KPSB 4WRLA 4Y4FB 3DGCR 4RMVA 4BFEA 4EI5D 3QDMA 1W72L 2X1PA 5FAAA 1I7RA 3PGDA 1ZT1B 1NMCB 1VFOA 1TLKA 4YDLC 5I1CL 4PJ7F 2Q8BH 5HGDB 1DQLH 1H3PL 2R2BA 4XPTL 1YEKH 5JA8B 5BJTB 4LOUC 2E27H 4FQXC 4W4OC 5JDJA 1BD2A 3DBXB 1YYML 2DN7A 3MC0A 2XTJE 4XP9L 4ELMB 4I5BB 3V5KA 3KXFE 2HFTA 3C6LB 3DXAB 3RVWC 4M4RA 3MA9L 1E27B 3ARBD 4NKOA 4OLZL 5C09E 4YXLL 1MAKA 5F9JA 2OTWA 3VFWA 4TVPH 2OJZH 6CGTA 3KR3H 4HPYH 3RIFK 1WBZB 1BEYL 5BV7B 2IBBA 5DS8A 3TV3L 5EPMB 3VXPA 3L1OH 2VISA 2ZNWA 1D6VL 1A0QL 2OL3L 2P8LB 3P4NA 4JFFE 4AIZB 5DK2A 3EO0B 4LMQI 2KUTA 3BJLA 1AI1H 5EUKB 5J9PA 2YUXA 3VGAB 5CGTA 5I71C 5ACMA 4FXKA 2D7OA 3U30B 3V52H 4FTVA 3SCMD 4XVSL 2ADFL 4UOW1 1G6RH 3MGTB 1F6AB 1RK1A 3ZKSD 4S1RH 1EFXA 2ICWA 5FYLL 1YN6B 1A7PH 1S7VA 4LSPL 1NFKA 4ZUTB 5E94A 2HH0L 3VGEA 4LLDB 3UTTA 3FO2A 3IETB 4PJCA 4QXUL 1J1XH 1JWSB 7FABL 4HPOH 4KROC 1QPXA 1EGJH 4ZXBA 3DUUA 2XA8H 5DUBB 3RWCA 1N5YL 2EDWA 4LLVA 3D25B 4FFVD 5FK9B 1YMME 3VCLA 43C9A 4OCYH 4P0DA 2I60H 1WT5C 4F15C 3UO1H 1F6FB 4Y4HA 5C0JA 2BSSB 4P9MH 4QHLB 2VZ1A 1XR9B 1GPOH 3EZ8A 5GGRY 3AAZB 5LGJB 1O0VA 2BJML 4LCWB 4BH7A 3CVHA 2BDNH 5EBWA 5GGQH 1FC1A 1X5XA 4TOYH 3KS0J 3FRUB 3Q48A 5F7LB 3LDBC 1E4XI 4UOJA 1EO7A 4PD4K 4LSRH 2WBJA 4P5KA 3S5LA 4LVOC 1A1MA 1AXIB 1CCZA 4Q6IB 5EA0H 4G8IA 4OIBA 1NUGA 4U1GB 4HG4K 2PTTB 2D7QA 4KRPB 4MA3A 5C08B 4D0BB 4OLVL 2A6KA 1OTTD 3HMXA 5FKAB 4KK5D 1TETL 3BYTA 3K2MC 5D7IA 2FWOB 1N4XL 4XNZC 5CJOH 3SDXE 2AI0H 3GSNB 1E4KC 1H5BB 1OP3H 5B3JF 3BZDA 4Y1AE 5I30L 2IQ9L 5ADPL 1FZJA 3U7YL 2I26N 2E6QA 1CTNA 4GAJL 1T21B 4UAOC 1EEZB 2Y6SD 3N50A 2DTMH 4NQEB 5DUMH 2YSSA 2OSLB 1A3QA 3L3KB 1I1AC 3ARDA 3DRQB 4BZ2L 1KCSL 4X83A 3GSXB 1UM6H 4HH9A 1RMFH 5CBEA 5LQBL 5KSBE 4DVBA 5ITFB 3MLVL 3T77B 5ACZB 1NGWA 1UWEH 3SE3C 4QGTA 1U8JB 4I2XE 1N6QL 4MZ3A 1QD0A 1NAMA 5I15H 1W0VB 1VPOH 3TC9A 2LE9A 3QQ9D 4PJ9C 4Y8DC 1QHOA 2VL5A 2A6JA 5DLML 2WAHA 2J8UB 1U95A 3DRTB 5JOEA 2IC2A 5B8CC 1FYTD 4YBLC 1WBXB 3NIGF 3KPSD 4Y4FD 1HYSC 3DO7A 1IBGL 1GGIL 1A1OB 3F65A 3GSOA 4CW1A 3HZMA 5GRYA 1E4XL 2GI7A 4OZHA 1NGZA 3L7EA 3IDYC 5HY9A 2H41A 4HF5H 1MIEL 3UTSD 4NQDB 1HNGA 5I76B 4XPAL 3LN4A 4XAKE 5ID0A 4YAQB 3GHEH 3STZB 4XBGB 5KOMC 2R1YB 5I1HL 1P7HL 5HD8D 4RSVA 1KCLA 4MA8H 5DJAB 4PJFB 4IMKA 4B5EA 5J1AA 3VXRB 3ZT7A 5GS1B 3SKNA 4PY8J 2SEBB 4RZCA 3EHBC 1CFVH 2PN5A 2DL9A 3MRQA 4YEEA 5HHVH 1AHWA 4KKCC 2NPLX 1MJ7H 5AD0B 5I75C 1FRGH 2FSEA 3P30H 5T3XL 3MOAL 35C8H 1HH9B 2EDTA 1AR1D 1XF3A 4GG6B 5EB9A 1YEHL 1FZMA 1NL0H 4HCRH 1G9NH 4R0LB 5I19H 1NGXA 5EU6D 5BMFL 1YN7B 5E95B 1W8OA 5F9WB 1AE6H 2V17L 1B4JL 3BSZL 1DBJH 4YHNB 3C2AH 3KXFA 2YMXH 2GY7B 1ZA6A 3QEHA 4TUOA 4LVHC 4RFOL 5KW9H 1C12B 4PRDA 5FDWB 4L8DA 3SDDB 3FCTB 5DTFA 1KTRL 3DX8B 2CLZA 4G6FD 4UILL 1CVSC 4OF8A 3KVQA 5D7JC 1KEML 1S7UA 3MBXL 5LJYH 3V0VB 2CXKA 3QIBC 4I48A 3VXUE 3BP7A 4X9FA 3LS4H 5E8DH 4M6NL 2GCYA 1RUML 5EZJB 5DMIL 4AJ0A 2CKBL 5A3ID 5IMKB 1H8NA 1QLFA 3BN3B 4JFHD 2P49B 3FOMA 1MI5E 2PO6D 4LCCB 1AGDB 3QAZC 3V4UH 4F8TA 1AP2A 2WIIB 4FQ1H 3DX6A 4WO4A 3VXTA 1CDYA 2BOBA 2APWA 5E6ZA 4ZNEA 1I1FB 3OBAA 4XB8A 1T20B 3IJHA 4K71B 4LGRB 2HJLA 5C0GB 4U1KB 1ULVA 5INCB 3GIVA 2WLYA 1F8TL 3BJ91 3O11A 1F3JB 3ETBF 4LSUL 4NJAH 4WW2A 4E41D 2O61B 5ERWB 2VH5L 3DI2B 2X5PA 4XTRC 1AXSB 3ABZA 3S34L 4O02L 4BZ1H 4KJWD 5GGRA 1IEAA 5F44A 1DN0A 5JR1H 1XCTA 1LNUB 5CEXB 1BQLL 3ULUC 5D1QC 4O2FB 3SO3C 3WXWH 4XCNB 1ZHNB 3GRWL 4PR5A 3IB4A 2H6PA 4HXAH 2YD7A 4K3EH 4XI5C 1I4FA 1QSFE 3BKYH 5DRNA 3D9AH 4MDIA 1ORSB 3PWLA 3W5NA 3O0RH 3U9UB 1TQCC 3L3DB 5GGUA 4TSBH 3MXVH 1YMMB 1W0WA 3GO1H 4DQOL 5HHQB 4LCIH 1G9NC 1CBVL 1GYAA 4J6RH 2H1PL 2XWBA 3BT2H 2IH3A 5KANI 2YD4A 1INDL 3X12B 1HCVA 3G9AB 1P69B 4XPHH 2QHLA 5EC1A 1NCCH 4CVXA 4IOFC 2X89D 3VFRA 4X99B 3NCFB 2ENSA 2CD0A 1CK0L 1WEJH 3MXWH 2O5YL 1I7UA 4P5TA 3PHOA 3X14B 3F5WB 3KPQA 2PXYD 4S1SH 3BQUC 4X7SH 3VRIA 2HAZA 3F7VB 4NM8H 4OFVA 5T1MB 3SE9H 3O2DL 1I1YA 1ADQH 1FSKB 3O3DA 5EO0A 1MVFA 1RI8A 3VE0A 3HPJA 2XZZA 4LGPB 2V7NA 3A67L 4M8QA 3HZVB 5HJ3A 1N7ML 4EJ1C 2PKDA 4X9HA 1ND0B 3CFKB 4F2MA 4Y2DD 2NW2B 3BZ4A 4LLMA 4HZLB 1VKXA 1R3HB 2J4WL 4D9LL 1IC7H 3PWPD 3ZKXC 2R1WB 4G42A 1GRWA 2HFEB 3SDXB 4BH8A 1XR8B 3HZYA 2N1KA 1MCWM 5M94B 3AS2A 1A6VL 4RRPG 1CFTB 4Y1AB 3MUHL 3VFVB 3S4SA 1RZ8B 2BSED 3HG1E 1YDPB 1AR2A 1L9MA 1NANH 3OJVC 4XPGL 1TITA 2R29H 3CVIH 4JDZB 1CF8L 1OM3L 3PWNA 3UJJL 5DEGB 3WUZA 3TPKA 1C08B 3QNXB 3LH2L 4M3JA 4G9DB 4LLWA 3G5YA 4IDLA 3O4LB 4I2XB 4XCFL 3HNSL 4C57C 2C3HA 4KWUA 3IJYB 4J3VA 1IAOB 3WFEH 2WSKA 3ULVL 1HHHB 4WEMB 2WQRA 2EIEA 2XYCA 4PB9H 1CDGA 1K6QH 4HFUH 4APQD 4AH2B 5E9DD 4ELMF 1S9XA 2P8MB 1X4ZA 2QSVA 1AKJA 3FT3A 3H3PL 1IFHH 1RAMA 3G5ZB 1D5IH 4H0HB 4UUJA 2UZXB 3VFOB 2VDPL 3P0YH 1SBSL 4KZDL 2ADGB 2XXCB 3NA4A 3ARTA 2O5XL 1Y0LA 4FHBD 1JJUA 2BRQA 4KRNA 5FFLA 4KXZH 3LSOA 4KJPD 3GUTA 4R8WH 1U93B 3LZFL 3HI5L 3SQOH 4PP2A 1JPTL 5JDSA 4YGAB 4YHKL 3RL1B 3MRBB 1EJOH 2XN9B 3IDGA 1MELA 4MNQA 4RA3A 5KANG 1DBKL 4LRIA 4BJLA 1DTUA 5DSCA 4NNXA 3IFLH 3EDEA 5IB5B 1MFEH 4M7JH 5DT1L 5KSAB 3SDDD 3TN0C 4DVRL 1F4XH 5DFTA 3BKML 1FZOB 3HZKB 5HGHB 2CR6A 3KJ4B 1BFOB 4CU8A 2AV1A 2VQUA 1U8MB 3H9SD 2UVFA 2ZOLA 1KIUA 3JBG7 1C5BL 2Q7NA 2VLRA 1Q0YH 5DD1H 5DVLA 3QFJB 4W6XB 3SY0A 4U1LA 1OL0A 1I7ZA 4MDJA 4ZFOL 2QV2A 5CSBA 1KCRL 5DRWB 3TH4T 1KENL 1ZOXA 1PYWA 1S7SB 1MHPH 5J4MA 2CK2A 1JIBA 5IBLD 4WDIB 3SDYH 5D7LE 3O2WL 1RZIB 1UT9A 2WW8A 1CLZH 4M03A 2XY1A 3MNVB 1PY9A 3CU1A 1U8PB 3VXUA 3V6BR 4JANA 1KFAL 3QHFH 4EVNA 3EGSB 3AGVA 4NZUH 3RWIB 3UTZB 3O6KL 3Q5OA 3QDAA 1UKSA 1ZHKB 5SWQA 3TNNB 1PG7H 1SQ2N 5HI4D 1OF2A 1MI5A 3L5XL 3JWDH 4HXBH 4L9DA 4LAQH 4LPWA 1X5ZA 3EYQD 3ARVA 4OB5L 3WNLA 4NN6B 1FNLA 1CXKA 1ACYH 3QUMA 5E1AB 2OR7A 2J2ZA 3MV9E 4PJ7A 3I9GL 4F58H 2NXZB 1X6LA 3CVHH 1RQ5A 3VD7A 5FA4B 4MCYA 1F4YL 2XZCL 1XGQA 3HE7A 5TGBA 5ISZB 5TDOB 4YNYA 5I1KL 4WIQA 4ZUVA 4QOKD 5J7CC 3SKJL 2Q76A 3QWRA 1EV2E 4LL9A 4QHUB 4HIEB 3GMMB 1FVEA 1R3LA 1KNOB 2E7CA 2NY2B 2EKJA 2I9TA 3MRDB 4ODHL 2G2RA 4PJXA 2AXFA 1MPAL 3BPNC 3VWKA 3BYYA 4CN4A 3BI9X 4AT6B 2CRZA 3QQ4A 4HQQH 3KYOB 1QSFB 3G5VB 3HMXH 4H0IA 3MFFA 4YDJA 1M1SA 2EE2A 3E3QE 5K59E 4QXGH 1R5WB 1OGTB 3PL6B 3SHSA 3FQWA 2X70B 4G80B 5DZNA 3QO0B 3HLAB 1NUDA 4XWGL 5MEOB 4RCAA 5E4EC 4ODXA 1KN4L 4NNYA 1Z5LA 4ZSOE 4RNRA 3AREA 1MCJA 5GRVL 4RFEA 2NQCA 2JCCA 4ZPVA 2OQJB 2P48B 2RJMA 3CAFA 4G7VH 3GMPA 1FBIL 2G5RA 1NBZB 2VSDA 5HHXL 4KK8C 1OTSC 5GHWH 4EN3A 1W2KT 2A9NH 2BMKA 4XNYL 1EUTA 3ILPA 3QP3A 1OD7A 4ZXBC 5L6YL 1OOAA 4G6MH 3E2HC 1NC4D 4G8FA 1CU4L 2XPGA 1UC6A 3H0TB 1KACB 1NAMH 4ZYKB 3RWGB 1F58L 3ZKMD 3KJ6L 2IMMA 2QSCL 2ZUYA 3MRIA 2GTZA 2LVEA 5MENE 2XG4A 2R4SL 1TTGA 3CFEB 5E7FA 1LILA 2J3SA 2JIXB 3BAEL 2J8UF 3D39B 3EYSL 5DO2D 2GJ6A 5GS0D 2A1WH 3JWDC 1YPZE 4Y4HC 1MWAL 5GSRB 2V9TA 1L9NA 3REVA 1AO7E 4NN5C 5D93C 2DQTH 3S36L 5HYQB 1CR9L 1GHFL 2X1OA 3IF1A 4UU9B 3RBSA 3O4LD 3EOBB 4JO2L 1G7HA 4NC2B 4GRLA 4F7MB 1QKZH 2HT2C 2X2YA 1T6WA 1RUQH 2ZG2A 3CFBB 3HG1B 5EBMB 4R4ND 1NCDL 5HYSG 4FG6D 4R26L 2IGFL 4Y4KB 1FN4B 5KOVC 1JF6A 1Z9LA 3TCLB 5F7EL 2WBJC 4F7EA 2FJHA 1A7BA 4PRHA 4QGYA 5E8OB 4EQ3A 4PJFF 4PS4L 4ALAH 2HLFC 1L7IL 1BGXL 2P47B 2VLLA 1FCCA 1CLOL 3X17A 2Q1EA 4OD3H 3OR6B 5AZEH 2MKLC 2AJ3B 2CIIB 2P5WA 3KLHC 5L2KE 5I0ZA 1WZLA 3MZTA 2DYPB 2C26A 3UCRA 3BWAA 4TUKH 2W9DL 3DETC 5TDPA 4KTEH 4GG6F 1AJ7H 3RTQB 3IDUA 2D7TL 1VESA 3PQYD 1MCOH 2AEPH 3U46B 2XN9D 1WWAX 2AKRB 3L5HA 1MLCB 2VR9A 4G5ZH 1INQA 2EDYA 4ZTOH 4H20H 4CAGA 1GJIA 3TH2T 2PYFA 5C92A 3BN9C 3ARDC 3QHZH 1T7YA 1HHJB 4I9WD 5KSAD 2ZCLH 3QT2A 4WWKA 1F42A 4U6TA 2MHAA 4P9HH 4G8GA 2ZG1A 5C0DA 1N3NB 3HI1B 1QYGL 3I84A 3PIQB 5DXWA 1JTPA 5GJTH 4YDKH 3P9MB 2FO4B 4D9LH 5E5MA 4DEPC 3U36B 4OUUA 5CJQH 4HK3J 4CU6A 2JJSA 1DE4A 3FQTB 3PGFH 2BSTB 1B2WH 1DSFH 3FQRA 5HYFA 3HKFA 3ARWA 3QFJD 2DKMA 4DGIH 2EDNA 3MLZL 4X6FA 1XZ0B 3U1SH 1YEIH 3NZ8A 3MMEA 4KAQH 4L4VE 4BFIA 2H26B 4X7TB 2Q7YB 4GFTB 5CHNB 1MIMH 1RUPH 4FFZL 2ADIB 2V9QA 3C6SA 5ADOL 25C8L 5J6HA 1RY7B 3MOQA 1ZVSA 3FL7A 3UPCA 4JJ5A 4GXUN 3ORJA 3QDGD 2J6EL 4MXWH 3OKMB 1T1ZA 3I75B 5DHVB 2FJFA 4NNPL 1HI6B 3WHE1 3GSUA 1MHHA 5JUEH 1KLUB 3MLYH 1KTKE 4IMKC 5DJ8A 1DFBH 4ENEC 5DGQA 4XBEH 2H3NA 5I1DB 3FZUD 2QSTA 1KCKA 3DVNA 1TJGL 1G9MH 3MJ9L 5D7LB 2V5YA 3C5SB 4OFYD 5GRJH 2E7LA 1HSAA 2LAGB 5ISZD 4F3FA 1UJ3B 3NACL 1JTOA 5T3ZH 4N9OB 1M4KA 5IW6B 3V79C 1LO4H 3REWA 2BVQA 2X9WA 1NCAH 5KSUA 5FCUH 3SDAD 5I1JL 1GXEA 5B38G 2XTJC 4MGXA 1BZQK 5F1NA 2X7LA 3IDXL 4ETQB 1HHGB 3IDJB 1P6FA 4HK0A 4HUVB 1U6AH 3DYOA 1FP5A 2E9IA 1JZ6A 3ARBA 4M1GH 3X3GL 4P9HC 4KPHH 3MV9B 1QO3B 3LKSB 1HOCB 2FX8L 5DJ6B 2QKIA 2LV4A 4MD4B 1F2XK 5F1SA 1RIVL 3DV4B 3PL6D 1AFVH 4NJ9L 2JJTA 2V5MA 3ZHKA 4Q0XL 4GBXA 4FNLL 2W60A 3ROOB 3RDTB 4N9GA 3LD8B 5BZWA 4UT9H 4U6HB 3ZHLA 2VXTH 4WFGD 4ODUA 1A7RL 2IAMA 4TSCH 3MNZA 5GGVY 1P4IH 1BF2A 4M7ZB 5C6TH 3RWDB 2Q3ZA 4LARH 1I3GH 1R5VA 4WO4C 4U3CA 4X4XA 3OJDB 1BX2B 4HIXL 2CDFB 4WTZG 4UQ3A 5D7SL 5IB1B 1JGEB 1Q72H 3MR9A 1OAXL 4ZSOB 3QPXL 4B7IA 4KRLB 4EDXB 4QF1B 4WW2C 3V7AG 1UYWH 2WWKO 3D39D 3HI6L 3WHXA 3CDGB 1WUNT 1CD8A 4JB9H 1CLCA 4PUBL 3O2WH 1CGYA 1TVHA 1F4HA 2O26U 2XY2A 2CDEB 4JRXD 5K93A 4EKXA 1LQSR 3W39A 4Q74A 4TNWF 1YEEL 3BUYA 4OV6F 4JFPA 1G9MC 2Z8RA 5TF0A 1TPXB 3QEGL 4Y4KD 1R3JA 4GXVL 4YDVB 1V3MA 3VD4A 5MENB 4LU5L 5FO8B 4Z95L 3BKCH 4OM0L 1JK8B 2AK1H 3BIBX 1YPZA 4WCYH 5D70H 2AJVH 5C0RL 4OJFH 5BVPL 1C5DB 1UCBL 3GHBL 2BVOA 3D3VE 4P5TC 3IAGC 3WS3A 3V5DA 2C3VB 5IG7B 4U1MA 5C07E 5MEPB 4LEOB 3EYFB 1PEZA 4NT6B 5ICYB 3KPPA 3RPKA 1T2XA 2NY0B 3B5GA 3TJHD 4DFIA 4TTGA 4U6YA 1UJTA 2R0ZH 3LKQB 4O2CA 2VDLH 1RURH 1KJ3H 1YZZA 2NW3A 3W9DA 5DFVD 4V1DD 2XIDA 3KPLB 4QTIH 4JHZA 5HI3D 3DSFH 2DKSA 4K23H 3TZVB 4LFHD 3B43A 4Q6YA 3HR6A 1NSNH 4F9LA 1F3DJ 1BFTA 3BDYL 5L2KA 1S9VB 1RJLA 2DQCL 1AY1H 2YBRA 3MJGX 1M71A 5DI8B 1OP9A 1XGTB 5C0NC 3SJVE 4M6AA 5KVEL 3G6JA 4HBCL 2AERT 1VSCA 3KPRE 3BPCA 2XZQH 5EU5A 3VI3E 3WN5A 3GKWH 3QUKB 2C4FU 2VAJA 4Q9QL 1I9RH 3K3QA 1DBMH 4PGJA 2QR0B 1YEDB 3NA9L 3OKOB 2A0LC 4XCEA 5CWSB 5EU7C 3WMSA 3EFFB 2BSRB 3AB0B 2PW1A 5IFAL 1UVQA 3TIEB 3H7LA 3F58H 1CDIA 1IGTA 1K8IA 1ED3A 2EDOA 4XNXL 4NPYB 2ZUVA 3SPVA 4POUB 2VN7A 4UNUA 4YK4B 1U8IB 3GM8A 4L3CA 2HJKB 3MV7E 3RNQA 1JV5B 1ZE3C 3F8UB 1IKFL 4X5LA 1FYTA 4U1HB 2HT4D 3BP6A 1ZTXH 3QCVH 1OHQA 3VFSA 4PY7B 1MFDL 5E2WL 1ZGLP 3NCMA 3FONB 2WM0A 1C7TA 4EUPG 3EDFA 4N8CL 5GXBB 4Z7UB 2R56L 2IBGA 5BZDA 4L4VA 1XEDA 4UBDD 1L4IA 5HDQL 4TUJB 3UTSA 3QUMH 3N1QC 4G6AD 3H7BA 4KZEL 1Q9WB 3K81A 3VFUA 4X98A 4YO0B 3MV8E 3DX9A 4JRYB 5EO9A 2GSGA 1EO8L 5FYJU 3CH1B 5D71L 5J12C 2K9UA 5JZ7D 4XVUC 4P23D 4HUWA 2Y07L 2EC9U 1KLFA 4IS6B 3FO1A 2WWMD 1A9BA 4LRIC 3MPCA 4DKEL 4M5ZH 3HRZB 5E8EB 5E5UB 4ZDHB 3CXHK 1MCIA 1J9CT 2VR5A 4YR6A 4JM2A 2ZSVA 4LKCA 3PHQB 1BBDH 4M43H 4XMPL 4HHAA 4X6CA 4QCIB 2Q86B 3RNKA 3PG2A 3C5JA 4WHTB 1NEZA 2EH7H 3TVMA 3V5HA 3ZLQC 4H5SB 2GT9B 4R3SA 1RU9H 4N1HB 1U42A 5DWUH 5AWNH 5AZ2H 5EU6A 2J5LB 3LQAH 4JAMA 3RDTD 2NXYB 4JFOA 2P8LA 3DECA 4FZ8H 4HC1L 3SQBA 1RIUL 4PG2A 3PDOA 3Q1SH 3MLUL 5BXFB 1BFVL 5I8EB 1UA6H 5I9QB 5HXMA 3FAWA 1H3VA 4NQCB 2UYLA 3EYOB 1BJMA 4PGDB 1CDJA 1M05B 1C5CH 5CIPB 3SGDH 5FO7B 2GW5A 3LKNA 5EU3A 1P7QD 4UIKH 3MROB 4UV4L 4W70A 1T4KB 2Z91B 3S37H 3QUZD 2KZWA 1C7SA 1P6AB 2CK0L 2PO6A 4JO4H 3VXMB 3O3UN 1ZS8B 4PV8A 3HCVB 2I5YH 4BSVA 4K3HA 5GISH 3Q6FB 4RGNC 4X5WB 2ZCKH 4M6MH 4JO1L 2VDRH 4L9LA 4NRXB 3QZWG 1YNTB 3QBTB 3MRFA 4E41A 3GDBA 1FPTH 5ESQB 4DGVL 4UT6H 3BVNB 3HE7C 5E2VH 1NBQA 5TE7H 5DMKB 1MVUB 1P4BH 3I02A 1G7MA 4JZNA 3BISA 1NGYA 4KU1A 3Q6GH 2BSSA 3BXNA 4GQPH 2NY6B 1IAKA 3V4PL 4JFZH 1OD9A 5F3HB 1QSED 1FLTX 2GQHA 4Y5YA 3VWKC 1IZJA 3RKPA 1H15A 2AXGB 3MBEB 3SOBH 2A9MH 1Q9KB 2MNUA 1HIMH 5E4IA 1GOGA 1WIUA 1OTUD 2MKWA 2NY3B 2NY0D 2BVEA 5HYJE 1F97A 4FQQB 1MCQA 5DVKA 4DN3L 5ALBL 1A6UL 2L7UA 5F7WC 4D0BA 2ED9A 2X89A 4TQEH 3AREC 2MPAH 2YN3A 5ANMB 1MAMH 3HC0B 3NCCB 4HUXA 1I9IH 1XCQA 4XC3H 5EORL 4MMZC 5CZVH 2PXYA 5J06A 5H2BA 3ROLB 1QFUL 3VH8A 3GSNA 4A6YB 3S8WA 4J1UA 3D3VB 5DF0A 3CH8A 5C07A 3EO1A 5T1DH 4EN3C 1U3YA 1GIGH 2EZ0D 1F4WL 1LK2B 1R6VA 1EEUA 1OWWA 2X4NB 5HGBA 4N0CD 2EIDA 3MNWA 1FNAA 2VLMD 4Y2DA 3T2NL 1JHKL 4L29A 4CADB 4P2RB 5EOTB 4XZUA 4K7FA 4BELD 1XIWB 5E70A 3PWPA 5F7FA 5ITBH 3QISA 5T5NG 3ZDYF 5ITFA 2YK1H 4YQXL 1S9WA 2W38A 5D9SB 5CSGA 3B9KD 5DHYA 2VLJE 2QQKH 1U8KB 1U8LB 5IFJA 3SJVA 3WS6A 3I50H 1MCNA 1MJ8H 2RBLA 1NLBL 3FFCE 3T3PE 3KPRA 3MA7A 4GRLC 5HVWA 1DQJA 2H8PB 3QA3A 1KG0B 2E6JA 3D85B 2J8UA 4RGMB 1UWGH 2C3XA 5IV2A 1UENA 4KRMB 2V2XB 4JCMA 2ED8A 3QG7L 5EUOE 2VDML 2D7PA 4Z78A 5FHAL 5DMYA 3U0WL 1G0DA 1CZ8H 4UB0L 1K85A 1VHPA 2IPKA 3EOYG 3VDCA 3O4OB 2OLDA 5F96H 5BVJB 2RR3A 4PIRF 4JFDB 4NO0B 1JYWA 5EWIL 5CP7A 2NY4C 5IT2H 3DX7B 4YAQA 3HFMH 4DKAA 3JVGA 1LO5B 4JRYD 3RI5F 1FFPB 2AGJH 4PJGA 5IF0B 3MLXH 3MV7A 5FYJD 4APQA 5DJAA 1ITCA 5E9DA 3OXSB 1KPRB 1YYLH 4I0CC 4CJ1A 4NKIL 1F90H 1JMXA 4KFZC 3GI8L 5IVXA 3IXTA 2EO9A 3K8MA 2BY3A 3S35L 1HK6A 4OTXL 3MCKA 4S1QH 2X09A 1FG2B 3D18B 2EYTB 4R96A 3I6LE 4WWKC 1FJ1B 5DURD 5TDNB 5F7NC 3B3IB 4P2OA 1ACZA 5C9JA 3MV8A 1QFWH 4OLYH 3OXRB 2FBJL 2HFGL 2UV3A 4R97C 4QHMA 2EDJA 2F58H 4K7PL 3INUH 1U8HB 3JWOH 2JJSC 2Z8VC 4M7KH 3GMLB 1TMCB 3QDJE 3AXLB 1HQRB 3HRPA 1J18A 1EK3A 1MJUL 4KMLB 3B8SA 4YXKH 4NQCD 4NDMB 5KS9E 4K3GA 1MREL 2NY7L 4YBQD 2KBGA 4LSQH 4HWBL 2YD9A 1KN2H 5LCVL 3I2CL 4DCQB 4JHWL 5JPMB 3H9SA 3MRJB 5J56B 5KN5A 3WNKA 2F8XC 2ITDA 2X4UB 1JFQL 1BIIA 1WTGT 4Y88A 4FZEH 4XHJC 5IFAH 5IMKA 1W8NA 2VDNH 4LEXL 5AG8A 2V2TB 3B2UD 4FQ2L 1NGQL 3VXMD 5LXGL 3QXDA 3KYMA 4NKMB 4XXCA 1FE8L 3LKOB 4QYOB 5C2BL 4XPBH 2DQGH 2GFBB 1KJMA 4BSWB 3OQ3B 2RCSL 5AYUL 4YHML 1IL1B 1BOYA 2XKNA 1G0YR 3CMOL 1CGWA 2CUHA 2P24A 3AFLA 2NY1B 1OSZA 1FGNL 4AEIL 3CSGA 1F3JA 5JPNB 1XGRA 4AM0A 5L2JA 3EO9H 2FEDD 4NFDA 1WFOA 3HUJA 2E7LC 3L3GA 5KSVB 3BE1L 1TNNA 3PWUA 2C4XA 3C9NB 4PJBE 2VKWA 1NBVL 1KUMA 2NY6D 1A3LH 1P5VA 1WFNA 3C08H 2FEEI 3BZEB 1B0RA 2Y06L 3TWCH 3WDHA 2VMFA 4HS8H 4IHOB 2YC1B 4R7DA 1JWUB 3ARBC 4JN2B 5E8PB 5HHQA 2Z8SA 5MP6L 2BNRE 3IDMB 4Q58C 4QOKA 1UB6A 4PLOB 5MERA 2CPCA 1OARL 4ZFZB 4NUGH 1RV6X 1GGCH 3MACL 3B2VL 3GSRA 2BNQD 2JJTC 1SBBA 3KYKL 1DANU 4GBXC 4YFDB 4RFNB 4EBQL 1JPSH 4DTGL 4OLXL 2DQIH 4PREA 1KJ2A 2FIRT 3AU1B 2VXUH 3CLFH 1X5FA 2IAMC 3MUZ1 5FUCE 5J1TC 3ZTJG 5D1XD 3WXVL 2EDQA 2VE6B 1CXLA 5L0QB 4XCCL 1BECA 5FDYA 3W11D 3SE8L 5KTEH 3E3QC 2F53E 3ZE2F 1CICB 1MEXL 5HI5D 3S7GA 1NUFA 3T65B 2DDQL 3PP3H 3SGEI 4EIZC 2O5ZL 1ND0A 3CFKA 2AW2A 3CFJA 2UY6A 2QQLL 4XP1L 2AQ2A 2NW2A 4P2RD 3KDMA 4AG4H 5DRXA 1T5XB 1XIWD 3H6JA 1UQSB 3QCUH 4QRUA 2HFEA 3NH7H 2QQNH 3QB7C 2F8OA 2FD6H 5DEFB 1V3LA 4WFHE 4M8VA 1G6VK 3VFVA 3QH3B 2ARJB 1DQDL 1FNEA 5SV3A 3STLA 1Y6KR 1NC4A 2B5IB 4RAUA 3UC0L 3A6CH 1T1YA 4P4RA 4U6VH 5IBTH 4LDEB 2JE8A 3GIZL 2GK0A 2XZAH 5D1ZB 5E2TH 2FZ3B 5DA0B 3D85D 2FEEL 1Q9OA 4CVZB 4KQ3L 1CGTA 4HWNA 4YGVA 4GS7B 1QBML 4FS0A 1KXTB 1UZ6E 3VW3H 4Y16A 1IM3B 1D3CA 4Z7UF 4DGVH 3VGHA 4LHUB 2BX5A 3PP3K 1URLA 5FGCE 4CN1A 4DKFL 1QRKA 4JFDD 1KIRB 3FFCB 1Q9LB 4H1LA 5F7DA 1RK0B 3R8BB 1YY8B 3AS3A 5IOPA 2G5BB 2HKFH 4YC2B 1A02N 4BK4A 4M6OL 3F12A 5JLZA 3TO4D 3SKOA 5EUOB 4L4TE 3G08B 1DDHB 6FABL 3BRFA 4Z5RA 1LD9A 1OTTC 2JELH 1EEYA 1E6JL 1P84K 4OKVA 4GKOA 5DJCB 4F9LC 2BY0A 3P77A 1CD1A 3ARUA 5JW3H 4JPIA 1A6UH 1NKOA 1VENA 4X6BB 1IQWH 3LMJH 4MAYD 3PQYA 1T0PB 2YUWA 3WCYA 2XN9A 3GSWA 4PD4J 5BV7H 1GZPA 2OP4L 1WBYB 2Z35A 2Y6SC 1RVFH 3WN5C 5DDHA 4ONHB 1VGEH 3TH3T 2WBWB 5GGVH 2DM4A 4XCYB 4NGHH 2PYEE 4MD5B 5IMLB 4I0PA 1YEFH 2BCKB 5L8JB 3ILQD 3UPRB 1FZOA 2C1PB 3HZKA 1FV1B 4HKBB 4M48L 4ZFGL 2HLAB 3HMWH 3RJDA 3ESVF 5B3NA 4WU5A 3PHSA 5CJ5A 1VADA 3T0EE 1FIGL 1V7NL 2P4AB 1IQDA 5J6GA 3A6BL 3SGJA 2VABA 2CLRB 4L3EE 2FO1A 5F6IB 4GKNA 2Z31B 5K9JL 1A6WL 3BIKA 5J11B 4Q7DA 1HHKB 1SYVA 5L7XH 4JDVA 4LVNB 3RU8H 3JTSB 3MRHA 3DGGB 3TBWA 3QDJA 3O3BB 2NX5D 3THML 4NCC1 4QRPB 2N7AA 4HIJB 4XP6L 1FH5H 4K3DH 3TNMA 3I6GB 1HZHH 5CBAA 1J5OH 2VQ1B 5CEZE 4ERSL 2NY1D 4PGBA 3QDGA 2P8PA 3TPUA 1DEEB 2FDBP 3RWIA 5H37H 3W0WE 4U0QB 3PGCA 5HD8C 3H9YA 1A6TA 4UI2A 4WEUD 3LQZB 5ESVB 5JNYB 1TQBC 2M26A 2VLKD 3QG6A 1BQHG 3U0TB 1TZGL 4PV9A 4FQCL 4NM4L 3QYCA 3HAEA 4JZJA 4YH6A 3MCLL 1OVZA 2R2EB 2DB8A 1QLEH 3O3AB 4OFYA 3G6DL 4JM2C 5FV2A 1PLGL 1WICA 3U4BL 4PB0H 4K8RH 4RWYL 1AR1C 1OPGH 4OGXH 3TVMC 2OTUB 2VWEC 4YX2H 3SDAA 3VFMB 1A4KA 1VDGA 4PJBA 3ISWA 4BK5A 4QEGA 2DD8L 3U4EB 4UTBL 3WSQL 3TIDA 1CD0A 3DHMA 4PG2C 1IGFL 1XMWA 1U8QB 4GW1B 4XNUH 5ICZA 12E8H 3KPNB 1MF2L 1NDMA 3PL6A 4ZUWB 5GIRA 1ZGLB 1QG3A 3GSNH 4DZ8A 4JY6A 4V2CB 5DQJA 2A83B 1CICD 2BNRB 3VXQA 4CBPA 1D5XA 2JJVA 5ICXA 4P2QD 3F6LA 3NOIA 2VDQL 2Q20A 1G7LA 1S9YB 1J8HE 2GK2A 3CK0L 1CFSB 1IGML 4PFEA 1M7XA 2QADB 3L7FA 4MNHB 4P2CG 4F8QA 2PO6C 4NBYB 1NUNB 2W91A 3L3JB 4OQ1A 4Y89A 5TF1H 3DPBA 4KY1L 4NZTH 2Y25A 1FQ9C 3FO0L 3GJFB 5IB2A 2ZUQC 1PSKL 1RJYA 2F53B 3IDNA 4J3OC 1IAMA 3QRGH 3VMNA 4WJ5B 4PRPD 4QWWD 2ZUTA 3VG0L 2X4RB 2DLGA 3TO2A 4L9LC 3EDKA 5DUPH 1PG7W 1OAUL 4GW5A 4YHMH 2VDOH 3D39A 5IJVB 3O9WA 4KJWC 4WV1B 2HVJB 2FR4A 5GZOC 1LO2H 4JRXA 4M93C 1KB9J 5HYQA 1GZQB 3HPLB 3T3ME 1ZHLA 3NZHH 4Y5YC 1NEUA 1HE7A 1PW3A 3OKNB 5FYKD 1J86A 1AGEB 3WLWD 3JV5A 2PCPA 2DAVA 2YPKB 4K8RC 4OI7A 4DKDC 4RMTA 3U2SA 5DK0B 5C0IB 2XXMB 4NN7B 1FLRH 3RVXD 1MCHA 1QBLL 2ORBH 2FGWL 4JJHA 1BOGB 3VDAA 4JQVA 3VRLF 1HHIA 4JG0H 1YUHB 1OAYH 1TZIA 3BX7C 1J12A 5HVFB 4MMXC 3GBNL 1N5AA 3KPMB 3C09B 3RGVB 1CFNA 1XGUB 3TT1L 2XNAA 4NZJA 1FL5A 1OAZL 3DWTA 5FGCB 2Y5TA 2PXYC 3BGFB 4ISVA 4QNPF 3QNYA 4ONFH 3UJIL 1FNSL 1FNHA 3WLBA 1JGDA 1KB5L 3OKKB 3EZJB 4E0RA 2R0WH 1EBPA 4V1DA 4EI6A 5CKAA 4JLRB 3MRNB 4Y2DC 4L4TB 4S11A 1WZ1L 3KGRA 5K9OB 5HHNB 5A2IH 1CG9A 3BO8B 2YA1A 4W6WB 2B1AH 1T3FB 4OQTL 5FYLD 4MA7H 4XMLH 2F54E 2VC2L 5D2LB 3QUYD 4YUEL 1VACA 4Q9RL 4UV7H 4RQQB 3WS6C 2VAAB 5EBGA 3ELAT 1WLHA 3GBML 4LCYA 4IRZH 5TE4H 5TH2B 4YHIB 5IWLA 1YY9C 4G8EB 3FRPG 3HNTH 1I9JL 3Q3GA 1MCRA 4XNMA 1T66C 1B4RA 2P7TB 4L8SA 3FB8A 4YHYB 2PYEA 4QHNB 1N8ZA 1ZGLM 2PR4H 3LEYH 1KCVH 4GRWE 1DQQA 5DYOA 3QR2A 4QRPD 1KXQE 4U1SA 1INEH 4ELKA 3C60B 3DV6B 3TBSA 4GKSA 3ZDZF 1FVCB 4YDIL 1YECH 5EBLB 3UROR 3VD3A 3T0EB 4JHBA 3ULSA 2WMPA 1TDQA 5CKGA 1TTFA 1A5FH 4JDTL 1DBBH 3JVGC 1N64H 1DUYA 2DJSA 4I77H 3WNMA 4APQC 4HMDA 5CZKA 4OCRL 5DJZB 3ARXA 4OAWA 2VXVH 3IDXH 1HINL 2VITB 3RZCD 4N5ED 1A3RH 2R8SH 4U3XA 3LN9A 2K1MA 4FFWD 1JYNA 3IXAB 4MJIE 2FNBA 3VWJB 4QY8A 5C7XH 5I74B 3QIUB 1S7XA 2P44B 2IFFL 3EDDA 4WTXA 1J11A 5FUZH 1JNNH 4P2OC 1JPFA 4EQ2A 2A38A 4KJPC 4KTDL 1D5BB 3CIQA 32C2B 4PJIF 1IVLA 1JE6A 2UWEE 5CGYD 3W0WB 4DN4L 1MQKL 4P23A 4NRZB 4XRCA 3FTGA 3H9ZA 2J7LA 4M7LH 4QTHB 1RZKL 4XXDA 2D7MA 3IT8D 1IAIH 3MLWL 1I8IB 3D0VB 1KJ2H 3QFDA 3GGWA 3WL9A 1HOCA 1WIPA 5DJ6A 4PRBA 4Z0BL 4DW2H 1VFAB 4MD4A 1T03L 4LCUB 2WP3O 5LKNA 3DURA 4KGJA 4Y5XB 3NGBB 3ZE1E 2V5RA 3UTOA 4NO3B 1LMKA 2F5AL 2I25N 1QVOA 5CILH 2X4TA 2DQEH 5CINL 4N68A 4LSSH 1S3KL 4YIQA 5FA3A 1N59A 2QADD 5GRWA 3BHBA 4AY0A 3EJZD 1H3GA 4UOW0 4GUPA 5JHLL 1EMTH 4KKNA 1MFCH 2B4CH 4XXCC 3HHRB 3VJ6B 4FN0A 3TT3L 1L0YA 5MI0B 1QRNE 3RL2B 1E4WL 2CIKB 1MUJB 3G6AB 5I0DA 2BHZA 2DQUH 4D2NA 1P7QA 4KUCD 4JZOB 4ODWB 3CXDL 4RDQF 4WWID 2C9AA 4FABH 1A7NH 2ZP0T 4HKJA 3UTQA 3QUZA 4QRSA 4JPWH 1FFNA 2AEQL 1J8HB 1ETZB 1HILA 1U0QA 3FB6B 4ZAKB 3RWHB 4A2LA 4ZD3H 5F1IA 4XVTL 1KJVA 5JXED 1J0ZA 3RX5A 1RUKL 2EDKA 5GS0H 2PF6A 3MOBH 3AC0A 5EU4A 4LLUA 1OT2A 4P3DB 3OJMB 4OCLC 4XVJL 1KTDA 1IGCH 2P46B 2DWEB 1XF5A 3S88L 3I6KA 4PJ8D 5FF6B 1EX0A 4MXQD 5D5MA 4TVPE 5E99H 4FMFA 5GQBA 3P4OA 3FQUB 3QIWA 5IQ7H 4HJGB 4R7NA 1PKQE 4H1LH 4JN1L 5DMJB 4KDVA 1I8MA 1AQDA 1LDPL 3AMLA 1KTLB 4PLJC 3BKJH 3U9PH 4I3RL 4D0DA 5IVOA 4UDTA 1ZHBB 1LO0H 1QSEA 1AD9A 5T3XD 3RY6A 1R24A 4FXLA 4LAJH 5EUOF 3X3FL 15C8L 1JHLL 2AJXH 4GQ9L 2DQHL 2DM3A 5B39B 3C5ZB 1IGYB 1SM3H 2J88H 3FAXA 1HYRC 2DQJL 2C3VA 4AEHH 1NCUA 4LRNL 2D03L 2C7UA 3WFDL 2Z92A 3U0PB 2DLFH 3O6MH 4L8CA 5TFSH 3LRSA 1TZHA 3R1GL 2X4SB 4KKAD 3SGKA 4D94A 4CMHC 2ED7A 1KELL 1WC7A 4NO2B 5D96C 2ZG3A 1UACL 9CGTA 4QRQA 1DR9A 4Z7OE 3QNZA 5HHMD 1U8NB 2WNGA 1WSST 2D3VA 2B4CC 1HXMB 4LQFH 1RULL 3RUGE 5KG9B 2VKXA 4GOSA 4IRSB 4WU7A 5D8JH 1ONQB 4E9LA 4IBLT 1Q1JL 2ZCHH 1LEGB 3ZKMC 5HVHB 1YEDA 3NFPA 5CWSA 1ES0B 4H25A 4KHXH 1B3JA 3SKMA 1PSKH 1T6VN 3N9GH 3TIEA 4OCXH 2DM7A 3B9KA 2AJZA 1JGLH 1RZJH 3L95A 3C60D 4I3SH 4KHTH 1X6NA 2F54B 4Y16C 2HWZL 2I07A 3ALWA 2KL6A 1RHHA 4NO5B 4OFIA 1OB1B 1P4LA 4R4NC 2DRUA 2H32A 4L5FH 1XF2A 3P73B 5KVGH 3O3EB 2BNUA 2WQ8A 1MH5A 5I1GH 2ESVE 2YRLA 4M5YH 4N5UA 3MQIA 5F8QC 4PJAE 3CJJA 3KNBB 2KQNA 4R90L 5K33A 5I8KL 4GRWB 2HTKD 3MRCA 5F88A 5IGXH 4F33B 5JW4Q 4L1HA 1PZ5B 3NAAL 2X4PB 3VWJD 3HAEH 4YDLB 2JTDA 1DCLA 5GJSH 1HN1A 2DLEA 3S36X 1YC8A 1G7JB 4YBHA 2YUVA 2W9EL 5I8OH 1G9EA 2NNAB 1ZT4A 3WFBL 1NFDA 4X4YA 3EDJA 2HKHH 1J1OH 5DJDB 3LRGA 4FQXB 1TFHA 2AVGA 1QR1A 1XF4A 1BHGA 2VUYA 3QWOA 5C71A 2DIJA 3BEWA 4LF3A 2ADJB 4PRAB 1JF1A 2OXHA 4K3JH 1CE1L 5FM8A 2VRAA 1A2YA 4G9FE 5IQ9A 3IGAA 5I18L 5LGHL 2ZPKL 3BGMA 5I2IA 3OAZH 4QCIA 4TPRH 2A6DA 4K94L 4MJIA 4I0PC 5FKPA 1UM5H 5H35B 3S3PA 1G7QA 2EYSB 4XGZB 3TEUA 3STBA 5C70A 2FB4L 1YNLH 3QEUA 1KPVB 3FQXB 5DJ2A 1J1PL 5I1AB 4NRYB 2UWEB 3SEPA 3RWEA 3SGJC 1MFAH 1SYSB 2NTFB 1AXTL 1SEQL 3MUGB 3UYOD 1A14L 3NCJL 3WFHB 1E6OL 4GG8B 4ZPTA 5HPMB 5TQ2L 4ODSH 2AK4D 4G6KH 4GAGH 4P46D 5IB3B 1UB5A 1HXYB 2IANB 5I71B 1RZJC 4PGDA 2F19L 5SWZB 5DVMA 1I3UA 1YJDH 1JYVA 3W2DL 3KLAB 2YWZA 2VZTA 3FQNB 5CIPA 3TGXA 4OZIA 2VERN 3OPZH 4HDIB 4UT7H 4NUJA 3G04A 2HJFB 4HLZG 4MAUH 3UBXB 4KUZL 2NLJB 3FB7A 4IIQA 3BH9B 3CPLB 1KPUB 3JV4A 1JHTB 1OGAB 4MA1C 5EOQL 5F3BA 3T0BA 3RWJB 1CGVA 4JFYA 4KROB 1LEKB 4KVCH 3Q6FA 1J05B 3M8OL 4KMQA 2Q6WA 3ULVD 2VB5A 3HE6A 1QRNB 4JZJC 3GMQA 2BVUA 2YKLH 4JG1L 5IHZB 5A2FA 4P57B 1YNTA 1MRDH 4KI5D 1L6XA 5CUSH 2VYRE 3BFOA 1QTYT 4F15B 2FIKA 2IADB 4OD2A 1NMBH 4BA8A 1B0WA 5F9DC 2EXWD 3QDHA 4U6XB 4LASH 1BJ1J 3CDFA 4WTWA 3F7QA 3GK8L 3SDAC 4B50A 5I1EH 1RIHL 3UYPA 1KXVC 1DLFL 3WD5L 3C5ZD 3LIZH 2EH8H 3CZFB 3GJFK 4ODTL 5L9DH 1UWXH 1WZMA 3WNPA 2ZJSL 4CMMA 2W0FB 3UTPD 1XGYL 3LDBB 3MODL 3PL6C 1CFQA 1A4JB 3QXAB 1A6PA 4XAWH 2R0KL 2VXQH 1PKQA 1J87A 4LVOB 3BEVB 4Y19B 2NY5H 1KGCE 2BNQA 4X4ZA 3LEVH 4GMSL 1R3KB 4PJHE 5KVMC 3L6FB 1GGBL 4O2EA 4NQSB 5CEYB 2EKSB 5EFIA 4WNQA 5C9KA 1DL7H 4XNZB 5D1XA 2XRAH 4BQ6A 5B22A 5I1LA 3PWJB 4RX4D 2APBA 3F7YA 1WIOA 4XNQB 1N2RB 3E8UL 5FUCC 4KV5F 4TULL 5D2LF 5EZOH 1QEWA 5JOPD 2EE6A 3R06B 4XH2A 1G6RA 5IMMA 4IRSD 3MLTA 2ATKA 3V6FB 1M6OA 4IRJD 3CFCL 5C0CD 3O2VL 4CVWA 4UAOB 4OF6A 5C0BE 1KEGH 4ZUSB 1I1AB 3JV6A 3VXOB 3OF6D 1S7WA 5I16A 4JGUA 1WV7T 3QO1A 5DD3H 2VIRB 3O9WC 4DZBB 1UWXK 4F7PA 3L5WB 3KPOA 3UJTH 4OZGE 3LHPL 3HR5A 4WFFE 4MVBD 2FCBA 1U8KA 3BD4A 3EYVB 3RVTD 3V0WL 1T2QL 4KH2A 3RUGA 5ID1B 1NEZG 4KVNH 1RUAL 1AD0A 1ZLSL 3DROA 2BVYA 3ZSSA 3QEQE 4E5XA 4GW4B 2X9YA 4XB7A 3GMRA 5FOBA 4HS3B 2R9HD 4PJ9B 1KG0A 2EDRA 4PBVC 1FGVH 1OAKH 4OLUL 4P3CH 1WFTA 5B8CB 4YBLB 4J3TA 4PJ5D 4ZO6A 1IC5L 1IGIL 2OX5A 4KJYB 4JQVC 5JIHA 1XGPB 1WQVT 5EDXA 2DIBA 1M7IA 2CUIA 1IM9B 2ITCB 2QBWA 4JFDA 3IDYB 1UADC 1P7KB 1JN6A 4HGWA 1ZANL 4TYUA 4MJ6B 3SDCA 3K8LA 5H8DA 4OIAA 1A6ZA 1LO5A 1SJEA 1WK0A 3O41A 4MS8C 5E6IA 2A77L 4FQXD 3TJHC 1K4DA 3HS0A 2ESVA 2RQ8A 3TO4A 2IH1B 1UEYA 2R4RH 1C1EH 1T89A 4PJAA 4XMKL 4KMTH 1K3IA 5DFVC 1M7DB 2DBLH 4MNGA 4YE4L 3RJQB 4TSAH 3ZDXE 5I75B 5SWSE 3QULA 1Q94B 5LBSH 4E42A 3U4AA 3W9EA 3ARRA 4MAYA 5SX4I 2WUCL 2AJUH 3L5IA 2BP3A 4U49A 4Z77B 4Z7WE 4RAVA 2P5EB 4ZOCA 4A6YL 1TJHL 3KS0H 3WIHL 5IWLC 2APTA 3L3HA 4P59L 3FOLB 1JRHI 1HQRA 1FO0A 3ES6A 4LPCA 4G9FA 4LVHB 2HRPH 4H88H 1A9EB 4PJEE 4L8SC 3VA6A 2IAND 3C8KA 3QDME 5SWZD 3MLSL 5D7JB 4O9HH 1JZ8A 2R0LH 5T1KD 2BY1A 2XWJA 4HUMB 1UXSA 3MRGA 4HGMA 4O58H 5J3HD 5CSZA 2V2WA 3OKEA 5GSVA 5J0BA 3E6FA 1T1XB 5IK3A 5HHOD 1GVIA 1PY4A 4YHOH 3MYJB 4ZFFB 1OGAD 2F5BL 5C1MB 2HT4C 1E28B 2NX5A 1GOHA 4U1NB 4YFLI 4Z0XB 1I7TB 3QAZB 5KJRH 4H8WH 3FFDA 4F7TB 4NKDA 3CFIC 1K4CB 5TE6H 3RIAF 1JZ5A 2Y9RT 4HIHB 5IM7B 3IRZA 5EIIA 3H3KA 3IRPX 5JPNA 5A2KH 4G6AC 4KI5F 1EPFA 1AIFB 5HHPA 1NMAL 4FQLL 1QNZL 1ZT7A 4GH7B 3FN0H 1T22B 3O45A 1D5ZB 4F37F 5EOCL 2VLKA 1Q0XL 3BDBA 4GKZA 4P23C 2BRRH 5D1QB 3K2UH 1PEWA 4J3SA 3SO3B 2EDXA 3L3OB 4LLQB 1GC1L 2G9HB 4TN9A 3HNVH 2ICEA 1S5HA 3BDXA 1VB9A 4IHOA 1WISA 5IKCB 1JPGA 2FX7L 1TQCB 1RJCA 5DR5L 5EZLB 4U7SA 4AENB 2J1KA 4CRPA 4RGOH 4Z8FH 2OS7A 4FFYL 1CGSL 4PJIA 3GB7A 1JI1A 4JR9H 3Q5TA 3MRPA 4P4KD 4XHQA 2H2PD 4Y19D 4KI1A 1JRHL 8FABA 3W5MA 3X13A 5DD6A 1U2HA 1FFOB 3AU1A 2Z0BA 4RISH 4QRRB 3FB5B 2JJWA 4OCWH 5T5FH 4YHZH 5C8JA 4K9EH 5I17A 3BQUB 3LS5L 4N0UB 3P2TA 5TQ0L 3TYGH 1C16A 5D72L 3T4AB 1S7TB 3R0MA 4HIIA 3HC3L 1VGKA 4YXHL 2QEJA 3QQ3B 4P2QA 1EERB 5I8CA 4JEGB 2DIAA 4OM1H 2HG5B 1I1AD 4PJHB 4YHPB 3BP4A 1WF5A 3QUZC 5JQ6L 3SE4A 3DYMA 2D31B 2FH6A 2CLVA 3ZKXB 4ZNCD 2OJEA 4H8WC 3GMOB 4M1DH 3MRMA 4MYWB 1AGFB 2AABH 3UDWA 1I8LA 4O5LL 3KWWA 3P9LB 4M61A 4LSTL 4O4YH 3WUWB 3LRHA 4PRPA 4OV5B 1JGUL 4FP8H 1F11A 5JIKA 1DJSA 2CJUH 1FHGA 2FZ3A 3P11H 2G60H 1RFDH 4JQIH 5BRZB 1W72A 3QIWC 4LLYA 2W65B 3ECBB 4HUNB 4CVZA 5JO5A 3M8OH 4X5XB 2H32H 1IEBA 4ONGL 1EAPA 4F57H 1HYSD 4OZGA 4LSVH 1K3ZA 5JORB 3RY6C 4GRWF 1X5IA 4OLWL 1U2CA 1IM9D 5D7IE 3RVUD 4MQ7B 4PTUB 1N0XL 1NAKH 4LIQH 2EE3A 4AMKL 3QEQB 3IAQA 5EO1A 4PG9A 4GAYB 3WIFB 3DIFB 1UXWA 4HT1L 4IOIA 1A1NA 3N1FC 3P0VH 5JOFB 4WY7L 5FYJH 1L7TL 3NN8B 1YQVH 4HKZA 3WIIH 4PRID 5CCKL 3SGKC 3N85H 2B1HH 4O51A 4WI9A 2VXSL 3P9WB 5DJCA 3VRJA 2GTWA 4K9EC 4FQIH 4NCC2 4ODBD 3D2UD 4ZS7H 3IDIA 1LK3L 4MB5A 4OT1H 3ZE0F 5JIPA 2OL3A 5DK3A 5IROA 4XP4L 2EZ0C 3EW3B 3UZQA 1FL6B 4WUKH 5FHBH 2P5ED 2UWEF 4PTTB 2ATPB 3M1BB 4PGEA 3M17A 4R4FL 4GLRH 3RWFA 2V7HB 4ZTPL 1S5IL 1X5KA 3PP4L 3PNWA 3O6LL 4QHKI 4UDUB 2R2HB 4M62H 3TN0B 1FV1A 1UM4H 1CLYH 3NABL 4HBQA 5SWSA 3ZT6A 3QUYA 5KZCB 4MJ5A 3B9KC 3L9RA 5ALCL 5D7JD 2BC4B 5ESAA 4OKDA 1RD6A 1GAFL 2CLRA 1OAQL 1NCWH 5HPOA 5CIPH 4Z7WA 1D6EA 4HWEH 1TCRA 1F3RB 2Q3AA 1DBAH 2FX9H 3NFNA 3RIFF 2JK5B 3CSYA 3MJ8B 1BZ9B 1FORH 1KT2B 3LN5B 5GZNC 3MO1A 1S9KC 4HIJA 3NFSH 5JHDD 4PJEB 2Z4QB 2OI9C 1PX4A 4U7MA 1BM3H 3ZTNH 1GCFA 1NC2D 3QDMB 1RZGB 1R5IA 5EC2A 4UTAL 3OMZA 5I1IL 1I7RB 3TF7C 5EZIH 3PGDB 4GAFB 2DJ4A 1ZLWH 1VFBA 1OT1A 5L88H 2R2BB 2B7DT 2VOTA 5C0AD 4D9RE 1OCWH 1HKLH 1GGTA 2OZ4L 4FOMA 4KJQC 4YWGL 5FYKL 3DVGA 1UH4A 4U1JA 1BD2B 2PTVA 1H3UA 3ULUD 5CJBA 2JB5L 2A6IA 4EXPX 3RZCA 3V5KB 3GJEA 4S10A 4XI5D 2F74A 3T0DA 1FAIL 3PABA 5IHUH 4O00A 4X6DE 4NKOB 4RDQG 3VFWB 1H0DA 3FO9A 3S98A 5DS8B 1NGPL 3VXPB 3U4EA 2VISB 4KDWA 3BPNB 2R23A 4WGWB 1EH9A 3K1KC 4QRRD 1LO3L 1D9KA 1MNUH 4LHUG 3P4NB 5I66A 4HFWA 5DK2B 2X4OA 3S35X 1ZLWK 1NJ9A 2YD6A 1LP9A 5J9PB 2VDKH 1ZLVH 2UUDH 1TJHH 4FXKB 4YBQC 4ZNEE 4FTVB 1DQTA 1U36A 1BVLB 1WAAF 4BFGA 3VFPA 4X80H 2ICCA 3VI4F 5E4EB 1RK1B 4ORGA 1EFXB 2ICWB 1AGBA 3T4YA 1B0GB 1BBJA 3OR7B 3EYUH 5CD3A 3F7RA 5IEHB 1S7VB 4GSDH 4K7PX 5FUOL 2UZIH 1R0AL 2V5TA 4IIQC 3IVKA 5E94B 4Z7OF 1V7ML 2OR9H 3UTTB 3JXAA 3FO2B 5IVNA 4PJCB 3U48A 4Z7VE 4H26A 3WE6A 4ZXBB 3DUUB 3CUPA 4PGCA 3RWCB 3HE6C 3E2HB 1Z3GH 3JTTA 4HMCA 4LLVB 3QUXD 1I3RA 4WW1B 2L7JA 5JXAL 4KKLD 3VCLB 43C9B 5T3ZE 3V6OE 5IMOA 3O6FC 5BRZD 5CLWA 2FEDC 2Q8AL 5SV4A 2GUOA 2HVJA 4EOWL 3OKDB 3IFNL 5JW5A 2DQDL 4XC1L 3IKCA 2UUDK 4Y4HB 5C0JB 1U3HA 3LOWA 3O8XA 5ECJE 4NN5B 5D93B 3TJEH 3MSPA 4Y5VA 5DRZA 4LPVA 4PJ8A 4BH7B 3CVHB 3HN3A 4DAGL 5EBWB 4ZO8A 1P9MA 2Y36H 3V8CA 1EHLL 4OZ4A 5E8NA 2WBJB 5SX4H 4P5KB 1IILE 1Y6NR 1JP5A 3S5LB 1A1MB 5ILTH 1PQZA 4X9IA 4G8IB 1YUHA 2EIBA 5BO1L 1KSRA 1R3IL 5T33L 3GEWB 4N90D 2GKIA 1RZ7L 2RFXA 2A6KB 4F9PA 1YEJL 1IT9H 5J89A 5D7IB 4BKLA 3P4MA 3ZYZA 5D1XC 1P5UA 2YPLE 1JTTA 3WEXA 4NHCL 1YNKL 3W11C 1DVFD 4D3CL 5HI5C 1FZJB 3D87B 1JGVH 1ZWIA 2W0LA 1RZFL 2YSSB 5GGTL 5GRUH 1KIPA 2FATH 5EU7E 4XPFH 3B8YA 3ARDB 2FHCA 3PDDA 5FGRA 4U3HA 3BO8A 4D9QD 2CKNA 4U2YA 3TN0D 1TJIL 3LKPA 4YZFF 1A47A 1FO0H 3ESUF 3OAUL 4LPTA 5CBEB 4M3KB 5KZCD 4DVBB 2CKBA 2BFVL 3BD3A 4LPUA 1NGWB 3LEXA 2VAAA 3OX8A 5DVOA 2IPUG 4IJ3C 4X6EA 4DEPB 1PX3A 4G7YL 2HT3D 3E6HA 4JPVL 1A22B 4DK6A 4OD1L 2L4OA 4X8JA 4X7FC 2VL5B 2A6JB 4ZG1A 1U91A 1JNJA 3NTCH 5IIEA 5DC0A 5A16B 3Q2CA 4NP4L 4WUUE 1OP3K 5TPWH 4S2SA 3DO7B 2H2SC 4PJDA 3GSOB 5E56A 4CW1B 3HZMB 4JM4L 5E08H 3OZ9L 1J0KA 2B0SL 4OZHB 4XP5L 1NGZB 3L7EB 4AL8L 5HY9B 2DICA 3GRWA 3SDCC 1C8PA 3LN4B 5E6IC 5HVGB 5ID0B 1IEHA 5MHSD 4WI2A 4NSKA 4UNVA 3V4VH 1KC5L 1BD2D 4MNQE 3MRLB 4F80A 5HYEA 3VXNB 3TO4C 5ABDE 3ULUF 1N0XH 3U7WH 5J1AB 1AQKL 1T89C 3B6SA 3SKNB 2WUBL 3C6LD 3DXAD 2COQA 4RZCB 3OGOE 3IFOB 3MRQB 1T1WA 4ODVH 5DD5H 5BQ7A 1JF5A 1F02I 1ORQA 2AEWA 2FSEB 1MFBL 4RRPA 3FMGH 1DUZA 1XF3B 1MCWW 3EOTL 4OGYH 3BW9A 4MAYC 1FZMB 4HJ0C 2EDBA 5D6DA 1ZXQA 1NGXB 5DZLA 2XTJB 2VLRE 4QRTA 2YWYA 1OSPH 1YEGH 3O2DA 2OR8A 4LLAA 4WHYG 3RAJL 3KXFB 2HN7A 1PVHA 5C3LD 4HK3N 1QFPA 1ZA6B 2ZKHL 3QEHB 4TUOB 4N8VA 2Z9TA 3ILQC 5BS0E 1FFRA 4PRDB 4X6DA 4UINL 3DO3A 5C09B 3V0AC 1JBJA 2CLZB 4FTVD 5EIVA 3GSQB 1S7UB 3VXSE 2C3GA 1Y18B 3O6LH 4HWZA 4I48B 3BP7B 1EFXD 3RZWA 2GCYB 43CAA 4PJHF 4OCSL 3OHXA 2AK4A 1QLFB 4P46A 3MCG1 4YFEA 3FOMB 4JFFB 2R69H 4KGLA 3UTTD 1L0XA 4I1NB 3UPAA 4KK8D 2B2XH 4D0CA 3MLRH 1V5JA 4RGNE 1AP2B 2BOCA 4WO4B 3DX6B 2BOBB 4MXVE 1JWMA 2AAVA 4PJ7E 2VJXA 1QA9A 2NY1C 3DI3B 3IJHB 4JFEE 4LPXA 3GIVB 1ZVYA 4FQJL 5J13C 3K4AA 4EDWL 3O11B 4WFEE 4WW2B 4JGMA 4HW6A 3RHWK 1W72H 5ACLA 5GGRB 1X3DA 1DN0B 1XCTB 4PJXE 3FT2A 5I1CH 1MRCL 1A7QL 3F62A 3QCTL 2YPVL 4XPTH 1H3PH 4PR5B 5HGGS 2H6PB 4Z7VA 1HQ4A 2F15A 1I4FB 4LCWD 5DRNB 5DQDL 4MDIB 1FDLL 3K1DA 3PWLB 4BZYA 1SJHA 3GNML 3TBYA 5GGUB 1YYMH 3H9HB 3EKCA 4XP9H 1JNHA 5DD0L 1W0WB 3V6OA 3RA7L 5DJXB 1J88A 2X10A 1G0XA 3G5XA 5D7KD 2XWBB 5CEZL 3WKML 2IH3B 3K80A 3MA9H 2JLLA 4HUKB 2HLFD 3TYFA 3ME0A 1VFMA 4OLZH 4JFXA 3OL2A 4YXLH 5EC1B 4KRPD 5C08D 3B5TA 4CVXB 2JCCE 3VFRB 4PLNC 3R8QA 3RX8A