2VIVA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
total genus 58
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vivA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vivA01
4D9QA 3SU4A 2Z6BD 1EZQA 1C2JA 5DK1A 4YT7H 2H5CA 3HPTB 1SBWA 4MTBA 3LKWA 4TPIZ 1TIOA 2VINA 4JZIA 1ZHPA 1TA6A 1AHTH 1S0RA 3ATWA 4X1PU 4NFFA 5EQQA 4Y76A 2LPRA 1YLDA 3ZYEA 1QJ7B 7ESTE 1AFQB 1FQ3A 4FU9A 1O3AA 3SJOA 1DUEA 1FI8A 1MTVA 1WV7H 5HXFA 2FOBA 1V2KT 3L33A 1H8IH 1O3PB 1NRSH 2UWOA 2ZPQA 1BRUP 3M61U 3Q3XA 1SG8B 3Q00A 2TGTA 1O3DA 1QQUA 3M35A 2ZU1A 4Y8YA 2OQUA 2PGBB 2HRVA 2SGPE 2ZNKH 1B0FA 1Y59T 1NRNH 2HALA 1T31A 4NSVA 1A0HB 5FAHA 2A5AA 3F9FA 4GUXA 1J9CH 1W10U 2VVVA 1W13U 5T6FA 1JRSA 2AIPA 3A7WA 1K1MA 1O35A 1QJ1B 4NFEA 1LHEH 2VIQA 1AVWA 1WU1A 1A7SA 1ELFA 1TGBA 2G4UA 1T8LA 2QYIA 4MVNA 4YO9A 2BY5X 1O2MA 2RCEA 1XKAC 2C8WB 5A09A 1NN6A 1MKWK 1NS3A 3K9XB 3ZVAA 1IQGA 1JRTA 3M5LA 1HFDA 4U2WA 4BAMB 2XTTB 2A32A 1AUTC 3N7OA 3ODFA 3QX5H 1N6XA 4XBCA 3ZZ9A 3PO1C 1SHHB 4VGCC 3VB6A 2QF3A 2A5IA 1AD8H 1T4VH 1EJAA 2EC9H 1THRH 1EX3A 1TRYA 1FIWA 1EQ9A 4ZKSU 1FN8A 3EA7A 1TGCA 2BVXH 1SL3A 1IQNA 3LGVA 4MLFB 1ABJH 8GCHF 1N8OC 1DDJA 3T2NA 5FCRA 5DP8A 2JKHA 1DX5M 1HAXB 4K2YA 1A5IA 2GCHG 3C27B 1HYLA 1J14A 1W2KH 3BTHE 1O39A 1QA7A 1ZYOA 4ISIH 1SFIA 1S6FA 1JXPA 2Q6GA 2ANKH 1BMNH 4E06H 3AASA 1YPHE 1QIXB 2VGCC 1P11E 3SJ8A 2KAIB 4CHAB 2FOGA 2WUBA 2J92A 2CF8H 3OX7U 1XVOA 2FOFA 1L4ZA 1X7AC 3TLOA 2FYRA 1GMHF 1A5GH 2P95A 1CHGA 2ZQ1A 2WPHS 4ASHA 1C1VH 4XBDA 4ABAA 1XUKA 3M5OA 1Y3VA 3LGUA 5DJ7A 1WTGH 1Z71A 3SV6A 5DP9A 3SU3A 3T28A 5EXLA 1SLXB 3NCLA 2QC2A 3D65E 3H5CB 1W0YH 2G8TA 1ZRKA 3VB4A 3RMMH 2QY0B 1MTNC 4X6NA 4AFUA 4D7FA 1NFYA 3SGQE 1SVPA 2AGGX 1YCPM 3MWIU 1HAOH 1C2KA 2A31A 1NC6A 2Z9KA 3SNDA 1BT7A 4X2VA 2RA0A 5DP3A 3KQDA 1GWAA 1FN6A 7GCHG 8LPRA 4IN1A 1C1NA 2UWPA 5EXNA 3PO1B 2O8UA 2EA3A 2CHAC 3STJA 2OUAA 1K1NA 1P06A 1EJMA 4LZ4B 1K22H 1UVPA 5DO4H 2VJ1A 3MTYA 1OWKA 2J94A 1TGSZ 1Z6EA 4I32A 4ZHLU 1KXFA 1T7CA 3SU1A 2O8WA 3SV7A 3QN7A 2FESH 4NCYA 1EAIA 1PYTC 2WPJS 2QCYA 1DWDH 4WY3A 4E7RG 1YPMH 3ATIA 3UTUH 1RFNA 1RJXB 3SUEA 2ZKSA 1IQKA 3F1SB 5JPMH 1V2PT 4X6OA 1GL0E 1ELBA 1TOCB 4AFQA 1PQ7A 3OTJE 4MPWA 4D9RA 1OKXA 2SGDE 1TBQH 1LDTT 4KP0A 3QUMP 1AE5A 2FOAA 4GAWA 3M36A 5AF9H 2EI7A 1G9IE 2ZP0H 1GG6C 1QB6A 2Z3CA 1GG6B 1UTQA 1D6WA 1YPHC 2BD5A 1C1UH 1L1GA 2SNWA 1TMTH 1WAYB 1GHZA 3TJOA 2PKSB 3SQHE 3FANA 2HVXA 2AH4X 4JZDH 1P2IA 3SV2H 4Y79A 1O31A 2H6MA 5L2YH 1BIOA 2TGAA 1O2PA 4FUIA 5EXMA 1YP9A 3E6PH 1U6QA 2R3UA 3GY2A 1HAGE 4DJZB 3BTQE 2BD8A 2NWNA 1CT0E 5E0HA 2OC0A 1DS2E 1EB2A 3EE0B 2SGAA 5CHAB 3RXRA 1DANH 1NM6A 3K6YA 2OP9A 5CMXH 4RKJB 4CRGA 1NFWA 1O30A 3MI4A 4ABGA 1ANEA 1GBDA 3TH3H 1ELTA 3ITIA 3VB5A 1C2DA 1O3JA 1Z8GA 3MU1A 1DLEA 1G2LA 4WXIA 1QA0A 1RGQA 1Y3UA 2XWBI 2PSYA 2NU3E 3MH4A 3C1KA 4ZUHA 5ESBA 5GCHF 3SOSA 3FP7E 2PHBA 1ZMLA 2ZHFH 1O37A 1QRWA 1ZRBA 1C5PA 1MAXA 3GY4A 1O3CA 1TNJA 4BAQB 6ESTA 1G32B 1XUFA 3V3MA 1C9PA 3OSYA 4JK6A 4ZMAH 2K1QA 2WPMS 1O2VA 3UIRA 3T5FH 3BTTE 1E36B 2FMJA 1CA8B 5C1UA 1XKBC 1WSSH 5JYIA 3IG6B 3D23A 1MTNB 3RXSA 4FUCA 1TMBH 1UVSH 1BJUA 1GDNA 3SJKA 4ZHAA 1GBBA 3QWCH 4XOJA 4AYVB 1QB1A 6GCHF 1XUHA 1E37B 1A3EH 1UK2A 2ZTYA 3LGYA 1OP0A 2VIWA 3A88A 5DP7A 3SZNA 2W26A 1BQYA 4WH6A 1E35B 1SGNE 3SO3A 1GI2A 1MBQA 2QA9E 2Y6TA 3SU0A 1O5EH 1C5VA 1KLIH 1LVYA 1HIAA 1P05A 5T6DA 5JB8S 3TK5A 1LMWB 3FP6E 1C5LH 1HCGA 5E0GA 5LGOA 2QAAA 2VWLA 3A87A 4DOQA 3MHWU 2SGQE 2FIRH 4INKA 1O33A 3K2UA 1XUIA 1SQAA 3QGJA 4NA8A 5SGAE 5HM2A 2UUKB 3UQVA 1F5RA 1J15A 3SU5A 8ESTE 4AX9H 3O8RA 3ZVDA 4X8UH 1FAKH 4GSOA 1GVLA 2ALPA 1TQ0B 4DVAU 3RDZA 1N8OB 1F2SE 1JBUH 1O2NA 5DP4A 1NZQH 4UONA 1B7XB 3WY8A 5E2PA 1TABE 2H9TH 9LPRA 1XXDA 1SLUB 1O38A 1GJ7B 4GLYA 2JH6D 1JMOH 3F9EA 1QCPA 1ZMNA 2ZC9H 3RMOH 1LVBA 2ZDKA 4CR5A 2H1UA 3LJJA 1MTUA 1QFKH 3SV9A 1ELAA 3Q76A 3UR9A 3CS7A 1TFXA 4MG3A 3M7QA 4CRAA 1TGTA 5FPSA 2WYJA 3E8LA 1CT2E 1KLTA 4B2BA 5GIBA 6LPRA 3SI3H 3A85A 4J2YB 1EJNA 1QJ6B 2QGRA 1O2TA 2GZ8A 1Z1JA 3RM0H 3UOUA 1O3NA 4IW4E 2FS9A 1QHRB 1GDUA 3GY5A 1P03A 2H2ZA 5C1YA 3RU4E 4Y6DA 1LQEA 1BHXF 1S81A 1MBMA 1MKWH 1P57B 2BX4A 5FBEA 1O5CB 2ZIQH 1Y5BT 1ZHRA 3KL6A 1O2GH 3V13A 5E0JA 1D9IA 3QK1A 4JK5A 4Y0ZE 3VPKA 1GL1A 2EEKA 2V3OH 3LJOA 3O8DA 1QBOA 3DFLA 1FZZA 2A7JA 2AYWA 1O3HA 3U8OH 5EQSA 1BRCE 1ZSKA 1SGYE 1MU8B 1EZSC 2FLRH 1IQFA 4OS5A 4GCHG 1T4UH 3BIUH 4UFFH 1FDPA 4JZFH 1VJAU 5EPYA 4K1TA 1CBWB 2LNCA 1Y8TA 3U1JB 5DKMA 3ODDA 5C5NA 3SU6A 1F5KU 5F8TA 2G00A 4DW2U 2DUCA 4THNH 2F83A 2GV6A 2B0FA 3EGKH 4Y7BA 4YT6H 4NGAH 3OU0A 1UHBB 3GYLB 1AKSB 4X8SH 2FM2A 4IC6A 2BLVA 2P8OB 2D2DA 1HXFH 1PQAA 3BV9B 1P10A 1O3BA 3SQEE 2WUCA 1TNHA 1GHAG 2Y80A 3A81A 2VWNA 3QDZB 4BTTB 1O2SA 2BD9A 1O2IA 1XUJA 3PLPA 1YKTA 1CBWC 1VR1H 3PLBA 1BMMH 1O2LA 2FEQH 1CGJE 2Q6DA 2QF0A 3A8CA 1YCPH 1YPJH 3RLYH 1ACBE 2FTMA 4YZUA 1UK4A 2EI6A 3BEFB 1GBCA 1UTOA 1HGTH 1HAPH 3SGAE 4E7NA 1P2NA 2XC4A 3BG4B 2FS8A 4K8YA 4AGKA 1CO7E 1DPOA 4H4FA 1HAVA 1D3PB 5EGMA 2JETB 1DWCH 1DFPA 5IYTA 3JZ1B 5EPNA 6GCHG 4AZ2B 1QGFA 2Y5HA 3K6ZA 3SNEA 2ODYB 4OS1A 2I6SA 2BVRH 1ARCA 3G01A 3A86A 3NWUA 2OC8A 3PLKA 1FY1A 3R0FA 1IHSH 1C2GA 1SSXA 2CN0H 1D3TB 2FTLE 1MQ6A 2OTVA 5EODA 3LGIA 3RXOA 3UY9A 4NA9H 1SC8U 1BTPA 4WXVA 3BTGE 1O32A 4RSPA 2ZF0H 2R2WU 3VFEA 2OBOA 2FODA 2BQWB 1P0SH 1TALA 2AMPA 3TJNA 3GDVA 4NIXA 1BTHH 2Z7FE 1D3DB 1FAXA 5A0AE 5F03A 1GJ4H 2WPIS 2Z9JA 2PKAB 2BY6X 3RXAA 4BNRA 2F9UA 3FFGA 1NTPA 2UUYA 4BTIB 4NA7A 4CRCA 3NXPA 4A1VA 2TIOA 1C2FA 2D1JA 2F9VA 2ZHDA 1GI9B 1HAIH 3KIDU 5JB9S 1XUGA 2HOBA 2F9NA 5JBCS 2W7SA 3SN8A 2OBQA 3RU4D 1C5RA 1ID5H 3ZZCA 1O3MA 3MFJA 5HYOA 2C8ZB 2XXLA 3RXJA 1QBVH 5LH8A 2VVCA 3L6PA 4XSKU 2JH5D 1MZDA 2Y7XA 2VH6A 4Y7AA 2NU2E 4D7GA 1FLEE 2ZU3A 1EPTA 3A7ZA 1FPCH 1EAUA 2G51A 5B6OA 4JYTA 3AW0A 1ZGVA 5DPAA 5FX6A 1LQDB 1VITF 3RXCA 3VB3A 1OYQA 3STIA 3BTWE 1OWEA 3LH3A 3PMJA 1ESTA 1MCVA 1WQSA 1MMJN 4Q7YA 1TX8A 3E91A 5GDSH 2WV4A 2ZU2A 3UNSA 3RC4A 1TPOA 3VEQB 2BQ6B 2C4FH 2VWOA 5ESTE 1P2KA 2HNTC 1V2RT 3E90B 4K60A 1P09A 2QV1A 3B23B 2BM2A 1UVUH 1Z8JB 3GCTG 3KHVA 4K1EA 2W3KA 1F0UA 1OS8A 2ZO3H 5DGJA 1D4PB 3MU5A 2A7HA 3ZVBA 1SGFG 2ZCLP 2BHGA 2P8OC 1AB9C 2HWLB 1GI8B 5I46H 2GCTB 4J1YA 4MQAA 1HDTH 2FLBH 3PTNA 5A2MH 1T8NA 2GV7A 4A1XA 1DE7H 1O5AB 1NFXA 2F9PA 1H1BA 2SGEE 1LPKB 4YLUA 5EW2H 3EYDA 2O8TA 2XBVA 1E0FD 2BTCE 1WBGB 3PTBA 1YBWA 2PTCE 3D62A 4MNVA 5H4IB 4FUDA 4TWWA 5K7RA 1O36A 4MPXA 3UWIA 2B7DH 4FUFA 2BLWA 3P8NA 5G4BA 1GHYH 3S9BA 1DLKB 3ZV8A 5J4QA 2AGEX 3ELAH 1BTXA 1C5ZB 1VGCB 3RXTA 3RXDA 2GVFA 1KXBA 4CH8B 3GCHC 3U8TH 1W7GH 5L30H 3NPSA 3V7TA 3BF6H 1ANBA 1FY4A 4NIWA 1OWHA 1TNIA 1ABIH 3M7UA 2VIVA 4FUEA 1MKXH 1JIRA 5EG4A 2RDLA 1RXPA 4WF8A 5LPEA 2HPPH 9ESTA 1F0RA 3A7VA 1OOKB 1ESBA 5JBTA 5JDUB 1DXWA 4B75A 2QIQA 1ZHMA 4MNXA 1AY6H 3ZZBA 4XBBA 2A45B 1BTYA 3MNSA 1QURH 4AB8A 2BMGB 1QNJA 1GHWH 3DFJA 4NIYA 3EA8A 3SUGA 1O5FH 1YPGH 1VCQA 4HFPB 4K1SA 1C5WB 2OCVB 1O2JA 1O3FA 4TY6A 1TX7A 4FU7A 1IQMA 1MZAA 3P8OA 4Z6AH 1P2QA 1O2RA 4BXWA 3A83A 1O5DH 1L1JA 3QTOH 5F6MA 1AKSA 1FUJA 3BEIB 1SHYA 1WCZA 4YOIA 4BAKB 4I8HA 1GCTC 3P17H 3PB1E 2A7CA 2ALVA 2RG3A 3I78A 1K1PA 1GJ9B 1SB1H 1GJ5H 1UTPA 2BB4A 4ZXXH 5PTPA 3LC5A 4B1TA 1GMDG 1O3IA 4F4OC 2ZGHA 2G5NA 3FZZA 4DY7B 4UFGH 3BEUA 1XX9A 3BTDE 3TK6A 5J4SA 2BY9X 3DT0H 1AGJA 1ESAA 1BA8B 3KCGH 4TYDA 2ASUB 4X2XA 1W3CA 1KTTB 3FAOA 1AIXH 2FI5E 1C4U2 1ZSJA 4AB9A 3RXLA 4DIHH 2GX4A 3VXEH 1RRKA 1IQIA 1GBEA 1MCTA 2BD7A 1OP2A 3RXQA 1CSOE 1E34B 1OP8A 1MKXK 1UTJA 3E1XB 3PV4A 3Q3KA 1CQQA 4KTSA 3UR6A 2QXGA 1L2EA 1O2KA 2J95A 1GBAA 1P9UA 5C1XA 1K2I1 2VNTA 3EAJA 3SNCA 1IQLA 1T32A 2V6NA 2Z9IA 1EP6A 4FVDA 5FXLA 3GCTF 3NUMA 1K1LA 1SGEE 1M9UA 1EOLA 3TIUA 1MD7A 1D6RA 1P2JA 1XVMA 5FBIA 2P3TB 1AU8A 2RA3A 2ZHEH 3F68H 2D26C 4Y71A 1V6DA 2EI8A 2XC0A 1KDQA 4LK4A 3SORA 5GXPA 2XCNA 1SGFA 4BTUB 3OYPA 7KMEH 1JOUB 5GWZA 1SGIB 1GHAF 1KSNA 2OXSA 3SHCH 3BIVH 2ULLA 5T6GA 4ABHA 1TONA 1NU7B 2WYGA 4ISOA 1QL7A 4M7GA 1P2OA 1FJSA 1LHCH 2XYAA 1C5UA 1SFQB 2ZTXA 4I7YH 1C1MA 3PWCA 2PFEA 5FX5A 3GDUA 1SR5C 3JZ2B 5AVDA 1SQTA 2BDIA 1ELCA 1TMUH 5I25A 1CT4E 4D76A 2BY7X 1C1TA 1C4Y2 1MU6B 2ZFQH 4GCHF 1GBFA 2STBE 2WPLS 5C2ZA 1RTLA 1V2VT 2FOMB 1QY6A 2PSXA 1UHBA 2A2XH 1HAVB 1FV9A 1DITH 3LDXH 1AMHA 2BLOA 2FX6A 1SMFE 1OPHB 3GY8A 1HUTH 1S0QA 4AYYB 4O97A 1OX1A 2Z94A 1C5OH 1A61H 2GGVB 4QT8C 2CMYA 1Z1IA 5FHTA 1AZZA 2JH0D 1UO6A 3EA9A 2P16A 1C2HA 3ZZ8A 3KNXA 5A8ZA 1F0SA 3RUOA 1TQ7B 4LOYH 1O0DH 1O2OA 3F9HA 2KAIA 1O3OA 4MNWA 5A0BA 1C9TA 1GBHA 1GPZA 3FVFB 1QL9A 3SGBE 2HGTH 2IOTA 3FP8E 2ZHQH 1LHGH 1BTUA 1BCUH 1A1RA 1UCYH 4FUHA 4X1RU 4YTAA 1NRQH 1FMGA 3VGCC 4X0WU 1K1JA 1AI8H 1YF4A 1NPMA 2BX3A 2HLCA 4MPVA 3RXUA 4TY7A 1SLVB 3W95A 1QR3E 1S85A 1ELVA 4FUJA 4O9VA 2PKSC 3MH7A 4KTCA 2ZZUH 1P8VC 4ZAEA 3KQEA 2TGDA 1LO6A 3RLWH 4R0IA 3MNXA 3TJUA 1AFQC 2OC7A 2OC1A 3QTVH 1WQVH 1K21H 1J17T 3UWJH 4UDWH 2QN5T 2GZ7A 5DP5A 1WYKA 1FPHH 2XCFA 3A7YA 1HBTH 1N6YA 1SGTA 5HMAA 1FNIA 3K65B 3BSQA 3SW2B 1EKBB 4CBNA 1OYTH 1THSH 2C8YB 4MPUA 1PPHE 2BY8X 4ABJA 2C93B 1Z7KA 4I8KA 1C5SA 2ZGBH 1QQ4A 1EATA 4NSYA 5FPYA 1KLJH 2ILNA 4GPGA 4KKDA 4X8VH 2J4IA 2GMTB 2HPQH 2ZHWH 1UMAH 4IS5A 3F9GA 1NO9H 2IJOB 2GT7A 1QRXA 1SOZA 1KYNA 2ZU5A 5LPRA 1NFUA 2QXHA 1AO5A 4IC5A 2GD4B 1A0JA 1YLCA 1PFXC 1B0EA 4H42U 2PW8H 1DICA 1PPFE 2Y5FA 1OSSA 2CHAB 1CGIE 3HGPA 2BXTH 1SGDE 1TA2A 1HPGA 3ESTA 3MNCA 2BDGA 2R9PA 5HM9A 1LCYA 1HAHH 4Z0KA 4Q2KA 5EU8A 2FYQA 1V2JT 3BTME 1AN1E 1RTKA 2P94A 1GGDB 1JIMA 1YYY1 1GHXH 2V3HH 3A7TA 4RKOB 4TPYA 1H9HE 1RS0A 4AOQA 1XMNB 3NK8A 1GVKB 1NESE 1C1SA 2IPHA 1UK3A 2AIQA 1SQOA 5T3HA 1BBRH 1GGDC 5TCCA 1K9OE 1ZSLA 4I31A 2IN2A 4FUBA 1EXFA 1BITA 1NU9A 3HATH 2ZFTA 3RXMA 1ELDE 1H4WA 2QXJA 3Q3YA 4DURA 2WINI 1GJ6A 1ZJKA 2OLGA 4VGCB 1AVXA 1UVOA 4OS6A 4X6PA 2H9HA 4AN7A 3CENA 3LH1A 5BRRE 2C8XB 2ZPRA 3P70B 3KGPA 3PM3A 3ATMA 1O5BB 2WV5A 4YM9A 1SGQE 1O2WA 2TPIZ 3RXPA 3TK9A 3M3SA 1ANDA 1EZXC 2B8OH 3PWBA 1KXAA 3RXIA 1Z8IB 1Y3WA 3OY6U 3O8CA 3BTKE 2ZGCA 2A1DB 1IQJA 4O3TA 1QBNA 1G3DA 1BB0B 1H9IE 3UOPA 4WH8A 1G36A 1IOEA 1V3XA 3GOVB 3L3TA 3QZRA 1ZTLA 4K69A 1IAUA 2YNBA 2J2UA 2FPZA 3RP2A 1V2ST 2W3IA 6CHAC 2GKVE 4X8TH 3ZZ3A 2DE8A 3CS0A 3LC3A 1W12U 1ELGA 1C5TA 2ODPA 2ZDVH 2AEIH 1C2MA 4Y8ZA 1AVGH 4ZKOU 5E2OA 3ZZ4A 2DE9A 3UREA 1LHDH 1AFEH 1CGHA 2BVSH 2SGFE 4R8TB 1DSUA 4B2AA 3VGCB 1BJVA 4IN2A 4CRBA 4TWYA 2D8WA 3P6ZB 3UNRA 2Q1JA 1C2EA 3DD2H 2A4GA 2VH0A 3GCHB 2AMDA 2R2MB 2ZFSA 4CR9A 4WWYA 1F7ZA 2FP7B 4INLA 2VIOA 3ZVFA 3RXHA 4AGJA 1A0LA 1O2UA 3BTEE 2SNVA 3I77A 4AFSA 1L0ZA 4F49A 1H8DH 2ZI2H 2FOHA 2STAE 3M7TA 1DM4B 4CRDA 4CRFA 3U8RH 1KIGH 3MU8A 2BYAX 3B8JA 1EPTC 2C90B 1A3BH 1F0TA 2BDHA 2AERH 4KELA 1TPSA 1P2MA 1ETRH 1P9SA 1TGNA 3EDXB 5AHGH 4WMDA 2XNIA 3ZV9A 1FY5A 3FZDA 4ISNA 4BAHB 1Z8RA 1GI5A 3IITA 2Y7ZA 3HKIB 4NZQA 1BHXB 1TNGA 3ZYDA 4CBOA 3LGWA 3QZQA 1AB9B 1GBTA 1NY22 1SGPE 3GISB 1AUJA 5TJXA 1LTOA 1GVZA 4IMZA 1TPPA 4ZKRU 4GHQA 3LONA 3SJIA 2FXRA 1IQHA 1P02A 3VB7A 3RMNH 1CVWH 2ZFPH 3QGNB 1GMHG 2VIPA 1GBJA 1FY3A 2C3SA 1DY9A 2ZWLH 1DWEH 4CREA 1PPBH 1L4DA 2OQ5A 2P3FH 3SNBA 5FPTA 3F6UH 4AG2A 1OWDA 5A0CA 1V2WT 4UE7H 3LIWA 1SI5H 3T27A 5A8XA 3P95A 3DUXH 2FI4E 3D49H 4BAOB 1CA0B 1ZOMA 1DT2A 2HNTE 4X1QU 3PMAB 1AZ8A 1GMDF 1MD8A 4WMEA 1GI4A 3UQOA 1ETTH 1HV7A 3GY7A 2FO9A 4DGJA 2Z9LA 2Q6FA 2XW9A 3MO6A 2PWXA 4UD9H 2BZ6H 2ZGXH 5DG6A 1C5QA 2UUFB 1QB9A 1G37A 4BOHA 2GTBA 1F92A 1C1OA 1NRRH 5GPIB 4JZ1A 8KME2 1CU1A 1ZPZA 4Y10E 4MDSA 1DXPA 2YOLA 1G3BA 5FCKA 4B74A 2VVUA 2M5TA 1EOJA 2J34A 3RXFA 4K5ZA 2XBYA 1S6HA 3GDSA 4U01A 2A5KA 4ZROA 1LPGB 2VU8E 2TRMA 4U32A 1S83A 3RU4T 2BDCA 1HIAB 1ZR0A 1LVMA 1W0ZU 1S82A 3S7HB 3ZZ7A 2PGQB 3ENSB 4OGXA 4KGAA 4K3JA 1BZXE 3V0XA 2PTNA 3P92A 3RM2H 1VJ9U 7LPRA 2FWWA 1GBIA 2UWLA 1KTSB 1Y3YA 1DUAA 4NG9H 4ISLA 3HKJB 4B73A 4IGDA 1TPAE 4ISHH 1HAZB 1P01A 2AGIX 2ZPSA 1KDQB 2XBXA 1YPEH 1HJAC 1A46H 1O2ZA 4UFEH 5C67A 1S84A 1KXEA 2NU4E 5L2ZH 3GICB 4SGBE 4A7IB 3BG8A 3TH2H 2AFQB 4ZXYH 1Q31A 1TBRH 1LKAA 2JETC 1VCWA 2R3YA 3ZVGA 7GCHF 1Q3XA 3S9CA 4FUGA 1C5XB 1HJ9A 1GJ8B 2ZDMA 1ZPBA 1TNKA 1YM0A 4WMFA 4ZHMU 2G55A 1GBLA 4HTCH 2SFAA 4ABIA 5BPEA 1C1WH 4H6TA 2P3UB 4OS2A 2BQ7B 5TCAA 2BXUH 5JBBS 2ZDAH 2G4TA 4UFDH 2ZTZA 4FXGH 3E16B 4PROA 3MH5A 4OS7A 3TU7H 2B9LA 3A8AA 3M3TA 2NU1E 2P59A 4I8JA 3GCNA 3S0NA 1Z6JH 1OWIA 5EOKA 1TE0A 2FDAA 1OWJA 3URCA 4OS4A 2BDBA 1GBKA 1L1NA 2BOKA 4B76A 2ZQ2A 5ETXA 2Y81A 1ELEE 4O03A 2BDAA 1BBRK 3HGNA 1G3EA 1C1RA 4O3UA 3QO6A 3TJVA 3MNBA 1K1OA 2F9BH 5IDKA 3VXFH 3ZZ5A 3KQBA 2BD4A 1UVTH 4Y8XA 2FZZA 3CP7A 1ETSH 1MH0A 3RC5A 2A4OA 1HXEH 4H6SB 4X2YA 3ZZ6A 1NT1A 2PKAA 1FXYA 3GYMA 4X1SU 2ZU4A 2ZFFH 3TH4H 2BLQA 1GDQA 4NWKA 4Q7ZA 1BTZA 2AMQA 1YC0A 4INHA 3M37A 2GCHF 1SGCA 3M5NA 3SJ9A 1BOQA 1LPZB 3S9AA 1HB0B 1HNEE 1BBRE 8GCHG 2FI3E 3NKKA 4FVBA 3RXEA 2GCTC 1MUEB 1BRAA 1WUNH 3AAVA 2W7UA 4CH2B 1GHVH 1N1LA 3DHKH 3KF2A 1HJAB 2XWAA 4MNYA 3ZVEA 3RC6A 2G52A 1O2XA 1ZMJA 1BUIA 1DWBH 3DA9B 3PYHA 1V2MT 2XC5A 4WJG2 3UFAA 1C2LA 1QTFA 1P3EA 2XRCA 3MO9A 3W94A 1V2UT 1C5YB 1ZGIA 3T62A 2ZCHP 3BTFE 2YNAA 5EQRA 3U98H 1ZJDA 2ANWA 1ANCA 2ZG0H 3ZZDA 4XDEA 4DIIH 1TLDA 2B5TB 3ZZAA 2G81E 1ZTKA 1O3GA 3A84A 3M3VA 1O2YA 1TNLA 5CE1A 1GI1A 1AQ7A 1HRTH 1VITG 5HGGA 1BDAA 1FIZA 1Q2WA 3UPEA 1W8BH 3GY6A 3MYWA 5C3NA 4LZ1H 1IHTH 2F9OA 4JYVH 3SUDA 2ZGJA 2P93A 3KQCA 3UUZA 4GVUA 2V0BA 4D8NA 2PUXB 2ZFRH 1GCTB 4IMQA 1UCYE 4I33A 1A2CH 1UTMA 3E3TA 2FOCA 1PPCE 2AS9A 4Q7XA 1NRPH 3LU9B 4XFQA 3A80A 2CGAA 1HLTH 1XM1A 3RMLH 1NROH 1INCA 1PPZA 5EW1H 1GHBF 3GY3A 3P8FA 3URDA 1SGRE 1GBMA 4JYUH 1C5NH 5F8XA 1KXDA 1XXFA 2A2QH 2OINA 3S7KB 4B71A 1H9LB 4KTUA 3S69A 4X6MA 1W11U 4IBLH 5ABWA 4I8GA 1T8MA 1LVOA 1G2MA 2R0KA 4JCNA 1TWXB 1UCYK 3AW1A 2V35A 2F3CE 1PJPA 1TOMH 2WPKS 3U9AH 5LPFA 2H9EH 1RIWB 3P8GA 1GI3A 4ESTE 3M5MA 2Z9GA 4E05H 3A7XA 2J38A 3B9FH 3MO3A 1YGCH 2A0QB 5JBAS 1GJAB 1QRZA 3TGIE 4HGCA 3SU2A 4ABBA 1V2NT 1O3LA 4Q80A 1EAWA 4AG1A 1MTSA 2ESTE 1VGCC 2J9NA 4I8LA 4YOJA 4FU8A 1SPJA 3H7TA 1O5GH 2ZDLA 3SUFA 4HZHA 1PYTD 2GT8A 3SNAA 1GI0A 3QLPH 2PR3A 5DP6A 3ZVCA 1EPTB 4LXBH 1EASA 1P04A 3A8BA 4K8BA 5A8YA 1BTWA 1DY8A 1EB1H 4DG4A 3NZIA 3TGKE 4JMYA 3T26A 1J8AA 1E38B 2HNTF 1Y5UT 2PUQH 2I6QA 2VWMA 1KXCA 1TRMA 3TNTA 2ZECA 1V2OT 3EQ0H 2F91A 1P3CA 1KY9A 1GJBB 3RXKA 5E8EH 1CHOF 2NU0E 5CHAC 4A1TA 2PLXA 2GZ9A 1FONA 2BD3A 1K1IA 3UNQA 1O2QA 2TGPZ 1P12E 1TB6H 1UTNA 3Q77A 4YOGA 1RIWC 3LOXA 1VCPA 1JWTA 1W14U 4YESB 1OXGA 4NWLA 3U1IB 2ODQA 2Z3DA 1AE8H 3V12A 1TAWA 2O9QA 1GMCG 2BDYA 2W5EA 1AWHB 1THPB 4A6LA 5C5OA 1EUFA 3MMGA 3TPIZ 2CF9H 1PQ5A 2VIDA 3R3GB 3T29A 3OY5U 4DT7B 3PMHB 3MOCA 1AWFH 2CV3A 1WTHD 3GCOA 3T25A 2GP9B 1W7XH 2O8MA 1EP5A 1UJ1A 5GJ4B 1ZPCA 3TITA 4ABFA 5AFZH 1Y5AT 1O3EA 4Y0YE 3MU4A 3ATKA 3TNSA 3A89A 1MAYA 1O34A 1GCDA 1RTFB 2VB0A 1LKBA 3A82A 4DCDA 2ANMH 1FY8E 2ZDNA 4A92A 2O8LA 3KEEA 6CHAB 3AVZA 1T8OA 1GMCF 3TGJE 1DOJA 1RD3B 3PROA 3LGTA 1BRBE 2Y5GA 2Z3EA 5C20A 2THFB 1YPLH 1GJDB 1TRNA 3LT3A 2GDEH 2GDDA 4ZKNU 2ANYA 1O2HA 4HI3A 1C4V2 3SV8A 1GI7B 3I29A 1DVAH 1VITH 3HK6B 4JZEH 1G3CA 2Y82A 4SGAE 2PV9B 1CHOG 1V2LT 3BN9A 4U30A 1CA0C 1TYNA 2FX4A 1ARBA 3O8BA 4B2CA 5AFYH 1QL8A 1ZLRA 1TX6A 4GHTA 5F8ZA 1C5MD 2XBWA 5L6NH 2TBSA 3H7OA 1F5LA 1MTWA 3ATLA 1ZTJA 4WVPE 2UUJB 4OGYA 4ABEA 1ZZZA 1BMLA 4BXSA 4AORA 1WOFA 1BMAA 4RN6A 3MU0A 2ZEBA 3HK3B 1EAXA 1UTKA 1C1PA 1UTLM 1DSTA 4X1NU 1A5HA 1V2TT 3MH6A 1Y3XA 1O3KA 1EZUC 1C2IA 2CJIA 1IQEA 1B5GH 4XE4A 1LHFH 1YPKH 3SHAH 3RXGA 5K0HA 1V2QT 4NZLA 2FOEA 1K28D 2ZA5A 1HJ8A 1GJCB 1VZQH 1S5SA 1PPGE 3IWMA 4NIVA 2BOHB 4X2WA 1MQ5A 2BD2A 3U69H 1CE5A 1D3QB 1GI6A 2G5VA 4AFZA 1YCPK 3A8DA 3RXBA 2A4QA 1TBZH 1PPEE 1G30B 3BG4C 3E0NB 4YLQH 2BZAA 5GCHG 2OD3B 4CHAC 2A4RA 2R0LA 2H5DA 4Y11E 3SBKA 4BANB 2VGCB 4ZH8A 3TVJB 3AAUA 3KN2A 1A4WH 1HAYB 3PMBB 1SOTA 4ABDA 1ORFA 3E0PB 2GMTC 4A5TS 2CXVA 4UEHH 3RXVA 2QXIA 1GHBG 2ZCKP 1J16A 1SLWB 1PQ8A 3SI4H 3LPRA 1C1QA
chains in the Genus database with same CATH superfamily
4D9QA 3SU4A 2Z6BD 1EZQA 1C2JA 5DK1A 4YT7H 2H5CA 3HPTB 1SBWA 4MTBA 3LKWA 4TPIZ 1TIOA 2VINA 4JZIA 1ZHPA 1TA6A 1AHTH 1S0RA 3ATWA 4X1PU 4NFFA 5EQQA 4Y76A 2LPRA 1YLDA 3ZYEA 1QJ7B 7ESTE 1AFQB 1FQ3A 4FU9A 1O3AA 3SJOA 1DUEA 1FI8A 1MTVA 1WV7H 5HXFA 2FOBA 5C0TA 1V2KT 3L33A 1H8IH 1O3PB 1NRSH 2UWOA 2ZPQA 1BRUP 3M61U 3Q3XA 1SG8B 3Q00A 2TGTA 1O3DA 1QQUA 3M35A 2ZU1A 4Y8YA 2OQUA 2PGBB 2HRVA 2SGPE 2ZNKH 1B0FA 1Y59T 1NRNH 2HALA 1T31A 4NSVA 4AC9A 1A0HB 5FAHA 2A5AA 3F9FA 4GUXA 1J9CH 1W10U 2VVVA 1W13U 5T6FA 5C0UA 1JRSA 2AIPA 3A7WA 1K1MA 1O35A 1QJ1B 4NFEA 3KYFA 1LHEH 2VIQA 1AVWA 1WU1A 1A7SA 1ELFA 1TGBA 2G4UA 1T8LA 2QYIA 4MVNA 4YO9A 2BY5X 1O2MA 2KCPA 2RCEA 1XKAC 2C8WB 5A09A 1NN6A 3DSOA 1MKWK 1NS3A 3K9XB 3ZVAA 1IQGA 1JRTA 3M5LA 1HFDA 4Q63A 4U2WA 4BAMB 2XTTB 2A32A 1AUTC 3N7OA 3OFND 3ODFA 3QX5H 1N6XA 4XBCA 3ZZ9A 3PO1C 1SHHB 4HG6A 4VGCC 3VB6A 2QF3A 2A5IA 1AD8H 1T4VH 1EJAA 2EC9H 1THRH 1EX3A 1TRYA 1FIWA 1EQ9A 4ZKSU 1FN8A 3EA7A 1TGCA 2BVXH 1SL3A 1IQNA 3LGVA 3OTPA 4MLFB 1ABJH 2QF4A 8GCHF 1N8OC 1DDJA 3T2NA 5FCRA 5DP8A 2JKHA 1DX5M 1HAXB 4K2YA 1A5IA 2GCHG 3C27B 1HYLA 1J14A 1W2KH 3BTHE 1O39A 1QA7A 1ZYOA 4ISIH 1EFRD 1SFIA 1S6FA 1JXPA 2Q6GA 2ANKH 1BMNH 4E06H 3AASA 1YPHE 1QIXB 2VGCC 1P11E 3SJ8A 2KAIB 4CHAB 2FOGA 2WUBA 2J92A 2CF8H 3OX7U 1XVOA 2FOFA 1L4ZA 1X7AC 3TLOA 2FYRA 1GMHF 1A5GH 2P95A 1CHGA 2ZQ1A 2WPHS 4ASHA 1C1VH 4XBDA 4ABAA 1XUKA 3M5OA 1Y3VA 3LGUA 5DJ7A 1WTGH 1Z71A 3SV6A 5DP9A 3SU3A 3T28A 5EXLA 1SLXB 3NCLA 2QC2A 3D65E 3H5CB 5B6LA 1W0YH 2G8TA 1ZRKA 3VB4A 3RMMH 2QY0B 1MTNC 4X6NA 1E1RD 4AFUA 4D7FA 1NFYA 3SGQE 1SVPA 2AGGX 1YCPM 2KFWA 3MWIU 1C2KA 2A31A 1NC6A 1HAOH 2Z9KA 3SNDA 1BT7A 4X2VA 2RA0A 5DP3A 3KQDA 1GWAA 1FN6A 7GCHG 8LPRA 4IN1A 1C1NA 2UWPA 5EXNA 3PO1B 2O8UA 2EA3A 2CHAC 3STJA 2CK3D 2OUAA 1K1NA 1P06A 1EJMA 4LZ4B 1K22H 1UVPA 5DO4H 2VJ1A 3MTYA 1OWKA 2J94A 1TGSZ 1Z6EA 4I32A 2RFKC 4ZHLU 1KXFA 1T7CA 3SU1A 3W1EA 2O8WA 3SV7A 3QN7A 2FESH 4NCYA 4P02A 1EAIA 1PYTC 2WPJS 3NRLA 2QCYA 1DWDH 4WY3A 4E7RG 1YPMH 3ATIA 3UTUH 1RFNA 1RJXB 3SUEA 2ZKSA 2J97A 1IQKA 3F1SB 5JPMH 1V2PT 4X6OA 1GL0E 1ELBA 1TOCB 4AFQA 1PQ7A 3OTJE 4MPWA 4D9RA 1OKXA 2SGDE 1TBQH 1LDTT 4KP0A 3QUMP 1AE5A 1YWUA 3N7EA 2FOAA 4GAWA 3M36A 5AF9H 2EI7A 1G9IE 2ZP0H 1GG6C 1QB6A 2Z3CA 1GG6B 1UTQA 1D6WA 1YPHC 2BD5A 1C1UH 1L1GA 2SNWA 1TMTH 1WAYB 1GHZA 3TJOA 2PKSB 3KQ5A 3SQHE 2QE7D 3FANA 2HVXA 2AH4X 4JZDH 1P2IA 3SV2H 4Y79A 1O31A 2H6MA 4B6FA 4XD7D 5L2YH 1BIOA 2TGAA 1O2PA 4FUIA 5EXMA 1YP9A 3E6PH 1U6QA 2R3UA 3GY2A 1HAGE 4DJZB 3BTQE 2BD8A 2NWNA 1CT0E 5E0HA 2OC0A 1DS2E 1EB2A 3EE0B 2SGAA 4TSFD 5CHAB 3RXRA 1DANH 1NM6A 5DSFA 2YMSD 3K6YA 2OP9A 5CMXH 4RKJB 4CRGA 1NFWA 1O30A 3MI4A 4ABGA 1ANEA 1GBDA 3TH3H 3DSGA 1ELTA 3ITIA 5CHBA 3VB5A 1C2DA 1O3JA 1Z8GA 3MU1A 1DLEA 3AK5A 1G2LA 4WXIA 1QA0A 1RGQA 1Y3UA 2XWBI 2PSYA 2NU3E 2WZQA 3MH4A 3OAAD 3C1KA 4ZUHA 5ESBA 3PRBA 5GCHF 3SOSA 3FP7E 2PHBA 1ZMLA 2ZHFH 1O37A 1QRWA 1ZRBA 1C5PA 1MAXA 3GY4A 1O3CA 1TNJA 4BAQB 6ESTA 1G32B 1XUFA 3V3MA 1C9PA 3OSYA 4JK6A 4ZMAH 2K1QA 2WPMS 1O2VA 5EJ1A 5GNDA 3N99A 3UIRA 3T5FH 3BTTE 1E36B 2FMJA 1CA8B 5C1UA 1XKBC 1WSSH 5JYIA 3IG6B 3D23A 1MTNB 3RXSA 4FUCA 1TMBH 1UVSH 1BJUA 1GDNA 3SJKA 4ZHAA 1GBBA 3QWCH 4XOJA 4AYVB 1QB1A 6GCHF 1XUHA 1E37B 1A3EH 1UK2A 2ZTYA 3LGYA 1OHHD 1OP0A 2VIWA 3A88A 5DP7A 3SZNA 2W26A 1BQYA 4WH6A 1E35B 1H8HD 1SGNE 3SO3A 1GI2A 1MBQA 2QA9E 1E1QD 2Y6TA 3SU0A 1O5EH 1C5VA 1KLIH 1LVYA 1HIAA 1P05A 5T6DA 5JB8S 3TK5A 1LMWB 3FP6E 1C5LH 1HCGA 5E0GA 5LGOA 2QAAA 2VWLA 3A87A 2PP6A 4DOQA 3MHWU 2SGQE 2FIRH 3ZIAD 4INKA 1O33A 3K2UA 1XUIA 1SQAA 5KEDA 3QGJA 4NA8A 5SGAE 5HM2A 2UUKB 3UQVA 1F5RA 1J15A 3SU5A 8ESTE 4AX9H 5EIYA 3O8RA 3ZVDA 4X8UH 1FAKH 4FOUC 4GSOA 1GVLA 2ALPA 1TQ0B 4DVAU 3RDZA 1N8OB 1F2SE 1JBUH 1O2NA 5DP4A 1NZQH 4UONA 1B7XB 3WY8A 5E2PA 1TABE 2H9TH 9LPRA 1XXDA 1SLUB 1O38A 1GJ7B 4GLYA 2JH6D 1JMOH 3F9EA 1QCPA 1ZMNA 2ZC9H 3RMOH 1LVBA 2ZDKA 4CR5A 2H1UA 3LJJA 1MTUA 1QFKH 3SV9A 1ELAA 1K0HA 3Q76A 3UR9A 3CS7A 1TFXA 4MG3A 2YMSB 3M7QA 4CRAA 1TGTA 3UB0A 5FPSA 2WYJA 3E8LA 1CT2E 1KLTA 4I86A 4B2BA 5GIBA 6LPRA 3SI3H 3A85A 4J2YB 1EJNA 1QJ6B 2QGRA 1O2TA 2GZ8A 1Z1JA 3RM0H 3UOUA 1O3NA 4IW4E 2FS9A 1QHRB 1GDUA 3GY5A 1P03A 2H2ZA 5C1YA 3RU4E 4Y6DA 1LQEA 1BHXF 1S81A 1MBMA 1MKWH 1P57B 2BX4A 5FBEA 1O5CB 2ZIQH 1Y5BT 1ZHRA 3KL6A 1WXRA 1O2GH 3V13A 5E0JA 1D9IA 3QK1A 4JK5A 4Y0ZE 3VPKA 1GL1A 2EEKA 2V3OH 3LJOA 3O8DA 1QBOA 3DFLA 1FZZA 2A7JA 2AYWA 1O3HA 3U8OH 5EQSA 1BRCE 1ZSKA 1SGYE 1MU8B 1EZSC 2FLRH 1IQFA 4OS5A 4GCHG 1T4UH 3F0OA 3BIUH 4UFFH 1FDPA 4JZFH 1VJAU 5EPYA 4K1TA 1CBWB 2LNCA 1Y8TA 3U1JB 5DKMA 3ODDA 5C5NA 3SU6A 1F5KU 5F8TA 2G00A 4DW2U 2DUCA 4THNH 2F83A 2GV6A 2B0FA 3EGKH 4Y7BA 3OEHD 4YT6H 4NGAH 3OU0A 1UHBB 3GYLB 1AKSB 4X8SH 2FM2A 4IC6A 2BLVA 2P8OB 2D2DA 1HXFH 1PQAA 3BV9B 1P10A 1O3BA 3SQEE 2WUCA 1TNHA 1GHAG 2Y80A 3A81A 2VWNA 3QDZB 4BTTB 1O2SA 2BD9A 1O2IA 1XUJA 3PLPA 1YKTA 1CBWC 1VR1H 3PLBA 1BMMH 1O2LA 2FEQH 1CGJE 2Q6DA 2QF0A 3A8CA 1YCPH 1YPJH 3RLYH 1ACBE 2FTMA 4YZUA 1UK4A 2EI6A 1FX0B 3BEFB 1GBCA 1UTOA 1HGTH 1HAPH 3SGAE 4E7NA 1P2NA 2XC4A 3BG4B 3FOAA 2FS8A 4K8YA 3FKSD 4AGKA 2QF5A 1CO7E 1DPOA 4H4FA 1HAVA 1D3PB 5EGMA 2JETB 1DWCH 1DFPA 5IYTA 3JZ1B 5EPNA 6GCHG 4AZ2B 1QGFA 2Y5HA 3K6ZA 3SNEA 2ODYB 4OS1A 2I6SA 2BVRH 1ARCA 3G01A 3SYJA 2EQNA 3A86A 3NWUA 2OC8A 3PLKA 4Q4LA 1FY1A 3R0FA 1IHSH 1C2GA 1SSXA 2CN0H 1D3TB 2FTLE 1MQ6A 3F2GA 4XRNA 2V3MA 2OTVA 5EODA 3LGIA 3RXOA 3UY9A 4NA9H 1SC8U 1BTPA 4WXVA 3BTGE 1O32A 4RSPA 1W0KD 2R2WU 2ZF0H 3VFEA 2OBOA 2FODA 2BQWB 1P0SH 1TALA 2AMPA 3TJNA 3GS9A 3GDVA 4NIXA 1BTHH 2Z7FE 1D3DB 1FAXA 5A0AE 5F03A 1GJ4H 2WPIS 2Z9JA 2PKAB 2BY6X 3RXAA 4BNRA 2F9UA 3FFGA 1NTPA 2UUYA 4BTIB 4NA7A 4CRCA 3NXPA 4A1VA 2TIOA 4B6EA 1C2FA 2D1JA 2F9VA 2ZHDA 1GI9B 1HAIH 3KIDU 5JB9S 1XUGA 2HOBA 2F9NA 5JBCS 2W7SA 3SN8A 1MABB 2OBQA 3RU4D 1C5RA 1ID5H 3ZZCA 4P00A 1O3MA 3MFJA 5HYOA 2C8ZB 2XXLA 3RXJA 1QBVH 5LH8A 2VVCA 3L6PA 4XSKU 5CDFE 2JH5D 1MZDA 2Y7XA 2VH6A 4Y7AA 2NU2E 4D7GA 1FLEE 2ZU3A 1EPTA 3A7ZA 1FPCH 1EAUA 2G51A 5B6OA 4JYTA 1YY3A 3AW0A 1E79D 1ZGVA 5DPAA 5FX6A 1LQDB 1VITF 3F0PA 3RXCA 3VB3A 1OYQA 3STIA 3BTWE 1OWEA 2WPDD 3LH3A 3PMJA 1ESTA 1MCVA 1WQSA 1MMJN 4Q7YA 1TX8A 3E91A 2L74A 5GDSH 2WV4A 2ZU2A 3UNSA 2VBCA 3RC4A 1TPOA 3VEQB 2BQ6B 2C4FH 2VWOA 5ESTE 1P2KA 2HNTC 1V2RT 3E90B 4K60A 1P09A 2QV1A 3B23B 2BM2A 1UVUH 1Z8JB 3GCTG 3KHVA 4K1EA 2W3KA 1F0UA 1OS8A 2ZO3H 5DGJA 1D4PB 3MU5A 2A7HA 3ZVBA 1SGFG 2ZCLP 2JJ2D 2BHGA 2P8OC 1AB9C 2HWLB 1GI8B 3VG8A 3U28C 5I46H 2GCTB 4J1YA 4MQAA 1HDTH 2FLBH 3PTNA 5A2MH 1T8NA 2GV7A 4A1XA 1DE7H 1O5AB 1NFXA 2F9PA 1H1BA 2SGEE 1LPKB 4YLUA 5EW2H 3EYDA 2O8TA 2XBVA 1E0FD 2BTCE 1WBGB 3PTBA 1YBWA 2PTCE 3D62A 4MNVA 5H4IB 4FUDA 4TWWA 5K7RA 1O36A 4MPXA 3UWIA 2B7DH 4FUFA 2BLWA 3P8NA 5G4BA 1GHYH 3S9BA 1DLKB 3ZV8A 5J4QA 2AGEX 3ELAH 1BTXA 1C5ZB 1VGCB 3RXTA 3RXDA 3FN8A 2GVFA 1KXBA 4CH8B 2WV9A 3GCHC 3U8TH 1W7GH 5L30H 3NPSA 3V7TA 3F3BA 3BF6H 1ANBA 1FY4A 4NIWA 1OWHA 1TNIA 1ABIH 3M7UA 2VIVA 4FUEA 1MKXH 1JIRA 5EG4A 2RDLA 1RXPA 4WF8A 5LPEA 2HPPH 9ESTA 1F0RA 3A7VA 1OOKB 1ESBA 5JBTA 5JDUB 1DXWA 4B75A 2QIQA 1ZHMA 4MNXA 1AY6H 3ZZBA 4XBBA 2A45B 1BTYA 3MNSA 1QURH 4AB8A 2BMGB 1QNJA 1GHWH 3DFJA 4NIYA 3EA8A 3SUGA 1O5FH 1YPGH 1VCQA 4HFPB 4K1SA 1C5WB 2OCVB 1O2JA 1O3FA 4TY6A 5C17A 1TX7A 4FU7A 1IQMA 1MZAA 3P8OA 4Z6AH 1P2QA 1O2RA 4BXWA 3A83A 1O5DH 1L1JA 3QTOH 5F6MA 1AKSA 1FUJA 3BEIB 1SHYA 1WCZA 4YOIA 4BAKB 4YXWD 2XNDD 4I8HA 1GCTC 3P17H 3PB1E 2A7CA 2ALVA 2RG3A 3I78A 1K1PA 1GJ9B 1SB1H 1GJ5H 1UTPA 2BB4A 2LELA 4ZXXH 5PTPA 3LC5A 4B1TA 1GMDG 1O3IA 4F4OC 2ZGHA 2KCOA 2G5NA 3FZZA 4DY7B 4UFGH 3BEUA 1XX9A 3BTDE 3TK6A 5J4SA 2BY9X 3DT0H 1AGJA 1ESAA 1BA8B 3KCGH 4TYDA 2ASUB 4X2XA 1W3CA 1KTTB 3FAOA 1AIXH 4RT1A 2FI5E 1C4U2 1ZSJA 4AB9A 3RXLA 4DIHH 2OK5A 2GX4A 3VXEH 1RRKA 1IQIA 1GBEA 1MCTA 2BD7A 1OP2A 3RXQA 2IPQX 1CSOE 1E34B 1OP8A 1MKXK 1UTJA 3E1XB 3PV4A 3Q3KA 4M9FA 1CQQA 1WDIA 4KTSA 3UR6A 2QXGA 3WW7A 1L2EA 1O2KA 2J95A 1GBAA 2W6ID 1P9UA 5C1XA 1K2I1 2VNTA 3EAJA 2JDID 3SNCA 3WWBA 3F2HA 1IQLA 1T32A 2V6NA 2Z9IA 1EP6A 4FVDA 5FXLA 3GCTF 3NUMA 4F48B 1K1LA 1SGEE 1M9UA 1EOLA 3TIUA 1MD7A 1D6RA 1P2JA 1XVMA 4OM9A 5FBIA 2P3TB 1AU8A 2RA3A 2ZHEH 3F68H 2D26C 4Y71A 1UW7A 1V6DA 2EI8A 2XC0A 1KDQA 4LK4A 3SORA 4F55A 5GXPA 2XCNA 1SGFA 4BTUB 3OYPA 7KMEH 1JOUB 5GWZA 1SGIB 1GHAF 5EJLA 1KSNA 2OXSA 3SHCH 3CNRA 1S6LA 2KCYA 3BIVH 2ULLA 5T6GA 4ABHA 1TONA 1NU7B 2WYGA 4ISOA 1QL7A 4M7GA 1P2OA 1FJSA 1LHCH 2XYAA 1C5UA 2J98A 2GJGA 1SFQB 2ZTXA 4I7YH 1C1MA 3PWCA 2PFEA 5FX5A 3DSPA 3GDUA 1SR5C 3JZ2B 5AVDA 1SQTA 2BDIA 1ELCA 1TMUH 5I25A 1CT4E 4D76A 2BY7X 1C1TA 1C4Y2 1MU6B 2ZFQH 4GCHF 1GBFA 2STBE 2WPLS 5C2ZA 1RTLA 1V2VT 2FOMB 1QY6A 2PSXA 1UHBA 2A2XH 1HAVB 1FV9A 1DITH 3LDXH 1AMHA 2BLOA 2FX6A 1SMFE 1OPHB 3GY8A 1HUTH 1S0QA 4AYYB 4O97A 1OX1A 2Z94A 1C5OH 1A61H 2GGVB 5IK2D 4QT8C 2CMYA 1Z1IA 5FHTA 1AZZA 2JH0D 1UO6A 3EA9A 2P16A 1C2HA 3ZZ8A 2XOKD 3KNXA 1F0SA 3RUOA 1TQ7B 4LOYH 5A8ZA 1O0DH 1O2OA 3F9HA 2KAIA 1O3OA 4MNWA 5A0BA 1C9TA 1GBHA 1GPZA 3FVFB 1QL9A 3SGBE 4ACAA 2HGTH 2IOTA 3FP8E 2ZHQH 1LHGH 1BTUA 1BCUH 1A1RA 1VKYA 1UCYH 4FUHA 4X1RU 4YTAA 1NRQH 1FMGA 3VGCC 4X0WU 1K1JA 1AI8H 1YF4A 1NPMA 2BX3A 3DCLA 2HLCA 4MPVA 2F4LA 4TY7A 1SLVB 3RXUA 3W95A 1QR3E 1S85A 1ELVA 4FUJA 4O9VA 2PKSC 3MH7A 4KTCA 2ZZUH 1P8VC 4ZAEA 3KQEA 2TGDA 1LO6A 3RLWH 4R0IA 3MNXA 3TJUA 1AFQC 2OC7A 1NBMD 2OC1A 3QTVH 1WQVH 1K21H 1J17T 3UWJH 4UDWH 2QN5T 2AHME 2GZ7A 5DP5A 1WYKA 1FPHH 2XCFA 3A7YA 1HBTH 1N6YA 1SGTA 2K0QA 5HMAA 1FNIA 3K65B 3BSQA 3SW2B 1EKBB 4CBNA 1OYTH 1THSH 2C8YB 4MPUA 1PPHE 2BY8X 4ABJA 2C93B 1Z7KA 4ASUD 4I8KA 1C5SA 2ZGBH 1QQ4A 1EATA 2KM0A 4NSYA 1KLJH 2ILNA 5FPYA 4GPGA 4KKDA 4X8VH 2J4IA 2GMTB 2HPQH 2ZHWH 1UMAH 4IS5A 3F9GA 1NO9H 2IJOB 2GT7A 1QRXA 1SOZA 1KYNA 2ZU5A 5LPRA 1NFUA 2QXHA 1AO5A 4IC5A 2GD4B 1A0JA 1YLCA 1PFXC 1B0EA 4H42U 2PW8H 1DICA 1PPFE 1OSSA 2Y5FA 2CHAB 1CGIE 3HGPA 2BXTH 1SGDE 1TA2A 1HPGA 5DN6D 3ESTA 3MNCA 2BDGA 2R9PA 5HM9A 1LCYA 1HAHH 4Z0KA 4Q2KA 5EU8A 2FYQA 1V2JT 3BTME 1AN1E 1RTKA 2P94A 1GGDB 1JIMA 4ZCNA 1YYY1 1GHXH 2V3HH 3A7TA 4RKOB 4TPYA 1H9HE 1RS0A 4AOQA 1XMNB 3NK8A 1GVKB 1NESE 1COWD 1C1SA 5F53A 2IPHA 1UK3A 2AIQA 1H8ED 1SQOA 5T3HA 1BBRH 1GGDC 5TCCA 1K9OE 1ZSLA 4I31A 2IN2A 4FUBA 1EXFA 1BITA 1NU9A 3HATH 2ZFTA 3RXMA 1ELDE 1H4WA 2QXJA 3Q3YA 4DURA 2WINI 1GJ6A 1ZJKA 2OLGA 4VGCB 1AVXA 1UVOA 4OS6A 4X6PA 2H9HA 4AN7A 3CENA 3LH1A 5BRRE 2C8XB 2ZPRA 3P70B 5EJZA 3KGPA 3PM3A 3ATMA 1O5BB 2WV5A 4YM9A 1SGQE 1O2WA 2TPIZ 3RXPA 3TK9A 3M3SA 1ANDA 1EZXC 2B8OH 3PWBA 1KXAA 3RXIA 1Z8IB 1Y3WA 3OY6U 3O8CA 3BTKE 2ZGCA 2A1DB 1IQJA 4O3TA 1QBNA 1G3DA 1BB0B 1H9IE 3UOPA 4WH8A 1SKYE 1G36A 1IOEA 1V3XA 3GOVB 3L3TA 3QZRA 2IJD1 1ZTLA 4K69A 1IAUA 2YNBA 2J2UA 4TT3D 2FPZA 3RP2A 1V2ST 2W3IA 6CHAC 2GKVE 4X8TH 3ZZ3A 2DE8A 3CS0A 3LC3A 1W12U 2J98B 2W6JD 1ELGA 1C5TA 2ODPA 2ZDVH 1YLNA 2AEIH 1C2MA 4Y8ZA 1AVGH 4ZKOU 5E2OA 3ZZ4A 2DE9A 3UREA 5HIZA 1LHDH 1AFEH 1CGHA 2BVSH 2SGFE 4R8TB 1SQRA 1DSUA 4B2AA 3VGCB 1BJVA 4IN2A 4CRBA 4TWYA 2D8WA 3P6ZB 3UNRA 2Q1JA 1C2EA 3DD2H 2A4GA 2VH0A 3GCHB 2AMDA 2R2MB 2ZFSA 4CR9A 3PRDA 4WWYA 2K8IA 1F7ZA 2FP7B 3EE7A 2VIOA 4INLA 3ZVFA 3RXHA 4AGJA 1A0LA 1O2UA 3BTEE 2SNVA 3I77A 4AFSA 1L0ZA 5KGOA 4F49A 1H8DH 2ZI2H 2FOHA 2STAE 3M7TA 1DM4B 4CRDA 4CRFA 3U8RH 1KIGH 3MU8A 2BYAX 3B8JA 1EPTC 2C90B 1A3BH 1F0TA 2BDHA 2AERH 4KELA 1TPSA 1P2MA 1ETRH 1P9SA 1TGNA 3EDXB 5AHGH 3PV5A 2XNIA 4WMDA 3ZV9A 1FY5A 3FZDA 4ISNA 4BAHB 1Z8RA 1GI5A 2KX4A 3IITA 2Y7ZA 3HKIB 4NZQA 1BHXB 1TNGA 3ZYDA 4CBOA 3LGWA 3QZQA 1AB9B 1GBTA 1NY22 1SGPE 3GISB 1AUJA 5TJXA 1LTOA 1GVZA 4IMZA 1TPPA 4ZKRU 4GHQA 3LONA 3SJIA 2FXRA 1IQHA 1P02A 3VB7A 3RMNH 1CVWH 2ZFPH 3QGNB 1GMHG 2VIPA 1GBJA 4DT4A 1FY3A 2C3SA 1DY9A 2ZWLH 1DWEH 4CREA 1PPBH 1L4DA 2OQ5A 2P3FH 3SNBA 5FPTA 3F6UH 4AG2A 1OWDA 5A0CA 1V2WT 4UE7H 3LIWA 1SI5H 3T27A 5A8XA 3P95A 3DUXH 2FI4E 3D49H 4BAOB 1CA0B 1ZOMA 1DT2A 2HNTE 4X1QU 3PMAB 1AZ8A 1GMDF 1MD8A 4WMEA 5C94A 1GI4A 3UQOA 1ETTH 1HV7A 1W0JD 3GY7A 2FO9A 4DGJA 2Z9LA 2Q6FA 2XW9A 3MO6A 2PWXA 4UD9H 2BZ6H 3SZEA 2ZGXH 5DG6A 1C5QA 2UUFB 1QB9A 1G37A 4BOHA 2GTBA 1F92A 1C1OA 1NRRH 5GPIB 4JZ1A 8KME2 1CU1A 1ZPZA 4Y10E 4MDSA 1DXPA 2YOLA 1G3BA 5FCKA 4B74A 2VVUA 2M5TA 1EOJA 2J34A 3RXFA 4K5ZA 2XBYA 1S6HA 3GDSA 4U01A 2HVYB 2A5KA 4ZROA 1LPGB 2VU8E 2TRMA 4U32A 1S83A 3RU4T 2BDCA 1HIAB 1ZR0A 1LVMA 1W0ZU 1S82A 3S7HB 3ZZ7A 2PGQB 3ENSB 4OGXA 4KGAA 4K3JA 1BZXE 3V0XA 2PTNA 3P92A 3RM2H 1VJ9U 7LPRA 2FWWA 1GBIA 2UWLA 1KTSB 1Y3YA 1DUAA 4NG9H 4ISLA 3HKJB 4B73A 4IGDA 1TPAE 4ISHH 1HAZB 1P01A 2AGIX 2ZPSA 1KDQB 2XBXA 1YPEH 1HJAC 1A46H 1O2ZA 4UFEH 5C67A 1S84A 1KXEA 2NU4E 5L2ZH 3GICB 4SGBE 4A7IB 3BG8A 3TH2H 2AFQB 4ZXYH 1Q31A 1TBRH 1LKAA 2JETC 1VCWA 2RDEA 2R3YA 3ZVGA 7GCHF 1Q3XA 3S9CA 4FUGA 1C5XB 1HJ9A 1GJ8B 2ZDMA 1ZPBA 1TNKA 1YM0A 4WMFA 4ZHMU 2G55A 1GBLA 4HTCH 2SFAA 4ABIA 5BPEA 1C1WH 4H6TA 2P3UB 4OS2A 2BQ7B 5TCAA 2BXUH 5JBBS 2ZDAH 2G4TA 4UFDH 2ZTZA 4FXGH 3E16B 4PROA 3MH5A 4OS7A 3TU7H 2B9LA 3A8AA 3M3TA 2NU1E 2P59A 4I8JA 3GCNA 3S0NA 1Z6JH 1OWIA 5EOKA 2LP6A 1TE0A 2FDAA 1OWJA 3URCA 4OS4A 2BDBA 1GBKA 1L1NA 2BOKA 4B76A 2ZQ2A 5ETXA 2Y81A 1ELEE 4O03A 2BDAA 1BBRK 3HGNA 1G3EA 1C1RA 4O3UA 3QO6A 3TJVA 3MNBA 1K1OA 2F9BH 5IDKA 3VXFH 3ZZ5A 3KQBA 2BD4A 1UVTH 4Y8XA 2FZZA 3CP7A 4FETA 1ETSH 1MH0A 3RC5A 2A4OA 1HXEH 4H6SB 4X2YA 3ZZ6A 1NT1A 2PKAA 1FXYA 3GYMA 4X1SU 2ZU4A 2ZFFH 5KECA 3TH4H 2BLQA 1GDQA 4NWKA 4Q7ZA 1BTZA 2AMQA 1YC0A 5FL7D 4INHA 3M37A 2GCHF 1SGCA 3M5NA 3SJ9A 1BOQA 1LPZB 3S9AA 1HB0B 1HNEE 4RI0A 1BBRE 8GCHG 2FI3E 3NKKA 4FVBA 3RXEA 2GCTC 1MUEB 1BRAA 1WUNH 3AAVA 2W7UA 4CH2B 1GHVH 1N1LA 3DHKH 3KF2A 1HJAB 2XWAA 4MNYA 3ZVEA 3RC6A 2G52A 1O2XA 1ZMJA 1BUIA 1DWBH 3DA9B 3PYHA 1V2MT 2XC5A 4WJG2 3UFAA 1C2LA 1QTFA 1P3EA 2XRCA 3MO9A 3W94A 1V2UT 1C5YB 1ZGIA 3T62A 2ZCHP 3BTFE 2YNAA 5EQRA 3U98H 1ZJDA 2ANWA 1ANCA 2ZG0H 3ZZDA 4XDEA 4DIIH 1TLDA 2B5TB 3ZZAA 2G81E 1ZTKA 1O3GA 3A84A 3M3VA 1O2YA 1TNLA 5CE1A 1GI1A 1AQ7A 1HRTH 4Z1MD 1VITG 5HGGA 1BDAA 1FIZA 1Q2WA 3UPEA 1W8BH 3GY6A 3MYWA 5C3NA 4LZ1H 3F2FA 1IHTH 2F9OA 4JYVH 2HLDD 3SUDA 3N7DA 2ZGJA 2P93A 3KQCA 3UUZA 3OEED 2V0BA 4GVUA 4D8NA 2PUXB 2ZFRH 1GCTB 4IMQA 1UCYE 1BMFD 3H09A 4I33A 1A2CH 1UTMA 3UAIC 3E3TA 2FOCA 5HIYA 1PPCE 2AS9A 4Q7XA 1NRPH 3LU9B 4XFQA 3A80A 2CGAA 1HLTH 1XM1A 2V7QD 3RMLH 1NROH 1INCA 1PPZA 5EW1H 1GHBF 3GY3A 3P8FA 3URDA 1SGRE 1GBMA 4JYUH 1C5NH 5F8XA 1KXDA 1XXFA 2A2QH 2OINA 3S7KB 4B71A 1H9LB 4KTUA 3S69A 4X6MA 1W11U 3FO8D 2F43B 4IBLH 5ABWA 4I8GA 1T8MA 1LVOA 1G2MA 2R0KA 4JCNA 1TWXB 1UCYK 3AW1A 2V35A 2F3CE 4RT0A 3OE7D 1PJPA 1TOMH 2WPKS 3U9AH 5LPFA 2H9EH 1RIWB 3P8GA 1GI3A 4ESTE 3M5MA 2Z9GA 4E05H 3A7XA 2J38A 3B9FH 3MO3A 1YGCH 2A0QB 5JBAS 1GJAB 1QRZA 3TGIE 4HGCA 5T1VA 3SU2A 4ABBA 1V2NT 1O3LA 4Q80A 1EAWA 4AG1A 1MTSA 2ESTE 1VGCC 2J9NA 4I8LA 4YOJA 4FU8A 1SPJA 2KCAA 1O5GH 2ZDLA 3H7TA 1QZ8A 3SUFA 4HZHA 1PYTD 1NBME 2GT8A 3SNAA 1GI0A 3QLPH 2PR3A 5DP6A 3ZVCA 1EPTB 4LXBH 1EASA 1P04A 3A8BA 4K8BA 5A8YA 1BTWA 1DY8A 1EB1H 4DG4A 3NZIA 3TGKE 4JMYA 2WSSD 3T26A 1J8AA 1E38B 2HNTF 1Y5UT 2PUQH 2I6QA 2VWMA 1KXCA 1TRMA 3TNTA 2ZECA 1V2OT 3EQ0H 2F91A 1P3CA 1KY9A 1GJBB 3RXKA 5E8EH 1CHOF 2NU0E 5CHAC 4A1TA 2PLXA 2GZ9A 1FONA 2BD3A 1K1IA 3UNQA 1O2QA 2TGPZ 1P12E 1TB6H 1UTNA 3Q77A 4YOGA 1RIWC 3LOXA 1VCPA 1JWTA 1W14U 4YESB 1OXGA 2KZ4A 4NWLA 3U1IB 2ODQA 2Z3DA 1AE8H 3V12A 1TAWA 2O9QA 1GMCG 2BDYA 2W5EA 1AWHB 1THPB 4A6LA 5C5OA 1EUFA 3MMGA 3TPIZ 2CF9H 1PQ5A 2VIDA 3R3GB 3T29A 3OY5U 1KMHB 4DT7B 3PMHB 3MOCA 1AWFH 2CV3A 1WTHD 3GCOA 3T25A 2GP9B 1W7XH 2O8MA 1EP5A 1UJ1A 5GJ4B 1ZPCA 3TITA 4ABFA 5AFZH 1Y5AT 1O3EA 4Y0YE 3MU4A 3ATKA 3TNSA 3A89A 1MAYA 1O34A 1GCDA 1RTFB 2VB0A 1LKBA 3A82A 4DCDA 2ANMH 2JJ1D 1FY8E 2ZDNA 4A92A 2O8LA 3KEEA 6CHAB 3PV2A 3AVZA 1T8OA 1GMCF 3TGJE 1DOJA 1RD3B 3PROA 3LGTA 1BRBE 2Y5GA 2Z3EA 5C20A 2THFB 1YPLH 1GJDB 1TRNA 3LT3A 2GDEH 2GDDA 4ZKNU 2ANYA 1O2HA 4HI3A 1C4V2 3SV8A 1GI7B 3I29A 1DVAH 1VITH 3HK6B 4JZEH 1G3CA 2Y82A 4SGAE 2PV9B 1CHOG 1V2LT 2WHXA 3BN9A 4U30A 2M2AA 1CA0C 1TYNA 2FX4A 1ARBA 2JIZD 3O8BA 4B2CA 2YMSC 5AFYH 1QL8A 1ZLRA 1TX6A 4GHTA 5F8ZA 1C5MD 2XBWA 5L6NH 2TBSA 3H7OA 2J5UA 1F5LA 1MTWA 3ATLA 1ZTJA 4WVPE 2UUJB 4OGYA 4ABEA 1ZZZA 1BMLA 4BXSA 4AORA 1WOFA 1BMAA 4RN6A 3MU0A 2ZEBA 3HK3B 1EAXA 1UTKA 1C1PA 1UTLM 1DSTA 4X1NU 1A5HA 1V2TT 3MH6A 1Y3XA 1O3KA 1EZUC 1C2IA 2CJIA 1IQEA 2EY4C 1B5GH 4XE4A 1LHFH 1YPKH 3SHAH 3RXGA 5K0HA 1V2QT 4NZLA 2FOEA 1K28D 2ZA5A 1HJ8A 1GJCB 1VZQH 1S5SA 1PPGE 3IWMA 4NIVA 2BOHB 4X2WA 1MQ5A 2BD2A 3U69H 1CE5A 1D3QB 1GI6A 2G5VA 4AFZA 1YCPK 3A8DA 3RXBA 2A4QA 1TBZH 1PPEE 5HKKD 1G30B 3BG4C 3E0NB 4YLQH 2BZAA 5GCHG 3WWFA 2OD3B 4CHAC 2A4RA 2R0LA 3MQKC 2H5DA 4Y11E 3SBKA 3KYGA 2VGCB 4ZH8A 3TVJB 3AAUA 4BANB 2KR7A 3KN2A 1A4WH 1HAYB 3PMBB 1SOTA 4ABDA 1ORFA 3E0PB 2GMTC 4A5TS 2CXVA 2L6OA 4UEHH 4ACBA 3RXVA 2QXIA 1GHBG 2ZCKP 1J16A 1SLWB 1PQ8A 3SI4H 3LPRA 1C1QA
chains in the Genus database with same CATH topology
4D9QA 3SU4A 2Z6BD 1EZQA 1C2JA 5DK1A 4YT7H 2H5CA 3HPTB 1SBWA 4MTBA 3LKWA 4TPIZ 1TIOA 2VINA 4JZIA 1ZHPA 1TA6A 1AHTH 1S0RA 3ATWA 4X1PU 4NFFA 5EQQA 4Y76A 2LPRA 1YLDA 3ZYEA 1QJ7B 7ESTE 1AFQB 1FQ3A 4FU9A 1O3AA 3SJOA 1DUEA 1FI8A 1MTVA 1WV7H 5HXFA 2FOBA 1V2KT 3L33A 1H8IH 1O3PB 1NRSH 2UWOA 2ZPQA 1BRUP 3M61U 3Q3XA 1SG8B 3Q00A 2TGTA 1O3DA 1QQUA 3M35A 2ZU1A 4Y8YA 2OQUA 2PGBB 2HRVA 2SGPE 2ZNKH 1B0FA 1Y59T 1NRNH 2HALA 1T31A 4NSVA 1A0HB 5FAHA 2A5AA 3F9FA 4GUXA 1J9CH 1W10U 2VVVA 1W13U 5T6FA 1JRSA 2AIPA 3A7WA 1K1MA 1O35A 1QJ1B 4NFEA 1LHEH 2VIQA 1AVWA 1WU1A 1A7SA 1ELFA 1TGBA 2G4UA 1T8LA 2QYIA 4MVNA 4YO9A 2BY5X 1O2MA 2RCEA 1XKAC 2C8WB 5A09A 1NN6A 1MKWK 1NS3A 3K9XB 3ZVAA 1IQGA 1JRTA 3M5LA 1HFDA 4U2WA 4BAMB 2XTTB 2A32A 1AUTC 3N7OA 3ODFA 3QX5H 1N6XA 4XBCA 3ZZ9A 3PO1C 1SHHB 4VGCC 3VB6A 2QF3A 2A5IA 1AD8H 1T4VH 1EJAA 2EC9H 1THRH 1EX3A 1TRYA 1FIWA 1EQ9A 4ZKSU 1FN8A 3EA7A 1TGCA 2BVXH 1SL3A 1IQNA 3LGVA 4MLFB 1ABJH 8GCHF 1N8OC 1DDJA 3T2NA 5FCRA 5DP8A 2JKHA 1DX5M 1HAXB 4K2YA 1A5IA 2GCHG 3C27B 1HYLA 1J14A 1W2KH 3BTHE 1O39A 1QA7A 1ZYOA 4ISIH 1SFIA 1S6FA 1JXPA 2Q6GA 2ANKH 1BMNH 4E06H 3AASA 1YPHE 1QIXB 2VGCC 1P11E 3SJ8A 2KAIB 4CHAB 2FOGA 2WUBA 2J92A 2CF8H 3OX7U 1XVOA 2FOFA 1L4ZA 1X7AC 3TLOA 2FYRA 1GMHF 1A5GH 2P95A 1CHGA 2ZQ1A 2WPHS 4ASHA 1C1VH 4XBDA 4ABAA 1XUKA 3M5OA 1Y3VA 3LGUA 5DJ7A 1WTGH 1Z71A 3SV6A 5DP9A 3SU3A 3T28A 5EXLA 1SLXB 3NCLA 2QC2A 3D65E 3H5CB 1W0YH 2G8TA 1ZRKA 3VB4A 3RMMH 2QY0B 1MTNC 4X6NA 4AFUA 4D7FA 1NFYA 3SGQE 1SVPA 2AGGX 1YCPM 3MWIU 1HAOH 1C2KA 2A31A 1NC6A 2Z9KA 3SNDA 1BT7A 4X2VA 2RA0A 5DP3A 3KQDA 1GWAA 1FN6A 7GCHG 8LPRA 4IN1A 1C1NA 2UWPA 5EXNA 3PO1B 2O8UA 2EA3A 2CHAC 3STJA 2OUAA 1K1NA 1P06A 1EJMA 4LZ4B 1K22H 1UVPA 5DO4H 2VJ1A 3MTYA 1OWKA 2J94A 1TGSZ 1Z6EA 4I32A 4ZHLU 1KXFA 1T7CA 3SU1A 2O8WA 3SV7A 3QN7A 2FESH 4NCYA 1EAIA 1PYTC 2WPJS 2QCYA 1DWDH 4WY3A 4E7RG 1YPMH 3ATIA 3UTUH 1RFNA 1RJXB 3SUEA 2ZKSA 1IQKA 3F1SB 5JPMH 1V2PT 4X6OA 1GL0E 1ELBA 1TOCB 4AFQA 1PQ7A 3OTJE 4MPWA 4D9RA 1OKXA 2SGDE 1TBQH 1LDTT 4KP0A 3QUMP 1AE5A 2FOAA 4GAWA 3M36A 5AF9H 2EI7A 1G9IE 2ZP0H 1GG6C 1QB6A 2Z3CA 1GG6B 1UTQA 1D6WA 1YPHC 2BD5A 1C1UH 1L1GA 2SNWA 1TMTH 1WAYB 1GHZA 3TJOA 2PKSB 3SQHE 3FANA 2HVXA 2AH4X 4JZDH 1P2IA 3SV2H 4Y79A 1O31A 2H6MA 5L2YH 1BIOA 2TGAA 1O2PA 4FUIA 5EXMA 1YP9A 3E6PH 1U6QA 2R3UA 3GY2A 1HAGE 4DJZB 3BTQE 2BD8A 2NWNA 1CT0E 5E0HA 2OC0A 1DS2E 1EB2A 3EE0B 2SGAA 5CHAB 3RXRA 1DANH 1NM6A 3K6YA 2OP9A 5CMXH 4RKJB 4CRGA 1NFWA 1O30A 3MI4A 4ABGA 1ANEA 1GBDA 3TH3H 1ELTA 3ITIA 3VB5A 1C2DA 1O3JA 1Z8GA 3MU1A 1DLEA 1G2LA 4WXIA 1QA0A 1RGQA 1Y3UA 2XWBI 2PSYA 2NU3E 3MH4A 3C1KA 4ZUHA 5ESBA 5GCHF 3SOSA 3FP7E 2PHBA 1ZMLA 2ZHFH 1O37A 1QRWA 1ZRBA 1C5PA 1MAXA 3GY4A 1O3CA 1TNJA 4BAQB 6ESTA 1G32B 1XUFA 3V3MA 1C9PA 3OSYA 4JK6A 4ZMAH 2K1QA 2WPMS 1O2VA 3UIRA 3T5FH 3BTTE 1E36B 2FMJA 1CA8B 5C1UA 1XKBC 1WSSH 5JYIA 3IG6B 3D23A 1MTNB 3RXSA 4FUCA 1TMBH 1UVSH 1BJUA 1GDNA 3SJKA 4ZHAA 1GBBA 3QWCH 4XOJA 4AYVB 1QB1A 6GCHF 1XUHA 1E37B 1A3EH 1UK2A 2ZTYA 3LGYA 1OP0A 2VIWA 3A88A 5DP7A 3SZNA 2W26A 1BQYA 4WH6A 1E35B 1SGNE 3SO3A 1GI2A 1MBQA 2QA9E 2Y6TA 3SU0A 1O5EH 1C5VA 1KLIH 1LVYA 1HIAA 1P05A 5T6DA 5JB8S 3TK5A 1LMWB 3FP6E 1C5LH 1HCGA 5E0GA 5LGOA 2QAAA 2VWLA 3A87A 4DOQA 3MHWU 2SGQE 2FIRH 4INKA 1O33A 3K2UA 1XUIA 1SQAA 3QGJA 4NA8A 5SGAE 5HM2A 2UUKB 3UQVA 1F5RA 1J15A 3SU5A 8ESTE 4AX9H 3O8RA 3ZVDA 4X8UH 1FAKH 4GSOA 1GVLA 2ALPA 1TQ0B 4DVAU 3RDZA 1N8OB 1F2SE 1JBUH 1O2NA 5DP4A 1NZQH 4UONA 1B7XB 3WY8A 5E2PA 1TABE 2H9TH 9LPRA 1XXDA 1SLUB 1O38A 1GJ7B 4GLYA 2JH6D 1JMOH 3F9EA 1QCPA 1ZMNA 2ZC9H 3RMOH 1LVBA 2ZDKA 4CR5A 2H1UA 3LJJA 1MTUA 1QFKH 3SV9A 1ELAA 3Q76A 3UR9A 3CS7A 1TFXA 4MG3A 3M7QA 4CRAA 1TGTA 5FPSA 2WYJA 3E8LA 1CT2E 1KLTA 4B2BA 5GIBA 6LPRA 3SI3H 3A85A 4J2YB 1EJNA 1QJ6B 2QGRA 1O2TA 2GZ8A 1Z1JA 3RM0H 3UOUA 1O3NA 4IW4E 2FS9A 1QHRB 1GDUA 3GY5A 1P03A 2H2ZA 5C1YA 3RU4E 4Y6DA 1LQEA 1BHXF 1S81A 1MBMA 1MKWH 1P57B 2BX4A 5FBEA 1O5CB 2ZIQH 1Y5BT 1ZHRA 3KL6A 1O2GH 3V13A 5E0JA 1D9IA 3QK1A 4JK5A 4Y0ZE 3VPKA 1GL1A 2EEKA 2V3OH 3LJOA 3O8DA 1QBOA 3DFLA 1FZZA 2A7JA 2AYWA 1O3HA 3U8OH 5EQSA 1BRCE 1ZSKA 1SGYE 1MU8B 1EZSC 2FLRH 1IQFA 4OS5A 4GCHG 1T4UH 3BIUH 4UFFH 1FDPA 4JZFH 1VJAU 5EPYA 4K1TA 1CBWB 2LNCA 1Y8TA 3U1JB 5DKMA 3ODDA 5C5NA 3SU6A 1F5KU 5F8TA 2G00A 4DW2U 2DUCA 4THNH 2F83A 2GV6A 2B0FA 3EGKH 4Y7BA 4YT6H 4NGAH 3OU0A 1UHBB 3GYLB 1AKSB 4X8SH 2FM2A 4IC6A 2BLVA 2P8OB 2D2DA 1HXFH 1PQAA 3BV9B 1P10A 1O3BA 3SQEE 2WUCA 1TNHA 1GHAG 2Y80A 3A81A 2VWNA 3QDZB 4BTTB 1O2SA 2BD9A 1O2IA 1XUJA 3PLPA 1YKTA 1CBWC 1VR1H 3PLBA 1BMMH 1O2LA 2FEQH 1CGJE 2Q6DA 2QF0A 3A8CA 1YCPH 1YPJH 3RLYH 1ACBE 2FTMA 4YZUA 1UK4A 2EI6A 3BEFB 1GBCA 1UTOA 1HGTH 1HAPH 3SGAE 4E7NA 1P2NA 2XC4A 3BG4B 2FS8A 4K8YA 4AGKA 1CO7E 1DPOA 4H4FA 1HAVA 1D3PB 5EGMA 2JETB 1DWCH 1DFPA 5IYTA 3JZ1B 5EPNA 6GCHG 4AZ2B 1QGFA 2Y5HA 3K6ZA 3SNEA 2ODYB 4OS1A 2I6SA 2BVRH 1ARCA 3G01A 3A86A 3NWUA 2OC8A 3PLKA 1FY1A 3R0FA 1IHSH 1C2GA 1SSXA 2CN0H 1D3TB 2FTLE 1MQ6A 2OTVA 5EODA 3LGIA 3RXOA 3UY9A 4NA9H 1SC8U 1BTPA 4WXVA 3BTGE 1O32A 4RSPA 2ZF0H 2R2WU 3VFEA 2OBOA 2FODA 2BQWB 1P0SH 1TALA 2AMPA 3TJNA 3GDVA 4NIXA 1BTHH 2Z7FE 1D3DB 1FAXA 5A0AE 5F03A 1GJ4H 2WPIS 2Z9JA 2PKAB 2BY6X 3RXAA 4BNRA 2F9UA 3FFGA 1NTPA 2UUYA 4BTIB 4NA7A 4CRCA 3NXPA 4A1VA 2TIOA 1C2FA 2D1JA 2F9VA 2ZHDA 1GI9B 1HAIH 3KIDU 5JB9S 1XUGA 2HOBA 2F9NA 5JBCS 2W7SA 3SN8A 2OBQA 3RU4D 1C5RA 1ID5H 3ZZCA 1O3MA 3MFJA 5HYOA 2C8ZB 2XXLA 3RXJA 1QBVH 5LH8A 2VVCA 3L6PA 4XSKU 2JH5D 1MZDA 2Y7XA 2VH6A 4Y7AA 2NU2E 4D7GA 1FLEE 2ZU3A 1EPTA 3A7ZA 1FPCH 1EAUA 2G51A 5B6OA 4JYTA 3AW0A 1ZGVA 5DPAA 5FX6A 1LQDB 1VITF 3RXCA 3VB3A 1OYQA 3STIA 3BTWE 1OWEA 3LH3A 3PMJA 1ESTA 1MCVA 1WQSA 1MMJN 4Q7YA 1TX8A 3E91A 5GDSH 2WV4A 2ZU2A 3UNSA 3RC4A 1TPOA 3VEQB 2BQ6B 2C4FH 2VWOA 5ESTE 1P2KA 2HNTC 1V2RT 3E90B 4K60A 1P09A 2QV1A 3B23B 2BM2A 1UVUH 1Z8JB 3GCTG 3KHVA 4K1EA 2W3KA 1F0UA 1OS8A 2ZO3H 5DGJA 1D4PB 3MU5A 2A7HA 3ZVBA 1SGFG 2ZCLP 2BHGA 2P8OC 1AB9C 2HWLB 1GI8B 5I46H 2GCTB 4J1YA 4MQAA 1HDTH 2FLBH 3PTNA 5A2MH 1T8NA 2GV7A 4A1XA 1DE7H 1O5AB 1NFXA 2F9PA 1H1BA 2SGEE 1LPKB 4YLUA 5EW2H 3EYDA 2O8TA 2XBVA 1E0FD 2BTCE 1WBGB 3PTBA 1YBWA 2PTCE 3D62A 4MNVA 5H4IB 4FUDA 4TWWA 5K7RA 1O36A 4MPXA 3UWIA 2B7DH 4FUFA 2BLWA 3P8NA 5G4BA 1GHYH 3S9BA 1DLKB 3ZV8A 5J4QA 2AGEX 3ELAH 1BTXA 1C5ZB 1VGCB 3RXTA 3RXDA 2GVFA 1KXBA 4CH8B 3GCHC 3U8TH 1W7GH 5L30H 3NPSA 3V7TA 3BF6H 1ANBA 1FY4A 4NIWA 1OWHA 1TNIA 1ABIH 3M7UA 2VIVA 4FUEA 1MKXH 1JIRA 5EG4A 2RDLA 1RXPA 4WF8A 5LPEA 2HPPH 9ESTA 1F0RA 3A7VA 1OOKB 1ESBA 5JBTA 5JDUB 1DXWA 4B75A 2QIQA 1ZHMA 4MNXA 1AY6H 3ZZBA 4XBBA 2A45B 1BTYA 3MNSA 1QURH 4AB8A 2BMGB 1QNJA 1GHWH 3DFJA 4NIYA 3EA8A 3SUGA 1O5FH 1YPGH 1VCQA 4HFPB 4K1SA 1C5WB 2OCVB 1O2JA 1O3FA 4TY6A 1TX7A 4FU7A 1IQMA 1MZAA 3P8OA 4Z6AH 1P2QA 1O2RA 4BXWA 3A83A 1O5DH 1L1JA 3QTOH 5F6MA 1AKSA 1FUJA 3BEIB 1SHYA 1WCZA 4YOIA 4BAKB 4I8HA 1GCTC 3P17H 3PB1E 2A7CA 2ALVA 2RG3A 3I78A 1K1PA 1GJ9B 1SB1H 1GJ5H 1UTPA 2BB4A 4ZXXH 5PTPA 3LC5A 4B1TA 1GMDG 1O3IA 4F4OC 2ZGHA 2G5NA 3FZZA 4DY7B 4UFGH 3BEUA 1XX9A 3BTDE 3TK6A 5J4SA 2BY9X 3DT0H 1AGJA 1ESAA 1BA8B 3KCGH 4TYDA 2ASUB 4X2XA 1W3CA 1KTTB 3FAOA 1AIXH 2FI5E 1C4U2 1ZSJA 4AB9A 3RXLA 4DIHH 2GX4A 3VXEH 1RRKA 1IQIA 1GBEA 1MCTA 2BD7A 1OP2A 3RXQA 1CSOE 1E34B 1OP8A 1MKXK 1UTJA 3E1XB 3PV4A 3Q3KA 1CQQA 4KTSA 3UR6A 2QXGA 1L2EA 1O2KA 2J95A 1GBAA 1P9UA 5C1XA 1K2I1 2VNTA 3EAJA 3SNCA 1IQLA 1T32A 2V6NA 2Z9IA 1EP6A 4FVDA 5FXLA 3GCTF 3NUMA 1K1LA 1SGEE 1M9UA 1EOLA 3TIUA 1MD7A 1D6RA 1P2JA 1XVMA 5FBIA 2P3TB 1AU8A 2RA3A 2ZHEH 3F68H 2D26C 4Y71A 1V6DA 2EI8A 2XC0A 1KDQA 4LK4A 3SORA 5GXPA 2XCNA 1SGFA 4BTUB 3OYPA 7KMEH 1JOUB 5GWZA 1SGIB 1GHAF 1KSNA 2OXSA 3SHCH 3BIVH 2ULLA 5T6GA 4ABHA 1TONA 1NU7B 2WYGA 4ISOA 1QL7A 4M7GA 1P2OA 1FJSA 1LHCH 2XYAA 1C5UA 1SFQB 2ZTXA 4I7YH 1C1MA 3PWCA 2PFEA 5FX5A 3GDUA 1SR5C 3JZ2B 5AVDA 1SQTA 2BDIA 1ELCA 1TMUH 5I25A 1CT4E 4D76A 2BY7X 1C1TA 1C4Y2 1MU6B 2ZFQH 4GCHF 1GBFA 2STBE 2WPLS 5C2ZA 1RTLA 1V2VT 2FOMB 1QY6A 2PSXA