2VJ0A

Crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, in complex with an fxdnf peptide from amphiphysin1 and a wvxf peptide from synaptojanin p170
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
246
structure length
246
Chain Sequence
ILAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVINIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solitary and Repetitive Binding Motifs for the Ap2 Complex {Alpha}-Appendage in Amphiphysin and Other Accessory Proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
total genus 68
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vj0A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2vj0A02
3VN5A 2A7BA 1KYFA 1PZDA 4BCXA 1IU1A 1QNBA 1TBPA 2G30A 1P4UA 1D3UA 5IYDP 1KY6A 1VOLB 1MP9A 4WZSD 1NA8A 1TGHA 2D0BA 3HS9A 1C9BB 5IYBP 1VTLE 4PY5A 3H1ZA 3OC3C 1QN3A 1B9KA 2D0AA 1QTSA 1NGMA 1QN5A 3MNMA 2MJ7A 2YMTA 1OM9A 5CN1A 2IV9A 1W80A 3ZY7A 1RM1A 1NH2A 1QNEA 1KYDA 4ROEB 1PCZA 1GYVA 1TBAB 1QTPA 2VJ0A 1QN6A 1GYUA 4ROCB 2DWYA 1QN4A 1VOKA 3EIKA 3OCIA 1AISA 5IYCP 1QNAA 1KYUA 1QNCA 1VTOA 4B0AA 2Z8UA 1KY7A 1JFIC 4RODB 1R4XA 1QN9A 2E9GA 2IV8A 1YTFA 1GYWA 2DWXA 3ASMA 1E42A 1QN8A 1QN7A 3HS8A 2D0CA 5CN2A 1YTBA 1NVPA 3ZHFA 1CDWA
chains in the Genus database with same CATH superfamily
3VWJC 2C3WA 1KXVC 1XGQA 1JNNL 3UTZA 3UERA 3CFMA 3FN3A 1D5BB 4M6ML 5GRXG 4LPTA 2XTLA 2HFFB 3STZA 2EYSB 3ZIYA 4I18C 3LRKA 1U21A 1P7QA 1TZ8A 4HK0B 1EWHA 4GP5B 3VMPA 1GGIL 2DM3A 3NJKA 4NO0D 4IOSD 4L1TA 5H94B 4Z7WB 1JBJA 2DMHA 3G6AB 3TXAA 1CICB 1O9ZA 1G6RB 1PIGA 4GKSB 4J12A 3RE0A 4OV6F 4EN3C 4PV8B 2PO6A 5JQ6L 1YPZE 4KHTH 3S2AA 3EOYG 2HRPH 3MRBA 4FG4A 5ITFA 3G5ZA 3KPMA 4GINA 4WTXA 5FUZL 3G04A 1RUML 1N68A 1LM8V 2FJHA 4Q6KA 4P5TC 1N64L 4ZUSB 4DP2X 3EYQD 4XPHL 4UOZA 1N70A 4MMXA 4PGBA 4MJ6A 3CFBB 3SPVA 5IOPA 4MCNA 3OSMA 3MZTA 4TSAL 1KCUL 2VJ8A 3G5ZB 3KPMB 4W9ZA 1PF3A 1GGBL 2EDWA 3U7WL 2MQ3A 4F37K 3L3DA 1KYDA 5ISZD 4DKFH 2KDYA 3DRQA 2IBGA 5F88B 2VISA 1ADWA 2VM3A 1LEKA 5JQHC 3MJ8A 1BQ5A 3EBGA 2YA3A 1GZHC 4DPRA 3I6LE 2MQCA 2R5XA 4YSTA 3OGOE 2I07B 3BMWA 3JTBA 2FCBA 2ADYA 2F19L 3SOBH 4PU2A 1NC4A 5GQBA 4AIOA 1S9XA 2FGWL 4KK5C 4OGXH 4C83B 2AQSA 2HSIA 5HHME 3SE9L 4MCMA 2DM4A 4ZNEA 1W72A 3FOLB 4HJGA 3UTTA 5MERA 5IFJB 4IOIB 2CA4A 3MUUA 2B08A 2NX5A 2YGNA 3PUCA 1FVEA 2DBLH 1CXHA 1B4LA 4YHNA 5DURD 1GGBH 3TV3L 2ZWLT 3FQTB 4QRAA 4NIKB 1PCXA 3BUDA 1KYOK 2H6PB 5T5FH 4IKKA 2XWJA 3HG1E 4XC1H 3VRIA 4JRXE 4H1LA 5KYYB 1RZ7L 4KX8A 3U46B 1I1FB 3EFOB 3HNVH 5L2KD 1NMBL 2D31A 4TUOA 4UZSA 4WKZB 5AKTA 5C6PB 1EK3A 1YEWA 3U0WL 5C7ZA 3QA3B 2ATKB 1U8IA 5K9QI 3KPRA 4GBXC 1UHVA 4F15B 3NEEA 4QPEA 4R2GB 3PWPB 1ROWA 2F7QA 4P3DB 5IJBC 5DUMH 1U8KB 4OCMC 4PJXA 4EO5A 2X3CA 4KWUA 1S7QA 5IHZB 1M05B 2OMYB 3PHAA 4U1KA 4JANA 4OF5A 4CBPA 4DSYA 4HUWB 1Z3GL 35C8L 4HEME 3MNZB 2DIEA 2NY5L 4HKXB 3GUTB 2Q76A 3O2DL 3K81A 5FIEA 5HSFA 4CDHA 1YYLH 2G5UA 4AYID 2BNUA 1ML0A 3NVQA 2QV4A 1K5WA 3QUZB 3MRKB 4XN1A 3AAZB 3OR7B 5I9QB 5JIIA 3IGAA 1ANUA 3UPAA 5C08D 1S7XA 1E5BA 4LLAA 2IJ0C 1QQDA 1VFBA 3C09C 5D2NE 4D3CL 3GMOB 4JZOA 5FK9A 1Y07A 4EN3D 2NY3B 2IQ9H 4UNTA 3T0DA 4R97B 3OGCB 4JFWA 4BKTC 4NZFA 4ZFOA 3BX7C 3IU3A 1KYOJ 1ZS8A 1JZ2A 4PGCB 4WV1A 1KN4H 1WO2A 2J71A 1DHKA 4UWQB 5C86A 3LNEA 1REIA 1X4YA 4MRQA 4V1DD 1G0XA 3QZWA 4TRPH 1SOXA 2AMGA 5DK3A 4OLUH 2X05A 1JI2A 2H1XA 3ZR6A 3LRMA 2ED7A 3SDCB 4AQEB 4XC3L 3ISRA 4UIKH 4QHUB 1YRKA 3BUTA 3GXDA 2VXQL 3EFDH 3O9WD 2AXWA 1R46A 4H8QA 1Z2KA 2D9QB 4S2SA 4I4WB 5TE4H 4EKJA 1R0AL 3INUH 1E8WA 1NPNA 3VD3A 2WXOA 1T7VA 3IDIA 1GYUA 3KHQA 1R3JA 4P5TA 4OLWL 1LMIA 3N0PB 5JMRA 3AQXA 3BP5A 3ETBF 4PS4H 4TL5A 3HN5A 5KVMC 3UADA 5IB2B 2CGRH 4K7PY 4X0KB 4MNQE 1NLBH 4JVUA 4L0ZA 5ICYA 1S7UB 4RNRA 1H15B 3FO2A 3GO1H 4YFDB 4FS0A 3WL9B 3WXWL 1AZZC 1EUUA 3GSOB 2FTAA 3HUJB 3PGDB 4YR6A 4AGQA 5B38A 3RWIB 4B0AA 4UTAA 3NJJA 1KY7A 2HN7A 1FVCB 3KPLA 5E2VL 2HVJB 3L17A 4NAQA 3BP7A 3EH3B 2ZUYA 4KXDA 1OL0A 4JB9H 1I1CA 4WWOA 3QORD 3I9PA 3RU8H 4DULA 4HJGB 2DL9A 2NY1C 4PRIB 4GFXA 2X70A 5I8CA 4GP8B 2GPZA 5HDOA 4NT6B 5AW6B 3NJHA 4M6NH 1ZDSA 1JHTB 3U82B 3VE0B 4OFYD 2XVLA 3SZKC 2H6UA 1OAYH 4KQ3L 3BXNA 4TSCH 4DEPC 1NKGA 2F74B 3LRHA 4QIRA 4A2FA 1MCWM 1UZGA 4B7LA 2X4UB 4KRLB 1V7MH 1WD9A 2QBWA 3QORC 4HJJH 4Q4IA 2XG4A 4CADA 1JD7A 2YGQA 3MJ9H 2GY5A 3OR6B 3INUL 1X9RA 3ARGA 3D9AL 4R4FH 3MUY1 4XXWA 2VW6A 4I1RA 4DK6A 3HBGA 4L8SA 3BCDA 3LCYA 3OC5A 4N0UB 1YPZA 3O3BA 3O6FA 4N2BA 5EU3A 5AOKA 3B2DC 1FZOB 2BVPA 2FH6A 3MRFB 3WE6A 3ARBC 1F3JB 4N0CC 3DX9A 2Z0FA 5ICUA 1DO6A 5ANHA 4LSUL 3U30C 4MRBA 5GGUA 1MDAA 4K3EH 2I07A 6FABL 4BJLA 3FHAA 3ABGA 3FQRB 4M29A 3RB5A 2EH8H 1T4KB 1OKEA 3NACL 4JY4A 1QR1A 1J1PL 2RHEA 2A9AA 4LRNL 3DPBA 5GGSA 3D18A 3IBOA 4DP8X 2YMTA 1LO5B 4P46C 3ZDYB 5E03A 1WFOA 4OZGF 2DJ4A 3O9WC 1F6LL 1F4AA 2PR4L 2DRUA 5E1IA 3T08A 3QS2A 3WTVA 2BVPB 5D7JB 4WCYH 1LP9A 5T3ZL 3AXIA 4LL4A 4MFHA 3UAJC 4NQCA 2QLVB 4IKLA 3ORJA 4YPJA 1N7ML 3TJPA 4N0YL 4Q9CA 3VXUE 1Z6JT 3QUXC 1OB1B 3SIKA 3HVNA 5GS1C 5FB8A 5D7SH 4DFHA 4JQVC 1RJZA 4OD3L 1ITBB 1Y1DA 1GW0A 3MRCA 1N5AA 4FTVB 5J57B 4U3CA 1XH1A 5CJXA 3HUJF 3VGFA 3D7PA 2NVMA 2PYED 4L1DA 1V55B 4UDTA 2X7LB 3QJRB 5KYWB 4XOAA 4JX0A 4F9LC 3VJ6A 5F7EL 1UUNA 4TVPL 4UIMA 3ASNB 4P06A 1QLEB 4KKLD 1SQMA 1C12B 2GJ6E 2V2TA 4OF8A 2EYTA 4XNXL 3ZGIA 2VR8A 1JYVA 4LFHD 1Q9LB 2ZTBA 4G80B 2BDNH 2YD7A 4PJ8D 3V5DB 4G6AC 1YCSA 3HRZC 4P5TB 1DBAH 1WP6A 4F91B 1X5HA 3AJ7A 4FNUA 4F7MB 1QUNB 1U91B 3NJVA 4QF1B 5C0EA 1V05A 1N59B 4XVTL 3SE4C 1WWAX 1LK2B 3L13A 3QI9B 3MUGB 3GMMB 4XPTH 1UCTA 2E74C 1MI5B 2Y25A 4TUUA 2VN6A 4HKZB 4YPGB 5I8EA 4DZ8B 1HVXA 1SMDA 1K4DB 5LO7A 5IJVB 5HGBB 2BMKA 3QZWB 3RVTC 3D4CA 2RIKA 4A7TA 4WHYH 2D9CA 4UQAA 3SDAD 2J55A 2WW8A 2A6IA 4UBDC 1JHLH 5K1NA 3D85B 4FLSA 1AXSA 5FXCH 4X6FB 4AUYA 5IGXL 1IKFH 2FEJA 5AFAA 2F5BL 2DQ6A 2HMID 1OP5K 3ZE0F 1SJEB 3NDYE 3VWJB 3HRZB 1D2PA 2Q7NA 4GS7C 4N0UE 4A7QA 1HOCA 5E6UB 2RFXA 3QJHA 4HFUL 4ONGH 2F1EA 2QLYA 5T33H 3FQYA 4XO8A 1SVBA 2H3KA 4LSVH 3NZ8B 1ILUA 4LSSH 4PCTA 2KH2B 3DHJA 3JT2A 5GS3A 1NAMA 4IK7A 3AW5A 5ENWA 1G6VK 2EDMA 3LEXB 4NNPL 5F7AA 4EQ3A 1JRHH 4PJ7A 1FGVH 4N2KA 2BFVH 3T3PE 3U25A 5C3IA 1BPVA 1Q1PA 1OSEA 5KJ4A 3PV6A 1M7DB 4B6ZA 3DVFA 1WSST 5JLZA 4ZBJA 4FZ8H 2ZPKH 3W2DL 3K71B 4O51A 5DRWA 5DD3H 5E56A 3HC2A 5LLIC 1PFOA 4F8TA 1ZPUA 4L0PB 1JRHL 2VDRH 4LL9A 1Z0MA 3PNWB 4PGZA 2CLVB 3V8OA 4MZ3A 3WSQL 3O9WB 3RVUC 5IHBA 3DTXA 2CUHA 1Q9UA 4HCGA 3E8UH 1N18A 4JS7A 4XZUB 3ZZSA 2VO8A 1JV2B 3I50H 4IGBD 1P1ZA 2EDFA 5C9JB 3NH7L 2F61A 2R23A 4R96A 1IVTA 3IJHA 5A2AA 4PRPE 3HZVB 4KXBA 5FHBL 3CZLA 4RRPM 1THCA 2CRMA 1MEXH 4JZNA 5IQNA 1VEOA 3Q5OA 5KVGH 1JF1A 3VFGL 4KJPD 1W72B 3UAJA 1BP3B 4OQTH 3MCLH 3IXAB 3O4LE 2XACC 4IMLB 4LCIL 5ISZA 3UG3A 4HIHB 5CSBA 3UC0H 3VA2C 5GS1A 2F0CA 1QFWH 4Z7VE 5IF0A 2W0PA 5IVZA 4FXKA 4LQFL 4ONFL 4MGXA 4HXBL 4EF3A 1FHNA 1LLAA 3IDMB 1T4KA 1OOAA 1NC2A 1DL7H 3U9UB 1DE4B 2EADA 3UAEA 3DRQB 1YEEH 3VFWB 1N5YH 5B1AB 2HVKA 3Q9PA 3T8XB 3MV11 2DLEA 3PGCA 2OTWB 4QJ4B 3C8HA 1WAPA 1VCBC 2UY6A 4YHML 4J3OC 5CN2A 1W16A 3KLKA 2EIZB 2HT2C 3TTYA 1NCBH 5GSVA 2OZNA 2YUZA 3MACH 3V0AC 5FR3A 1J88A 3CU7A 2H2SC 4FXKC 2R4SL 4U7KA 3U2SA 3B2VH 3QWOB 3QQ4A 1VJSA 2XG4B 3Q2VA 4FG2A 1XAKA 4WNQA 5D93C 4Z3TA 4EMZA 2VDLL 3OKEB 4JG0L 4GQPH 5IBLD 4YHPA 4KK9C 5EU6A 4W9HC 2JVUA 3PREA 1JV5B 1XGTA 4HK3N 5BZWA 3SO5A 3QEUA 4DGWC 1MCBA 1RZKC 2QRDA 2XZZA 5ADOL 4CW1A 3DPUA 4ZTEA 2HH0H 5HDBB 1HS6A 5HHMB 3WG7B 1JE6A 4YHMH 5SWZD 1JXDA 2YEQA 2OW6A 2WWKO 3SZ6A 2NCEA 1K4CB 4XMXA 5DMYA 5IMKA 5LG1A 3NA9H 1P5UB 2Q7YA 2AJYL 3O45B 1F6FB 5F9JA 4LIQE 4MJ2A 4F2FA 5J6GB 4PP2A 3WNLA 4ZODA 5EOQH 1HAUA 3EZ8A 4U05A 4QUOA 4MMZC 1XB3A 4CVUA 2B5IC 5LAPA 1E2ZA 4QYOB 4AV4A 3O2VL 4UT6H 4YDIH 1IGJB 2ORBH 1TBAB 3K46A 4JFUA 1IT9L 2P5EE 2WVUA 3KXFA 3EF7A 3WCYA 1KGWA 4IOFD 3X17A 1N6QH 5HI3D 4KVNL 4W9DC 5AVTB 3ML8A 1SJHB 4R7DB 3VFMA 3IM1A 3D3VE 1RZKH 5IBTL 1MAJA 4N28A 2LU7A 1B9ZA 4MNGB 3UAFA 4ZMTA 3BVNA 2EDKA 4NZ8A 4LEOA 1AI1H 3K91A 5FOBA 3SDDA 4BH7A 1PLGH 1AO7A 2H32B 3HCVA 2Z6FA 1X7QB 3LS5H 4ZS7L 2JIXA 2AJSL 4TLSA 1P5DX 1VTOA 1HYSD 1SJXA 3HLAA 3KE0A 2EDEA 5EU7C 4PTTA 2Q7AA 3E38A 3LX9A 4JFDE 1SF3A 2QVFB 3KZ8A 2F53A 3ARYA 4BUGA 4RRPG 5KVFH 2OK0L 4PR5B 3QIBA 1ETJA 3LPOA 3LKQB 1YTFA 2B1AL 2BSSB 3HW7A 2DWXA 3ASMA 5J1AA 3K6OA 4YWGH 4NPJA 3QDJE 5HVGB 2JTYA 1J0JA 4FFZH 4NCC2 4FA7B 2AGJH 1F11B 4QHKJ 3SOTA 2GTWA 1QN8A 2XA8H 2BNQA 3GRWA 4J4PD 5TGBA 5GS1B 4GBXB 4F15C 2B20A 1KXVA 1VENA 4P2RD 4D0DA 1FNEB 2X42A 4BFFA 4LVOC 5E1QA 2GY7B 4NM8H 3BMVA 5BRZA 2FL5B 1GAFH 4X9BA 5FW7A 3NSDA 1E9PA 4P07A 4FLRA 5JHDB 4KRMB 3L2MA 1C8PA 1BAFL 1SY6L 4OM1L 4JFOA 2N0MA 3ZW3A 1SYVB 4CVWA 3KYMA 1XSKA 2Q8BL 2W65B 3LQAH 3FFCB 3RIKA 2MKLC 1OZTG 3MV9A 2P7TA 4OV5A 2L0DA 4M7JL 3I75A 4XNAA 2DW5A 3N1MC 3PWPA 3CMOL 2ENQA 1KEGL 2J25A 4Z7OF 1KFAH 4PWEA 15C8H 3A6CH 1F5WA 3QA3A 5F3HB 5ETUA 2WOYA 1U30A 2BIHA 4ZQKA 2D31B 2EXWC 2BO0A 2L3BA 3HI1B 4E9LA 3OC3C 4EDWL 4NT6A 2WUCH 3ESPA 1CQKA 1MRDL 3I75B 4JM4L 5C6TH 5CLYA 4ELMB 1CLVA 3SD5A 4FI7A 5C0FB 5JLZB 3GJEA 1PGRB 2C8NA 4Z6AT 2UUDH 3NSYA 3B37A 2X6AA 3D0LA 3HAEB 4KTGA 4DN4L 3ECQA 5I82A 4PYGA 4YHNB 5IIEB 3QIWC 3VFRA 2NY4D 2X6MA 4IS6A 2WJ5A 4Z77A 3LY6A 4M7JH 1MI5E 1VFUA 2Z8SA 4N8VA 5EEUA 5IT2L 3S97C 3LPPA 1GJUA 1NJ9B 2XG5B 1VFMA 4OVVA 1ROCA 2VZ3A 4UOW1 1JZJA 4TSBH 4FG6D 4KK6C 3F62A 1VEPA 3HHMA 5EO1B 3CTTA 1UOKA 3I6SA 1JTPA 1TVBB 4PRHD 1AGDB 5GGVY 1HSAB 2GFBA 4LDLB 2DS4A 3LRGA 4HIEA 5E9NA 1GJIA 3LRSA 1SDDB 3MJ6A 1UQSA 3WIIH 3BEVA 1RIUL 2JKIS 2X2JA 5I1EL 1ORSA 3BUYB 4P59H 2RB8A 2EDRA 4GRWB 3V4VL 3HB3D 2WMPA 3IDYC 2EJ1A 4MXWH 5IT2H 3GLZA 5J89A 4HUCA 4WDIB 3HCVB 4MHHG 5D2LA 4ANVA 3VXRA 1E5CA 3IKCA 3EJQA 4WUUD 4L2YA 1IQDA 3GS4A 4NRZA 5KBPA 1A2YA 1OCCB 1A4AA 2CHNA 5DJCB 2BZDA 5T1KD 4H20L 4HC1A 4WHCA 1LEIB 4TPSA 1QRNE 3AB0B 2XQYG 4HH9A 1KZQA 4WFFD 3WGVB 5IKCB 3MKKA 1BW8A 1F3DH 5GHWL 1WS7A 3BZ4B 4HW6A 5DLLA 5BZZA 4WJ5A 5FK9B 3V79C 3NN8A 4RISL 4U2YA 1OP3K 1I85A 1I3UA 2MCMA 2H2SD 1BZQK 1QHQA 3QFJD 1PZ2A 5FYLE 2BSEA 4AIZB 1UM6L 2A6KB 4EXKA 2HL8A 1ZLVH 1HXMA 3KPNA 4KXAA 4PJFA 4ODSH 2VXVH 3BWSA 4BUHA 3VMNA 3NIGB 4NN7C 2PWHA 4MJHA 2A77H 2G2NA 4WZSD 2DQJL 2I60L 4JHAL 2Y1YA 4AV0A 1UD2A 4M7ZC 4HPOL 1LEGA 3EBAA 4F7MA 2UY7B 4TNVF 1PCJX 4E42A 4ACPA 1KCUH 1QFWI 4BZYA 4WI0B 1PZSA 2WQRA 3RUGB 4C4BA 2CR3A 5GGQH 1K2YX 5FS5A 2OSLA 3TN0C 4JDEA 4PBDA 3H53A 3RURA 4JHWL 2E7CA 5D4QA 5LN4A 1BZ9A 3MRLB 3OX8A 4PJ8C 2D0AA 2H0PA 1M2OA 1NINA 2F8VA 2EYRA 1I8KB 3FT1A 4WI0A 1PIFA 1D5MA 2E56A 2VC2B 4EIZC 5IOKA 3AABA 1CTMA 5EBMB 4ETQA 1NFDE 2Y5TB 3BN9C 3L5XH 4B9YA 1EJ6A 3MRIA 4JR9H 1CVSC 3SDAA 5T3XH 4L8CA 2O3OA 1A7OH 4XXCA 2QGBA 2O30A 3K6DA 4PP1C 2R0ZL 5CD3A 2D3JA 3DV4A 3RDTA 3QAZC 1OAQL 5EZLB 4PLKD 5L4MA 2G2RB 3PWLB 3UGXA 3CZNA 2Z4TA 1KBWA 3MRQB 3ULUH 3QT2A 2JQZA 2FWLB 1HEZA 1I9EA 3Q2LA 4J6RH 4LGSB 4ODBD 4UOJA 3REWA 5J9PA 3HKZA 4TPRH 4HSQA 1Q9OA 5J4MA 1RVFH 3EBIA 3OLIA 2XQYA 1YAZA 4C56B 1U3NA 1ADQL 1KV7A 1CFVH 3GJFA 4M7KL 2CR0A 5KYUA 2CALA 2R2CA 5F1IB 5IM7B 3Q43A 4HUUB 2QSQA 2APWA 3CSBA 2ZCKL 3MJ8B 3B43A 1K85A 1W0YT 4NENA 4QHNA 2FGZA 1D9KD 3GSQA 2Z8UA 1ZHNA 3DGGA 1JRHI 4G9DA 4GQZA 3RI5K 2HG0A 2IXQA 4GT7A 2EE3A 5F6HJ 5LBGA 1BGXL 2B0SH 4FNQA 4XCCH 1U8QA 1WZLA 2D7TH 2ZG3A 4GW5A 2GTZB 2UXTA 1IM3D 2CUAA 2P5PA 3GMNA 5GGQL 1Z7JA 5IROA 4AYFA 4E5XA 4R3SA 1DFBL 3SE3C 1GGCL 4XI5C 3FMGL 2N59A 1S5IH 3HG5A 2J5LB 2ROYA 4HLZH 3NQIA 4YIQA 4K8RL 3WNIA 3HMWH 5C2UB 4IU2A 1K3ZA 3DJTA 2N3JA 1TITA 3BPLB 2DQCL 4KKLC 5EULV 3VFUA 5IQ7L 2Q20A 2DAVA 3H85A 4R7LA 1K8DB 4KKZA 1ZA6B 5E24E 5IQOA 1BVKB 4DQOH 1QNZL 2XX1A 5DGRA 3C8DA 2BP8B 4NJAH 4DGVH 1RIHH 2Y06L 1Z9OA 3ULUD 4JO1H 4O2CB 5JYLA 1EUVA 3EADA 3NJLA 5CILH 5TDNB 4UTBL 1RMFH 2HJFA 2ZKXA 3MRHA 4GRWF 5HYIA 2PXYD 3OHXB 4ZFGH 1J0HA 4JDTH 5I30L 4P23C 2X2YA 2YQGA 3GK8H 4I8OA 3QFDA 3GINA 2WKOA 4YDNA 4I0KA 3W0WD 2NWVA 1ZLVK 1FLRL 3A67H 5I16A 1AD9B 3FQ1A 2Q86B 1C08A 4FFYH 4WUKL 1KB5L 3ZO9A 3HHRB 4GXUN 1HESA 3IRCA 3C6LA 3GMRA 1OCRB 3N2JA 2BDNL 4ZSOE 4TQIA 2QVKA 2V7NA 1UCBH 3BWUF 5I0DA 5DCCA 5I26A 2HYMA 3QHZL 1BD2B 1R5VB 3KXFE 1G9NH 4FFYL 3K8MA 4H5SB 1UA7A 1ZIAA 5L2KB 1BCIA 1YQVH 2JKXA 1OWWA 3LVEA 4UILH 3QZLA 2W38A 3CHSA 4PJAA 1I8MA 3DK2A 2D7QA 4GO8A 2IF7A 3IJEB 1OHZA 3KPPB 1CMOA 1KIRB 2A99A 3QJVB 1V3MA 3S7GA 4QTFA 5I1JL 3SDCA 4A2DA 4I88A 4AQEA 1RZIB 5I0YA 5K39A 4X8GA 5BRZB 4JQIH 4KKNA 2YO3A 4G8FA 1XX9C 4JR9L 2JJUA 3VFOB 3OJDA 3CK0L 2PYFB 3NZ8A 4Y1AB 3VFGH 1PVSA 4ILDA 4JFED 4WGVB 2WNGA 1F45A 3GMMA 4P2AA 3QJHB 3QUHA 5DZ9A 3VI4B 3TJEH 1ES0A 1HDMA 2QGCA 3KG5A 3U48A 3IJEA 4N0FB 4HULB 1NFIB 2AK4B 2OMZA 4AX3A 3HMWL 5IK3A 2JCCB 2GUOB 5DJYA 1N26A 1RCYA 1NCCL 4YHIB 3BQUB 3UYPB 1P7HL 5JW3H 3RI5F 2WLKA 5DFAA 3FZUC 1BOGA 1QD0A 1WA1X 5IHUL 5FOJA 3BFQG 4JFEB 2IG2L 1OY3B 3T6WA 1CD1B 1XF4A 1QLEL 1IBGL 4NQXA 2C3XA 3HJ0A 1YJDL 2NXYC 1A7PL 4WI9A 3LN5B 3MA9L 3T6ZA 1USQA 1KLGB 4KI5E 4PI2A 3CFJB 1B0RB 4YE4H 4HJ0C 5C07B 1VEMA 5C0CB 4JKMA 2OMUB 4P49A 4UDUB 2YD1A 4ZFFB 2V17H 5HDRA 1WC7B 1SN2A 2FAUA 3NEOA 4QTHB 3S37L 2BJML 4B97A 4CMMA 4JRXB 2IQAA 3V4UH 3AT8A 2BCKB 3KGTA 2CLZA 1CLYH 2EEFA 4P3DA 3X12A 4F7KA 1YNLH 1A9EA 1S9XB 4HJEA 3D51A 1I4FB 5DD6A 5DJ0A 5F9WC 3AT0A 2ZKMX 3R06B 3GI9H 1G9MH 3DPBB 5D6DA 5GGSB 4QWWD 2AJ3B 2QQKH 4ZO6A 4B9JA 5E23A 2BNQE 5E99H 1YEGH 3OV6A 3IRZA 1K8DA 4GLRH 4LKCA 4Z8FL 3HG1D 1H3XA 3DSFL 4YK4B 4IRSD 5F0LB 1O6SB 1NIEA 1FCGA 1KNOB 3U0PB 4PJDE 3AWFA 4E9XA 3BLBA 4NOFA 3RUGE 4BYHA 1VZHA 3D2UB 4ATTA 2HT2D 4JY6B 3MRCB 1FL5B 1MCPL 3UTSA 5E2WL 5KS9E 4U6VH 2PTUA 3H56A 5B7MA 5I6KA 3O0RL 1YEIH 4DP7X 1OLLA 2CLRA 1WK0A 2XWBB 2G2PA 3FCTA 3OVUB 4ZUSA 4MQTB 2PCXA 3EH4B 3FOLA 4PLOB 5EB9A 2UY6B 3N1QC 4BFKA 5LVEA 4PRHA 1J9CT 2MNWA 3ETSA 2EDXA 4NQQA 4Q6IA 3PGCB 1F90L 4Y7MA 2JELL 2VIRB 3B7YA 1F4YH 3QK0A 1MHEA 4GXVL 2WO4A 3VSUA 4U1IA 5IUSA 1UXSA 5EO9B 3I6KA 5EC2B 5IB4A 3BI9X 5F88A 5C0JA 4PJ7F 2R1WA 2FUVA 4J2QA 3IRPX 5CGMA 2ZD0A 1B4JH 5CUSL 2W9EH 1A02N 1UWYA 1PLAA 3X13B 2JB5H 4XBPA 4HS6B 5EIQA 3EYUH 5IB5A 1J1OL 2XOTA 3FF7A 3ULVF 1HKLH 1NCHA 1YO4A 1E8ZA 3VXMA 1E9QB 1G7LB 1YNTB 2V9JA 2FIKA 3Q5TA 1T21A 3SGKA 3VXOA 1LK3H 2KZBA 3V6ZB 2OOYA 2Y23A 5EPMA 1FN7A 2HVKB 4EZMA 3BJ91 4KI5F 4EBQH 5FF6A 1FV1B 3CH1A 4UI2A 3AXLB 2DWTA 1BVNT 1FRGH 4NRYB 4NKDA 5E5RB 4L9LC 4WEMB 4FLOA 3TBCA 3UPRB 1CTOA 4XXDB 5HHNB 1J5CA 4PCSA 2GJPA 2H2PD 1M56B 3N3EA 3P3TA 4G1EA 4LEBA 1TZAA 3UO1H 1CBVL 3W38A 2JNZA 5DHYB 3SYAA 4HSAC 4OIIL 5T5NG 1D5RA 4LP5A 4NCC1 3U0TB 1FRGL 2RD0A 3EYVB 1E3FA 3TA3B 1GA2A 4YXKH 4D0BB 4S0HA 2WWNA 1IX2A 4OZHF 2VLKA 3CC5B 2DN7A 3QJQB 4NM8L 1IGML 2I5WA 3VN5A 4I9XA 2TRYA 1XIWA 1FF5A 3DX6A 1PCMX 2ADGA 4AUJA 3O3AB 3DWTA 1JF5A 1MY7A 2Q9OA 1NGYA 3K4ZA 2A9CA 4UV4H 1SM3L 2Y7NA 4HJIA 3PYCA 3HFMH 4PJHA 5DD5H 4G42B 2VN7A 2NXZD 3LN9A 4NWTH 1S7VB 2CLVA 4HHWA 2NW3B 1YY9D 1F3DJ 1WAAE 2YRBA 3QDHA 4S1DC 1I8MB 1XR8B 3FRPG 1G9HA 2R29H 5AW3B 4AENA 1YYCA 2VDLB 2YA1A 2FT6A 3T0EE 4DEUA 3ILPA 3GB7A 2NW3A 3T0VA 2VDQH 1XIWC 3PHQA 4FZEL 4PMEA 2C3VB 5EO0A 5FYKD 5DZPA 1FFQA 1KGXA 4OZGA 1R24A 3VGAB 3KYNA 1CUOA 2Z4QA 5E6IA 3M7FB 2KUTA 4ZAKA 2CPUA 5L6YH 4Z95H 4U33A 1N64H 2HT3D 2OZ4H 4JJHA 1MCHA 5GRWA 4I9WD 4XPGH 2F54B 1YEFH 3FBQA 1KENH 4OM1H 3RIFF 4UUJA 1N6VA 2B8OT 2B4CC 3MLVL 4PY8I 4W9EC 4OZHA 1JGUL 3A6BL 3A21A 4JO4L 4F1SA 3K0WA 4MAYB 1CU4L 1N12A 5I2IB 3PDKA 2JXMB 2YKKA 4PW3A 4WWNA 3WY4A 5EOQL 3SJVD 2IBBA 3D2UD 1Z5LB 2ZX8A 4YGAB 5EF1A 1DEDA 5LBSL 4ZTOL 3BE1L 1X5MA 1ZOXA 3CFDA 4NKMA 3ZTNL 2AGJL 2H6PA 1LDPH 2VQTA 3MLUH 4JFHE 3C87A 4XO3A 4DK5A 3SKMB 4EJYA 5EG6C 1A0QH 4AEEA 1E8XA 3KS0J 1KEMH 1M3IA 5SWZA 4RSYA 1F8TH 1EMTH 3MLXH 4LF3B 5C3LD 2B1AH 1G7LA 1IGFH 1D6VH 5D4HA 5D7LE 5DD1H 4YFLF 1FZKB 4HISA 5B39B 4RGMC 3GRWL 2NY0D 3ZBMA 3LN4B 5F7WC 3UACA 3VQ1C 2BNRD 2XRAL 1L0XA 3QUML 3EO9L 5BMFH 1I7UB 4KTEH 3IXTA 2VDOB 2EYTB 3B6SA 2ED6A 3WY2A 4NNXA 2HRGA 4HZ1A 3TV3H 3IJYB 1YZZA 2WYIA 3P77A 3SO3B 4AGOA 1QR1B 1KPUB 3Q9QA 1U36A 2XQBH 3GHEH 5CMAB 5EO9A 5CO1A 4LARL 4NKDB 3WENA 3FQRA 4D7BA 3FFCA 2UXVA 1CWVA 4XP5L 2QSCH 3GJFB 2CM6A 2EUVA 5CJOL 1ILSA 4I48A 1KJ2L 4IKIA 4JJ5B 2V2WB 1AQDB 3PDDA 3LQAL 1ZMYA 2B9BA 4GPVA 2GC7C 1IGYA 2A74C 4DIXA 3KEHA 4O02H 5DHMC 4UT7L 3DX7A 1QTYT 5DZNA 3EXLA 4C56E 4XP6L 1RY7B 1FNSH 4Y1AE 2NLVA 4P2OB 4L18A 2LFEA 2GK0B 4M9PA 1F02I 4H20H 4JM0A 4GSDL 5DK2A 5IMOB 4HGKC 3MOBH 4OM0L 4PJ9B 4EOWH 3I0XA 4OF0A 5D7KE 3ZSSA 5IF0B 1H5BA 3W39A 2JHNA 3CFKB 2A4CA 4Z7WF 1CIDA 2Q8BH 4Y19D 3HC4L 4XWGL 3ILEA 4U6XB 2G5RA 2DIJA 3U4KA 4WU5B 3O41B 1K5NA 1T1WB 5I19L 3QDMB 2BVUA 2R0KL 4G5AA 1PQZA 4MAZA 4YNYA 5GIRA 4PJFE 4UM9D 1EXUB 3IVKA 1CXFA 3VI3B 1QFPA 1VKXB 4QKTA 5HP5A 3VX0A 2X4TB 1OCWL 4RDQG 4MNHA 4I0PB 3ZDXB 2F58L 3FUIA 2BRRH 1KT2B 4Y19B 4YR6B 1A3RL 3VXUA 4BEIA 1A14L 1X9UA 4IBZA 2J5WA 1ZSDB 2DQTL 3ESMA 1A7QL 3QARA 3N41F 4YDLB 3PQYE 4RDQF 4HEPG 3L7EB 4HHGA 4X0KA 2QHRH 3J2PA 3L9YA 1M2VB 3MLTB 2PO6C 2AJXL 1J5OH 4R4ND 1MCCA 3QUMB 5D1QB 2ZXCA 4ZD3H 2TSBA 3NYKA 5EIIG 4HF5H 2JKSA 4IBQA 2Z31C 4I13B 1YJDC 2UWEB 5D96B 1QMUA 5DTFB 2HRHA 1RUKH 4R9HA 1P5UC 1VDGA 2GCYA 4APXB 2WINB 4WW2A 1UTDA 5CWSA 3JWNC 4I4WA 5D5MF 3BP7B 4P8QA 4DKFL 5C0CA 3NIFF 3NCJH 2D2OA 4QHUA 4Y4FA 2VLLB 4RWYH 4MAUL 3OH9A 3FO1A 1UFGA 1UATA 3NZHH 4W93A 5MP6L 1RK1A 4KMQA 1KC5L 2DQGL 5GRYA 4N6RA 1R24B 3AUVA 1SVCP 3ZHNA 4LCWD 5GS0H 2AZUA 1ZHBB 1AE6H 1WH0A 3D0AA 4FL4C 2PWFA 3FN9A 1UXLA 1GYCA 4TVSa 4ZD3L 1MCSA 3WTYA 1KLUB 4CMHC 5JPNC 2YBGA 3DIVA 1I3RA 1ASOA 2VDPH 4NO2B 1VF5C 3EUUA 5LGKA 1QNBA 3IFPB 4UUJB 4JRLA 5I74C 1VRSA 4PRAB 1UFUA 3IH7A 3CXDL 5CD5C 1D3UA 4F57L 3NFPA 2ENJA 2ZP8A 1VAHA 5EIVA 5C97A 3ARFC 2UWEF 4N6RB 2DI9A 2MHAA 2O1AA 1M6OA 4TTGA 4Z77B 5TE6L 3G6JA 4HS3B 4RAVA 4Z7QF 4BV1A 3IGFA 4QRQB 1M71B 4PJ8A 4XMLH 1FFTB 3P4LA 2Y8LA 4G8EA 5C92A 3WLBA 2Y2WA 4GUPA 3VD1A 5IHZA 4Y4HB 4IGBB 2YAMA 1Q0XL 3V6FB 3X2QB 1RZJC 2UZXB 5AALA 2ESVD 3V0FA 4M8VA 3MFGB 3VI3F 3R7RA 2Y5QA 3WN6A 2F68X 3ECVA 5AB1A 1MCOH 2VC2H 4CU8A 4U1LB 1T66C 4M1GH 3UBXB 3BRDA 2F54E 3D4ZA 3DHUA 3P73B 1T2QL 5CAYB 5JZ7D 2CMRL 1E5UI 1KXQE 4KU1A 5DLML 1I1AC 1FFPA 3QUZA 4K5LA 1QLRB 4U7MA 5DVLA 1LWWA 3LEVH 2HZSA 4KROC 5E8EB 4HP5A 1CGVA 5CSZB 1JGEA 3N42B 1TQSA 1QNZH 4Y0GA 2K6ZA 4QHLB 1DQLL 1IVLA 1VOKA 4CSSA 2CU9A 2YBRA 4YXLL 3FT3B 3U2IA 2ZE0A 4JFFE 3WN5B 2J1XA 2FX9H 3SPJA 1AQMA 3MRHB 3C8KB 4ZUTB 1K5NB 1T1WA 1XO8A 1BZ7B 4LLVB 1UWEH 2JV6A 1HZHL 3WXVH 5GS0L 3SDXA 4RRPA 1KTJA 4LOUD 1AGFB 2VLJE 1F97A 3PJSA 5ESAB 4AQZA 2BP0A 2K70A 1BVKA 3WS3A 5JOPE 4R90L 5DJ8A 2NOBA 3CZUB 43C9A 5HPMA 4WWKC 1DBKH 2D7TL 4F33A 2E9GA 2P7TB 4OV5B 1PAMA 3G7TA 5BZDB 4IU2B 3RKDD 4PRID 3LNGA 3FQ4A 3RIAK 1MHEB 2CKBB 2CZNA 3G5XA 3VD9A 1M1SA 4GSXA 2L7QA 1XWVA 4P2QD 3Q0HA 4ELKB 1MHHB 2H7WA 2VIRA 3Q1EA 1YN6B 4GY4A 5GGTA 5KS9B 4LOVA 4HF5L 5D1ZB 3RFRA 4KXZH 4UV7H 1R3KB 1UGKA 2AK1H 1H6FA 2I5YH 5DU7A 1OE3A 1CI3M 2W0FA 2VITB 3JXAA 3VH8A 3TEXA 3W57A 4MJ4A 4RGNB 1B90A 4ALAH 1H9DA 3MRBB 3EGXA 4QJ5B 1FLRH 1KGCD 3FQNB 5EF2A 1QEWB 1IU1A 2IOOA 3VGGA 3QUYC 6PCYA 1FZJA 4D94A 3QG6A 5AVZB 2GJZA 2HPTA 1YY8A 5I6XC 3F7PC 2CK0L 5FM4A 3CN0A 5T8IA 2ETWA 1HQRB 2AEOA 4JFHD 4CJ1A 2ZP0T 4D0CB 3MV8D 2GW5A 2J8HA 1T83C 4ALAL 1BVLA 1U42A 5DS2A 5LNGA 3CBRA 5E9DB 3SCMB 3ZKXB 2BVOA 3QI9C 2IPKA 3MBEB 3BEWB 2HWZH 1EV2E 2I9TA 5HGBA 4N2MA 1CF1A 1EJOL 2DQCH 2J72A 4AEHL 4HPHA 2BC4B 1NQBA 3UTZB 3K5SA 1M42A 4HKZA 4JRXA 4YPGA 3FL7A 2IAAC 4IDLA 3V4LA 1FYTE 5KVGE 1AO7B 2H32A 2OMUA 3MBXH 3O8XA 4M62L 2N7BA 2YXWA 1UA3A 5KOMC 2BC4A 1RI8A 3L9RB 3FU3A 4EAGA 1UXMA 3QO0B 2AV1B 2JSFA 3KPOA 1L9TA 5D8JL 3FAXA 2R0LH 1NCGA 4A2HA 1X4ZA 1DQML 3NSCA 5KSBF 2QQLL 4O00A 2V7HA 4RMTA 4F2EA 2YQ2A 2YPKB 5KVEE 5MEOB 2FLRT 4XP1L 2R0WL 5F9OH 3ZDXE 5AW8B 1ZA3A 3GLEA 1CL7I 3WNMA 3NJMA 4QRSA 1X5AA 5BMPA 1G0YR 4U31A 1ZHLA 2DMCA 3A5VA 2BXYA 2CNZA 4G5ZL 4EDXB 2HTKC 2J8UE 1ZJAA 1KB5B 1W0VB 4NQDD 3CPUA 3R1GH 4JKLA 4JCMA 4U1SA 2HFEB 1LWVA 2ARJB 1C4GA 5HYJA 3U7YH 2YPVL 3FYIB 2IAND 4O5LL 3V7AE 2X9XA 3HLKA 2AJZA 3H2PA 4OFQA 1U4EA 3CFUA 3LKRA 1DJXA 3BZ5A 4NSKB 4EZLA 3TIDB 3QDJA 5E2WH 4WIQA 2VMFA 5ACZB 4YLCA 1ZTMA 1WUNT 4MJIB 3HRPA 4X5WA 1CBVH 2K8QA 3MOAH 4P46D 1O7VA 2D8KA 1MCLA 5A40E 2CCVA 2N7AA 1OE2A 3PP4L 4ZSOB 4MHHI 3VXQB 1NEUA 2EABA 4M7KH 3PCYA 3WDHA 3U2SB 3VB8A 4LHUB 5JHBA 2DBJA 4YC2C 5CS7A 3FFDA 2W0LA 4M43L 1HZLA 4WSJA 4H0LC 5CR8A 3KL0A 2JH2A 1NM4A 1FSKC 3S35H 3KS0H 2HUEA 2B59B 4B9CA 4DCQA 1EO8H 3QORB 3EG9B 1C08B 2E47A 2OOXA 3QCTL 4QLRA 4Z0BL 4BQ8A 5KUKA 3B1UA 3RRQA 5F96H 3TBWA 5G4NA 2D3VA 4GKZB 4GKLA 5GZOD 4OSUL 3ECUA 5IY5B 3WNPA 1MSPA 2UYLB 3NCYP 1HSAA 2FUTA 1Q4NX 3UDWC 1YMHA 1EEQA 2VW4A 5EN3A 2OYPA 5L2KA 2F8IA 3JQOB 1FVDA 4PJCF 4YVUA 1JZ7A 2XNAA 4N22A 5FC9A 1XR9A 3GKZA 3MV01 4HLEA 1N6UA 5DJZB 2P8LB 3RIAF 5LCVH 5DQJA 2VDKH 2PWDA 4JN2A 1EBPA 1DR9A 3CVDA 4ODHH 4F9PC 3C60C 4J6IA 4S1QL 1BBDL 4HHAA 2W9LA 2F5AH 3E3QC 1V10A 3TVMD 4OCXL 5C08E 1SFHA 1BQKA 2EXTA 4HOWA 5KANI 4TNWF 3GJFH 4LLYA 5HI4C 1XEUA 3VXOB 5IFAL 1NH2A 1OAZL 2Z3FA 3FOMA 2ZCLL 5EU4B 4GW5B 1CFTA 2OSXA 3VTAA 4XXCC 5I75B 3P73A 2XFXA 3HFML 3HPLA 3VQLA 4CKQA 1MDTA 2EIBA 4HJSA 3BIKA 5JDSB 2HJKB 1XF1A 4N2AA 2PW1A 2OMVA 4V1DE 1VFOA 5BRZD 4AY0A 3WKQA 5I73C 1Q9KB 4IU3A 3DUHA 4EAIA 2E6QA 5L4IA 4L4TD 5F9AC 3MFFA 2CBTA 2G3NA 4XOBA 1SYVA 3AU0A 4P2RA 5D1ZI 1UZ8A 1AZUA 3JZYA 3QO1B 5DVNA 2X6CA 2YFNA 2NSQA 4WW2F 2AXFA 3RSMA 4ZZFA 3BUPA 4GP4B 1JFIC 2DWSA 1KJVB 3STLA 3N04A 3WY3A 2P47B 4WI2A 3DARA 5CZXC 3TJHD 4YE4L 2MCAA 2LHAA 4KRPB 1X7QA 3SE6A 2Z4QB 1KCWA 3G04B 1QPXA 2BHYA 1W0WA 1XZ0B 1SBSL 3R4RA 4R97C 4U1HB 5HDQL 5CIPB 5ICZA 1O7DC 4IOSA 2F53D 5HYSA 4APQA 1YEHL 4NO0A 5T1DH 5KSAC 1F58H 2GTWB 4MKTA 4TOYH 3P9WB 1NBQA 2NSMA 3N44B 4IQHA 4QHNB 3SYCA 3PPSA 4QRFA 3U7AA 1I3RB 5L9DL 1I7ZA 2MOVA 5F70A 1AQHA 1XSJA 2J8OA 3KJ6H 3KXFB 4LEXL 1FORL 4FYTA 1UEYA 1ACXA 1GL4B 3FT4A 1XGRA 1GTFA 3M45A 3GRBA 1BIHA 1KENL 3FB8B 1DJSA 4PJIB 4ZI8A 3C6EA 2X3AA 4RDBA 2A1WH 2WZPA 5C0NC 1PPIA 3LOWA 4OB5L 1GZPA 2HTLC 1OTSD 4KO7A 1OOWA 1OP5H 4F58H 4KKBC 1UACL 3I3EA 1MHCB 1NBZB 2BOCA 3Q8CA 1MF2H 4APXA 1EFXD 1A6ZB 2VZVA 4AYMC 2K9FB 3P02A 1VSCA 4ZX6A 1F90H 2ZF9A 1KACB 3BAYA 5ESVB 1WYJA 2Y07L 3GBDA 3EO9H 3VI4F 5CZVL 3RVXD 1QN3A 1QA9A 1OIOA 3GXMA 4RA0C 4UT6A 4ATWA 3ULVH 5I1KL 1WITA 1J3MA 2WLHA 4K7PL 5HYEA 4L9LA 3I9GH 1DBMH 2NY1D 5A2FA 1A6ZA 2QRCA 4JQXC 1DVFD 1VFAA 4HIPA 1MHCA 1USZA 2YRLA 3GI8H 5ALCL 3IJSA 4D8PB 1BQHA 1GYVA 4MQ7A 5JXED 5BV7C 2J7LA 1F3JA 5FYJU 4ZK8A 4UU9B 3FN0H 1I9RL 2CM5A 3OMAB 2ZSVB 1I1AD 3UBHA 1R3KA 3VYPA 3FRPB 3B3IB 1LP9B 1ZEAH 4WHDA 3WO3B 3TS8A 2A6KA 1NAKH 2I25N 4C8XA 1L6XA 1FPTL 1TTCA 5AVYB 3B2VL 4GKNA 4Q8BA 4OBSA 2CHXA 2DQIH 3FU0A 3SKJH 5ABZA 3UTOA 5DSCB 4RGNE 1LDSA 3VAEA 3HZYA 1F6AA 2VXTH 3L5JA 3SN6N 5IMOA 1H3PL 1IMHC 4G6AD 5DZJA 1WFIA 1AZVA 2GJZB 3FPXA 4GS7B 1BVOA 4DQAA 4KAQH 1JUFB 3IJYA 5AB9A 4P2OA 1HNGA 1GMIA 2YAFA 1QAWA 3TESA 2ZCHH 3QBTB 4YGVA 5AYUL 1AGFA 1UXWA 1DJGA 2OM5A 1NFKA 2SODB 4QXWA 2N0KA 2LTQB 5AYQA 1HHGB 1PX4A 4M61A 1NKOA 3G5VA 3L1GA 1M3HA 1UJ3B 5BV7H 3GBML 3IU4H 1XB8A 4PJGE 5BXFB 5KVEH 3EKCA 2Z31D 1QN7A 4ELKA 5A1AA 2YAHA 3G6DL 5C0DB 4IRJA 3WFCL 1ZY9A 3B2PA 2A3TA 2BHUA 8FABB 3DOHA 3O6MH 2DQEH 4J8RB 3OKKB 4XNQA 3KPRE 3R7QA 2X4OA 4JFEE 3X11B 4KH9A 3BUBA 2FZ3A 1XBDA 3SBRA 3C04A 1XEDA 1D5ZB 3UABA 4HUXB 4PRBA 2JB6B 4RFOH 1P7BA 2J1WA 4LSTL 4OCYL 3LHPH 3ZKQD 2KQMA 1YA5A 3PQYA 1M57B 1NAKL 3GBMH 3K71A 3ENCA 5HJGA 1XL6A 3V0DA 5JPNB 5KL0A 2JK5B 3P4OB 4G6FB 2QTEA 4YUEH 3VFTB 2EO1A 2B2XH 4Y4KA 5G2NA 2WLNA 2PCPA 2ADJA 4FQCH 5EEZA 1IE5A 2WWKT 1BVNP 4KHXL 2WD0A 4HCIA 4IKJA 4X50A 3RFZB 3KPSE 2B1HL 3N40F 4YAQA 1RUQH 3EHBB 1OGAA 4R26L 5B7EA 1IC4L 4KDTC 4J8QA 5DFVD 4X8XA 3RHWK 4OLYH 2EE6A 5IG7A 4LSRL 2G75A 3F6JA 3BH8B 5GPRA 5C2BH 5I15H 5DEJA 1L9RA 4FQCL 3VTMA 2NY4B 3JVGA 4C7PA 4NO2A 1DP0A 3N85L 2DM2A 1R34A 3C9NB 1MW3A 2L4OA 3GEFA 3BQUA 1KFGA 3NZUA 4FQPA 4HEMA 4J23A 4O51B 5J8OA 2DOCA 4PY7A 4EUPA 4Z3EA 3TZVC 4GG6B 4ZFQA 2V5YA 1DQQA 3E6FA 5FDWA 2CJ3A 1JHKH 2YGVA 5ADPH 4I0CC 1WRFA 3RGVD 1AHWB 3DLQR 4OZIF 4N5EC 3DIFB 3FO1B 3FQWA 2Q6WB 1DVQA 1WZAA 1NEPA 2H1LM 2H0JA 3ILQD 2I7OA 3GIZH 4HAKA 1WBXB 3S96B 4D8PA 1J48A 2BVQA 4JN1H 2A4ZA 1ZHLB 3C12A 4KV5F 4GAGL 4PJCB 2K6WA 2OR9H 1N8ZB 1Q1JL 4HIIA 1CDCA 3KM1A 3VWJA 3S34L 2Q3XA 5DUJA 4ADGA 2WXHA 1DLHA 3EDDA 1DBKL 2ATPB 4OJCA 1G9NC 5IBUG 4Z9KB 4KDVA 3V9CA 2I24N 3OX8B 2EVJA 4BWWA 2HG5B 5IROC 1DVFB 4ZO9A 5C9KA 2AJZB 1CGUA 3SE3A 1KB9J 2VLJA 1KTLA 4KKPA 2ARJA 5I5MA 2WIIA 4ZNEE 4KQ0A 1CE1L 1PZ3A 4OLXL 3SPCA 1V7NL 1SHMA 4HZLA 2XA3A 2K8MA 3GSUA 3CCHB 3GRGA 5T5NF 4KNTA 4OZ4B 2OP4L 1RHHA 2Y6SC 3DIDA 4JO2L 1QP1A 1K2DB 5F0PB 1JERA 3M17B 3QIUD 1LK2A 5CJ8A 3TWYA 2ATAA 1BQUA 3Q3GB 3FU7B 2D7PA 2NX5B 3BE1H 5LN8A 4OCSL 1M05A 2OMYA 2HJFB 2DQTH 4NQCB 2O5YL 4JHBA 5CBEB 3QNFA 3WTTA 4XPFL 2QMJA 1Y0LA 4O2CA 5BVPH 1TVDA 3Q1SH 1JSYA 1J86A 1QLFA 4AGPA 2QADC 2XYBA 3JV4B 3DI3B 4WW1A 3GQFA 1OARH 5E2UH 1QEXA 5JW4R 4FI8A 4JO1L 3K8KA 1F4WL 3ZVVA 1IL1B 1OF0A 1QR4A 4CU6A 5EIIA 8FABA 5HYQB 1ZGLP 1N3CA 12E8L 1RIVH 1BEYH 4GW1B 3DI2B 3P3UA 4IM8A 2MIZA 4LFHG 3NK3A 3OLEA 3KWXA 3QJSB 4N5ED 3CVIH 4C58B 2VYRE 3V4VH 1P2CB 3UEQA 3P9MA 3QEQD 1BPLB 4KJWD 5D96C 2R69L 3VXMB 5D1XC 4HEPA 4J5VA 4TMPA 3SDYL 3STLB 4F37F 2V9UA 4L4JA 3WJLA 3GM0A 1P1VA 2MTPA 2X4SB 1B4RA 1KCBA 4KVPA 5DJ2A 3TWCL 4HUNB 4HIEB 1N2RA 5EPCA 1DYZA 2NUPB 3ECBB 4G9FA 1RURH 3P0VL 5DK2B 5KG9B 4NZRL 1HZHH 1UXSB 2CHZA 1V5SA 1XGZA 1WUZA 4PWKA 3MU3A 5H94A 4WFGD 4JFDD 3ARGD 4EI6A 3HG3A 1UUSA 3F7RA 5DJ2B 3HE7B 4N0RA 5HGAB 1ZGLM 1BM3H 1G7MA 1KGJA 3L4TA 1DBBL 3N91A 3O8XC 3QIWD 2C1OB 1RURL 3P0VH 3EYOB 1CYGA 4HX1A 5HI5C 3FTGA 5CJBA 3WHXB 2VLRA 1PSKL 2FJHB 4X6BB 1QNAA 4G6MH 2MFNA 4TPRL 3SKOB 3MCG1 3VSVA 2XHIA 3VD4A 1HJCA 2PW2A 3OBAA 1OAKL 2XN1A 4M1GL 4NQUA 3RP1A 2IWKA 3ZE0E 3TZVD 5I5IA 1BF5A 3CSYB 2P1YA 4IIQB 3ZQ9A 4F8QA 2B0SL 3RWIA 4G7RB 2R29A 3VXSE 3PFQA 3UBXG 4NGHH 1D5MB 1NDGA 2R2BA 2WK2A 2YXFA 3DTDA 1LO3H 3X14A 2LAEA 3MJGX 1LE9A 2FO8A 3H3KA 4GMTH 4UBDD 3CVIL 4IL8A 3UJJL 1KCSL 3H4HA 3GLAA 1D9KC 4PJ5B 3VRLF 5F0JB 4E9VA 3LMJH 5F7LB 4EI5B 4JZJB 4R2GC 4RWHA 4PRNB 2FB4H 2G0KA 3IDUA 3B9DA 4UT9A 4WHTA 1ET7A 4BGDA 4CMMB 2MQGA 3ES6A 4LSDA 3OAYH 3RIFK 2R9HD 3FSWA 2WZ5A 4OAWB 2R8SL 4QRQA 2NY3D 5SV4A 4R5XA 1DQIA 2X2UA 3OZLA 5C07A 3TCLA 4WAFA 1X9LA 4LBEA 3MXVH 4H13C 2OQJB 4NAMA 5JIKA 3QULA 1L9NA 2EEBA 1ZGLB 3HR5A 3WLWD 3EYQC 3HBPA 1N7MH 4ORGB 3SO3C 4Y2DD 1E50A 1KDIA 4DQOL 2XFGB 3DV6B 4JRWA 5TE4L 3T6QC 1KJ2A 3GKWH 1O6VA 4D9LL 3MLPA 1XF4B 3J8F7 3O9WA 1YMMA 5EF3A 5I6NA 1AHKA 4YSEA 4PY7B 3K72B 3VDCA 3MLRL 1FAKT 5DZAA 3Q5YA 2IAMB 4JO3H 3V0IA 1L0PA 3DECA 2VL5A 2JI1A 3BW9A 1SF5A 4X5WB 4NFDA 4YDJA 1HXYA 2F5AL 1DJHA 4XNMA 3OAWA 1XH2A 2YAOA 5D1QD 3PV6B 3D05A 3MYJB 4JRYA 5CIPA 1WCBB 5ICZB 3H9YA 2AQQA 4WWPA 4LOFA 3NPZB 4X4KA 3K6IA 1HXKA 3GMPB 1GMEA 4HH8A 3H9SE 1MWAH 1NCCH 4QY8B 3MRDB 4MAYD 1KB5A 1AMXA 2CXGA 4H2CA 2RACA 3GXTA 4OBRA 4OZFH 4UANA 1C5CH 4OZIB 4MB1A 1ZD6A 4LCUB 3VDAA 3EOTH 5D6CA 2VAAB 3CVCA 3HZKA 4JM2D 4IRSC 3NSXA 3SJVB 4J3WA 1SDDA 2QQLH 1OPOA 4PBXA 5CEZD 4F8PA 1EEUA 2WCPA 5LWYL 4PRPA 1V7ML 1T89C 3AY4C 2DWYA 3P4MB 1CICD 3PWJA 2CO3A 1IM9B 3HTLX 5C0AB 3HZMA 2ATKA 3GMOA 3P54A 4JZOB 2JPIA 1JYXA 2WSKA 3AREA 3AS3A 5FYJH 3OXRA 3WIFA 1BDYA 3FUHA 3WFEH 4YHYB 2PCFA 2YMOA 2JE8A 2D4DA 2GBTA 3FTUA 4H1LB 4PS4L 3CFTA 5KYYA 4JFXA 5AWNH 4NKIH 3I2CH 1QSFA 4AMWA 4G71B 5E08L 1WA2X 3QHZH 1NCTA 1Y7VA 5E2TL 1CC3A 4FHJA 2IH8A 1AQ8A 4YHOH 2NOIA 1Z9NA 2H3NB 4I5BA 1T21B 2ZNWA 3R0MA 3ZRSA 4KZ0A 3LB6C 1FC2D 3ZKNC 3DX0A 4HX1B 1J1PH 3GSNB 1LWYA 5TDNA 2WTPA 3GSXA 4UQBA 1I1YA 2K1MA 2XXGA 5CBAA 4OCXH 3EDFA 4MRCA 2YD8A 3P4NA 5AZEH 2QGDA 2MNUA 3T65A 3L7FB 2ZQKA 4ODXB 5D5MA 2FZ3B 1GRWA 4HU2A 3B2UD 5AAPA 4G8IA 4KKRA 1TTRA 1TJMA 4FZEH 5EZIL 4XNZB 4NS0A 4NC2B 4FMVA 4OF7A 3VJ6B 5AW9B 5JOEA 3BPOB 3BVWA 1JJUA 5GRVK 1N2RB 3FRUB 4OQTL 4NJAL 5I76B 1LJMA 4IRJB 4L37A 4G83A 4OB5H 3IFNH 4JPVL 2KZKA 1X3DA 4GKNB 2NY5C 5EBWA 1F4HA 1B4JL 2ZYHA 4QCIB 3BQVA 2VR5A 4HJ0D 3TYGH 5IOPB 1ZT7A 1QRND 1NBYA 1PQZB 1B0GB 1KY6A 1COBA 4X6CA 3KLQA 5KSAA 2YFOA 2VSKB 5EU6E 4WU5A 4UV4L 3IETA 2OYMA 1K35A 1CN4A 1RHFA 2O5NA 4MA1B 2DKUA 4GIPD 1TQBB 4MSWA 2H9GA 1JPTH 1EHAA 1LD9B 3DMMB 3E8UL 5F72S 2F8OA 1CDBA 3S35L 5IEHB 1FFOB 1G7QB 4ZDHA 5DT1L 3RY6A 4P4RB 1B9KA 1EBAA 3MGOA 4ZPVA 3B9KC 1FUNA 1U33A 2YEZB 3CWTA 5D7IB 2BXZA 1CO1A 3WEXA 5M95B 3BHBA 4G6FD 3LNFA 1U4FA 3HVDA 2WVSA 3EJCA 1LNUB 3UX9B 4PTTB 4H26B 4M3JA 4E36A 2BCKA 3D12B 1AC0A 1F1AA 2BP3A 5TE7H 3HHSA 3JSSA 1WCQA 3QCTH 2JJTC 3Q3GA 1G9ML 4EI5C 3ARGB 2IVFC 1ASPA 4BCYA 1MAKA 2YD3A 1V27A 4KPHL 3VGHA 3QUYA 4GXFA 4L8CB 4NHCL 4O02B 1CXEA 3MRGA 2DQDH 5E8DL 1OSYA 4XN4A 5FAAA 2FO4B 4HOMA 2VDNH 3GMQA 1O6SA 3QJXA 1I8KA 2YPLD 1F3RB 1G5AA 4NQXB 4PJHF 5MEOA 1PKQE 5DEFA 5MI0B 4B3EA 5DURB 4XTRC 4LOEA 4MS6A 4W9LC 2Y69B 2D2CC 3RTQB 3FO0H 3JWOC 1HI6A 3M88A 2FSDA 2QQNL 3DYPA 1FGVL 3EUDA 5ICXB 4KOBA 5ITBH 2D7NA 5DHEA 4TUKL 5IESH 3QNYB 3EJSA 1H8NA 1UWFA 1IBGH 2IPUG 4XR8C 4NJ9H 1L7TL 3D85D 4MNQD 3U7WH 5A2KH 3DURA 1ZS2A 1TPXC 4KVCH 3VGBA 2VN3A 1UWGL 2IADB 5IV2B 3QWRA 2D0CA 3TA3D 3AG3B 1IBDA 1KPVA 3QUXD 4AMKH 5LGJA 3WUWG 1ULVA 4JLRB 1SMOA 5CLXA 3WFDL 3AFLA 4DP0X 1L6ZA 2L04A 3L95A 4ODTH 1KPRB 2FEDD 3SOBL 2ERJB 4JFFD 3ATFA 3GTNA 2D7OA 3KYOB 2VERN 1BZ8A 3ULAB 3V5HA 4DUWA 4GQQA 5IWLC 3BO8B 1BXVA 1IAIH 4IOFC 1TENA 5TQ0H 2BSTB 5CFHA 5TTRA 5E99L 4IW4C 5C08B 3TLRA 2FQFA 5EUOF 1YNKH 3AC0A 4OZIA 2H1PL 2J1ZA 3VXTA 1JWSB 1L9SA 1TZHB 1JK9B 2BINA 5EU4A 1A4JB 5LAXA 4XPHH 1TYRA 3F7YA 1RJCA 2FLMA 1BYPA 1MFBL 1T22B 5KN5B 3US0A 1GW6A 2FKMX 3MRPB 3QI9A 3GI8L 3I3BA 4QRRD 2QREA 4R26H 5KJ7E 3F83A 4NNYA 1QSFE 2FECI 3H9SA 4G6KH 3LIZH 1KB3A 4ELMA 1M7IA 1IBZA 5JOFA 1ZT1B 5JW5A 2BFVL 2IANB 4HA1A 3TVMB 4F92B 4YDVB 4YVNA 2VZTA 3GTVA 3OJ2C 5TD4A 3I74A 4A2MA 3MRMA 5JW4Q 3GSWA 2J8UA 2FQEA 4P9HH 4MJID 4PJAE 5IQMA 1GGIH 3BVXA 3MV7B 3CW7A 1NJ9A 2XG5A 3E6HA 3E3QE 1ZSDA 2QL1A 5CINL 1RZGB 4PEEA 3WAJA 3LHPL 2IH1A 4FYQA 1ODAA 6PAZA 4QI3A 2BLFA 3RQ3A 2R0KH 4YDMA 3T0EC 2AEQH 3UZQB 5TPWH 2PPEA 2AZAA 1IFHH 1JGEB 3FSOA 2NOFA 1EXUA 3IVKB 3V9EA 1RP9A 1UJ3A 1ZJBA 1SUJA 2B59A 2XWZA 4HKJA 4DCQB 3KR3L 2P4AB 5D7JA 1URLA 3D69B 1ZV2A 2GJ6B 2ZWNA 4PM1A 5HJ3A 1E6OH 3MV7A 3KW8A 3ZL4L 4QRBA 3MNWA 3M86A 4JDVA 4XN5A 1A6AA 1J0IA 3QC5X 3US9A 3ASWA 4NBZB 4WW2C 2X4OB 3TCXA 3X11A 4PQXA 5F89B 2R1WB 1IAMA 2ICWA 2NYKA 3W9EB 2PYEE 1TO5A 3OKKA 1D6EB 4P4RA 4XPBL 4HOZA 3TEWA 4M5ZH 3RWFA 3WJMA 5J1AB 2NQDA 1A3ZA 1CDGA 3LEYH 2XY2A 3QUMH 5AG9A 5IEHA 1INDL 2PP8A 4QTIL 1IGIL 4R7NB 1MVUB 1BBJB 2C7FA 2YAEA 3P9LB 2APBA 2M83A 4UM9B 1NGPL 1WVZA 4OLYL 3IMRA 4PJ6A 1LMKA 3IFOA 4G6KL 4PGDA 2YARA 3TTSA 2QMKA 3TZVB 3M07A 4CGUB 4I0PD 3QEHA 1E30A 2CRZA 3MV8B 4RQQB 4PREA 1S46A 2EE0A 5DRNA 3FU6A 4J1UB 5EWIL 3WMQA 1HOCB 1ZTXL 2V8LA 5KUMA 3TYFA 2NMSA 5I76A 3T3ME 1Z3GH 35C8H 3RL2A 3O3DA 5F7YC 1GKEA 5BJTB 5J13B 1SYSB 2J5LC 3F12A 2C34A 5CP3A 1URZA 2A9MH 2YGPA 2ZAGA 2OCCB 4GAFB 5DHDA 5FA4A 4IEFA 2ENSA 2KLSA 1XCTA 4J3BA 5BQ7B 5DJ0B 5E0QA 1YNTF 2QEJA 3CPLA 3GS7A 1AD0A 5DDHB 5F0MB 1F4XH 3MRQA 4QXGH 5LXVA 4QYOA 1FZKA 4DETA 2IQAB 5AVWB 3QJFB 2X9WA 4N5UA 1NBZA 2OL3B 3SBPA 3S3BB 3AB0C 4I5BB 2OSWA 4EDXA 4W70A 4LLWB 1G84A 2GBUA 1TQCB 2XQYK 3A23A 3C5JA 4UQ3B 2CO7B 3HOGA 3PHOA 1EJ8A 4PG2A 3RWDB 1ED3A 3SDAB 2OX5A 1EHXA 3V4PA 5L8JB 1CFQA 1UOWA 4D9QE 4MCYB 4P2CG 3LZLA 1NGQH 2R1XB 4WUUB 2JCWA 4FABH 3RTQA 4MA3B 1UACH 3PGFL 4KH2A 3QQ3A 2XC8A 1JK8B 3ETBJ 3JV4A 2WBJD 4G7QB 3SBQA 3HC3H 5FKAA 3TFKC 3L81A 1BM3L 1T1XB 1SOQA 1RPKA 1T2JA 2NW2A 4YHPB 2HMIC 4OCNC 1AIFA 4PRPB 5C09A 2MCPH 1OT4A 3KLDA 5INDA 1QEWA 2GSIB 3O0LA 3RWDA 1CCZA 4FG0A 3ZDZE 4B3VA 1HU8A 3KGUA 1UM5L 2VABB 3CDFA 5J6GA 1TU2A 3K5RA 2FX7L 4NUPA 1FH2A 4G8FB 4XI5D 1HJBC 3N1PC 2YSSB 5I1AA 5F7UA 1T6AA 2IPKB 1KSRA 2YN3A 3TIEA 1TG8A 4H2AA 1EAPB 4PH8A 3MYJA 3NK4A 4PMFA 1D6VL 2WXJA 4WX8A 3RAJL 2BWIA 3KCPB 1AKJB 4JB9L 4RMQA 4MXWL 1Y18B 4AXWB 1CFSA 4FP8H 2VUOA 2ZCKH 2Y1AA 4RMWA 3Q8FA 2ZUVA 4ABUA 4P9MH 4H25A 3GTTA 4YBLB 4WZ9A 1QATA 2ZOKA 5T5FL 2JWYA 4BJUA 3EJYC 3ZK0A 3VH8B 5GZNC 3OR7A 1T7YA 4LLVA 1PZDA 5EBGA 1Y6NR 4L4TE 4IBSA 4A04A 2DBLL 2QFPA 5SX4H 4GH7B 5D70L 3V0JA 4OZIE 3T6XA 3GUTA 2ROXA 3AS0A 4AQ8A 3PWVB 1KIRA 5LDSA 5E4IA 2OBGA 1BAWA 5B4MC 5E8OB 1NA8A 2Y36H 3L3GB 3NIDB 1BYNA 3H42L 3IN0A 2QR0B 3ZQWA 4GJTB 4QHPA 3E6HB 4H7VA 1U58A 4I77L 1DN2A 3S3SA 4FMKA 2DQHH 3FMGH 2EXYC 5LHDA 3O11B 1I1YB 3EFOA 1ACYH 4L3ED 4KQ3H 4K3EL 6FABH 4N2HA 1KIQA 5IVNA 3GSNA 1MAML 3U2JA 1MJ7L 2QZ5A 5C0CE 3B9EA 2WB1A 5F7NC 4ERSL 1LO0H 3QPXL 4X0NA 1S8DB 2CBQA 2DQHL 4FERA 4R5TA 4ELMF 2HKAA 5LJYH 1VB9A 4ROEB 3WS6A 1E4WL 3NFSL 2YK1H 3F3HA 3UMNA 3UPCA 1NCAL 3HB3C 1FYHB 3ARDB 1BEYL 5JXAL 4ADJA 3T0ED 2VR7A 1PY9A 4HJJL 4YZWA 4TVPH 4F7TA 3Q7JA 2EUZA 2FVNA 3GLDA 1H0DB 3RVXC 3IJ8A 1JNLL 5AW4B 1DANU 2WZ0A 2XXFA 4YBHA 3ZHLA 4J6RL 4XX1G 4ZUVA 1B2WH 1JGLL 1WIPA 4HUUA 4Z3JA 5GRUL 2HKFL 4TUJA 2UYLA 1J11A 3QDMD 4X99A 3ZUNC 3DYMA 2WY3B 2EACA 2P5ED 3QZMA 3MYZA 5BVJB 3QQNA 5DUML 5HYJB 5EZOH 4N1CA 1Q0XH 3FRPA 3F7YB 4MJ5B 3V0GA 3FUKA 3WDJA 5KBKA 3JTTB 4L8BB 1NCAH 3MNDA 2AQTA 2OP4H 1MH5A 2G4EA 1U8QB 5EC1A 3UEZA 3PWUB 2VXQH 3EFDL 3DV4B 2O93L 3ZE1B 5KW9L 4OJYA 5JDJA 5ID0A 3BVNB 2V9TA 1TQWA 3QAQA 4KROD 5D1XB 1F41A 2C9AA 2JTDA 3NTCL 3EGSA 4JFQA 4K3DH 3U6XS 2A6JA 3OKNB 5EZPA 5KTEL 1C16B 5JZ7C 4ODHL 3QUMA 5D1QA 5BS0E 2HVBA 3MGTB 3BAWA 4X83A 5ESQB 3GXPA 1KJMB 4JLRA 4Y8AA 3S88L 1IJ9A 4MA3A 2AXGA 3L4YA 3JV6B 4KK6D 5D7LD 3QNXB 1DDHA 1AY1L 1N67A 2CLZB 2APFA 2FO4A 1GS6X 2R0WH 4D8OA 3KPSA 3ARPA 5E5MA 4W9CC 4IJ3C 1W0VA 1X5FA 1L7IL 3QDAA 3OXSA 4OGAD 5D93B 2MEJB 2ZOTA 3M17A 3AGVA 2I9LB 1QABA 4PJEA 4EUPG 2V6HA 3QNYA 2RJMA 5HHMD 3QDMA 2JMRA 3VNYA 3AM8A 4AQAB 4PJDB 3HG0A 3MVSA 1KIPA 4ONOA 2Y24A 1SXAA 4G7YH 3UTQA 3GJFK 3ZR5A 5EBLA 4J3VA 5JHLA 3DXAE 3MBXL 4K07A 4XVTH 2VT0A 4ACTA 5EDSA 1RK0B 5CCHE 2AANA 2NUTA 2P80D 1FG9C 2LOEA 3PNRB 3DUSA 3PAZA 2MMXA 5ACLA 4UB0L 2NY0C 1JNHB 4NRYA 5K9OA 1A1NB 1CDJA 2V92A 3CK0H 5L88L 4G7SB 5L2KE 2ZFDB 3QC6X 2GI0A 1FNGA 4L1SA 4PG9A 3UIYA 4C56D 1XCXA 1G7PA 1DQVA 1AJ7H 2HKPA 3PG2A 1F4WH 2WBJB 3WXWH 3EYSH 4X6BA 3RJQB 2R15A 3MV8A 3T4YA 4IOIA 4EBQL 2EIZA 1NTDA 3TZVA 4GB9A 4H1LH 1ZT7B 1NSNH 2IPTH 4N90E 4UTAH 1QN4A 4Y5YB 2FLBT 3SCMA 3MRNA 2EVHA 4Y5VC 1UASA 1JWUA 1U93A 1AQKL 3QCUL 4EUPB 4ABWA 1CURA 5MENA 3D8MA 2EZ0D 4MJJA 5JPMA 5K9KB 2BJMH 3L4XA 4Q2ZA 5B39G 3F12B 4P04A 1HL5A 4H4NA 2YEVB 4M7LH 5KG9A 1W9XA 1KCSH 3UG4A 4JHVA 2R51A 4L3CB 1FIEA 3DX1A 2X44D 3IDXH 4LLMA 4NRZB 5JN5A 1NFDF 3DRTA 3BCFA 2VXSH 1KB5H 4U0RB 1NAMH 3WIHA 4LSQL 1T03H 4YAQB 2Z34A 3H7BA 1A1OB 1JPFB 4GG8B 4U3SB 4PRIA 2YIHA 5BO1L 2BY2A 4G7YL 1BBDH 3AG2B 3B8YA 4YE0A 3SE8L 1K6QH 1KELH 3D39E 1C5BH 1N0LB 1SFDA 2H3XC 4G8GB 1IC5H 1J8HE 3WN5A 3EHBC 1TZGH 1OZUA 2AABL 4FQIL 3TBSB 3ZKSD 3W56A 3DVNB 4HGWA 4LSQH 5CKAA 5D2LF 3EXJA 3ENEA 1S2EA 2EXYD 4X42A 3WV0A 2BSRB 1UOVA 3HUJA 3PGDA 4EALA 5KVGL 4XBGB 3PL6A 1IKNA 3G6AA 1S7UA 1TNNA 3BXNB 3HI1A 2ZWSA 2FEDC 3KLAA 1H0DA 4K8RH 3QR2A 4K71C 5ADOH 1BVZA 1LP9F 1IBFA 3A24A 1R3IL 2GJ6A 4FQLL 3ILDA 3FQ2A 5ELIA 5H2BA 3KBFA 5HHOE 4Y4HA 3SE8H 1I8LA 4UTAL 1S9VB 4DGYH 4AMXA 1NLDL 3ZE1F 3VFRB 1DVXA 2GK2A 4Y1SA 2XDHA 4A2LA 3EYFB 5D6CB 2W60B 3MZGB 4UT9H 2N56A 3ZKXC 1G9MC 3EYSL 5AW0B 4BE5A 4Y5VB 3V4UL 3LEXA 3ABMB 4N0YH 1QO3B 5L4FA 5AW2B 1G6RH 2ZXBA 1E2VA 1TTAA 4PD4J 5C09D 3FFDB 3THMH 2FJGA 4ANKA 2VMCA 3OLPA 5I1CH 2E86A 1OSPH 1IAKA 2DH2A 4MDJB 3P4MA 4Y16D 1AR2A 3RHWF 4ZMWA 1AYRA 3MV9B 1HHHB 3NRQA 4LL1A 5HHVH 3GBNL 1ZLUK 4AH2B 3APCA 1F00I 1QW9A 1B0IA 3CZKA 3L95B 4W81A 5DS1A 2WYZA 4HFUH 1EDHA 4IRZH 1HYSC 4CFFA 1FL6A 2KHAA 5T5FA 4HJTA 4OT1L 4FEMA 1TJIH 5FW6A 4A1RA 4N87A 1C1EL 4AM0A 3AMKA 4RAHA 2OXHA 1AAJA 4XH2A 3DOSB 3IJ9A 5DO2C 3OCIA 4WWKB 1IB5A 1AFVH 1IC7H 4OAWA 3AWEA 2WIMA 4PJ7E 4QRPB 5HGHA 4AVJA 1WT5A 1UWXH 1KCKA 5ALBL 2GYSA 2IDUA 3AROA 3TV8A 1EAJA 5DZLA 4ZSOA 1V3JA 1AGCB 1MJ8L 4U2ZA 3IFPA 1P84J 4RFEB 4TM9A 5D9SB 4KVCL 3QUXB 3D39A 3PWNA 1YQLA 1LE5B 1Y18A 4AXWA 3CIAA 4NDMB 3TT1H 3KPRB 4R7VA 3NIDE 2HT4C 1YMMB 1L0YA 2AQ1A 4M5SA 3ALWA 1MJ8H 4LKXB 3UPRA 3VNZA 5MHSE 3MLWL 1JOIA 1U92A 5E1HB 3UFIA 3A4FA 2NNRA 3IDXL 1S9KC 3GBLA 4IKNA 2DYPA 2XTSA 3NRFA 2K3TA 3HE6B 4WFGE 1LP9E 4XGZB 3WHE0 1A0QL 3F7VA 2C3GA 3IDJB 2XTJD 3WMSA 3ZHFA 5K5YA 4UZGA 1IGTA 4FNPA 5CN3A 1NFDA 1XZWA 1Q94A 3ME0A 4XB8A 4B95C 3HN8A 4XAWH 1WFMA 2QVIA 1YEDA 3PQYB 2WO3B 3FT2B 3BRGC 3BZFA 3QPKA 3PAUA 2UXGA 5SX5H 4EI5A 5A2IH 4PRBB 3SKNB 4ZUUB 1IC1A 2DDQL 4RETB 3KBEA 2NY6C 3NJFA 4PW4A 4YLQT 4TQ8A 1VOLB 4TXVB 4S1SH 1WAAF 3WO4C 4NP9A 1T6WA 2VM4A 1ID5I 4UTCA 1XB6A 1MCIA 1PG7X 4XBGA 1Q38A 5F7DB 5DI8A 1JS4A 5FO7B 5D72H 3WUWA 1E4XL 4JW3A 4P5SA 1GS7A 5E95B 1FH5L 1EXHA 5DRNB 4I3SL 4YH6A 3QXWA 2Y7QB 1JWMA 4N68A 5KSAB 5L7XH 5B8CC 1QN5A 4XC1L 5D7IF 5HGDA 1MIMH 5CGTA 5FWRA 1HSBB 4PGDB 3AUWB 3QQXA 2Y07H 5E4EB 5KBMA 2YMXL 2EDNA 4RESB 3BVDB 1GIGL 1RM1A 2DLFL 4XP6H 1QNEA 3QWNA 2OMTA 4L3CA 2AEIT 4PJBB 4N2OA 1TZOA 2L7EA 2QPSA 3QUGA 4E68A 3BH4A 2CO2A 25C8H 3BGFC 3L1OH 3NG5A 5F7MC 1XH3A 2CUMA 3PY9A 5CP7B 4HT1H 1HC1A 1J0ZA 3T65B 1T0OA 2QPDB 2DYPD 4HUMB 4NQTA 1JI1A 3D52A 3L1FA 2EZ0C 3IGUA 4UMGA 3IT8D 4LEEA 5L6YL 5D7JC 3S36X 2OJEB 3SEPA 4P2QB 2ORBL 5DEGA 4P23D 3RVTD 1FPTH 4HZAA 5EZLA 3DXAD 3AWGA 1FL5A 5EBWB 1PZBA 5D1QE 4D7QA 2LT9A 4NYLB 3GEWB 2PO6B 3DBXB 2N4IA 3JUZA 3CFDB 4NKMB 1ZVNA 2PWGA 4G43B 1WHPA 4X7FC 4HZLB 1BEXA 1KIQB 3U9UA 2JKJA 1UT9A 4X6DA 3UJTH 5HHQB 2PTTB 5LQBH 4KAQL 4O58H 3ROLB 2WN3A 1I1RA 2A9DA 1DVFA 2BIQA 1EMTL 3PJSB 4HSCX 5ESAA 2WWMD 4AGLA 3B6SB 4KDTA 4KMTL 2X0VA 3R19A 3D4GA 4A7VA 1WT5C 3I9GL 2IGFL 5C0IA 3QCVL 4ZTOH 2YKLL 3QUXA 2A74A 3UIZA 4F2ME 3TN0D 2RALA 1P69B 4ODWB 4N90D 3UYOD 3J07A 4QO1B 3VYOA 1JZ6A 1ZPLA 3HMXH 1P4BL 5SWSB 4AE0A 3JWDH 1XV8A 1KXTB 2BVQB 1SEBA 2NY3C 2VLRE 3APMA 2NY7H 3MBED 3TL5A 1KTCA 3MBWB 4KX7A 4LVHC 5G55A 4BSJA 5I1IL 1FA4A 3ZTJG 1I9RH 4CVZB 3P0YL 4OVUA 5E8EA 4AEFA 1B88A 1U8JB 2FL5A 3IJ7A 4AL8C 2XJLA 1MCWW 3DIFA 3JYCA 3APDA 2A9BA 4PS3A 4OCSH 4N2LA 3LD8C 5I19H 2VQ1A 1PLBA 3HNTH 4HDIB 1HX0A 4WO4B 2MCPL 3FFOA 1BFSA 4YMPA 2Y0SA 4YFLI 3U4AA 2NOEA 1MFMA 3GSWB 4U3XA 1FFRA 4P2OC 5AAMC 1H19A 4AH2A 3RWHB 1H3UA 1H6UA 1DLHB 1KYAA 3KYOA 1INDH 3GSRB 2LFGA 1AGCA 4LLDA 1HILB 5D1XA 3LKQA 3F2LA 3LH2L 1CIUA 1E4HA 4G6ML 2B3RA 4PJEF 3QUYD 4Y4HD 4CILA 1HCYA 4KGJA 4XVSL 2VQ1B 4Y1AA 4U1SB 1SMAA 2E6PA 1XF2B 4DVBB 3FB6A 1INEH 3CN1A 2VDOH 3KVQA 1KTDA 2Q86A 3CXHJ 3KNBA 1FH5H 5EUKB 2WXLA 1AZBA 1JP5A 4YSQA 4G7VH 4NP4L 4WV1B 3VXNA 4FQHB 1UM6H 5K33A 1IRAY 4ZFOB 5HHOD 2BRQA 1Q72H 3R8BB 3V5DA 1SLUA 4Z3IA 4N85A 3BGMA 5PCYA 3NESA 3ALPA 2HKFH 5I1IH 4PCKA 5M7QA 1UGNA 5GXBB 3ZTCC 4LU5L 3RGBA 3CU1A 1S7XB 3HNSH 2BPBA 4BZ1L 4H8UA 2UX7A 2XVKA 4NHUA 1WS8A 2VLKD 1MFDH 3MA7B 2J44A 2XIBA 3FOMB 3LAFA 2ZICA 4BZ1A 3QIBC 4JM2C 4JGJA 1R33A 5EOCJ 3DTUB 1C8QA 3TBBA 4KQ4H 1ZLUH 2ALAA 5E2VH 2L7UA 3O45A 3RAJH 1EHLH 3QJUB 3QE5A 1V3KA 1X5KA 2EIKB 3L45A 4D0BA 2C4FU 3NSJA 4OM0H 1A1OA 1JPFA 2OXGA 4GG8A 4U3SA 3TPUA 3T3PB 1QKZL 4M8RA 4GNKB 4CVXA 1DBJH 2XBTA 4MBRA 4HUXA 4OLVL 3WEXB 5JW4N 3NOIA 3O6LH 4ERSH 1NKRA 3HE6D 3LXBA 5D1ZD 4EI6B 5BRQA 4DP6X 3F7KA 1SXCA 3MGOB 3OMNB 4LB8A 4NFCA 2W95A 3NPSB 2RA1A 3RPBA 1RZ8A 1GC1C 3ZL4H 4OLWH 5AZUA 2SEBB 4AG4H 4PJBA 4UINH 3CWSA 2YPLE 2WQVA 4URTB 4N86A 2A77L 4PI0A 5EUOB 4O02A 4I3RL 2FGWH 1JDAA 4OGXL 4HIXH 3HC0A 4HV8A 3EJTA 4CKVX 1R0AH 2XIDA 1T0MB 3H2QA 3EOTL 1NGZB 4QOKD 4RQQA 1NCWH 4Y2DC 3HHSB 4U49A 4ZX5A 2XPGB 1M5Q1 2PETA 1INEL 4CBZA 3CZGA 5I66B 1A9BA 3DO3A 3GF8A 1A1MB 1TLKA 3ABKB 4FQ2H 4LQ1A 1KB9K 3N9GL 4FCAA 1LO0L 1XTMA 3A47A 3NCXA 4RGNC 5D8JH 3OMZA 2OI9B 5INCA 5E9DD 1CLZL 1H5BB 3KH3A 3CDYA 1H3GA 3E80A 2WZAA 1G4MA 2ICEB 4QGYA 2V2XB 3NTCH 4K3DL 4PJAF 5MHSD 3DSNB 4XCCL 3T0EB 1CICA 4GKSA 3D25B 5FYJE 3CVHA 1FFOA 5GGTL 3BT2H 1AO7E 4PJIF 3VH8G 4YHZL 3PPEA 4P99A 4X8JB 4LSRH 4XNYL 4ZTPL 4BCZA 2NRDA 3F05A 3RWJB 3F6LA 1CL7H 1U6AH 4PVBA 2JJSC 3IXAA 4IMLA 4K5PA 3AG4B 5ISZB 3TPKA 2M8XA 1QFHA 3OZKA 4NGHL 1LYQA 4OFDA 1MQKL 1EGJH 1TU2B 9CGTA 3RDTB 2MRYA 3CFEA 4BH7B 2YN5A 3HI6L 4XGZA 2R8SH 1DVYA 4KKAC 2OR7A 2NY2B 1KBGH 2HFGL 4HS8L 4J7RA 4RMSA 4URKA 4X7SH 1O7DE 2G3ZA 1ZA3B 2XWRA 4CC1A 4CN6A 2FK9A 1KFQA 4L1LA 4L9LB 1KTLB 2O5XH 1A7OL 3PP4H 3QPQD 1G1YA 3AREB 1TCRB 5IYCP 3D07A 4UOW0 1KYUA 4X6DE 1MRFL 1OW0C 3FPYA 2HZHA 3DX4A 3SGJC 2PF6A 2HLFC 1EERB 2FT8A 3B56A 2KYIA 4M4RB 2A38A 3HNVL 4MVBD 1OALA 5AW1B 8PAZA 3COOA 4WK4B 4RFEA 1FBIL 1FG2B 3FFCE 3MA9H 1AG0A 4PJGA 4JEGB 3ULSB 4BSVA 3H0TA 4H8VA 1XMEB 1SLVA 2XWCA 3P2BA 4P5KB 1JZFA 2ERJC 3APNA 2WLLA 4Z3GA 1BFOB 3HPJB 3I02A 5JHDE 5D2LB 2Q6WA 3LJ3A 4JREB 1NCDL 3WYRA 5AKSA 5AOJA 4OF3A 2VDPB 4J28A 1TZHA 2QDVA 3N9GH 1DDHB 3F7LA 2W07A 4ESKA 4PLKC 4K15A 4DO6A 3MRJA 4LHUD 3QDGD 1DSFH 1QFWM 3OXRB 2W81C 4OU3A 2WLJA 3EO1A 4OQ1A 4OZFA 3WD5H 1HILA 3RG1C 3MCKB 2P46B 4MNQB 2F08A 1AY1H 3ISWA 4AWJC 2BSBA 3KPSD 4N2EA 4CRPA 3NJNA 5IW1B 2BNRE 1UB5B 3C5SA 4OZFB 4GIOA 4ALAC 1GOFA 4S2SB 3M8OL 4J1UA 2CMRH 4JFVA 4LCVA 3R4DA 5EUKA 2V7NB 5KTEH 3GIVA 3S98A 3VFOA 2GUYA 3MRKA 1I7TB 4TVPD 4BFEA 1EGJL 5I0ZA 4HWEL 1SDYA 3MREA 5FYKH 2BM3A 2WLYA 4AQ1C 1AD9A 3PL6C 1JYNA 3RZCB 3G08A 5FDWB 3F5WA 2AXHA 1MHHA 1U2HA 5GJSL 4G6JL 4MYPA 1AANA 5IW3A 5JPNA 2DQUL 2BWQA 3D3VD 4LDOB 3A0OA 4AZ8B 5FCUH 1TQVA 3POCA 2Q0ZX 4NKIL 2X4RA 2EIEA 4OCRL 4MDIB 4KFZC 4FQ1L 1A6WL 3CJJA 4RFNC 3GI9L 3RWEA 5BUPA 1EAQA