2VJ0A

Crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, in complex with an fxdnf peptide from amphiphysin1 and a wvxf peptide from synaptojanin p170
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
246
structure length
246
Chain Sequence
ILAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVINIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solitary and Repetitive Binding Motifs for the Ap2 Complex {Alpha}-Appendage in Amphiphysin and Other Accessory Proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
total genus 68
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vj0A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2vj0A02
1QNEA 1VTLE 3HS8A 1RM1A 4RODB 1QN3A 4BCXA 2D0BA 1QN7A 1JFIC 1KYDA 1CDWA 1QTPA 3H1ZA 1NVPA 3EIKA 1R4XA 1KY6A 1QNAA 1QNCA 4ROCB 1GYUA 1PCZA 3ZY7A 4B0AA 3HS9A 1TBPA 1VOLB 1QN6A 1KYUA 4PY5A 5IYCP 1KYFA 1TGHA 5CN1A 1P4UA 3VN5A 1QN8A 1QNBA 1VOKA 1W80A 4ROEB 1IU1A 1TBAB 1GYVA 1B9KA 5IYBP 1AISA 5CN2A 3OC3C 1YTFA 1NGMA 4WZSD 3MNMA 1GYWA 5IYDP 1E42A 1YTBA 3ZHFA 1PZDA 3ASMA 2E9GA 2DWXA 2MJ7A 1QN9A 1QN4A 1VTOA 2D0CA 1KY7A 2YMTA 3OCIA 1MP9A 2DWYA 1D3UA 2IV9A 1QN5A 1OM9A 2Z8UA 2G30A 2IV8A 1QTSA 2A7BA 1NH2A 1C9BB 2VJ0A 2D0AA 1NA8A
chains in the Genus database with same CATH superfamily
1ZT4A 4F5CE 3BPOB 1L0XA 1HE7A 2ZCKL 4OZIA 2XWTB 1ZHKB 4WKZA 2J6EH 4J3BA 3HG4A 4MNQB 2B08A 2GPZA 3L9RA 2FX7H 2VLME 4WY7L 4HAGA 5KBKA 4MJIB 3ZE0B 4CJ0A 1FZMB 3GJFA 1D9KD 2Z8WC 4M4RA 1CXIA 3MRLA 1CFVL 5FUZL 1QAWA 2WINA 1BQHG 1OQXA 5JIMA 3DHJA 3BUDA 2V7HA 3ETBF 1GH7A 3JUYA 5DVPA 1D9KC 4HYTB 3T1FB 4EJZA 3EYSH 5T8IA 1J0IA 2EP6A 3AT9A 1A14H 3WFHB 4PJBE 1DBKH 2PYEA 5I6NA 3NACH 2Q76A 2TRYA 4XNAA 4YHLL 1F6AB 1M3QA 1QD0A 3O4OB 2WYHA 1S9YA 1GXEA 3TPUA 4I18A 1MIML 3OXRA 2NOZA 2VO8A 2F9BT 3V7AG 2ZX6A 3ECUA 2Q20A 4D9QD 4WAFA 4NB7A 3TYGL 3K46A 3KL0A 2VLRA 3U6XS 1X5MA 3DSFL 1AZBA 1ZT7B 3NCCB 3VM7A 5CKAA 3WXWH 2AXFB 1BWWA 3KJ6H 4ODHL 2O30A 1NFKA 4U6YB 5K9OA 2CJSA 3WJLA 3MV7E 4UANA 4M6AA 3OR6A 4AQ1B 2QR0A 4HLZG 4MA3A 3QI9B 3BSGA 1O7DC 2YFNA 3K6NA 1NGZB 1NIBA 3BEWB 1GSKA 4D0BB 3S8FB 2WAQA 4ABQA 1OP9A 1YN6A 5IW3A 4M1DH 4F1SA 4GSRA 2QGEA 5EHFA 1NCDH 3MR9B 5K1VA 3T3PF 5IQMA 1XSIA 5C0DA 5AKVA 5AD0B 3TTYA 4Z23A 1KXTB 2ROYA 1V54B 4P57B 1E4XI 5D72H 4N2GA 1XIWC 3L3GA 3RVXD 1S9YB 4ZMNA 3ZGIA 3QORA 1JPTL 4QTHB 1T20A 1JGIA 4CDHA 1KB5A 4PG9B 5DK2A 1LYQA 2BP8B 5CILH 1UUNA 3VACA 1CBVL 2CAKA 3MYJA 3U46A 1CR9H 3SD2A 4XAWL 4G9FB 3L1OH 4JHAL 1YAZA 1CD8A 3OPZL 1VFOA 1I4FB 2WXPA 5AZ2H 3NCWA 4OKDA 2PCXA 4YO0B 3T4NA 2H0FA 2DQFB 1PKQA 4FXGC 4XZUB 3L7FA 4AQOA 3SGKA 1XIWB 2WINB 1D5ZB 2VJ0A 1N9PA 1XL6A 4R3SA 4A2FA 2D0AA 1NA8A 1NCCH 3HJ0A 2VMCA 3BQVA 4KO9A 3QS2A 3ETTA 3LXCA 1MJ7L 1D6EB 3L2LA 4L3EE 2ZSWB 2ZAHA 3UBXA 4R5XA 1KJ2A 3W81A 2VABA 1Q9OB 2YZ8A 2IO5A 3IFPB 4FI8A 4FQIH 1T2XA 1WE5A 1RUKH 1UH2A 3ARXA 3AADB 1I3RB 2J55A 4AQ1C 4B9YA 3ARDD 3FRUA 3QO1A 2YSSA 1H3PL 4H26A 5CZVL 3PHAA 2F58L 5JPMB 3V6OE 4DP2X 4F91B 4RRPA 3BP6B 3RDTC 4M7KL 1WRFA 4EOWL 1KCUH 3AXLA 1X5FA 3F7QA 4OCXL 3KCPB 2P24B 5ALBL 1VEPA 2XKSA 1NMAL 4JDVA 1J1OH 5E5MA 1UURA 1BBDL 4HOXA 2PN5A 2J2ZA 3V4VB 1BQUA 5DS8A 1JGVL 4BSWA 2OMWB 3N91A 2XVLA 2HX9A 5ILTL 3WKYA 3QDJB 4K0OA 4PJCF 3FUIA 4IU3B 4XP6H 4PCTA 2HLAB 5LJYH 3UDWC 3QR0A 2OOXA 1YC8A 4H1LB 4OD1L 1VOKA 4CVZB 1EHNA 1M57B 1QFOA 4LP8A 5E6IC 2WXMA 1QZ1A 4KKQA 3ZKQD 4XGZB 5DUML 4XP4L 2ICEC 4W9JC 5D9SB 2XTSA 2N1KA 4HEME 4XCCH 1QNIA 4Y5XC 4ZK8A 3UAAA 4QY8A 3KJ4B 5IVZB 1QG3A 2E27L 3FCTB 3S96A 1TEYA 4OGAC 3HE6A 3BH8A 2Q7YA 4DJMA 5J3HC 4JM2C 3GEWB 2WJ5A 3T2OA 3TZVA 1SHWA 2C1PB 2DWTA 1IBGH 4HHGA 3V0GA 5E08H 3BDXA 1JZDC 4L5FL 1KEGL 1MCPH 2DQJL 3OD3A 1XH1A 5C8JB 5IMKB 2VWEC 3RL2B 5IQ9A 2FGTA 4M61A 4RGNB 2O93L 5DK0A 1WQVT 2NTSP 4JFXA 1MAJA 1OVZA 2EYSB 4WI2A 2VR5A 2DV6A 3SCMA 1KXVA 1JWMB 2P47B 2ZWLT 2DWXA 3HW7A 3WYRA 3GZQA 5KUKA 4TRPL 3BVNB 3KPRB 1QO3A 3HC4L 4G5ZL 2CHXA 4OZHF 1NMCC 4MD4A 1YPZF 4NI3A 2OSXA 5AALA 3ARFB 3MUY1 4GSXA 2YSSB 5CBAB 5BJTB 3CSFA 4YGAB 4YJZL 3EO0B 2AJZB 3VRLF 4PWJA 3CWSA 1LO2H 1JGEB 1T1XA 1RH8A 4ZAKB 4Y9BA 4PRDA 3QFDA 1ZGLB 1BXVA 1PDKB 3LCYA 1GY2A 1F02I 4FFYL 5IY5B 2RMNA 2IH9A 4UUJB 1AGDA 2FZ3A 1CDCA 4JFHD 4L3CA 2YA0A 3MRDA 4JFQA 3WAJA 2NY1D 3MACL 2R56H 3D8MA 1DVZA 3B6SA 2VERA 4HKXA 4UDTA 4W9IC 3WJJC 2FB4L 2O26U 3LZPA 4PRHB 5AYUH 2OMZA 4MGXA 1PZCA 2M26A 4YFDB 4PJ9B 4PGJA 2YQBA 3RX9A 5IJKC 3TO4D 3MQIA 1I3GL 4PGZA 2YMXL 4F9PC 3EOAB 3QJTB 4JANA 4RMRA 2PKDA 2Z35B 1NBZB 1NGYA 3BFOA 4NWUH 4BWUA 4U1GB 4MHHI 3TFBA 4DKFL 1W6WA 4R97B 1IKOP 1R33A 1UXSB 3OBAA 2W0PA 3LQAL 1I8KB 25C8H 1RK1A 3Q8FA 2I32A 3BD3A 4OKVA 3VTTA 2D7OA 1F4XH 2MEJB 2A9BA 4ELMB 4U1SA 2ZQKA 5C9JB 3ASNB 4LCUA 1B88A 1KELH 4XP9L 3RNKB 1CGYA 2I60H 4J6RL 4GRMA 4JJOA 2O72A 2XVBA 1AZZC 4TVPD 3DURA 5LHDA 2P5WD 1WBXB 2CNZA 3T6ZA 2QEJA 4P0DA 4WLCA 4N9GB 4GG6B 3TASA 2XICA 4OAWB 4N0FA 1UC6A 4PW3A 3QJFB 5GS1C 4Q9QH 1I1RA 3DYPA 4J2XA 4EN3D 5EPMB 4OQ1A 4QHLA 2VR4A 4UDUA 4G7VL 1GYAA 4Y2OB 2PTVA 1VAHA 2HH0H 5I73B 4CN6A 5T1KA 3UTTD 1XF3B 3V0AC 4L3AA 1WC7A 3GXUB 2IWFA 5EBLA 1EZVY 4KNSA 2X4SB 1D5XA 3FSAA 3OMIB 5B1JA 4Z8FL 1AG0A 2OL3L 3GSOB 4PJFE 5E8EA 1HHHB 4FX5A 4LIQH 4DO5A 4DNLA 1E4KC 4XN4A 5F88B 4WWPA 1C1EL 2YA2A 3W9EA 1URLA 2D0FA 3SGDH 2R0ZH 2J1KA 3NRPA 1F8TL 1M7IA 1C5BH 1BIHA 2WQVA 3G7TA 4TSBH 3O81A 4JO2H 4DTGL 3A4EA 4YDLC 4F7KA 1N0XH 4Z7NB 1S3RA 3TP4A 1INQA 2G3MA 1K4CB 1YEWA 3O9WA 4F57L 1EAPB 1GZPA 2C3GA 1H3XA 1OPOA 4PP1D 3FQXB 1U95A 2BWDA 2I9TB 1G6VK 1O9VA 1J7VR 1F41A 3GDCA 1B4TA 4HW6A 1BG9A 2R83A 4LCWA 3B6SB 5I8OH 1W8NA 3DA0A 4IRZH 3OMNB 1GJIA 1SY6H 3IGFA 1E30A 4DKEH 4XAKD 5E8OB 2CRZA 2VH5L 5CCGE 3HHSA 1AYRA 2P8LA 1HXKA 3PWPA 2EYTB 4XXCA 1KYDA 4CMMB 1A6ZB 2GTWA 2FAUA 4WW1B 3D06A 1KBGH 4P2OD 3PHOA 3C60B 1H6TA 4TVSa 2B2XL 4CW1B 4KQ3L 4OH2A 3VWJB 3OC5A 4YDIL 1QSFB 2G0KA 4NCC1 2EEXA 3BUYB 4D3CL 4A2LA 4WDIB 1ZHLB 3HR5A 2VDOL 4FD0A 4HPYL 3ENOC 3TTSA 3FN9A 4PUBH 4QTIL 3U4BL 1L6ZA 3KPRA 3FQNB 5HPMA 2WTRA 4P04A 1U8CB 4MNGB 4RGMC 4ZTPL 5KYXA 4HKZA 3KYNB 5IP4A 4L8CB 3UYPA 2Y36H 5ADPL 1HJCA 2B15A 3G6JF 1IO4C 1UYWL 1NUFA 1U58A 3KPMA 2X6BA 1F4HA 3O3AB 2EDDA 4TM9A 5CM1A 1XHHA 3LTVA 1FO0B 3EOTL 2WLLA 4WUUB 3TEYA 4MB1A 2APFA 3APFA 3I6KA 1RXLA 2H3NB 2K45A 2D7PA 1Y18B 5CSZB 2C3VB 3MX0B 3S5LA 3A23A 2Q9OA 3EYVA 3KYKH 4IRZA 5C0CB 3ULVF 3DHUA 3UBHA 3FT1A 1OK8A 5F21B 2MTPA 5DVMA 5F1NB 1IQWL 4WUUD 1KFIA 2FKMX 4EIZC 4PJXF 2CBOA 4MMZB 3FB8A 3TNNA 1V7MH 3RWEB 2QSCH 4HIIB 4E5XG 4XB3A 3H4HA 3L3OA 3GM8A 1GCFA 3OGDA 1NZRA 1GOGA 3QQ9C 3ZSSA 4JRLA 4XR8C 1EH9A 4YEFA 4JRXE 2ZSVA 4BWTA 5GGTH 4DPBX 2NUPB 5EORL 1CLCA 4XN2A 3OMZA 4OCSL 5DEJA 1OZUA 1FIGH 3JWDL 4OLVL 2XXCB 2VO5A 2UZIL 15C8H 2X5PA 3FOLA 1AP2B 4JDVB 2JTDA 4WWID 1XEDA 5K9QG 3G5ZA 4FQQA 2XRAH 4E41B 3F7RA 1CQYA 2IDQA 3BGFB 1FNFA 4NFBA 2Z91A 1HHIA 3D51A 4UMSA 4F33B 2CGZA 4NRYA 2QHLA 5I76B 4RGOL 1A8ZA 4GXFA 1UH3A 1H3WM 4HMCA 3ZUCA 3QXTA 4AE1A 3ULUL 2RFXB 4M8VA 3MRNA 3ZTJH 4D94A 1QN7A 1D6EA 1JK9A 4JFFB 2KPWA 2X4RB 4HF5H 1BLNB 1EJ6A 2AVGA 2WAHA 1MI5A 3CUPB 3I3EA 3QNYB 4GMTH 3WNMA 2UVFA 3NDYE 4FHBD 4Q8BA 3GLZA 5D1ZC 1XGZA 5CAYB 1L9OA 3CD4A 2ZX7A 5ITFB 5JZ7C 5HHOA 4FQJH 5EEVA 3RHWK 4UYPA 2C9QA 5GRWA 1KYUA 3HLKA 1YY9D 2JCCB 4F8QA 1LWJA 2H2PD 5BS0A 2ATKA 5AENA 4XGZA 3L1GA 3L9BA 4G8EB 5E4EB 4L5FH 3C5JB 4FYTA 3UZQA 4EEEA 1MCPL 3QEHB 5LNEA 3V5KA 1U3YA 4S2SA 3U9UB 1I82A 3BPNC 3GSNB 4I77H 4ZO8A 1A3QA 2AJSH 3HPLB 4W9LC 3O2WH 3CXHJ 2XU9A 2XX1A 5DUBB 2Z3FA 4IIQB 4LCVA 5DJ6B 4HWZB 1QBBA 1QEWA 2QKIB 4JB9L 4NO2B 4OFIA 3S4SA 1H8SA 3HUJF 2VXSH 4P49A 4PREA 5D70L 3ZIMA 1V55B 4PJHE 7FABH 2IXQB 2YAHA 1NL0H 5DHDA 2NNRA 4R4BB 4ILDA 5D93C 3IU4L 1CC3A 1LWVA 1FFOB 1CIDA 3B3BA 2OCJA 3A5VA 3ARWA 5LNGA 1KCKA 3UL4A 1WCBA 1HHGA 2CGRL 2N59A 2X0VA 2NSMA 4WO4C 1J88A 2ODIA 3EYFA 2XT1B 2YK1H 5IBUB 2JKIS 4Y9GA 3BAEL 3TXAA 1DBJH 2IBGA 2XG5A 2CH8A 3DGGA 3V4PL 4N5EC 3CK0L 3TBWA 3MTRA 4J3SA 4LLWA 3VFPB 1A7PL 3GTTA 3QJHA 4HWEL 3HN3A 1L0YA 3GSOA 5E8EB 4KDWA 3HZ3A 1QFWL 3O45B 3WE6A 5EOTA 2UZPA 2YIHA 1Q94A 5JQ6L 3VSUA 5IJDC 1QHPA 5IVOA 1C8QA 1RPUA 2QQLH 4EAJA 4AYID 4XMZA 2HPTA 1KYOJ 1CICC 5HHVL 2C7UB 4J1UA 2ENSA 1X7SA 3PPEA 4ZX5A 3G6DL 1XTLA 3BQUD 1S7RB 5EFIA 1BBJA 1ZLDA 4WX8A 2OAAA 3CQQA 3RX7A 2XG5B 2DW5A 4LL4A 5FW8A 4OT1L 3B2UC 4ABWA 4AEEA 4Z7WF 2BZCA 5ANMA 1N18A 4G11A 1ZANH 3DXAB 1KYAA 3TEUA 1ZIAA 2QR0B 2I60L 2X0WA 4K7FA 3ZKND 4YR6B 2DEYX 3QIBC 1CIUA 2BZDA 3DJRA 1IAMA 2IPUG 4MNHA 3K6SB 4BUHA 1HQ4A 5GS0H 3RKPA 3EFFA 1QEWB 2QKIA 5LAPA 2EILB 5BO1L 3GSUA 4MX7A 1U8JB 3CFIC 4XVSL 4AVHA 3BGAA 1XGPB 2H1LM 1OSPH 2Z8VC 4GXVL 2GY7B 4OZ4B 3GNMH 5BV7B 1S7RA 3ARFD 3M1CA 2PPFA 3WE1A 3L3DB 1A6ZA 3CVBA 4KRMB 4F37K 4X9HA 2XQBL 1MH5A 3DVFA 3C6SB 2E8YA 3CJJA 4L0YA 2G9HA 3T9WA 1YYCA 4I89A 1SVCP 4ZPTB 1YEIH 2MWCA 3JWOH 3WEXB 1VSCA 2COQA 3QUXA 3KBFA 5JW4N 1DVFC 3HC0B 2EXTA 2R0LL 3PJLA 2XZQL 4OFQA 4P3CL 4DESA 2WWKT 4LLUA 2ZWSA 2YLKA 5C6PB 1HSAB 5C6TL 4C4KT 2H2SC 1MUJA 5A2CA 4AENB 2DTML 3MV9E 4TSCH 5IROA 2NW2B 3SJVD 5H35B 1I3UA 4WF7A 2VDRB 1TR7A 3MBWA 1T22A 3VB9A 3NCJH 3D07A 1YSOA 2R0WL 3IGAA 3ZHFA 4PJCB 4JY6A 2J88L 4YGVA 2AANA 3ULSB 1B2WH 4XVUC 3AU1B 3CZFB 3L5JA 3LRHA 2NZ1A 5JQHC 3ROOA 5DFTA 2VW6A 5AUMA 1XFPA 1IGJB 4D9QE 2EHBD 1CD9B 3SY0B 1KGJA 5D8JH 3SDDB 3TBCA 4IRZL 1ZTMA 3KLHD 4QPEA 4I3GA 5CCKL 5F7WC 4JFOA 1DANU 1YUHA 4NP4L 5JIIA 4G6KL 2EE2A 1MCSA 3EF7A 2WIMA 3ARTA 3AWGA 1PL3A 3NCFB 3O11A 3NA9L 3F7PC 4FI6A 5IB1B 4HK3J 3KLHC 4BUQA 1G9NH 3MV8D 4R7DB 1JZGA 3P30L 3WHXA 3Q5OA 2DS4A 1AXSB 2NSQA 4L4TD 4KQ3H 3OAZH 1H8LA 1DL7H 4X4MA 2BNRA 4OLXH 4GRWH 4HH9B 2Z34A 1K72A 2MH4A 3ZRFC 4X50A 2J8UF 3HS8A 3JVGC 1OEZW 3S96B 3LPPA 4P5TC 1AQMA 4PG2A 2FK9A 2XWCA 4OLZL 5I1LB 1QKZL 1QATA 2ZKHL 3QEUB 3H7BB 3LMJL 3QDGE 1XR9A 4KXZH 3VFTB 3SDYL 3HHRB 1DQKA 1L4IA 1E28A 3KXFB 3R18A 4WWNA 3V4VH 5DZPA 2JHJA 2J1YA 2F5BL 1EXUA 3O41B 3WN6A 1ZWIB 1A22B 3LN4A 2D3JA 3BH9B 3OLIA 4MFHA 2VDMB 5A16B 2FJUB 3VXME 5LVEA 3QC5X 6CGTA 1HYRC 4GG8B 3KYNA 3EFOA 3ZO0A 1AQ8A 4XOEA 1NLBH 4I5BA 1OTTD 4PJ5D 4XP1H 5KSAB 4G9FD 4LBEA 5LO7A 4EN3C 4GW4A 5A6LA 1CDGA 4FXLA 3PWJB 2VLMD 4FF9A 5E2WH 1L7TL 3KZ8A 4PP2B 3UW2A 3OZ9H 3ARGB 4OZGF 3H9SB 3AT8A 3WFCL 4B7LA 5DJ0A 2VXTH 1PCMX 3VVVA 4X8JB 1ND0B 1JYVA 2XVKA 2EDMA 4G1EB 3SDDD 5HD8D 3QJZA 2EQDA 3B9KA 4DP0X 2VDKB 2W65A 1DJYA 3K80A 5EC1A 2F54E 1A9BA 1FNEB 1S5IH 3OC8A 2O5XH 5I9QC 1Q0XH 1S9XB 1UM6H 3L3HA 2F54A 4GUOA 4P2RE 2X4PB 3MREB 4GSQA 3IH7A 15C8L 2BSSB 3B2VH 5ICUA 2W59A 3QRGH 2FT7A 1HHKA 3LEXB 3S37L 2UZXB 2AAAA 1YEFL 3HMXL 1BQ5A 1WS7A 3FN0L 1R5VA 2Y72A 3ZW3A 3L7EA 2DJUA 1UD3A 2YPLB 3DYOA 3OHXB 3SJVB 2NLVA 3II2A 4QWWD 1F42A 1RY7B 3DO3A 4Y1AB 1IGJA 1IKNC 3RWGB 1RJZA 1IAIM 2CIIA 1YUKB 4M7JL 5BW7C 3DROB 4RQQB 4KK8D 3P0VH 5LCVA 1ZKAA 2XPGB 4W9EC 3CFCL 4Y16A 1EAQA 4YHLH 1Z5HA 1S7WA 3AY4C 4H0LC 2NNCA 4IOSD 5DHVA 3QARA 1TCRB 1XCTB 2JJTA 1BLIA 5C8JA 1HSBA 1ZY9A 5E2VL 4WTXA 1LNUB 1J0KA 5IB2A 3LB6D 4BFFA 1VGEL 3VDCA 1UVQA 3GLDA 4OGXL 2DBJA 2QGDA 5DWUH 1PU0A 5EU5B 4PR5B 5DC2A 5BZZA 1SUHA 4FQJL 2AJVH 2J71A 1B4JL 2WY3B 4NAQA 3ZKXC 1SEQL 1TTBA 5BOPA 4EDWH 2ZF8A 4EI0A 5ID1A 3D6GA 1IAIH 4QXWA 4IHBA 1JD7A 2ZXBA 4KROC 4U33A 3ULXA 5HYIA 4L48A 2KH2B 3GHBH 1XL4A 4Q9CA 2ZCKH 5E4AA 1RM1A 1FFRA 2OQJB 2NOYA 3WS3A 2ALAA 2DI9A 1TTUA 5AKTA 4HUVA 1JFIC 2VQ1A 1CD1B 5C71A 4RAUB 1J18A 3W82A 1HU0A 5E2UH 2VIRB 3B34A 4I0PC 4K3GA 1D2PA 1JPTH 3LZNA 2F6AA 2D9CA 2W8CA 4GOSA 5T1MB 1LK2A 2CPUA 1DEDA 5TTRA 2WBKA 2VLRE 1P4UA 3TX4A 5BRZB 1YQMA 4KNTA 3NT0A 4F9LC 3C8KA 1QRKA 3F7VA 5B8CC 3K71A 1QW8A 1D5BA 3NACL 5C09E 5HGHA 3LHPH 4HWNA 4MA7H 1ROCA 3L5IA 1FBIL 3KLAB 4BKTC 1SOSA 4PSPA 4ZNEA 5KW9L 4Z78B 3P4LA 3BT2L 4BQCA 3SD5A 4D9RD 1MJ7H 43CAB 3DUSB 2EIKB 2C3WA 1U2HA 2YKKA 4D0CA 3OLEA 4BYHA 5EU7C 3TYGH 1NCBL 3IDYC 1G7IA 2N4IA 1U9KA 4RQQA 3GMNA 4KUZH 2GBAA 2AGJL 1XGRB 4LEBA 4R90H 1H3PH 5CZVH 3T77B 2OMZB 2MTAA 2X9XA 1CWVA 3WY1A 3MNMA 1G9EA 3H56A 1VENA 5IYDP 3O3DB 1PIGA 3ES6A 1MFDL 1O7DE 5AVUB 4WSGA 3RA7H 3PNRB 5JW4R 5IWLC 1CXKA 4ZZFA 1OTUC 3PDKA 2OYPA 4ZPTA 2A0LD 1AI1L 3VGFA 2OCFD 1JWUB 2WVSA 5C0JA 4MCNA 2XNAB 1KTJA 1BQHA 3PWNB 4XNZC 4ZOEA 4OUUB 2VIRA 1QA9B 3VJ6A 1OTUD 1WCQA 4PWGA 2APVA 1FNSL 1RJCA 2B0SL 2R1WB 4IGBA 1DDTA 1QLEL 3MNZA 1N64L 4G3YL 5DMIL 2R9HD 3U7WL 4BFOA 2R29H 4P2QE 4QXGL 1NCOA 3WIIH 3OCIA 3GLAA 1SN0A 2ADGB 4JRYE 4KDTA 4TN9A 1M53A 5BZDB 2CR0A 3RU8H 4YXHL 1HQ4B 2DQMA 4XP4H 2YOCA 4OLYH 3RFRA 2IH3A 2WUBL 4MMZC 1T89C 1AE6L 1E27A 2YKLH 3F01A 3DETD 3FU0A 5BRPA 1TETH 2QT6A 2ARJA 2Y6SD 4QRUB 5CNHA 5AW7B 3ZKMD 2X4RA 3MCLL 3DETC 2R2EA 3NIGF 4IRSD 3K8MA 4F58H 1G7PA 1PG7X 1KEGH 1V7NH 1J05A 2FD6H 5BO0D 3KPPB 3QDMD 4WHYH 2AQPA 4WRLA 1DYZA 1GGYA 1PVHA 3DARA 5BMPA 2CO1A 1T66C 2DY2A 4HJ1A 2ALWA 1AYOA 1CUOA 5AB2A 3NFPB 3WEOA 1NGQL 3RB5A 2XV6B 1YYML 1ZLUK 5HYQB 2NX5B 3ECVA 3W0WE 1D6VL 1X5ZA 1D7BA 5ALBH 5GZNC 3ZVVA 4D9RE 4U3CA 3G5ZB 4FQQB 3ZXAC 2FIKA 1NM9A 1CLOL 5AW4B 5E6UB 3QPKA 4ESKA 2YJQA 1DIZA 1KIUA 1SGKA 4NJAL 3TO4C 4R0LA 1QI3A 2Q2EB 4UOQA 5B22A 2AK1L 1FN7A 2X42A 3GGWB 1UH4A 3GIZH 2WXLA 5DJ2A 5JN5A 4B3EA 2XHIA 2PP8A 3RE0A 1E9PA 2WZPD 5T3ZL 3INUL 1CXFA 5D4IA 3S9DB 2EABA 4I1NB 4HS3A 4L8SA 1FYTA 1DANT 3AAZB 3P3SA 1RZGA 4NO0A 5DQ9A 5AG9A 1GYVA 4GS7B 5IJBC 3TWCH 1IEBA 1RJLB 2GYSA 3QR2A 4I2XE 3RY6A 4D0DA 4FFYH 1Y0LB 4JJ5A 1TQCB 4X6DA 4NGHL 5GS3A 3K2KA 4Q9RH 1P7QD 4I3RL 3U0PB 3VXUE 1WZ1L 1P7QB 3BZ4B 4JY5L 4XCCL 2ORBL 3K4DA 3C9NB 5HHNA 1BP3B 1OSEA 1RPKA 2X4NB 3L4UA 2GSMB 4G6JL 5IT2L 3EGDB 2KBGA 4G6KH 5J6GA 3PHSA 2V7NA 3BZ4A 1YG9A 3ROOB 4OCRH 1KO9A 5F8RC 5B1CA 3S4SB 2ITCB 5HHQA 2WO3B 5A2IH 1I3RA 1FJ1A 4IGBD 2ZOKA 4XHQA 3IS1X 2GC4C 3X3GH 4AL8H 1S8DA 3O3AA 1IZJA 1WGOA 2ZXQA 2VR3A 2XFXB 7TAAA 2VTFA 4MNGE 4S2SB 3FTGA 2HFGH 3RGVD 1TDQA 4N6RA 2ARJB 1NIDA 1RJYB 4Q89A 3BSZH 1KJMB 2ZD0A 3H7BA 4U1NA 5CLTA 5F6IC 2TSAA 3M8OH 3WTUA 4WUUE 2O5NA 4WWOA 4ELMF 4ODSH 4GBXC 5DRXA 2FWUA 5AAMC 3CHOA 3BLPX 4G6FB 3A24A 3O3EB 4RETB 5EUOE 2XXFA 1MCOH 3RUGF 4J8RB 4YZFE 5C0CE 3KTUA 3ILQC 4R96B 1UD8A 5GRVL 4X4XB 1WA1X 4FJZA 2V9UA 1H6FA 1QW9A 3BZFA 3SE6A 1SF3A 3D34A 1AOZA 1YYLH 1LXMA 3Q44A 2CLZB 3IFNH 1J9SA 3I6GA 4UINL 1FG2B 2Y5QA 2BNQA 3IMBA 1RHHB 3GI9L 3NABL 1S7UB 3C60D 3QK0A 1F58L 4JRXB 4ADIA 2NOEA 2JF1A 2B4CH 2NQCA 4HKBB 3FOMB 3OZ9L 3OG6B 5CUSL 2V17L 3KM2A 4YBLC 3L2MA 2OJZH 2W80C 4RISL 2XJKA 1EEYA 4P23C 3WLWD 3P4OA 3AG4B 3ZRSA 2CKBA 1MCRA 3EH5B 3SE8L 1YMMA 3B7YA 3IPEA 1EQWA 1LO5A 2L04A 3WHE1 1N59B 3OV6A 3GF8A 4DCQB 1OD9A 2YMOA 3OJMB 2WOYA 2R0ZL 5FR3A 3TO4B 1LWRA 1SXZA 2A73A 3VI3B 1RK7A 4UM8B 1INEH 4K55A 4NNXA 1KLUA 2VYRE 2H32H 2Q76B 3I6SA 3FU7A 3QZBA 1OAZH 4E0RB 4UOW1 1L7IL 32C2B 5A40E 2CHZA 1XGYH 3NH7H 3QAZB 4JVUA 1U8NB 4HJIA 4LVOC 5JOFB 4ZUVB 1MLCA 3VI4A 4DOHE 2AEWA 4FQ1H 1XO8A 3IETA 2PPEA 1OTSD 1VADA 1FIEA 5J0BA 5CINH 5EF1A 4PS4L 5HI5D 2ZCHH 2QADD 4AYFA 4U6VH 4NZUH 5IV2A 3HE7C 2UXFA 1AD0A 1DQQA 2DL9A 1H15B 5F1IA 1JPFB 3K1DA 1IM3B 4EALA 4PD4K 4HUXA 2VSDA 5E94A 3WO4B 4NKMA 4Z7VA 1UUSA 3N1MC 4XH2A 5KYYB 5MI0C 4N8VA 1I9EA 1KV7A 4JLRB 3MMEB 1A65A 4P46C 1I9IH 2F54D 4TNVK 5FV2A 4YR6A 1I9RL 2AEPH 4L4TE 2ZOTA 3RTQD 1KFAH 5I26A 5I2IA 2M2DA 2XXMB 1B0GA 1HDMB 5HYJE 5JW5A 1AFVL 1L9SA 4UDUB 4ES9A 4Z8FH 4GP8B 3GHEL 5DJXB 5IHWA 2VN3A 3GZPA 2ATPB 2NXYC 4P3DA 3LY6A 3V9CA 3SSGA 1PMYA 4N2FA 3WXVL 3N42B 5CWSB 3GK8L 2VZ3A 4G59C 4LSQL 1NFDE 1GW0A 1AQDA 4OUUA 3RVUC 3EJZC 2I27N 1R3HA 4HUVB 2DDQH 4HETA 3MGTA 3G04A 5K1JA 3ETBJ 4UOJA 5C1MB 1OTTC 5JOFA 1NC2B 1RIUL 1X5XA 1JWSA 4G6AD 2CIKB 5HHOB 3WENA 2VGLM 1OLLA 3ZTJG 4KMTL 4DKEL 1IQWH 2PCYA 3IAPA 4XPAH 1Q0YL 1X7QB 5HHXL 4NKOA 1BZOA 1HNFA 3FB7B 5F9DC 2F53B 2ICEB 3VXNA 1LEIA 1WLHA 5DRZB 2EDFA 5FXCH 3WIAA 2VUYA 1DFBL 2A6DA 2R27A 4JFSA 3RUGB 3D1MC 4XMPH 3I9AA 3EKCA 5I1CL 4LCWD 4XB8A 2W07A 5CBAA 1HFUA 4MCZB 3D69B 4RAVA 2C7FA 2VERN 5ANHA 3UADA 3ARGA 5C09A 5CHNA 2VC2B 2H3XC 3NJFA 1FL5B 1VFAA 4LBAA 3X13B 5FHBL 1BZQK 3D4ZA 4E41A 3CXDL 3Q1SL 2ED6A 2IXQA 5IFHH 3F10A 4X7TA 1JHTB 3C5ZD 3ABLB 2ZG3A 3FB5B 5D1XB 4H0GA 4AGLA 1ZA6B 4PJ7E 1PYWA 1KT2A 2EIDA 4R2GC 4AV4A 4FMVA 3LXAA 3SCMB 3DOSB 1MG2C 2IADB 4ZX3A 1PJ9A 1AQDB 1UYWH 3FSOA 2B0SH 3BP7B 1N64H 4IKJA 3PABB 1ZWIA 3LN4B 4E9YA 5IBLD 1T21A 4AGQA 4M4PA 5HHMB 3O2VH 3Q2LA 5BMNA 4KXCA 2ZUTA 4TVPE 5D6DA 3RWEA 3MO1B 4Z0XB 4JUTA 5JYLA 2YPVA 5K59E 2C9UA 2H26B 2R7EB 3H42H 2BSBA 4JKPL 2WUBH 1AXTL 2VT0A 4OJFL 4M6NH 4MBOA 1JNLH 2Y23A 2IPUK 5I15L 1BPLB 1WD8A 5FAAA 2Q3AA 1A5FL 1CDHA 1CGXA 3QEQA 5J6SA 4FXGB 2E8ZA 5HHMD 3ARBC 4WK4B 2CBPA 3REWB 4O2EA 4AKPA 1KN2L 1V7ML 1IIKA 2X44D 4OZFA 4GW5B 3LS5L 4HH9A 4Z7UB 5F7EL 2LE9A 3KXFD 4NUGL 2BK8A 3RY5A 3WMPA 3OJDA 3A6CH 1V7NL 4HV8A 2HL8A 1M56B 3CFBB 4I9XA 2M8XA 3DX8A 3VFWB 3P3UA 1BOGB 3FTVA 5FDWA 3B5TA 4H0HB 2X38A 1QTSA 1TPXC 4IHOB 2XCMC 3VSTA 3B2XA 5D7LE 2Y7MA 4QCIA 1IM9A 5F96L 3QI9D 4JB9H 3LZFL 2J4WL 4XNMB 2Q7YB 3SKNA 3UX9B 2GUYA 2EINB 1QUNB 2OI9C 4ANWA 1T1ZB 4M9PA 2IH3B 4PVLA 5FK9A 32C2A 1E6JH 3C8HA 2Y5TA 4V1DE 5AB9A 5HXMA 2DKUA 4IBVA 1NIAA 3L3KA 4N2AA 5IEHB 4KK6D 1WH0A 4F8TA 1OW0C 1RURL 2N56A 5HPOA 3ALWA 4YGVB 3ULSA 3U7AA 4LCCC 3IDUA 4UM8A 2PW2B 3NCMA 2FLMA 4DN4H 2JJSC 1P84K 5E1AB 5L7XH 1Z3GH 4R7NA 1G43A 4I3SH 3AG1B 2HZSA 3PG2A 2F7QA 2BFVL 3BLKA 4GMTL 4LDLB 3CN0A 1KT2B 4CL7A 1EZSA 2EVFA 4JREC 3M86A 4Z7AA 1WTLA 2H4LX 4YQXH 2BLFA 3MRHA 1NBQA 5KSAC 2AV1B 2WNGA 4GLRI 2NY7H 3BD4A 5HGDB 3RP1A 1YNKL 2DN7A 2VMJA 3IJ8A 3WEXA 3D5OF 4CN4A 3W5NA 2YRBA 3NOIA 2X1OA 2NOHA 2ENJA 3VNZA 2VKWA 3MYJB 1DQIA 3G5XB 2SEBA 1ETZA 3U1PA 4NC2B 5GRYA 4C7PA 1UZ6F 3ZE2E 3V6FB 3TV3H 5I1KL 4IBTA 5GGQH 3FTYA 1I8LC 3JBG7 5SWZA 4I77L 1MW2A 2DZEA 4ZFZA 2D03H 4YE4H 2RAMA 5G4OA 3MBWB 4DFHA 1JMZA 2V3FA 2JTYA 2QLYA 5EZLB 4ZS6D 1A1MB 1CF8H 3QT2A 4N2OA 2R4RH 4GW5A 5IF0B 1CK0L 3ZYOA 1SY6A 1QFWM 2C4FT 4UQIM 4ODSL 3NJJA 1NCAL 3VH8B 1R75A 2H45A 4R84A 4MLIA 3ZR6A 2QR1A 4FQ2H 1CGSH 1C16B 4QYOA 4P99A 3PIQA 3C6LD 1PFCA 3KCWA 4CMHB 2D8KA 2EEAA 2DYPD 4W9GC 3UEQA 4F92B 5EOCJ 1AO7A 2W0KA 3LKNB 2I07B 4FEMA 3BAEH 1QN4A 4PLKD 1XCWA 4GXVH 3MLUH 3GNML 3HIZA 2Y8LA 2XLLA 4A55A 1S8DB 3MRIB 3BVXA 3K72B 3TBVA 4IOIB 3MLVH 4XMLL 5DXWA 3NABH 2JHNA 5A6IA 5DJXA 1AHMA 2HTKC 2AXGB 4EDXA 2G2RA 1QFWH 4ABUA 3K6SA 1F2QA 1ZA3A 4XNBA 5C0AB 3PE9A 1YJDH 4M1CD 5L9DH 2KS0A 1FL5A 1F1GA 1E4WH 4MJ2A 5D2LA 5KS9E 3LNDA 4KRPC 1RUAL 5F7MC 5IB5B 3VXSA 4S1QL 1K4CA 5DTFA 5F3HB 1PY4A 4MQ7A 3P40A 1KEMH 2I26N 4NIYE 5DO8A 2OCCB 2DTMH 4ZUWA 5L4IA 1YQ2A 5DJDB 4YDKH 5SWZE 3DGGB 1MCIA 2BOCA 3KR3H 4JQXA 3VRIA 4FNRA 3ZDYB 4ZMLA 1XCTA 5FOBB 3GWJA 2YXMA 4NQSB 4WI7A 1MWAB 2ZP9A 4LEEA 4BZYA 3VXOB 4P2AA 4NKOB 4QHKI 1HHGB 1A4KA 2VDLL 1NCGA 3VH8G 5DHYB 5EBLB 1XF5A 2W88A 2EDHA 2YAMA 5HVWA 2DLIA 2Y24A 1I4FA 3CSPA 3F7YB 4FERA 4X98B 5D8JL 1J86A 1P2CB 1QWNA 3HS0A 3OKLB 1J8HD 4WGVB 1A64A 4G7RB 1RFDL 1QYGL 4EF3A 4TOYH 3C6SA 5AOMA 3VFGL 4PYHA 3VXPA 4CADA 3M7OA 4JL2A 4UUJA 2FSDA 4CILA 3S8GB 2DTSA 4PJEF 4WWKD 1MLBA 1TQBB 3LQMA 4XCYA 1RU9H 3HUJB 4H2CA 2E7LA 3QUYD 1NBVL 2PTTB 1TZOA 4GKZA 5FOBA 1ASQA 4QUOA 5KVDE 1JDAA 1QSED 1W0WA 4HC1H 3DKHA 3IPBA 3IFOA 5GRVK 2W9DH 2A9MH 3O4LD 3QUYC 4LDCA 4C56D 1JVLA 1OM3H 3VD3A 4E9WA 3C5ZA 5DLLA 3CG8A 1ZCRA 1KFAL 2BZ7A 5B3SB 4DEPC 4JW3A 3K91A 2XI9A 4N2IA 4R4BA 4H88H 4C4KO 2Z6FA 5C6TH 1KG0B 1KBWA 2NY0D 1QLEB 1BX2B 1RZJC 4UT9H 4ZG1A 3GUTA 1UVQB 3DX9A 1RMFL 2D2CC 2I5YH 5H8DA 3ASMA 1Z9SA 3RWCB 5T1DL 4BE5A 3NK4A 1S7WB 3QUMB 4IMLB 4F1ZA 1RZIA 4LOUC 2OA9A 4MJ5B 3BAXA 3ECBB 2QFRA 2RQEA 1RIVH 4JDEA 4MAZA 1U8NA 5FGCB 1W15A 5CIPH 2ZT9C 4KQ0A 3OWRA 6FABH 3FU6A 1Q94B 2WV3A 2DM7A 4W1TA 3HG5A 3A22A 4JUSA 4EVNB 2VW7A 4W68A 2O6PA 4HJJH 4WGWB 1EO5A 2CA4A 1MI5B 2C9VA 3F58H 3NP3A 4JRXD 4X6DF 1HH6A 4OJEH 2E59A 4RMQA 3ILPB 1K2YX 2DQIL 3UTTE 1BVLA 2XSKA 1FCGA 2OW7A 4XTRD 4POYA 3NJIA 3QEQE 5K9JH 3LPGA 3WFEL 3U6RA 5IMMB 3IJYB 2J2ZB 5FUCC 3RVTD 3DRTA 3W3BA 2V33A 1YN7B 4JPVL 4O5LH 4XI5D 4XTRC 1ZT4B 2V92A 5C86A 1NVPA 3VYOA 2X4NA 4P2QB 1SJEA 2F19H 4YSEA 4LSUH 4PJXB 2XBDA 5DZ9A 1MY7A 4M62L 1PZ5A 3IJSA 3IFLL 4DUWA 1YN7A 3MBED 4NC1E 2FBJH 1GSMA 2W9EH 3PWVB 4K71C 1KFQA 3CSGA 1OE2A 5PAZA 3T8MA 3HVDA 4NM8H 1N3CA 1KTRL 1CVRA 4JFYB 5KTEH 1RUPL 1S7XB 1ET8A 1NEZG 3K2IA 1BD2D 4XHJD 4YSDA 1Q8MA 3LDBB 3QIUC 4PIRF 3SE4A 1E5AA 2C5DC 4AQ8C 1QFUH 2NW2A 5C0CD 3FO2A 4G8EA 4O9HL 4OFYA 4PJDF 4UM9A 3GMMA 5C0GB 4AXWA 2V5MA 4JKPH 3BX7C 1AIFA 1QBML 2OMTA 3REWA 5FDYA 4BH8A 1EXGA 2VXQA 3AUWB 4X5LA 2E9WA 1SBBA 2Y07H 4KK5D 3BHBB 3A4FA 3BRFA 1E4HA 1NAML 2ZKWA 1ETA1 2F1EA 4OGYL 1IAIL 2P5EA 2OMTB 4RNRB 3P4MB 2IOOA 3MRCB 2A6JA 1NAKH 2BNRB 4HEPG 1EBMA 3ZN6A 2WSPA 3IMWA 3K8KA 3KPOA 5A2KH 3MRFB 2K78A 3AFLA 3LSOB 5FB8B 1FO0A 3BLBA 1S7XA 3BP7A 4L9DA 3C2SA 3FU8A 5E2UL 3L4CA 4D9LH 4Z1PA 2JI2A 3UACA 4GAYA 2P8LB 5D4HA 3B2VL 3F83A 4MZIA 3NJVA 5JUEH 2K1MA 5I74B 4NJ9L 3LZFH 5FEBA 5IM7A 3LRLA 4D0BA 2CCVA 4CSZA 1DLFL 3ULAB 1TXKA 3OQ3B 4EZJA 4JVWA 1JXKA 3GBML 1E6JL 3QDAA 4TTDC 3G5YB 4NQEA 3MRQA 2NY3B 4M7JH 1E5UI 1ZT7A 5KYYA 3JV4A 3WTXA 1JXDA 3CCHB 5CS7A 5E7BA 1VFMA 3BN9C 3GIVA 5T3XL 3TT1L 1JAEA 3FUHA 4IEFB 4DN4L 3AVEA 3GXIA 4EUPA 1Z3GL 4JM0A 5DQDL 4NQCD 3IPFA 3UBXB 2X6AA 2NLJB 3OKOB 3ZZLA 2EUVA 5DJAA 3FSWA 1IC7L 2GAZA 1YY8A 1HNYA 2AKRA 1FZKA 1U8KB 3FXIC 4U0QB 4G1MB 3QDMB 3TO2A 3GGWA 3MU3A 4JCWA 4PJ8C 4IDJL 4O02B 1P9MC 5IFJB 1SMOA 4Y4FA 4KUZL 4LFHG 4YQXL 4A67A 5E9DB 2D3NA 4Z7VE 3VRJA 4PJDA 3IMSA 4ZDHA 2Y9RT 2AQNA 2GK0B 2HJLB 3E80A 4CVXB 1S5HB 4ALAC 2ZICA 1MIEL 4HZAA 2E6QA 3OGCB 4DETA 3L08A 4HLEA 4J3OC 2D03L 3TA3D 1RK0B 1H5BA 4PTTA 3AJ7A 3QBTB 1SRDA 3C6LA 1S7TB 1JVOA 3QCUH 3QPQC 3VMPA 4G3YH 4P5MA 1E4KA 4I48B 3D33A 1YMMB 5FYLH 5K9KB 5IBLC 2YO3A 4DERA 4H8WC 1EO8H 4K23L 1CDUA 1XBRA 4Q74A 3V8CA 4FTVB 1ODAA 3D18B 3BQUA 5KVFE 1YECL 4PRAB 3QPQD 3QEUA 4WV1A 4UILH 4L8BB 2HKHH 2WXOA 4ZS7L 3ZDZE 4MA1B 3WNOA 3QNXB 5HGAA 1AKJD 3Q8EA 3OSVA 2DQDH 1TJGL 2E7CA 4GSDL 3EADA 4U4IA 5EPMA 3BDBA 4FL4C 4G7YL 2A4ZA 3BKML 1KIQA 5EO0B 2XN1A 1FBIH 1JZEA 1L9TA 12E8H 4RDQG 1X7TA 5D5MB 3V0WL 3MCLH 2QPUA 2D0GA 1H19A 4M7ZB 4U1JB 1H5BB 2VR7A 2DQ6A 4NRZA 5D7IF 1FVDB 3GSWA 4XPGH 1JZ8A 4MJ6B 3VMOA 5HYEA 4M9OA 2XG4A 5EUOA 3RL1B 4NPYB 2AZAA 4Y1AD 5C0JB 3B7SA 5IZ7A 2VXUH 4R90L 2GJZB 2ATKB 4JFOB 3LVTA 2IDTA 3EIFA 1CFMA 4TVPL 2LVCA 5ANME 3RWIA 4L3ED 3FO1B 3CDGB 4QHPA 3OKEA 3MFFB 4AJVA 3IDJA 4XRCA 5FUCE 3SPGA 1TEFA 3KLKA 1VKLA 2HA1A 3ARPA 3VG9C 4ODBD 2J1ZA 4I48A 3OAUL 2PYEE 1NEPA 2WXGA 1JGLH 2ZUSA 1GVIA 5F6HI 1AD0B 1DQQB 2ZIDA 3T08A 2HT3D 3N3EA 3QIWC 1OT1A 1D3CA 1O9ZA 1PEZA 2VLKE 4IEFA 3CWGA 1R3LB 2FX9H 3CLFH 1R3KB 4JZOA 4UIKH 5CJXC 2A5UA 5EU6A 2FO8A 4MXQC 1WAPA 3JYCA 4AQAA 3AQDA 4XCEB 3RU8L 1AR1C 5HSFA 4MHHG 1P5UA 3I9GH 5EU4A 1C08B 4ZFGL 1UEYA 3BPLB 1BXUA 4QRPB 1QRNB 5FA4A 1HKLH 2YKLL 4DQOL 1JNNL 5C0AA 4JKWA 3RJDA 2HPOA 4X9BA 1YDPB 3EYQC 3QGVA 3CZKA 4KI5F 3WTVA 1LVEA 3S88L 4JPQA 2OR9L 1EGJL 4PJEA 3IJYA 5J56B 5JHDA 3V6ZB 4AJ0A 2YD3A 4GKSB 5JIDA 1DZ0A 3MDJA 3OZLA 1CDWA 3MOQA 1QP1A 3EOBB 4JHUA 3TONA 4ZRGA 2IVFC 3S3PA 3SDCC 4LF3B 1Q9WB 1C12A 4OLUL 1I85C 1XGPA 1EZVX 2VM9A 4N9GA 1Q72H 3VFSB 1DUYA 3UG4A 5B38A 2LU7A 1KCRL 4HT1H 3HC3L 4P5SA 4P9ML 5BJTA 3IT8D 5JHDD 3LEYH 2Y4SA 2BNQD 4NBYB 2GCYB 3RILA 2BO0A 1NINA 3BSZL 2LFEA 3BWAA 2B9AA 3D52A 5TK4A 3RNKA 3CSYB 3RI5K 3FRPB 4XNMA 4B7IA 4AMKH 4U0RB 3MLRL 1OCWH 1Y18A 2AK1H 2CALA 4N8VB 5CSZA 1U6AL 1MCOL 3APCA 2J8UA 3BPCB 5EDXA 3QFJB 5TFSH 1A4AA 2CDFA 3IDXH 3MV7D 3N40F 1DSFH 2NQDA 2R69A 3DUUB 1WAAF 1MRDH 4JZNA 4M7LH 5T1LD 2J8UB 3BPCA 2V2WA 2GB2A 1WZ1H 2F53E 2GI0A 3LZRA 4JY5H 3OKYA 4W4OC 2GQHA 1A02N 4HCRL 5KN5B 5I1LA 1VFBA 2JCCF 4EBQH 1UCBH 4M03A 2XOTA 1XGTA 1B9ZA 4MZ3A 1HILB 5CU5A 5T1LB 2H32B 3FULA 4XNUL 3JTSB 3QDJD 4QAMB 1PAMA 1HHKB 5DJCA 1XCQB 3SOBH 2OJZL 2L7QA 1AGDB 3FUJA 4NQEE 4TL5A 2YC1A 2UY6A 1CJYA 1CFBA 1TKWB 2V6HA 3OKOA 4YC2C 5FFLA 4B60A 3N89A 1K8DA 3B9KB 4OY9A 5F6HJ 5J12C 4NX0A 1MY5A 2HKFH 5I6KA 3SQRA 4CMMA 3S6CA 3D3VB 3T4AA 1ZK5A 3JTBA 4KXZI 5MENB 1BQRA 2GTZA 3JV4B 1QPXA 3QDJE 4YHZH 3D4YA 1GRWA 2HT4D 2Z8UA 1AHWB 3L45A 1AAJA 4TQEH 2IGLA 1J8RA 3D0LA 3SDDA 1U95B 3IVKA 4R8WH 3LIZL 1Y7VA 2XVGA 1OAUL 2IF7A 3MRRA 1XGYL 2CO3A 3NZHH 4WCYH 4XN5A 3VD5A 3PHQB 1E3XA 4PJ5E 3TVMA 1CXHA 4ZW8A 1DBKL 1IIIA 1KB5B 1Y0LA 3PWPE 1BJ1J 2UWEE 4JJ5B 4PS4H 4AEIH 1MNNA 3K4AA 1J87A 3CHQA 4IIQA 1FSKB 4LCYB 5CGMA 1Q9OA 4U7KA 4X7FC 1F90H 1PGRB 3DO7B 1TTCA 1AC6A 1VERA 3QUZC 1KZYA 3HG3A 2DI7A 4HKJB 3AM8A 3NAAL 3Q5TA 5D7SH 5DJ2B 3UO1H 3IN2A 4F5CA 4XX1E 1NC4B 2H8PA 3N0AA 3PUCA 2P5EB 4HK3N 3ZTEA 5C9KA 4Q2ZA 4LKCB 1MHPH 1QFPA 4FFTA 1IE5A 4RH4A 5SWSB 5CCJA 2C1OA 3N1FC 4DP6X 4FE9A 1N67A 1AFVH 1L5GB 2OMUB 3MBXH 4JFDE 4S1DC 4ZMAT 3GMRA 2V9QA 2X40A 1TTRA 5FF6A 1JZFA 2LLNA 2WBJA 2YQGA 3JWOC 4CW1A 1W0WB 4WJG3 3BKJH 2HLAA 4ADJA 2HMIC 3MJGX 4Z7WA 3P69A 2BP0A 2MPAL 2X53A 1NCHA 4ALAH 5CMAA 3KPNA 1HH9B 4QMEA 1E8YA 4XX1G 4AC2A 3R8QA 4NJ9H 4CADB 1ZK9A 4IKIA 3DXAE 3VSQA 2A2QT 4F33A 5H37G 2OJ1A 4AYSA 1BX2A 5F9OH 3NSXA 3GBMH 3MJ7B 1IAOA 4QT5A 3NQIA 4HJEA 3PP4H 1WWWX 1V3LA 2ZX5A 3SY0A 5AZ2L 1XH0A 2CUMA 2FL5B 4ZODA 1FA4A 4L1DA 1LP9E 4PRAA 4LNRB 5JPMA 5DMYA 4XH2B 4QWWC 3L4WA 1XT5A 1JRHI 3H9YA 4U1LA 5F7NC 4M4RB 5E5LA 5CZRA 1IEBB 1RJLA 2DKSA 3IMVA 1KC5H 2ZXWB 3BESR 4AGNA 4AW7A 2ZSWA 1R3IL 4WFHD 1IC7H 1S7SB 4OZFG 2AABH 1ZSDA 3LKRA 2Z7WA 1ZHKA 4LPWA 4OFPA 3BISA 5DTFB 3SPIA 1G9NC 2NXZD 2F58H 3NIDB 4Y4KD 5EN3A 3H0TA 1VDGA 4FTVD 4X98A 3SJVA 4Y8AA 1VB9A 2MKLC 2W95A 3KYOB 3UYRH 1KTDA 5AL8A 2X88A 3ES6B 1M2VB 4KJWC 4HG4K 2R8SH 4MCMA 1MHHB 2G2RB 3RTLA 1OAXL 1E3ZA 5GGUB 4YPGB 1BBDH 3D2UA 4JO4H 3VXOA 2FNBA 2X4PA 3MREA 1OT2A 2W60A 2R4SL 5FO9A 1LQBC 1P4LA 1CFSA 3TBWB 3VFPA 1P69B 2OJEB 4PJCE 3L3GB 3RFZA 1FO0H 4N8CL 4XXWC 1CD1A 5D2NE 3QI9C 4GEIA 1ND0A 5AVZB 2YBRB 1FFNA 1OF2B 3EH1A 3KVDD 1CE1H 3ARFA 4APQC 1NGZA 3PS6A 3FT0A 4R4FH 3C2AH 3TH4T 4HIEB 3MLXH 1A4JB 3CH1B 2IPTH 2OTPA 3P3RA 1VFBB 4TQIA 4H44C 5J5EA 7CGTA 4TUJB 2JB5H 3WFDH 2WXKA 4B0AA 2IBZX 4UTBA 1OP4A 2FATL 3OAYK 1BM3H 5IEKB 1QHOA 2VR9A 3QWRD 5F7EH 1IBGL 4F8OA 1PLCA 1NBZA 1NGYB 1SMDA 3KPLA 5KS9B 2OXGB 4HV8B 4LOEA 4FFVD 2IFFL 3PQYB 4JE0A 4APXB 5BMFL 1OAYL 2ZCLH 3TBSA 3U1QA 4TVUA 2BCMA 3KDPB 3QDGA 4KKBC 3C12A 3FQ2A 2V8QA 2AQTA 5B21A 1HWGB 4TUUA 4XPBL 4CVXA 2YD2A 4K5MA 5KJ4A 3R4RA 4ZUSA 1AJ7H 5C0BE 4N0UA 1I8IB 4KKBD 4U1MB 4OZHE 3ZDXE 1R5VB 3IK2A 5D55A 1PLAA 4LSSL 4P4KA 3VB8A 2OULB 2DLTA 1BYPA 2JQZA 1P4IH 2B1HH 3H9ZA 3HNSH 3FO0L 1WBZB 3ORJA 4JG9A 4XNDA 1FZJB 1DHKA 1K2DB 3LKPB 1MWAA 1UKSA 5ISZE 2HT2C 1CDYA 4GYBA 1PD6A 1M71B 2A9AA 4HHAA 4XP6L 4LF3A 2K7QA 3VFOA 1XF2A 1EERB 4ZAKA 2IH1B 5T3XD 3BPOC 4DN3L 4OFVA 3TGXA 5I71B 3PJSB 1T03H 4UMGA 3OKKA 5GGRB 3Q13A 3O2VL 1WS8A 4J3XA 5I82A 3SBQA 2YXVA 4DWHA 4ZMPA 5JW3L 3I9GL 3MBEA 4NQDB 3SPCA 1KIPA 5HVHC 2Y5TB 4IRJB 4M3JA 4PJXA 1EFXB 1WC7B 3KHOA 3GXNA 5I15H 4HDIA 1OCRB 2AV1A 3D4GA 1CICA 5DHMC 5HHNB 3C08H 1J1XH 1QX1A 1KY7A 3OM3B 3P9LA 5D7JB 2ICES 2IDCA 4MMXA 1KIPB 2BP3A 2F0CA 3EDEA 1DQDH 2ZE0A 5K69A 5MENA 2G5UA 3UAJD 1F6LL 1OQOA 1SDDB 2QHRL 4KUCD 4N86A 2HLFD 5DQ9B 1LEKA 1S4IA 3D39B 5IMKA 5JDJA 1W0YT 5F9WB 4U05A 4OCWH 1XF2B 4YE4L 3KWTA 3MRFA 4MVBD 4DP7X 3TEZA 3HC3H 3MUHL 2IQ9L 3MOAH 4OIIH 4P9MH 5D1QA 2RTTA 3V6OA 5F96H 1MUJB 3SZKC 4N90D 4HGMA 4BFIA 4TRPH 4DUVA 4QTFA 1ZGLP 1L9QA 4QO1A 3ZMNA 5GXBB 3HKZA 3ZYJA 1NGWA 1R24A 1XGTB 1PD1A 2FJHA 1TTFA 4XNYL 4F2MA 4PHXA 1QSFD 3U0WL 2NX5A 2H6PA 3CHXA 2WUCL 4CSPA 1VHPA 4PWEA 5KSAA 2QBWA 4L2YA 3AB0B 1T21B 2BWIA 4EE2A 1J12A 3H9HB 2B14A 4OCMC 4I4WA 5GGVY 3OB8A 1BGXH 3O6ML 4N2EA 2JJUA 4YHOH 3BAKA 4L9LA 5FM8A 3ULVD 3DOIA 3D39A 2RFXA 3NJKA 3QDJA 3P3TA 4I3SL 5DFAA 5E1IA 2CMRH 2AP2A 3CWAA 4OM0H 4KKZA 5IOKA 4LLDA 4LLVA 4XMLH 3GUFA 1SHSA 2BNRD 3G9AB 1RJZB 2CIIB 2K4AA 4DIXA 5FM5O 1ED3B 1IJ9A 1P6FA 4ZW5A 2PCPB 4E9RA 2I85A 2MIZA 2YWZA 4WNJA 5CEZE 3CHRA 3G3LA 2H26A 2R7EA 3RQ3A 2CNYA 5T5NF 5HVFB 4NN6B 5D2NA 4C57C 4ZBJA 1A6VH 1OPGL 1FC2D 4KV5E 4BQ8A 3ZE1B 3RUGA 1SXNA 5KL0A 1IFGA 2OKMA 3BVUA 4JCLA 4LO9A 4PRNB 4KFZC 5MHSE 4IRJD 2WO4A 3NN8A 1I9JH 4L8SB 2JXMB 3R7QA 4I13B 1XXFC 3O0RL 1F8TH 4UCFA 5G5DA 4M6ML 2J6EA 1UADC 2V5SA 1BA9A 4R9HA 5AW2B 1AGBA 5T5FA 1U8OB 5CJ8A 4P5RA 1IVTA 4N3TA 3WHE0 5BQDA 1PZDA 5GGSY 3T0EC 2GG1A 1M2VA 2LLGA 3ILQD 4Q97A 4XP9H 1YQLA 2V9TA 1ACYH 4BBWA 2MOGA 3LEVH 2XBZA 2XX0A 4TUOB 1EHLH 2NDFA 5EA0L 1BXXA 5KVMC 4L1TA 4FQHB 5ECGA 5L2KB 2Z93B 3UP1A 2BVQA 4TOYL 1P5GX 1D7DA 3PUUA 3DDFA 1W9XA 1SN5A 3I75B 2EUXA 4M43H 5CEZD 1F90L 1WFMA 5F9JA 1U8HA 4WW2B 3T3ME 5EF2A 5CU9A 2B3RA 5LLIC 1HX0A 2BXZA 3HI1A 4NNPL 2A9ML 2KQMA 2B59B 2NW3B 3DRQA 3ZZQA 4HIPA 4HP5A 2HH0L 4EAIA 4CSSA 5I8CB 1R5WA 5ICZB 4O2CA 5DRNB 2FR4B 1L0QA 1XF3A 2AK4E 4FQXA 4QR7A 4U1HB 4AGMA 3KYMA 3MBXL 2DQUL 4S1QH 4XVTH 2OL3H 4TUKH 3TCTA 5C07A 4P2OC 4AIOA 4UT9L 1LD9A 3C09C 2OZ4H 4ZTPH 1GZHA 5GRJL 5BNXD 3DVIA 1IGML 4P4RA 2VN5A 1FL6B 3G6JE 3MJ8B 3OF6D 3ESUF 3S48A 3K6OA 4RAUA 3V5KB 4JO2L 4DTGH 1F86A 3J2PA 4Q6IB 1FGVL 3FYIB 1U8JA 5FF6B 1XB3A 2HRPH 3ZY7A 5DFWH 4HWBH 3X1EA 3IXTA 5T5FH 2VDLH 4I18C 1ORSA 5M94B 3EJUA 2Z7YA 3FH8A 1Q9KB 4LVNB 5ID1B 4ZSOE 3KYOA 2I9TA 4O2CB 5F8QC 2FR4A 4LCUB 2IAAC 3SDAC 2C9XA 1MW1A 5DHYA 4IBQA 2GW5A 1RJYA 3DNKA 3SIKA 5BUPA 1FI8C 4JE4B 4Z7VB 4WNSA 2FWSA 5CBEA 4EI5A 4C56B 4OCYH 4P5KA 4HJSA 3TV8A 1MVYA 1NCUA 2VDRH 4L1HA 4X8XA 2DYPB 2EZ0C 3E8UL 1IFHL 4ZPVA 2E4FA 3HHMA 4GB9A 1TF4A 2NXZB 3UIYA 1QSEB 5DRZA 1WWAX 5GGTL 3BO8A 5K9JL 3NEXA 4J4PC 5CBEB 4LSPH 4U1LB 4ZXBA 1R5IA 3L7FB 2UZIH 3VXSB 5IB5A 1FSKC 3T0BA 3D2TA 4OGQC 4DGIL 4O5LL 3FQRB 4PUBL 4QTIH 2XY1A 3ATDA 3L7EB 4H88L 3QUXB 1IAOB 2F19L 2WCPA 4KJQD 1P0SE 4JFTA 4QT5B 1OAXH 1KSRA 4JG0H 2X1WL 1JYXA 2XWBB 3A6BL 4NERA 4HWZA 2DLHA 3A47A 2EDQA 4L2LA 4DGYL 3WNLA 3RGBA 5CMAB 5F0JB 4BCZA 5EEZA 4XCFH 4RGOH 3TBYB 1PDKA 1DR9A 1B4RA 4R0LC 1NUNB 1NFDA 1P7BA 1IC4H 3CPUA 2APXA 5G4MA 3U9WA 2CKBB 1W91A 4X8JA 4GEJA 1WBXA 4R7LA 1A1NB 3CN4A 5CCHE 5JIQA 1BAFL 1S9VA 2BY2A 4KBPA 5EU3B 2IPTL 3BVVA 4PJ9D 4Y2DA 4L0PB 1B0GB 1HDMA 1I31A 1SZNA 5JW5B 1A6AA 1S7QA 4TNFA 4LU5H 1HCVA 1BAGA 2DMCA 3SDXE 5KN5A 3TJEL 4GLRH 4NN5B 5JLZB 4U1SB 2GBUA 4L4TA 3SE9H 3VGDA 2AI0L 4QCIB 4H20L 3ECWA 4FTVA 4Q14A 3C5SB 1YEDB 4HALA 4S1DD 5JNYA 4PIBA 2C3HA 5E94B 5IB2B 4G8GE 5IQ7H 3LNFA 2FTAA 4PRIA 1F1DA 2EACA 3Q01A 2VDMH 3HAEH 2BRQA 2CQVA 1PKOA 4YHIA 2EIEA 2IFFH 5D1ZD 3W39A 4BSVA 5FB8A 5KVFL 2IPKB 4JVPA 2DWDA 4WEMB 4L1SA 4LASH 1MFBL 1EVTC 4HKZB 1X5KA 3WKNA 1A7QL 4AYFB 5BCAA 1AD9A 4L8CA 3OSMA 2PP9A 3DVGB 3EGDA 2VXSL 3UMNA 1L3NA 1ULVA 2QSQA 1JXJA 5B1JC 1E27B 2G75A 1QQDB 3MNWA 2PCFA 2VLKB 4LPCA 3SYQA 5HP5A 2MNJB 3Q6FA 5D9SA 1VZGA 3FO0H 3H54A 3J8F7 2NSXA 2JOIA 2H8PB 2KZKA 3P54A 5AZEH 4AXWB 4F8PA 2QELA 4LOVA 3VN5A 4A2HA 4BDVA 2OR7A 4AYBA 4NUJA 3ULUH 1MF2H 5KTEL 5I1DB 5DYFA 5CGBA 2PW2A 4NQUA 2B16A 3W57A 5I18L 1UOVA 4DK5A 3T6VA 1OLZA 1P4BH 1JV2B 3T2PA 1A7PH 3LB6C 5FC9A 3WUWB 2DB8A 4O9HH 5F89B 4DPRA 3E6HB 5JDSB 1GTNA 4E2OA 1J9RA 3MA9L 1KGUA 4NENA 1HT6A 5A3ID 1BD2A 2XA3A 3A4AA 5IMLB 2GFBA 2Y2YA 4MD0A 4HKBA 3MNWB 5FGBA 5TDPA 5C0CA 3RTQA 5B4MC 3GXDA 3V0VA 1DQDL 4H26B 5D7LD 3VXRD 1NAKL 4KRLB 4DVBA 4HMEA 3HG2A 1V3JA 3BAJA 1PX3A 1JK8A 3WGVB 4WUUA 2FJFB 1RZGB 3SYOA 2IGFH 1WFUA 1A9VA 1M71A 4HHAB 5DGQA 3WEBA 5J11B 2IQ9H 4OIIL 3OSTA 3OJDB 3WNNA 1HOEA 2CJUH 4FXKA 2YC1B 4Z7WE 5L4JA 1UG9A 1IL1A 3U2JA 3U48A 4QRTB 2QQKH 4FNPA 4JDZA 1MJ8L 3ARDC 4PBWD 4QGYA 3EJQA 2G0LA 1DLFH 2LU4A 7FABL 2NYKA 1CE6A 1KB5L 1IMHC 2EIBA 2F7PA 5LG1A 3EAYA 3DGCR 4UILL 3LAFA 1Z1WA 3V5HA 3AREA 1KN4H 2Q7AA 3FT9A 3I2CH 2O5ZH 4AT6B 1IC5H 3UGXA 3R19A 4KAQH 2DI8A 3BKMH 1YEKL 3CVCA 2CJ3A 5DMKB 4H8QA 1AXSA 2DYSB 5DJ8B 4FQLL 3MRKB 1QVOB 4OZGA 1DJWA 1LEKB 1SJMA 1KACB 1FAIL 3IDMB 1LQSR 4PRIB 3UC2A 3VWKC 2ARWA 4UT6H 3PWNA 4JO5A 5J57B 4B9KC 1MXDA 2PR4L 3EXLA 3DC0A 3VXRB 4JY4B 4S1SL 1TMQA 5IJCC 4DGUA 1DSWA 1Y6NR 3EJSA 2R2CA 3P9LB 5EWIL 2JLPA 4PAZA 1HYSD 5JA8B 2ZJSL 3D3VE 5CFHA 3FQRA 5B1AB 2W38A 2B59A 2BSEA 5C0EB 4YSOA 5EIIG 1U8MB 1FFNB 1OF2A 4X8CA 5HHVH 3WJLC 3S8WA 3RURA 2LABA 3FU9A 1FHGA 3BT0A 2VC2H 4HUXB 4JGMA 5IQOA 4KY1H 4QRPD 1I9JL 2YARA 1AIZA 3H6JA 1ZAGA 1T22B 1N5AA 2E76C 3MOBH 3QG7H 3QHZH 1RZ8A 2FQFA 4D8OA 3NTCL 3QHTC 4M5YL 4S1RL 2EYTA 4JN2B 4JL1A 4PJAE 4BIKA 4HWBA 1PY9A 1U3HA 3LYRA 4MQXD 4XT1C 1IBFA 1EVUA 2ZUQB 1D2OA 1EFQA 1KZQA 1TFHA 2HKHL 4IBYA 4I87A 4B9IA 5AAWA 4OZIF 5HGDA 1T3FA 4LDEB 4G8GA 5DURB 4ZFGH 2F7LA 4PLKC 1XF5B 3HG0A 2DQDL 5EZJB 4KKAC 3UPAA 3GZOA 5CCKH 1G0DA 4N5UA 1WFIA 3FQWA 4TQHA 2BHFA 3ZKMC 4AW4A 2OYLA 4G1MA 1JXGA 4GRWF 1ZVYA 5FKAA 4ENED 2MQ3A 4RVBA 2P48B 3NA9H 2A99A 5K39B 3F05A 3UAJC 4NQSA 4NDMA 1DVSA 5FYJE 1FNEA 3VI3A 4OLWL 2O5YH 3P30H 3ZK0A 4XPGL 1D5RA 1OSYA 4Z7NF 4LQ1A 1MCEA 2GT9B 2ZUUA 3GIVB 1ZTXL 1W72A 2ATPA 2WB1A 1MFEH 4MYPA 4TPSA 5AOLA 3CTTA 5F70A 5C3LD 3UZEC 4PW4A 2OW6A 1JV5A 3EYOB 4OR1A 1NWPA 5E4IA 5FM4A 1JHLH 4FA8A 9PCYA 3QNXA 3OR6B 4AQ1A 4X6BB 2TRHA 3F12B 5T1KB 4X5WB 3LVEA 2P5PA 4OB5H 2NZ9D 5LCVH 2DMGA 1HXMA 3FPXA 4LEOB 5T1MA 2EECA 4OZFH 2VLRB 2EXSA 2VL4A 3QVAA 5KVEL 2FH8A 2O6DA 5G2NA 4JFEB 2F5BH 3UTZA 5TFSL 4FLHA 1HSBB 3DTDA 3SKOA 1ZXKA 3BH9A 2HZHA 2UY7A 3AT0A 3TURA 1FGVH 3QEHA 4XXCC 2W60B 1OAJA 2HT4C 3CFKB 3KNBB 2XN9E 1MHCA 2XWXA 4I1RA 4PLNC 1XD0A 2F18A 2WXQA 2BIIA 3NESA 4FFZL 4Q2ZB 2VLJB 1N6QH 3Q9QA 1OCZB 1HIMH 1YPZE 4E0RA 5HDBE 1SM3L 2KLTA 3H1ZA 3LXBA 5GIRB 3UJIL 4JHWL 5AZUA 3GJFB 5D4QA 1MCBA 2WIIA 4JPKL 3BC9A 3ATBA 4HOMA 2LVEA 4ZFZB 2FJFA 1M1SA 2V5TA 1GMIA 3ARRA 4BRJA 3EO0A 2N7BA 5JPNA 4UIMB 1D9KA 3VI4F 4L29A 1JNHA 3TFKD 4OBSA 4BELD 2V7NB 3HNTH 2XJLA 4WFGE 2JK5B 3V8OA 2XKNB 2ZWZA 2LU3A 3CFEB 3P77B 3QJRB 4K7PX 4TQEL 5CP3H 5TQ0L 5HD8C 2YQ3A 1WT5C 4JG0L 3O0LA 4Q6IC 4FXTA 2IEPA 3AS0A 1P7QA 2X4UA 4DKTA 2VLLA 1RHHA 1QWHA 3WTTA 1MOEA 4NO5A 1N12A 3ARZA 1ZS8A 3JT2A 5DJ6A 5MP6L 4CU6A 1BG1A 3ABKB 1PZSA 5I66A 5IVXF 4CC4C 3GSNH 5EOQH 3IEAA 4H8WL 4R4NC 1CLYL 3HB3C 3GBLA 3SO3C 1SVZA 2FDBP 1Z9LA 3B4NA 5D96B 5DDHB 2QGCA 4P46A 4KGJA 4R3SB 2OSYA 4OF8A 4PV8B 1TZHA 1NLBL 4XP1L 3FL7A 2HXAA 5D5MF 2NT1A 1VGEH 3O3EA 4G71B 3VXUA 2R69L 4LOUD 1PLBA 3L1EA 2CK0L 3FCTA 4F2MB 2J8OA 5GSVB 4ZW7A 3WY4A 4JQIL 1SDYA 1ED3A 4N90E 3SE9L 4JDEB 4R6UA 5EMYA 3AG3B 4HVBA 3QISA 3QW9A 1OGAE 5AW8B 4G5AA 4QTHA 4OF7A 3GJEA 3ULUD 1N8ZB 2YEZA 4LHJB 4NSKA 1B90A 4JHBA 1Q9UA 1MJJA 3N2JA 2O5XL 2VNCA 4KVPA 1UM6L 3S2CA 4JFEA 1B4LA 1HL9A 5AW5B 1JK8B 2D7MA 1A7QH 1SDDA 4ALAL 4XCNA 4H8PA 4TYUA 4Y4KC 3LH2L 1JZJA 1U21A 4HCFA 1BMWA 2KMWA 4WNQB 2MMXA 1U4FA 4JDTL 5M7QA 1I1FB 4MJHA 4MD0B 4N2HA 5DU7A 4JN1L 4A37A 3UCQA 1I1YB 3PP4L 3UOAB 4K8RL 5DUJA 3MJ9A 5FFOA 5BS0D 4BFIB 4BUGA 2H7WA 5GRUL 5HI5C 5D6CB 4HPOH 4OVVA 3T0AA 4FJ6A 3CFCH 3WUWA 5JXEA 1ZLEA 4K9EL 2FCBA 3PL6C 2D0HA 2JKNA 3OXRB 5I6XB 2CO7B 4NN6C 3HN8A 4UQDA 4UZGA 4NDMB 3CBJB 2APTA 2I24N 1KUMA 2X2UA 3NAAH 4WW2F 5D7SL 3PDOA 4YVNA 2YPVL 1MQKL 4J4PD 4KKPA 4ZOAA 3RPIB 3UTPD 4KOCA 2P52A 5IESL 2GIYA 1SXBA 2Z31B 3BIKB 3BXNB 3ZT5A 1TGHA 4J3WA 4A2GA 2FLRT 4LSTH 1SEQH 5JXED 3BIAX 1QQDA 2D9QB 4UQ9A 4HUMB 1RZ7H 1XF1A 5C7ZA 2IALA 1AI1H 2P49B 3DV4B 4OQTH 1B0RB 4JN2A 1G7LB 2P8PB 4CBZA 1G87A 3BN3B 1K8IA 2QZQA 3BKJL 2DWDB 1FC1A 5AL0A 5F0LB 2FT6A 1MHEB 4XXDA 3V7MA 2P5WA 5E6RB 2VUOA 5E6IA 2BH0A 4LAJH 5CXPA 1RZJH 4DZ8A 1BIIB 4N8CH 3REVA 5EG6C 4K3HA 3RVVC 4X6FB 5KVDH 5D2LE 4Z5RB 4RIRA 2MQ0A 1ROWA 2WYTA 3IDJB 5F9OL 4S0TD 5J6HA 2KZBA 2EXWD 3PQYD 3H4FA 1MHCB 1NDTA 2NTFB 3GJFK 1DVXA 3HR5B 4BZ1L 5SV3A 4KJPD 4PI2A 4EZLA 4MD5B 2NX5D 1PZ3A 2VE6B 1EIBA 3HG1A 5DK2B 5KW9H 5EEYA 4PH8A 4XN8A 2RR3A 4NZJA 1AS8A 4PU2A 5BUGA 5BV7H 3R7RA 2A6KA 3DSNB 1W0VB 1NCBH 2R1YA 2VZTA 2VMDA 1RULH 4J3VA 2PR4H 4WEUD 4PEEA 1DBBH 1CVSC 4QF1A 1YUHB 2R51A 3CIQA 4ZQKB 1R0AH 4OSUH 4PJ8D 5DRXB 3VI3E 2BY1A 2K0RA 4FQPA 2NY2D 4PY7B 5AOZA 2D7NA 3SBWA 4CC1A 4GINA 3VQMA 4UBDD 4PGEB 1BFVL 3KG5A 1MFCH 4OKVB 4LCCA 2VLJD 1EBAA 3MXWH 2R1XB 3G6JA 1A1MA 2B1HL 2BINA 2B4CC 3B56A 4KY1L 1KWGA 1WD9A 4I8DA 5FPIA 4UZSA 3JVFC 1JK9B 3CMOH 4X6CB 1MCDA 2WBJD 4TULH 2W92A 1UHVA 4FHJA 3ERXA 4M7LT 3CWUA 1FJ1B 4JZJA 2HKPA 1FWXA 3MJWA 1YJDC 5F7YC 3EDFA 1HHIB 1PX4A 3H53A 3CVIH 4I3RH 1V5SA 3ZYIA 4PRHA 4XVOA 3CDGA 2PYFB 2FT8A 3U30C 2F1BA 1PKQE 4X4ZA 3ULUE 3TOPA 2ZOWA 5INDA 5L4FA 4MQSB 5LDUA 1ORSB 1J1XL 4Y19E 1K4DB 1CTNA 1HHJA 5J7CC 2GTZB 5I19L 3EHBC 3UMTA 2OBGA 2Q6WA 1W0VA 5F7KC 3MV01 5HYJB 1MPAH 2K4WA 2FSEA 3X3GL 3BD5A 4AL8L 4OAWA 2BCKB 3D09A 3RWJA 1ADQH 1G6RB 4Q4EA 5ERWA 1TBAB 5JR1H 3CFDB 3P1VA 2E75C 3ISRA 3VDBA 1EPFA 2WZ6A 4URTB 2HFGL 4K2UL 4GH7B 3MOAL 4J3OF 1C47A 4OI9A 1NGQH 2Y0SA 2K6YA 4J3OH 4JFUA 1M05B 2N0KA 3VH8A 4LCIL 5KSUA 3AU0A 2KQNA 3BVTA 4HXAH 4E68A 2ZWKA 3VD7A 2OXHB 3QIWD 3U0WH 3O8XC 2MCPH 5KZCB 3ZJAA 2OI9B 4G9FE 4NC0B 1JWMA 4FG4A 2E6PA 3R06A 2VAAB 1HH9A 3MGOB 4Y4HD 3UTQA 5F1IB 3ZKNC 4WFGD 2PXYC 4AJWA 1ZGLM 2CE6A 3TBTA 2OMNA 3FUNA 2G3NA 4HG4J 2XN9D 1CT8A 2EDXA 4NHCH 4IBZA 2F5AH 5BQ7B 2F7OA 2HRHA 1WIPA 1W8EA 1LTXA 2B39A 2OM5A 2WNXA 5MEQA 3EH2A 3FT3A 3TH2T 1VTOA 2WTRB 1H0DA 1Z9PA 1URZA 3UDWA 3WGUB 1H3GA 2X87A 1UA3A 3FRPA 3PRZA 4JO3H 4MXQD 2PWHA 1MP9A 2XZCL 3BHBA 4HSCX 4PCYA 1KCVH 2A9CA 3SDCD 4JM2D 2MQGA 1XD1A 5FIEA 2V17H 3Q05A 1IC1A 4JDZB 2E3VA 3SQBB 4YK4C 4MJ4A 2FZ3B 4L3CB 2MNUA 3MC0A 1TSHA 4XOBA 3SQOH 3DMMC 1NWOA 4OCWL 2VJ8A 4DCQA 1TKWA 2OSLB 1PSKH 1U3HD 1XWVA 4NQED 1J9TA 1WGVA 3CWTA 3CGTA 1PYWB 4YBHA 3RX8A 5KBPA 2FEDC 1S78C 3G5XA 2PO6C 3DO4A 3IMUA 3NIFB 3HBPA 3SCMC 2IAMD 3RNQB 3WJMA 4N2KA 2AV7B 2F74A 4H5SB 8CGTA 5CHNB 4RA3A 4WNQA 3AS3A 2C3VA 1ZLVK 3DX1A 4U2YA 1YC7A 5CINL 4N20A 5KOVC 5HBBA 1S3KL 3EOYG 1N2RB 2A6DB 3SDXB 43CAA 2CO6B 5EO9B 3KPMB 1NGXA 1GGIL 4MCYB 1K2DA 5J13B 1D5ZA 3IE4A 2FECL 5C0IB 1AC0A 3FQNA 3WXWL 4AKOA 3MZGB 5KJRH 2VLJA 3KJ6L 3EJYC 4ODHH 4K94H 4B3VA 5DMGC 5CLWA 2X2IA 2K6WA 4DGVL 5IGXH 1MJUL 1P9MA 5SWSD 5SWZD 3ARGD 4HFWB 3W9DA 1EAJA 1UCTA 2HN7A 3HRZC 2GHWB 3MV7B 4W9HC 2J5WA 4ONFL 2D7TH 4LHQB 2VRAA 2OMBA 2YD9A 5L6YL 4KKRA 2QRDA 1PNDA 2EC9U 5D1QB 3D85D 4H1LA 1A9EA 4XCNB 4UAOC 5E6ZA 4Y7MA 3EUDA 1IGMH 1IKNA 3QORB 2ENYA 3KBHE 4WY7H 3GMQB 1AMYA 2WYIA 1NFDF 4UQCA 2J5LB 3RWFB 4PLJD 5I5MA 2VR8A 3GXTA 5DR5H 1W16A 2EDYA 3VD1A 4I7ZC 4DQAA 2A77L 3LKQA 2DJSA 3FB5A 3GPEA 5B3NA 1AHWC 3BWUF 3ARVA 5DZLA 3FCGA 1CR9L 2FJGA 2P1YA 3KYMB 1QN9A 2KERA 2NXYB 1YEGH 3L1OL 1FFQA 4X42A 1YRKA 5FYKU 3D9AL 1EAOA 5GSVA 1A14L 3FONA 4JJHA 4PR5A 2NR6D 5J12B 4AOFA 2GCYA 4X83A 5I1JL 4KX8A 3RIAK 1O5DT 1L3WA 4QYAA 3CZFA 4X80L 4U6VL 5HDRA 2XPZA 2FYYB 1JFQH 4WFFD 4Y4FD 4OCYL 2V9RA 3MNVA 2J7LA 1UZ8A 4YSTA 2A6IB 3WO4C 4EQ2A 3JQOB 2FSEB 3EO1A 3Q8AA 3DOSA 3DSFH 4YBQC 4TF4A 4DGWC 3HE7B 1P6WA 3RWGA 1NDMB 2WLNA 3CFJA 1HWWA 2OFQA 1IV8A 4IJ3C 4HD5A 1NAMA 4PV1C 1QACA 1RZ7L 3FUKA 3UTOA 4YHYC 2JJVA 4KZCA 1G7HB 4XVTL 4LVOB 2XZAL 5JORB 1BF5A 4MB5A 3ECBA 1EDYA 1ACXA 4OGAD 4V33A 3P73A 3LOWA 4UTBL 4Z0BH 4DW2L 4F15C 1EDHA 3QJHB 5J9PA 2WBXA 3BO8B 3S35L 3LQZA 1PBYA 1NC2D 2WN3A 5E2JA 1N59A 4YL9A 1ZV5A 5LUMA 2NYZA 4U0RC 5E00A 1GCYA 1IC4L 2BVUA 1HZLA 1F4YL 1F6FB 3GB7B 4GI8A 3TDHA 5F1OB 1U8CA 1XB6A 2IAND 1B6UA 3LZQA 1WO2A 2DL2A 1OP5H 4QJ5B 1JPSL 4HUCA 2IFGA 4M6NL 1DZBA 3ZMRA 4RESB 4OJYA 2IAMB 1EEQA 4C54A 4HIEA 1IU1A 4KMTH 3QUKB 3RVXC 5HJ3B 2JH2A 1A2YA 1C7SA 3QUXD 2BNQB 4Y5YC 3HVNA 3KM1A 3UAFA 5MERA 3UG3A 4KVCL 2Y7QB 1U3JA 2UY7B 4FQCH 2BP0B 1DFBH 4FQIL 3EGXB 3HAEA 1GZQA 4XMPL 5DHVH 4LARH 5C08A 2WQAA 4ZJ9A 5FKAB 3LNEA 5I23A 4BFBD 2OL3B 2EDRA 3WS3B 1GAFH 4RGNE 4XI5C 5C07B 1R47A 4MXVF 4PRPE 1YQVH 4YHML 5EUKB 1JTPA 2CUHA 3PXHA 2LR4A 3WIFB 2VITB 4YK4B 4PMFA 1T3FB 1BECA 1NLDH 2QADB 3MCG1 1MFCL 4J27A 2IG2L 4PJAB 3JVGA 3N43F 5ITFA 4NUPA 5LBSA 2X7LB 1ODUA 2Y2WA 1AIFB 5TJWK 2B1AH 3DXAD 4P5TA 1QOKA 4QHUB 4U7MA 1Z0NA 5H4YA 3T6WA 1II4E 1RZ8B 3GS4A 4KK9C 4TSAL 3I0WA 4XCFL 5E00B 5GGTA 1KNOB 5JHLH 1T5WA 1MF2L 4A6YH 3RDTD 3CU7A 3GDBA 1IT9H 1UT2A 3GI8L 1GPOH 2PW1A 5DSCB 4KZEL 4B9CA 4P59H 1R3JB 4RA0C 7PCYA 5I17B 4WTQA 2FQGA 3DROA 4LGPB 4FNLH 2PP7A 4JFDD 4TUOA 1JNLL 2NOBA 2E27H 4HIQA 2QSTA 4J23A 1A5FH 1JHKH 2YHGA 3FW6A 2HVJA 4CVUA 3W1ZA 1KN2H 1AP2A 2AI0H 5D7IB 5LWYL 2YWYA 4I8OA 2CBTA 1H5BC 4I1PA 4N4YB 4JFQB 5IQNA 4DP5X 2D0BA 3AU1A 1FZKB 1A0QL 4HOWA 5I1KH 3IFPA 4FULA 3WKQA 5KBNC 4RMWA 1EK3A 3CLWA 3ILPA 2WJ7A 4AYDC 3WLBB 2AJXL 1KTBA 2GSIA 5E8PA 4J8RA 1QPPA 4L1BA 1B3IA 5HDQL 2A38A 4XMVA 3FB8B 2NUTB 4IKNA 3TNNB 1QN6A 1BZ7A 2ZYSA 1JIBA 2H32A 1C5CL 4CGTA 5FO8B 5IYCP 2VUKA 2XQ0A 3RY6C 3HC4H 1RUQH 4G8IA 3PNWB 2WMPB 4GO9A 1M3IA 5FYJL 4JPWH 3Q2WA 2EKSA 1CTOA 4TNWF 4QRRA 3QRBA 3NZSA 5BZXA 4JAMB 3LJ3A 1JDCA 2ZTBA 1P5VA 2BSTA 2O5ZL 3L5HA 3LIUA 5EO1B 4ANVA 5HHPA 1LO2L 2DQGL 1XB8A 1SJHB 4FZ8H 4BK4A 2OXGA 5HDBB 2BFVH 2CDFB 2ED9A 4PGCB 3GS0A 4HLJA 3K81A 1ICTA 3FTZA 2GTQA 2HFEA 1E9OB 2ZUYA 1Z6JT 2R2HA 4X6CF 5HPMB 1CQKA 4FKKA 5JO5A 1ET5A 1I75A 1WFOA 3KS0H 3HE6B 3HI6L 1EUTA 1G9MH 4OJCA 4P2YA 5HJDA 5TQ2H 3S34L 3SGEH 4KXBA 4PJ8B 4LSRL 2P43B 2FQEA 3DXAA 4NZ8A 1BD2B 1UJ3B 4Z7OE 3ZHLA 4JPIA 2CGYA 5LXGH 3SB3A 1S9VB 3S3CB 3NFNA 3QNZA 4DFIA 3MRJA 1HNGA 2ERJB 1GOHA 2A4CA 4UOW0 2JMRA 2EE0A 2GSIB 4K5NA 5ERWB 4OU3A 4P9HL 1XX9C 1NGXB 1WITA 2B8OT 4B95C 3TBYA 4QNPF 3DDGA 2A74A 2NY3C 2CJUL 4AUUA 1GTFA 1N7ML 3R1GL 3QHZL 1LDPL 4ADGA 1ML0A 3SKMA 4CGUB 4CNIA 2IOIA 3LN5B 2VQ4A 1ZA6A 3CFMA 1M7DB 2DQFA 2YD8A 5J6GB 3CFTA 1KPRA 2QTVA 2I9LB 4JFFE 5T1LA 3EW3B 4RFEA 4XNZB 5I74C 2LAAA 1QRNA 5LGJB 1HVXA 2EH8H 5TDOA 3SKNB 3V79C 4U1KB 5C09B 1KBPA 3DVGA 3FFCD 1SY6L 4PJBF 1IC5L