2VJ0A

Crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, in complex with an fxdnf peptide from amphiphysin1 and a wvxf peptide from synaptojanin p170
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
246
structure length
246
Chain Sequence
b'ILAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVINIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
publication title Solitary and Repetitive Binding Motifs for the Ap2 Complex {Alpha}-Appendage in Amphiphysin and Other Accessory Proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 68
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vj0A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2vj0A02
2IV8A 1QN4A 2D0CA 2YMTA 1QN8A 2DWXA 1TGHA 3VN5A 2IV9A 2VJ0A 1QNAA 1TBAB 1OM9A 1D3UA 1KY6A 1P4UA 1QN6A 1TBPA 1MP9A 4PY5A 1QTSA 4ROCB 2MJ7A 1VOLB 1YTFA 1GYVA 3EIKA 2A7BA 1KYFA 4B0AA 1NVPA 1VTOA 1NGMA 1C9BB 4RODB 1VTLE 3ZHFA 3OCIA 1GYUA 5CN1A 4WZSD 1QNEA 1CDWA 1QTPA 1YTBA 2G30A 3HS9A 1QN5A 3OC3C 2D0AA 3H1ZA 1VOKA 1W80A 1QNBA 2Z8UA 4BCXA 2DWYA 1KYUA 5IYBP 1NH2A 1QN7A 5IYDP 3MNMA 1NA8A 5IYCP 1RM1A 1R4XA 1E42A 3HS8A 1IU1A 1GYWA 1AISA 1QNCA 2E9GA 1JFIC 1QN3A 1PCZA 1QN9A 1KYDA 1PZDA 3ASMA 1KY7A 4ROEB 2D0BA 3ZY7A 1B9KA 5CN2A
chains in the Genus database with same CATH superfamily
3VRIB 2AABH 2FGWH 2TAAA 4UAOB 3UO8B 4AENA 5HI5D 3LXCA 4UDTB 2A74B 3C6LD 5DJ6A 1J8HD 3LQZA 1BJ1J 5AKVA 1J0IA 3U0WL 5GGQL 1ACZA 4MJIA 3SCMB 1Q38A 2Y6TE 3BLPX 2BFVL 3PDOA 3IDNB 4PJ7B 4YSPA 1EZSA 4AW7A 5JXEA 1RZIB 2X89A 4L3CB 2ZF9A 3THMH 4IJ3B 3VAEA 1BQHG 3GRWH 1CFTA 4U0RB 1IC7H 3RTQC 5TE4H 3ECUA 3RPIA 1G6RL 1YEGL 3WTXA 1WBZA 3KLQA 3P9LA 3L1OH 2QMJA 1K3ZA 2H26B 4XWGL 4EZLA 4X42A 3GM8A 3CC5A 4LVOB 4BKTC 2WZPA 4LHUD 5M94B 3JV0A 5FHBH 4F7EA 1UVQB 3KGRA 3QXDB 3VFRA 1NCAL 4O02A 4C4KT 2IBZY 2W60B 1N2RB 3SDXB 3TBSA 5JHAA 1PSKL 2QGDA 5L4IA 4D9RE 2CUIA 1RUKL 4J28A 3UYRL 1MFCL 3FQTA 4ORZC 1EAQA 4WHTB 3RSMA 3MLSH 4Q9CA 1ID5I 3TT1L 2JKSA 4KDTA 3M86A 2HKFH 2BOCA 3C87A 3JV6A 2HKHH 5AOMA 2IWFA 2G30A 2A1WH 4JY4A 5CP7B 1QBBA 3APCA 3KNBB 1OP3K 1T5WA 4U2YA 2WYIA 3S4SA 3IJEB 4XVJL 1KTRL 1PVSA 2IQAA 2VUOA 4OAWA 5GRXG 3S2CA 2IANB 1RCYA 4MJID 3LH2H 1NC2A 4P2CG 3ME0A 3ALXA 4DESA 1MFBH 4F57L 3C5SB 4LL4A 2MTPA 5E56A 3X11B 3H1ZA 2OSLB 4ZMXA 1ZGLA 2Z91A 5JXED 1VOKA 1JUFB 2X89D 1Z0NA 4WO4B 4EAJA 3ILPA 2XG5B 3BWUF 3QORA 3M46A 5B39G 2OYKA 5KWYC 1A14H 2NZ9D 1IC4L 3BP7B 2P8MA 4MNGB 4D0CB 4AM0B 5GGSA 3X1GA 1ZHNB 1H3VA 3PJNA 2C9AA 1TDQA 3GRWA 1ILUA 3HRZB 4JANA 1KN4H 4UM8B 2OMNA 4NSKB 1OAJA 3U2SA 2GBTA 2CSPA 2WZPD 4D9RD 2EH8L 1KT2A 2CO1A 4ZW3A 2P5WB 3GHBH 3KWWB 1F3JA 4YDLC 3A6BL 3KM1A 4MS6A 1XAUA 3ARGA 2DIJA 2JKIS 4FQXA 1XF5B 3DI3B 2P8PA 1OOAA 3OLPA 2CJUH 5LLIC 2E7LC 2H0FA 2FIKB 4OKVB 3NBNA 1A3LH 4LCCA 3PNRB 3ESNA 2RFXA 2DYSB 2Y07H 3F5WA 4XO3A 3SQRA 3AUWB 2AK4A 3B9AA 4L8DA 1LYQA 1ET7A 4YAQA 4CGUB 2HZSA 1FZMA 2BERA 1UM6H 2DEYX 4X6CF 1A5FL 5L8LB 2XZCL 2V2TB 1ZWIA 1KIPA 2BP8A 3KMDA 1ZIBA 2GSGB 3M17B 2AV7B 1DBJH 4XC1H 2NYYC 5ECJE 5EOQL 1MCDA 5JOPE 1LXMA 4MD0A 4CVWA 4AVHA 4CW1A 4D7RA 2GK2A 1Q9KA 2X2HA 4YHZH 1O0VA 1NC2D 2O72A 2VKWA 2YR3A 1BM3L 3OXSA 4I0PC 4OD1L 3QIUC 2PABA 1JK9A 5HYSG 2L7JA 2B7DT 2VSCA 1CFNA 4GRLD 4W70A 4N0UB 2AANA 2OX5B 2DWEA 3AU1B 4A2GA 4WI3A 4FOMA 1FV1A 1CF1A 4Y8DC 4KX8A 1SOKA 2PW1B 2Q7YA 4L29A 3B9KB 2B2XL 3IYLW 1H15A 5JXAL 1ZDSA 3CCHB 3DIFA 3QQXA 2ZXCA 1TUPA 5IB3B 4ODBD 3P3UA 1CU4H 2V7NB 2W9EL 3FQUB 4JN1H 3ARGD 5D6CA 1BQHA 1HEZB 4B9KC 2D7QA 4MDRA 1ZK9A 2XBZA 5IBLC 5CEZH 3WIIL 3QDGA 3LNEA 3TH3T 1JE6A 1OT4A 2O5XL 3BAJA 3LVTA 3OZLA 1PS3A 4M02A 1CDWA 4YHML 2AK4D 3CQPA 5F7YC 4M93B 5I1JH 1Q9OA 4MAUL 4C56A 1SHMA 4D9LH 5GRVK 3EHBC 2CHXA 1MREL 1TF4A 5I74C 1TVBA 2J8OA 5IR1B 3N42F 5J6GA 2F7OA 3S3CB 3VMNA 1RP8A 3U9PH 3COOA 1A3RL 4HS6A 1UJ3C 3GJFK 4DVBB 1MCRA 3QWRD 1SUHA 5IREA 3Q06A 3UC0H 3CSFA 4ZW6A 1D9KB 2PCPA 5D96B 3ZGIA 1N6QH 4FFZA 3OAZK 4KVNH 4LGRB 3CN1A 1PGRB 4TSAH 1FAIH 1O6SB 3CSYB 2AJ3A 3EFFB 2VDLL 3QJXA 4UT9A 4CADB 1TT6A 1TZOA 4GW5A 2WKGA 4QJ4B 4OB5L 5IB5B 3B37A 5KBLA 3T0XA 2VERA 4K3DH 3FN0H 3D12B 7FABH 2NNCA 1SBSL 1KXQA 1KCRH 4HIEB 4HJTA 4WNJA 4ZXBD 1E30A 1LE5B 1TZAA 3ZXAC 1JHTA 3HI5H 1NMAL 1GJWA 2FJGA 2B0SH 1T20B 3WD5H 4KQ0A 5E5RB 2C9RA 1CK0H 1WP6A 7PAZA 1A7NH 3QDGD 4LZKA 1BQUA 4ONHB 2OS7A 3QS3A 3QR1A 3OJ2C 3O9WC 1QW9A 3VE0A 1HXMA 3RHWK 4XMXA 1QFWH 1BYPA 1QHQA 2K1MA 2UV3A 4PRIE 3WY3A 3KZ8A 2AZUA 1IMHC 1E5CA 4UAHA 3TM6A 3V5KA 4AV5A 3ATAA 1ONQB 2C4XA 1YN7B 2R0ZL 2UZXB 4YO0A 5CEZE 3EGSB 2R4RH 3RNKB 1AXTH 3CHOA 1IT9L 2C26A 4OM1L 1NBVL 4TLUA 4U6TA 4UCFA 3D3VB 2I60L 4GQRA 1P7QA 4XO9A 3WFHB 1QEXA 1WDAA 5KSAC 4PJGE 1TIUA 5I5IA 2L7QA 1T5XA 1F5WA 4QYOA 1FNLA 2V9RA 5GS3A 1A6AB 1CXEA 3G9AB 1YEWA 2HKAA 1UTDA 1WJWA 2Y4SA 1MW2A 2XY2A 4TQEL 4BUQA 5BS0A 2X42A 2H8PA 3U0TA 5IMOA 4JJOA 5FK9B 2YXVA 5DZLA 3WMPA 1U58A 3PLYA 4FABL 4NHUA 1NCCH 5HYSA 2D3LA 3TT3L 3OLIA 2A99A 1UWGL 4RZCA 4R97B 5J8OA 2VZVA 5C6WH 4MYWB 1I9RH 3W57A 4WEUD 3U4BL 2HRLA 4AITA 1AGBB 5T1KB 3P0GB 5EORL 2AV1B 4RX4D 3UMNA 1UZ6E 5C0JB 5I15L 1JPEA 1MZZA 1DVQA 2GB2A 4K2UH 5LB1A 5CEZD 1CXLA 5DO8A 1TETL 3FO0L 3JUYA 4LCYB 4GXVL 1DZBA 1VEMA 4HAKA 4ICXA 4O5LL 4GXFA 1EEQA 2F1BA 2MFNA 2O6DA 2AKRB 4YDIL 2QREA 4A7UA 2XHNA 1G5AA 4WY7L 2F2HA 5HSHA 2YUVA 5AAMA 4P5KB 4UOQA 5JIHA 1J05A 1ITBB 4QT5A 4FNUA 1FE8L 1NC4B 1IV8A 5HHNB 5IESH 2MZ8A 4B9ZA 4FKKA 5SWZE 1MCIA 1OCOB 2NY3C 3VXQA 2G3ZA 3LSOB 2HH0H 1HKLL 1R19A 4LCWE 5EO1A 1JERA 1BGXH 1MJ7L 4MGXA 5DRZA 4YXLH 5I75B 1XF2B 1SHXA 4XPAL 1NJ9A 4NEHB 3RX8A 3P2DA 5IROA 3K6FA 3HR6A 4F2MA 3HEIB 1R4XA 3VGEA 3BKML 4LO9A 5I1KL 4HOZA 3CFQA 1BG9A 2ZTBA 4JDVA 3BEVA 2FEDD 1VFBA 5EPMB 4LCUA 3S96B 4CSTA 2A6DA 1QNCA 2YC1A 1J87A 2Y1AA 5DYFA 3U30B 4XC3H 3IDGA 4LHJB 1VPOL 3P69A 1FORL 4YIQA 5H4YA 3U7YL 4JQVC 2PLTA 4GLRH 5ADPL 1X3DA 3V0HA 3H0TA 3IN2A 1HZHH 2YFOA 1RUKH 1IRAY 4XCYA 4DGYH 1MFCH 3WNJA 3STZB 4UTAL 2Q3AA 2YEZB 2MHAA 4PRNA 1FFQA 4GFTB 4AENB 2IOMA 5HYQA 1PLGH 1CTMA 2CR0A 1HCZA 5DJ6B 3LQZB 2DQFB 2XRAL 4LL9A 4MJIB 1M2VA 2VXSL 4WZ9A 4YUEL 1Z9PA 2FEEI 3PDOB 5DQDL 4D8PA 1ZK5A 1F90L 2C3VA 2CRIA 3Q7JA 4LCWD 1XR8A 3UAJD 5EBMB 2FBOJ 1TG8A 2ZKYA 4WI6A 5FGCE 2WXHA 4EVNA 4PLJC 1CFTB 2OTUA 3RPIB 4H8VA 2ENQA 4F58H 1NPUA 3PREA 3QUHA 5AG8A 1WBZB 3P9LB 5IROD 4Q89A 1AACA 1ETZB 5CSZA 2OR8A 5E1IA 5JA8B 3UZEA 3CZKA 1OAKL 4NT6A 3VW3H 1G7PA 2W8CA 3L5XL 3MLYH 3BPNB 3OR7A 5J12B 3VFRB 4BZ1L 3ZHFA 4O02B 3HVNA 2EEFA 3NJGA 3TBSB 3NVQA 1G6RA 3UCRA 5HHVH 2D2CC 4ICWA 5HD8C 4YDMA 2R1WA 1H5BB 2HJLA 4FF9A 3A6BH 3FQTB 2YD7A 3FBKA 3RKPA 2DKSA 4XOCA 1LO0L 4ONFL 1E8YA 1U8PA 2WXLA 2BOCB 1DFBL 3JV6B 3D30A 4LPTA 3N41F 3ZKND 4JY4B 4MHHG 5HDRA 1T5WB 3S4SB 1L0PA 2FCBA 3NDYE 2BO0A 4OAWB 1HE7A 5F97E 1DQJB 2BZDA 4WO0A 1E40A 1NC2B 4R6UA 3ME0B 4DOHE 4OLYL 2Z7ZA 4QKTA 3DJRA 4JFEA 4Y2NA 1ZGLB 3V55A 2HCZX 2Z91B 3HS0A 4BD4A 3MBXH 3ILPB 5FW6A 3QORB 1KYUA 1MJUL 1EMTH 4ZX3A 3CSTA 3WJMA 1MWAL 1NH2A 1QYGH 1GTFA 1SJHA 2DYPD 2P8MB 2BJMH 2BIHA 3LZNA 5K39A 5GGSB 3T3PB 3MJ8A 3X1FA 1FLTX 4FNTA 2AJUH 3L3JA 4JANB 2HJFA 1T0NA 1EERB 3U2SB 3KHQA 1X5MA 1FH5H 2FBJH 3NH7H 1KT2B 3PUCA 5KS9E 1F3JB 2B2XH 5F7MC 3RBGA 3PPSA 5IFAH 3ARGB 2BHFA 4Y4FC 4FQXB 1KC5H 2UZPA 3G7TA 3LNDA 2P8PB 5DC2A 4Z7NF 3V0FA 1E4KC 2RH0A 3ARUA 4W9CC 5LG1A 3NP4A 4Y5YA 5IK3A 1SMOA 4LCCB 5MI0C 5GGTL 2RFXB 3CLWA 3F5WB 2VR9A 2FO4A 5IGXH 1MJ8H 3IU3A 12E8L 5F6HI 2AK4B 3WIIH 1BMGA 2DQJH 4L8DB 4W68A 2E9WA 4YAQB 1MQ8A 1FZMB 5F7DA 4H8QA 1ZWIB 5DLMH 3RVVD 1KIPB 2BP8B 3EGDA 3SIKA 2XN9E 1BLNA 1IO4C 1WCBA 2YARA 3BGFB 5MEPA 3GMLA 4MD0B 4KI5F 2X3AA 3F12A 1Q9KB 4CMHB 4WSKA 4JFED 1I3RB 3OXSB 1DL7L 4YDKL 4X6FA 5DDHA 1JK9B 1IUZA 1WRFA 1JDCA 4TUUA 1S78C 3MRGA 5E4IA 5JR1L 3B6SA 1CFNB 1CLZH 1B4TA 2DWEB 3IWVA 5F1KC 1DQMH 3ZR6A 1DIZA 5DVNA 1FV1B 4HWNA 4W4OC 4H1LA 2Q7YB 4L29B 3ZK0A 3FJTA 1H15B 2ICWA 3CGTA 3DIFB 1VFOA 4WFEE 3V4UH 2FUQA 2IPUK 1F8TH 4Y89A 3FQNA 1HK6A 5D6CB 1CYWA 1EAOA 1BQHB 2C5DC 2QMKA 1X6LA 5MENB 3QDGB 3F00A 2P5EE 4XE0A 3HKFA 2JJSC 3AS2A 2F61A 4IW4C 2JQMA 5C3IA 2K7QA 3HS9A 3V8CA 2P26A 3O6MH 1Q9OB 1FNFA 1QI5A 1MQKH 4C56B 1HSBA 3KGTA 4S0SD 1JTPA 4X9IA 4TPRL 5JPMA 3QO1A 5AAWC 2J72A 5I0VA 1TVBB 1A65A 1R3IL 1BECA 2IDTA 1SJMA 5J6GB 1DVFD 3K4DA 3RWJA 5JNYA 4HS6B 4X8JA 4PJDA 1PX4A 4N6RA 4PVMA 4F91B 2OMUA 2YOAA 4RGMB 3SO5A 1S46A 3EBAA 4ZW5A 2PCPB 4BGDA 5IYBP 4PJDE 3N55A 1NIDA 5INDB 5EU5A 2AJ3B 2XWBA 1ITCA 3PF2A 25C8L 3OKMA 5DWUL 2HX8A 4WSGA 4X4XA 4GW5B 1C1EH 2D2OA 3TN0C 3NRPA 3V6BR 4EDWL 4JS7A 2GPZA 3VX1A 4JPVL 4HC1L 3S3JA 5KVEL 3L9RA 2P5ED 4RNRA 2CWRA 3PPEA 5AVXB 4LLVA 4IRJC 4UILL 1JHTB 2OV0A 4LARH 1ZXKA 4A2EA 2FJGB 4FHKA 2CMRH 4HCGA 2GFBA 2WK2A 4PB0H 3B7RL 4R90L 3TT3H 2OYLA 4AJVA 1UWGH 1FGVL 3DBSA 3ET9F 4K3JH 3T1FA 5IOPA 3DGCR 2WMPA 1HXMB 1KLFA 2A0LC 2Z8VC 1CPUA 4U4BA 2JKRM 4D2NA 5LWYL 1TQSA 3KXFE 5DO2D 4NB7A 5EORH 3V5KB 3APMA 4H44C 4MA8H 1EFXD 1A3QA 4PJGF 4YO0B 4G72B 4ACPA 1IGIH 1HH6A 2NOLA 4O5LH 1BWMA 1DJGA 4M7LL 1ZVNA 4WY7H 3N40F 3GMNA 2FX9H 2FUTA 3IKCA 4KWUA 1HH9A 1EZUA 2VZ3A 1AZRA 4YHOL 5B3JF 1AQMA 1T5XB 1DSYA 4N6QA 4OJEH 4NRXA 6FABH 3IDYB 4APXB 7PCYA 1CBJA 3CPUA 3V9EA 3F6LA 2AEIT 5D7JD 4PIBA 1ZMYA 1IAOA 3DHPA 5KBDA 2VISA 3AM8C 5E6IA 1UYWH 3W11C 3X3GH 3U0TB 2H8PB 1KDJA 1C7TA 3LHPL 3QCTH 4JHAL 5BO1L 5BS0B 5IMOB 3MOBL 1MCJA 4PP1D 5K33A 1NCIA 4XNQA 2NQDA 5GJSL 1U58B 2E7CA 4WI9A 3U4EA 4NHUB 3BVDB 5HYSB 2BNRA 2X0WA 1NUNB 4XX5A 4RZCB 3OZ9L 5J11C 1JWSB 2EUZA 3EH5B 3KL3A 4PJ8C 3U7YH 2XXMB 4KAQH 4XVOA 3KXFD 3L4UA 2VLJA 3PDDA 2PYEA 2TRHA 2YD8A 4L0PB 3QZLA 4XP6H 3IDXH 2WXQA 4B97A 2YXWA 1GRWA 2WBXA 2PWHA 4AGPA 4HZAA 4UMSA 3CK0L 1MI5E 3WO3B 1J05B 3NIDF 4QT5B 3T3MF 4IJTA 4JK0D 2BIIA 5LDUA 5EU7C 3SO3B 1LVEA 1T2JA 2DWYA 4NN7C 5HVHB 1JXGA 3T6ZA 3VXQB 1JPFB 5F21B 1KDIA 4GIOA 4H8UA 4PCYA 5EO1B 4Z8FL 4JY5L 5DRZB 1IVLA 5DMGC 1NJ9B 3S88H 4BZ2L 1XXDC 2NY2C 4F2MB 1HCYA 1IZKA 1CR9H 4JDVB 3BEVB 4K0OA 3MV7E 1VFBB 5E6ID 4LCUB 3SSGA 2A6DB 3QEUA 2YC1B 3WKYA 1MFEH 3IDGB 3LKSA 3MJGX 2A9CA 3C08L 4MMYA 4YIQB 3WS6A 4O9HH 3T8VA 2OQJA 4XMWA 1I9EA 3IK2A 3WIHH 3H0TB 4PV8A 3T8XA 3GBDA 1FL5A 3MACL 5B7MA 1DQQA 2D0CA 4HWEH 4OGAD 4XCYB 3LJ3A 2VLJD 4JO1L 5IQNA 4DTGH 3T0DA 2PYED 1ESOA 2MHAB 4PRNB 3GXMA 2WQSA 1MI5D 3I75A 4X80H 5HYQB 3GIVA 1DFBH 3PAYA 4KQ4H 2DM7A 4L9LA 4EZJA 4GIPD 2ZOKA 1M2VB 5AWNL 3SDYL 3HMWL 3KEHA 3TZVD 3AWEA 4D9QD 4D8PB 2C3VB 1XSKA 3WXWH 1CBVL 1TBPA 1KIRA 3MLRL 1XHHA 2CO3A 4G8FA 1E6JH 3PGDA 4YPGA 2J4WL 4G6KH 1ZJBA 4N1HB 3I3EA 4EVNB 1CTOA 2G4GA 2OTUB 3KPRE 2EE0A 4EI5C 5D7IE 1T1XA 2DYPB 2P47B 5ACZA 3V6FA 1CUOA 1MJUH 1XV8A 2C9UA 3ARBC 4E41E 1MWAH 1VENA 5CSZB 2UY6A 2FQFA 1XGTA 4WAFA 4PS4H 1AGFA 4NT6B 5KVDL 1VSCA 1G7PB 1RZPA 3RPKA 3VMPA 3OR7B 3K2UH 3N9GL 4D0DA 1S9XA 4M3JA 3VXOA 1ZVYA 3RZCA 4FYRA 5D4JA 1G6RB 3WFCL 3UPRA 3LV3B 4HK3J 2R1WB 3L3OA 2HJLB 4OCSL 1WTLA 2WB7A 5FYLL 4EOWL 2FKMX 1YQVH 3CG8A 5J89A 1U8PB 5CR1A 4FXLA 4LNVA 2NY4B 5F7KC 4BZ1A 2CLZA 4QRUA 1FLRL 3WIHA 4NNYB 5HYIA 2ZCHL 5D7LE 3RJDA 3L16A 3K1DA 1B2YA 1NGZA 2C8NA 4H8WL 4CJ0A 2NT0A 4M43H 1RKRA 4TRPL 4DPBX 2W80C 1JDYA 2B20A 4JFEB 3HS0B 3T5WA 3FXIC 2WQVA 1C8PA 1T7YA 4KZ0A 5SWSA 3WJMB 5I1GH 5SX4H 1UL7A 1SJHB 4RWYL 2Z4TA 3TA3C 4MX7A 4UQIM 1YQ2A 2W81C 5AZEH 1WAAA 4KMTL 3MJ8B 4YSEA 2FJUB 2WUCH 5KS9B 4HX1A 3L3JB 1KTCA 2HJFB 1T0NB 1XCQA 1QN9A 3GKWL 1TEGA 1AIZA 4HJ0C 4KKAD 4N85A 3SDCD 3DUSA 1MWAA 2EDWA 1MAML 5DJ2A 2VABA 4G7VL 1XGYL 3LB6D 4U3XA 1FZJA 4Y5YB 5IK3B 1MOEA 3IMSA 1TTBA 5I6MA 3REVA 1YPZA 4LK4A 3F3HA 2F5AH 2FO4B 3GMPA 5CEXA 1FYTE 2Q6WA 1D5MA 4FNPA 1P1VA 1FBIL 3BDYH 1HEJC 5GZOC 5F7DB 3OMNB 2X6CA 3EGDB 1BLNB 3U79A 1WCBB 5TDPA 4B96A 5MEPB 1XVSA 2RA1A 3GMLB 5C0NC 3BN9D 3F12B 1RUPH 1DVFB 2YAQA 3CU1A 5GGTA 1KN2L 4FJ6A 4IOFD 3NQIA 1TQBB 1RVFH 3PWVA 3QZMA 4HH8A 1BZDA 2WGXA 4X6FB 5DDHB 2UZYA 3PV7A 5FA4A 3BFQG 4UQ3A 3MRGB 5ESVA 5KTEL 5SWSD 3DVIA 1VF5C 3B6SB 1EHLL 2NY1D 3TVMD 3JWDL 3HTLX 1HI6A 1P6WA 4Q6IC 3VSUA 2VWEC 4KRPD 2VOTA 1XIWC 3C8HA 2C1OA 3P2TA 3BRFA 1BBJA 1YJDL 3Q2VA 4CJ1A 5FWRA 3QJHA 1AR1D 2ICWB 4JG0L 4GYBA 1Q94A 1RZKC 3N5AA 3O81A 3EZ8A 2DI7A 2BVTA 4HJHA 3MGAA 1AS6A 3FQNB 1Z9OA 4OT1L 2GABA 3V5DA 4WUUE 1OGAE 4IKLA 1FYTD 1NGPL 2H3NA 3O6KH 4YLCA 5ISZE 4UU9A 3DJ9A 5F7EH 2Q7NA 4DKTA 4KI5C 4HH9A 4F5CA 2EO1A 6CGTA 1N0LB 4R90H 4P06A 1PEZA 2VDQL 3BJ91 1P69B 5JW4M 2A9NL 4QNPE 1HSBB 4G7SB 4QAWA 4BSJA 1EFXB 5JPMB 4GW4A 3QO1B 1F97A 1MIEL 2Z0FA 1PD6A 1LO3L 3RWJB 4L3AA 4ACTA 4X8JB 5AUMA 4PJDB 5FDWA 2YD9A 4N6RB 2C9PA 2OMUB 2EE9A 1GZHC 1UT9A 3RVXC 3DK2A 3CFEA 3IMTA 4ODTL 1J1OH 1Z0MA 2WINA 4M7LH 4C58B 1G43A 1GCYA 1NUFA 4K7FA 5JHBA 5EU5B 4IGBA 2XWBB 1ROCA 3VGHA 2VLKE 3LKOB 5JIQA 1WH0A 4X4XB 2D8KA 4U0QB 1IJNA 5DU7A 5A3ID 5F0MB 2KLRA 3P77A 1U2YA 4Y19A 1V8HA 5D70H 3QYMA 2P9RA 3L9RB 2R0LL 3NJMA 3SE4C 5IQ7H 4RNRB 1KIUA 4LLVB 1O7VA 2VDLB 1WWWX 4MNQA 1QNZL 5FFLA 2GFBB 3IDUA 2A73A 1SFHA 4PVLA 3NSCA 3RVUC 3ZJAA 3BZEA 1DVSA 3T1FB 5IOPB 3R4DA 2WMPB 1KLFB 2UUDH 3OBAA 4ODHL 1CJYA 4X98A 4LPVA 2O5YL 3ZL4H 4A1RA 2AEPL 4UUJA 2EP6A 1HH6B 1Q90A 1ASOA 1TENA 2R23A 4J3OG 1M71A 1CVSC 4RDQG 4XXDA 5IW3A 4YBQC 2EIEA 4Z7VE 3CK0H 1HIMH 1URZA 3HOGA 5AOZA 3TEWA 3IKCB 5BOJA 1HH9B 2OMXA 5GGUA 4QRBA 2VLKD 3UEQA 4P57A 3VFMA 3L9YA 4MVBD 5I17A 1TJIL 3MJ7B 5AW3B 4LEEA 1NTDA 3I9GH 4LQ1A 4ELKA 2NWVA 3LMJL 1UH2A 1VGEL 1JHLL 2DQDL 4HZLA 1IAOB 3QEGH 4RODB 2VISB 5E6IB 2CAKA 4KMQA 3D34A 3D7PA 1PZ5A 3IBOA 3PIQA 4K15A 3GHPA 4Y19D 5JDJA 2VN4A 1O9WA 4CSPA 3CBKB 4I1RA 3O3BA 4XNQB 1BZOA 1ZHLB 1BCIA 3U4EB 2DMGA 1THCA 3CHRA 4NJ9L 4HJGA 2BNRB 1YMHA 2WAQA 3ABGA 1FF5A 3BIBX 3MGTA 3PL6C 5DMKB 1WIPA 3C08H 4I1PA 3C5ZD 3OKOA 4APQA 3U9UA 2Z7WA 2VLJB 2CNYA 1ZV2A 2PYEB 3HC3L 3KGSA 5J3HC 5HSFA 1M05A 4JO1H 4ZO9A 1E8WA 4JEGB 4FEIA 3D2TA 3HNSL 1RJZA 3ZZQA 4DULA 3DTXA 3TLRA 5LO7A 5AZ2L 4RRPG 4RZKA 4UQBA 1WEJL 4FG2A 4YR6A 4C8XA 3MUHL 1VDGA 2OOYA 2Z93A 3ARDA 4EJYA 2QELA 4BWWA 4GQPH 4J3OH 3LQAL 3H9HA 2J88H 1BVLA 4M1DL 4DKDC 4Q97A 3QAZC 3NFSL 3J7HA 3HPLB 4GO9A 4WK2B 3IF1A 5J06A 4TYUA 3Q3GA 2QHLA 2X6UA 4L3EA 1B0IA 3QEUB 4IRSC 5E2VH 4HCIA 3ABMB 1HILA 4E36A 3LKSB 4PRHA 2XKSA 3ROOA 4MMYB 1MFUA 1D5BA 1J1PH 2ZPKL 4MAYC 2YH5A 2V9QA 3N9GH 2OQJB 1S4IA 4EAKA 1EEYA 4MA7L 3G5VA 1D7FA 4N0FA 1GGCL 4O00A 3DA0A 1AS7A 1FL5B 4FERA 2CG9X 4PV8B 1DQQB 4G3YL 3T8XB 3DGGA 3DO3A 3WFCH 4APQD 1ID2A 2WKOF 4RWHA 1TVHB 4M7LT 5T5NG 2CQVA 1QBAA 3EJPA 4AZ8A 3AT8A 3I75B 4OZGF 4RDBA 2DLFL 4NQDA 2YZ1A 2AHIA 1G1YA 3GIVB 2X9YA 4NKDA 2QR0A 3DUUA 4WFGE 3M1CA 5ALBH 2CR3A 4KITB 1UD4A 4L9LB 2FVNA 4JHBA 2ZOKB 2C4FU 5HP5A 4U4IA 4LFHG 2VZ1A 3HG1A 4QGTA 2OXHA 4XN8A 5D7IF 4HU8A 4H8WH 4HT1H 1UXSA 1KIRB 5IEKA 3AMLA 4G8FB 3PGDB 2QQNL 5CLTA 4YPGB 5A2AA 1P4BH 3T4NA 5F6HJ 2QHRH 3VWKD 3SKJH 3K6SA 1MH5A 2F7LA 3VD4A 5DJZA 1T1XB 5ACZB 3V6FB 3ZDXB 1BF2A 2APTA 4NN6C 2ED6A 3KDMA 2UY6B 4GG6F 1XGTB 1AGFB 1H6UA 4L3ED 2J8HA 4D0DB 1S9XB 4PRHD 3VXOB 5KANI 3RZCB 3MBEA 3GKWH 3VG9B 5AFAA 3IB4A 3LXUX 4PM1A 4UIKL 3UPRB 3RDTA 3L3OB 1IVTA 3FPYA 2DIBA 2WLLA 3ZE1F 1XGYH 4G5ZH 3N1MC 4QXGL 3L1EA 4XCCH 4I8OA 2APWA 1D7CA 1D5RA 1OPOA 4WFGD 2CLZB 4QRUB 4JRFA 4I2XE 1EUVA 2XWJB 3ARTA 1JHKH 4NQDD 4PJIF 3MCYA 2EEBA 3MLXL 5JPNC 3A4FA 5ABDE 1NGZB 4PGDB 2A9AA 5IHUL 2QDWA 3W2DH 2IWEA 1V10A 3GSQA 4HHWA 2X53A 3DDFA 1N8ZA 3HA0A 3QZNA 4AW4A 5I6OA 4ETQA 3RWEA 2IH3A 1KBPA 4NQCE 3I84A 3RFZC 5SWSB 2NY1B 4HULB 4WNQA 3MCG1 1NCWL 1E2VA 1HWWA 1MNUH 5KTEH 1KJVA 4MX7B 3DMMC 4OKDA 1NFIA 1DP0A 3KWTA 2HT2C 3R1GL 1AR1B 1QRNE 1XCQB 3FSVA 4O51A 4J3OD 1P1ZA 2ADJA 5IKCA 1CI5A 3RE0A 4M7KH 1VCAA 1CGUA 3DUSB 1MWAB 4UBDC 1RPQA 3AITA 3L1FA 1E5AA 4M03A 4X2UA 2BS9A 2VABB 5DJ2B 3RTQA 3T2OA 4QRAA 4Z7OF 1BHGA 3RDTD 1FZJB 3EO0A 1QWHA 1ZY9A 4QXWA 4NKOA 3REVB 1YPZB 2EECA 4U1GC 1PLAA 2XPYA 5HHXL 1W8OA 2WXJA 3GMPB 3U6RA 4AOFA 1TLMA 1RJLA 1X5ZA 1OAUL 1D5MB 2Q6WB 2MCAA 1P7HL 1HHJA 4XP4L 3T77A 4BHUA 2XVGA 3FFCE 2D0HA 1NL0L 2ZAGA 1OLLA 5TDPB 5T1JA 3TBVA 2YMXL 1SDDA 3HC2A 3VO0A 4NQCD 1NCHA 5K69A 2FWSA 5KSUA 1N5YL 4F33A 3PWVB 4UM9A 2UZYB 4CUCA 5D93C 2UUDK 5FA4B 4UQ3B 5ESVB 5H2BA 3LH9A 3UGUA 5B7FA 3QFGA 1HI6B 2AF2A 2JI2A 2C1OB 4OZHA 1BBJB 3NP3A 5CD5D 2KHAA 3OCIA 3QJHB 4NNXA 3GSRA 4O58L 2MCPL 1L7IL 5DQJA 3WUWG 4RA3A 1CE1H 4GUPA 5C07E 2VT0A 4UNTA 3IS1X 1QTPA 3BT2H 2VL4A 3V5DB 4HA1A 2PTVA 3PP4L 4QRPE 4IM8A 2H6OA 4KY2A 5DHXB 4QNPF 5I8EA 1J9TA 2H3NB 3MJ9L 1T89C 3WFBH 5CXPA 4N90D 4UU9B 3QJQB 4BK4A 3GIZL 5F88B 4QOKA 2K9UA 2XQYG 3HE7A 2NLJB 3N44B 4HH9B 4PJ7F 2VDKH 1M3JA 4HKBA 5FYKU 4KKLC 2QRCA 4PR5A 5TTRA 3VB8A 4ABQA 1HYSC 1SVCP 4GW4B 5FYJL 4JM4L 2X3BA 4CN1A 4TUOA 5LCVH 3C9NA 1THAA 3SY0A 5K9JL 3HUJA 5AUMB 5FDWB 4OD3L 3T6VA 1TXKA 4Z7UA 1F6FB 4DPRA 5B8CA 4F3FA 3HBGA 4J2QA 1W72H 4WCYL 5CAYB 3CFEB 2VLKB 3B2PA 2WINB 3BAWA 3HUJE 2VQTA 1IC5L 5ACLA 4K7FB 1PFOA 4IGBB 3SDXF 5I8KH 2WO3B 1BD2E 2GCYA 2J8UE 1OAQL 2PO6C 1JPSL 3H9YA 5IQLA 1TJIH 1GIGL 3G6DL 3P77B 1F4AA 3D9AL 4LFHD 4Y19B 2PWEA 4P23C 1PU0A 4PJXA 2O5NA 4CBZA 1KIUB 3GSVA 3QWQB 3SJVE 2F7PA 2JJUA 1LP9A 2JI1A 3MUZ1 4MNQB 4MZIA 4JQIH 2XIDA 4EI0A 1U33A 2A73B 2DIAA 4Z7QF 1GHFH 1DLHA 4CN6A 1DDTA 3WNPA 4NP4H 4QOKD 3E6HA 1K8IA 3HE7D 3NCJH 3ULUF 4FL4B 4PY8I 4X98B 2ZCKL 2VH5L 4OD2A 2AI0L 4LQFH 4Z7VF 3IN0A 2KPWA 1OANA 4EF3A 4PJ9C 4KK6D 2ZUQC 4UYPA 3J07A 1UWXH 4CU6A 2QJDA 1I1AD 1U4FA 1E6OH 3VD7A 4EDXA 2XA8L 3RY4A 4UUJB 5C0BA 2X40A 2R23B 4XXDB 1M71B 2PP8A 4EN3D 3HNSH 2R8SL 1GYVA 5AVUB 5EIIG 4LEOA 1X5XA 2AJYL 2BCKA 3QFDA 4YXKL 2OMXB 1QBLH 5GGUB 4Z7IA 4YH6A 4P57B 3VFMB 4JHVA 2HMID 1QMUA 4A55A 5I17B 5DD1L 2J5WA 3SN6N 2KUTA 5EEWA 3OLEA 1BJMA 5AVRB 3LQAH 3FU0A 4HZLB 3D4ZA 5DA4A 5IWLC 1UJ3A 1PZ5B 2ZCZA 3PIQB 2DDQL 4RGNE 4LOUD 1U8HA 4U31A 2ZYHA 3B4NA 9PCYA 1BXUA 4LSDA 5K93A 2FX7H 3Q13A 4G7QB 1I7RA 4N2FA 2C4FT 1JDAA 1CCZA 2CPCA 4A7GF 2K0RA 4HJGB 1YMHB 3MGTB 3ZKQD 1NCNA 1U3HA 3CDZA 4OLWL 2QQLL 2NY0D 4KXZI 4AYEC 1YEKL 1NANI 1S6NA 2AEWA 3OKOB 3RDJA 4XPGH 1SPDA 4KRNA 5DUPL 4APQB 3GS7A 3U9UB 2IDSA 5FYKH 1K5WA 4JQIA 5L7XL 4NUQA 5IF0A 1M05B 3UTSA 4DP1X 5I71B 4IDLA 3OC5A 3TCTA 1T0OA 1EXHA 5DZPA 4ZNCD 1RJZB 2OMVA 1X6NA 4P8QA 5D2NE 4URTB 4Q2ZA 4X0NA 3NCBB 1EGJL 2FEEL 4GAAA 3RIFK 4YR6B 3N50A 2Z93B 2N7AA 3ARDB 3B43A 3OGCA 3DKHA 4HOXA 4RMWA 5DRWA 3H9HB 3H54A 5H4ZA 4ZUTA 3WIAA 4AL8C 5C09A 3T71A 3MTXA 4KHXH 1RFDH 1T4WA 3IF1B 3R18A 4OSUL 5I6XC 4RMTA 3A67L 2PP9A 2WWKO 3IJ8A 4L3EB 4P2RE 1DQIA 4UB0H 1HILB 4PRHB 4DK6A 1BQKA 4PS8A 2IBBA 3NPSB 4BYHA 3BAYA 2FD6H 1D5BB 5F9OH 4MBRA 2M1KA 1EEYB 3G5VB 4N0FB 2WLZA 4HK3N 1H3PL 2QVTA 1F1DA 4HFUH 4N9GA 2D0FA 4IS6A 3JV4A 3K72A 3DGGB 4XB8A 4GKZA 1FZKA 1S9VA 4HKZA 2FJHA 4I3RL 3CZEA 4FQQA 1D6VL 3VACA 4DKFL 4OZ4A 3FTVA 5JIKA 2J5LC 4AZ8B 2OL3L 3CQFA 5TQ2L 2EDBA 4Y9GA 4NQDB 1V7ML 3I6LE 4Z0XA 4NKDB 1Z5YD 2QR0B 2W92A 3FK3A 4MASA 2YGQA 3AAZA 3ZZSA 2CJSA 2BDNL 2VDOL 3HG1B 1TTUA 2OXHB 1NGXA 1SOSA 1EH9A 5DK2A 3EYSL 1OSPL 5T1LA 3WNOA 2FNWA 5IEKB 3FFDB 4IOSA 5FYJU 3LEYL 3U7WH 1YNTA 3K6SB 2ZXQA 3OGOE 1MH5B 4URKA 5DJZB 3TDHA 2XA3A 1WYJA 4R8WH 5F6IB 3S9DB 1N5AA 1JFQL 1IQWL 5C09D 2BSDA 3KDMB 5JLZA 3NSDA 4DO6A 2CD0A 3VRLE 4P4KA 5TPWL 2AXJA 2N59A 3BYTA 3EJCA 5L6YL 2WO4A 5C08E 3SKNA 2VR4A 3KVDD 3MBEB 3FHEA 4OI9A 5L8KB 2RIKA 1XCWA 2B77A 5MENE 3RDTB 1MW0A 3BO8A 4L05A 5EO0A 4LU5L 4MXQD 1SDAB 3AQXA 1IC1A 2P8LA 1PY4A 2W59A 3RGVD 4GJTB 1E4WL 3I6LD 2XWRA 1EHNA 1L0QA 4JO3H 2J25A 1KPVB 3OAUL 1QNBA 2DJMA 4UINL 3QUML 1JNNL 1OAUH 3A6CH 2EXWC 4H0HB 5FYKD 3GSQB 4NQCB 1N8ZB 1AKPA 1NFAA 3NJNA 4Z7WE 3MNMA 1J0ZA 3P30H 2AVFA 4F2FA 4ETQB 2PPCA 5T1LD 4ZMPA 1B4JH 3RWEB 2IH3B 4PWJA 3RFRA 4IOSD 5I23A 4J3WA 3DROA 2PXYA 4TQ8A 4OVUA 4WNQB 1JXKA 3OMZA 1UEYA 1LMKA 2YA2A 4R0LC 3LPFA 1KJVB 2N01B 2NOYA 4EI6A 1NZRA 1NFIB 4YSOA 1FFNA 1O5PA 5E6SB 2X4NA 5J1AA 4O51B 4M6NL 1P1ZB 2ADJB 5IKCB 3F8UB 2DBLH 3F62A 1PYWA 1Y7VA 3M6DA 4JVPA 5EIQA 5GJTH 5HVGB 3SD5A 2I9LA 4TSCL 3T4AC 3RTQB 5HHPA 1KBGH 2QRDA 4K94C 3EO0B 4OIIL 5L0QC 1H9VA 4NKOB 3FB7A 4XCFL 1IFRA 5CO1A 1K85A 4KPHL 4F8QA 5HPOA 4W1TA 1OSZA 2NY7L 5BVPH 3U6RB 3AY4C 1BQ5A 5GGRA 1RJLB 1I1RA 4NM8L 4KHTH 4Y0GA 4J12A 1HHJB 3T77B 4XO8A 4DKEH 2XY1A 5E6YA 3OG6B 2FSDA 4PG2A 2QGCA 8FABA 5J9PA 3IH7A 5EDXA 1OSYA 4M1CC 3FCGA 3TBVB 4LMQI 3NYKA 2ZFDB 5CZKA 1EXGA 4ZRGA 2K6YA 4LSUL 4KDWA 5EFIA 5KSUB 5EU4A 2DD8H 2W94A 4F33B 1G9NH 4UM9B 1GS6X 2YBRA 2P3YA 3A24A 1AG6A 2J55A 4R7XA 5K9JH 5H2BB 2PXYD 2ZWYA 1VFMA 3X13A 4AY0A 1KTDA 3ASWA 1UWXK 2XTJC 1UD8A 4OZHB 5IFHL 3APNA 2BY0A 5DURB 3S48A 2BSTA 1ZRUA 4NNXB 1F2QA 3GSRB 2YAOA 3MVSA 1DDHA 1DJSA 4GS7B 4XNBA 3SQBA 4KY1H 5DQJB 1RMFH 5C2UB 2PPAA 1GIGH 4GUPB 4KROB 5DT1H 4GSDL 2Q8AL 4ELME 3L3HB 3QJVB 1A2YA 1GGTA 4LF3B 4B53A 2O3OA 3IBEA 1XXFC 4KKBD 4OF3A 4NJAH 4OF6A 4QOKB 4Y4KA 3HE7B 4JVUA 2CRMA 2O6CA 5L9DH 4HKBB 3ZUCA 3HBPA 4M7ZB 1PG7H 1E3XA 4JKKA 1I1AB 2CALA 1EUUA 1GGBH 4LLMA 3OD3A 3T0WA 5D1QC 2F7QA 2X28A 3MODL 4BFKA 4GSUA 4KTEH 3C9NB 4TUOB 3RPJA 4EN3B 4PREA 2DYRB 1U8QA 3HUJB 4CC4C 4Z6AT 3MRLA 3I02A 1D2PA 2EYTA 4Z7UB 4PEEA 5B8CB 4F3FB 1ETA1 5K5YA 2E9GA 1GKOA 3GZKA 5I0YA 4WFFD 3JWNE 5D1XE 1CFBA 2X2YA 4X7TA 4YXKH 3A5VA 1MVUA 5L4MA 4YSUA 1B0WA 4KKPA 2GCYB 2LOEA 4UAOC 3ZTNL 3ASMA 4L48A 2QVMA 2A74C 5CCKH 5GRWA 1J0KA 3HR5A 4PJXB 3MRMA 1JF6A 2RB8A 1RZKL 1E8XA 3SCMC 3HFML 1ACYL 1RY7B 2AQSA 3UH8A 2TSAA 3BLKA 3GSVB 5BUGA 5C6PB 1LP9B 2NY0B 4IJ3C 3RWGA 4W4OA 4EQ3A 3EDKA 5A2CA 4Q74A 1MIML 1AE6H 1DLHB 2EKJA 4OLWH 4U0RC 3TYGL 5A2BA 5C70A 5EA0L 1FC2D 3E6HB 1A7PL 1EDHA 3HJEA 4Y4KD 3UTOA 2P49B 5LGKA 4OD2B 3BVWA 1U95A 1NSNL 1KO9A 4EZMA 1FPTL 4LSTH 3S98A 4LVOC 3QE5A 4EDXB 5L7XH 1MCLA 2K8MA 2VDKB 3POHA 3ERXA 4HUUA 4WKXA 5DSCA 3PAVA 5C0BB 1PIFA 2QPFA 4Z9KB 2ROXA 1J0JA 3QA3A 3FSAA 4M62L 2BWDA 1B2WL 4S1DC 1JZHA 1ANUA 3FUIA 2GI7A 3SDDD 3T3PF 1NVPA 3FU3A 4LEOB 3QFDB 4ZSOA 2BCKB 4M4RB 5BW7C 3ZDYB 3QC5X 1J5HA 2ZIDA 1EGJH 1P4LA 3CN2A 5IVXE 4A2HA 4OU3A 3CN4A 4WW2A 1HWHB 3SBPA 3S36L 3F7RA 3E6FA 2X7LA 3B7YA 3T8MA 4XWOD 2DMHA 1A1MA 3QZOA 2I7SA 1FIGL 3MX0A 2IGFL 4KVCH 3UJIL 1UJ3B 1T1WA 5K9QG 3MV11 3NIFE 1U8HB 4KK5D 1X9UA 3PHAA 4IBQA 2DQCH 1G4RA 1RHHA 1I7RB 1KCSL 4OSUH 4I0CC 5AL8A 4TVUA 1AXIB 3NESA 2DMBA 4XNUH 4JDZA 1U3HB 3CDZB 4EO5A 1ZSHA 2JVUA 4YWGH 4WI4A 1DEDA 3JV5A 1JF5A 4WO4C 4LLDB 1N64L 1XMEB 3SKOA 3AT0A 3P11L 4LSSL 4ZS6D 1F11A 2WKLA 1LILA 1OCCB 5IF0B 4BFRA 3WJLA 4Z7AA 1YQKA 1F6LL 5D2NB 1OW0A 3J27A 1M4KA 3HRZC 2WXFA 4AK2A 5KVFH 4HPHA 3E0GA 2OMVB 3ILDA 1V7MH 4L4TE 5B1AB 4Q2ZB 7CGTA 3CVIH 1RK0A 2ZOUA 2FB4L 2VE6A 1Y6NR 1VA9A 1AOZA 2ZKHH 1E7VA 4RMRA 2KT6A 3OGCB 5H8DA 5DRWB 5E7FA 5EUOA 4PLKD 2NSMA 1MDTA 4ZUTB 5JQ6L 5C09B 2RD0A 4X83A 5AYTA 3EJZD 4ZDHA 5L2JA 3ATBA 1EGJA 1U8LA 2BIQA 2VC2H 1DQDL 3KCWA 2DIEA 3GRGA 4OJFH 4XBGA 2CRYA 4S1QL 1QN4A 2X4QA 1QEWA 2DQHL 3M07A 5AKTA 2D4DA 1KGXA 4QLRA 5TPWH 5FA3A 4GKLA 4ZMZA 4IEFA 3MRKA 3NIGB 3KAAA 4I48A 2PR4H 1ZAGA 4N9GB 5DFTA 4IS6B 2ZX7A 5DMJB 3JV4B 3K72B 4V1DE 4HU2A 2W1NA 3MA9L 4L37A 1O7DE 4GKZB 1FZKB 1S9VB 4HKZB 4JHZA 3G6JA 2FJHB 2W07A 4B41A 2X87A 1W8EA 4FQQB 2KZKA 2YWZA 4OZ4B 3Q6GH 4ZD3L 3GHEH 3ZE2E 1R17A 4XNMA 4L4TD 3K0YA 4GINA 1QBMH 2CK2A 4PVNA 3EO9L 4Z0XB 2GBAA 2I32A 3KPTA 3KJ4B 3AAZB 1EO8H 5B1JA 4PJ8A 3TIEA 4MJ4A 3D33A 4D3CH 2A7BA 5JW4R 4KZDH 5DK2B 5T1LB 1QFPA 3KPMA 3OHXA 4G1MA 1MFNA 1AYRA 2NRDA 3CD4A 4EKXA 1FAKT 5CM1A 3CQQA 3VRLF 2CHZA 1YNTB 1M56B 4JRXE 2H47C 3D52A 3AQZA 2GY7B 1USQA 1N5AB 4M93C 4N24A 1IILE 5JLZB 4NZTH 3EJRA 4HMEA 4AYBA 1WD9A 4OZIE 2AJSL 4P4KB 2VXVH 2Z1PA 4HUNB 3C5XA 4U1JA 4LIQH 2NY3B 3MV9A 2GBUA 2EDOA 3TJPA 3SKNB 2X41A 4HISA 4M6NH 2PUQT 3SQOH 3BO8B 4NZRL 5EO0B 3MRQA 1A7RH 5C0CA 1GGIL 2EHBD 1ZDQA 4ABVA 2P8LB 1D9KC 2DLTA 5D96C 1QKZL 5F9DC 1W80A 1FGNL 1P6AB 2AXWA 1A0QL 5C0IA 5I18H 4YL9A 1DN0A 1R5IA 1N4XL 4Z7WB 1E3FA 2WN2A 4NM8H 4CNIA 1RIUH 3FMGH 3K2IA 1ZVHA 2JELH 5FAAA 3ZMEA 4JHWH 1SN0A 3VVVA 1XT5A 1URIA 1LEKA 4NN5B 2NW3A 4UQ2A 1FNAA 4J3SA 4UTBL 2GI0A 1HINH 4FQHB 4OI8A 1EEUA 2W0LA 4RMBA 2CKBL 3DROB 2PXYB 1OARL 2EUWA 4XNYL 4Q52A 5ELIA 3SGKC 2J1ZA 3IMVA 4EI6B 4NO3A 1FFNB 2ZT9C 3Q01A 1WV7T 2X4NB 2XSKA 5J1AB 4ZX6A 2G5UA 3QH3A 2JKXA 2IV8A 4FE9A 2YK1H 4X6DE 4YBHA 5EHFA 4K5MA 3US0A 1PYWB 1RZ8B 1R46A 3LEXA 3M1BA 2L0DA 1DUZA 3MV9D 4G6JL 4ODVL 4TNEA 3SBQA 2I9LB 1CICD 1T0MA 3SNSA 2BZCA 3WJJA 4H8HA 3FTZA 3K74B 5HHPB 1RAMA 4OIBA 4QHNA 3L7FA 4LVHB 5JIDA 3TEZA 3HHRB 3B2VL 3FB7B 4N8PA 2JCCA 4S2SA 4PJ5E 4P2AA 3ELAT 2ZNWA 5F0LB 1KEGL 1OSZB 1J88A 2B15A 3PFUA 1XF4A 1INEL 3Q1SH 5GGRB 1W0YT 4LIQE 4M1GL 5T5FL 4AE0A 4HWBH 3ZT6A 4D7BA 8FABB 1KFIA 3KW8A 5J9PB 1KGCE 2H4EA 3ZTJG 5KEZA 2EDLA 2UXTA 2VYRE 1TVDA 2Z31C 3EYOA 2R1XA 1AKJA 2FDBP 2MH4A 2P24A 3QJUB 5EFIB 5EU4B 4PMEA 3UADA 4R97C 2YBRB 3IFLH 2ALWA 5AYUL 5DHEA 4LOVA 4XB7A 4PY8J 4RISH 3MXWH 1KTDB 2BNQA 3II2A 1NAMH 3GTVA 5IB4A 4ELMF 2JFCA 4XMPL 1CXHA 5HI5C 2CRZA 2Z92A 4YGAB 4JB9L 4AQOA 2ZOTA 2BSTB 3NSYA 4ZMTA 1I9IH 4E5XG 1DDHB 2VN5A 2DI8A 1E5YA 1W2KT 2K3HA 3PYCA 2V3DA 4U33A 4JAMA 4B95C 5DD3L 3FTGA 4PJ5D 3WFEL 1A2YB 4N0YL 2W0PA 1PPIA 4NHCL 1JVKA 1PIGA 3ESVF 4R4ND 2YZ8A 3VA6A 4FG6D 4HD9A 2VM9A 3VD0A 5I75C 2GITA 4Y4KB 4JPKL 1VB9A 1KGCD 5I6KA 2G5BA 5MEOA 5D4HA 3UDWA 2IADA 1F4WH 2NR6D 5CZRA 2CE6A 2XPGA 4EAEA 3JBG7 1WIUA 4PREB 1U8QB 3MRLB 3I02B 1MHHA 4RMSA 2EYTB 4U6HA 3EDDA 3VFUA 1VCBC 4KUZH 2DMCA 4M5YL 4FQLL 4NKMA 2EC8A 4MXWL 4PBVC 1IQDA 4WRLA 4X7TB 2A38A 1MVUB 3OMIB 2BNQD 1MN4A 1VFAB 3POCA 4N2MA 3MZTA 1XSOA 2YMOA 1RIHL 1TZGH 5FEBA 1XH1A 1AGDA 4PVBA 5K9KA 3HR5B 1FIGH 4YSAA 3MRMB 4P9HC 1I1YA 1NGWA 2YMTA 5HXMA 4LLQB 4AG4H 4N8VG 1FO0L 4MDIA 5JXEC 1KGYE 5DK3A 2HAZA 1QSEA 2C1PA 2Y22A 1KCSH 3GBLA 4WFHE 2OP4L 5E2UL 5IBUG 2Y8QA 3RWGB 2OJZL 2UXFA 2XN1A 4IKIA 2V5RA 1H3UA 3AROA 2VR7A 2HLFD 1QSFA 1XO8A 4XAKE 3P40A 3OPZH 5LDSA 1B0RA 1HKFA 3EJJX 2VXTL 2W5PA 1U95B 1MCPL 1YYLL 1AC0A 1J18A 1KSRA 1SLXA 1AJ7H 2DQUH 3P11H 3DHMA 3STBA 3TV8A 4PY5A 4HMCA 3H4FA 3ZR5A 4OCRL 4QHLA 3BPNC 3DNKA 3B1UA 5J12C 4HUUB 5DSCB 2QV2A 3QBTB 1ZPUA 1A8ZA 3QA3B 4Z1PA 4XMKL 1PCSA 3VH8A 4CVZA 4LEBA 1H5BC 4ZSOB 3IMBA 4TULL 4K9EC 1P4LB 3GI9L 5IVNA 1A66A 4WW2B 1QASA 3I6GA 1V55B 2X7LB 1H8SA 3E6FB 4KDTC 1DO5A 5FW8A 1K8DA 1EDQA 3MX0B 5KJRL 5HYEA 1TUOA 5F0JB 1T1WB 1ZTMA 4JR9H 4PJAE 1OAXL 5DZOA 2UWEE 4XN9A 5F93C 1T1ZA 4WEEA 3NK3A 1UFUA 1T2XA 1LDPH 4I88A 1QFWI 2ZUVA 1J0YA 3GSNH 4OLVL 3T2LA 3FONA 2MNUA 4HPYH 4JDZB 2AAVA 2J12B 4I18A 4GKNA 5E2TL 2DQHH 1T1YA 3FU7A 2Y72A 4IBTA 5DD5L 3VB9A 3QR2A 4GRLC 3SKOB 4TUJA 4N8UA 5I1HH 4GEJA 4K23H 3TTYA 2HT4D 2NXYD 1F11B 3TNMA 2HL9A 3JWOL 3MA9H 4Q0XH 1YG9A 5MP6H 4F2EA 4ZNEA 3FSOA 3TJEL 3QCVL 2H4LX 3CVHL 3UZQA 1RK0B 4JZNA 3ARGC 3HLAA 1WVZA 2VE6B 3IDJA 3W0WA 4OGYL 1L6ZA 4F24A 3QCUH 2YJLA 2LLGA 2DW5A 1AQKH 2V2XA 2YRPA 3LKNA 4JDEB 4FKHA 4LCCC 1J0HA 2ZCLL 4JJ5A 1OAZL 5ESQA 1MF2L 3MA7A 3P73A 1EZVX 5EUOB 1BF5A 1HEHC 2JWYA 3KRMA 2YSTA 3KYNA 1B9KA 1ZEAH 4ZDHB 2RGSA 5L2JB 1KYOK 1PG7W 4G7YL 1U8LB 2AAAA 1RIVL 3S36X 3U1QA 5LVEA 2OPCA 3IWUA 4XBGB 3BGFC 4YHLL 2FK9A 4ZFGL 5ACMA 2X4QB 4UQCA 1QEWB 2GK0A 3F58L 3QW9A 1Y0LA 2ZICA 1N59A 2N4IA 3OKKA 5FA3B 4CMHC 1L0XA 4A6YH 5D2LA 4XX1E 3HLKA 1AOHA 3GBNL 4IEFB 3MRKB 4Z77A 1F4YL 5FO8A 1WFUA 3ZE2B 5HJBA 5HI4D 3VI3A 3ABKB 3L4WA 5BQDA 5HYJA 3UP1A 4L37B 4NZRH 1V54B 3G6JB 2W07B 1MCWM 2O30A 4OLXL 5HTSA 5GSRA 4FQJH 3X3FL 1QKZH 3DVFA 4XNMB 2O93L 3IJSA 5HYJE 3BP6A 3HB3D 2FX8L 3E8VA 5TK4A 4F8OA 5AB9A 3TIEB 2AEQL 4ZXBC 4UZGA 1KB9J 4PTUA 2ZONA 3B9DA 3FUMA 2HL8A 1QLRA 1Z6JT 3KPMB 3OHXB 4G1MB 1OTSD 3CDCA 3S3PA 2ZXEB 2ADYA 3RL1A 4OZIF 4PRDA 4A37A 5FUOH 4FHBD 1GZQA 2HZMA 1FCCA 3ZQXA 1RXLA 4LKXA 4FX5A 2VDOB 2QSQA 5E2WH 4GLRI 1T7WA 4AL8L 1NCOA 1WS7A 1X4YA 5DHYA 4F7PA 4HXBL 4Q9RL 1NUGA 3U4AA 1SXNA 2FATL 1XBRA 4K71C 4U1JB 4MMXA 1FSKB 3MV9B 1Y07A 3FQRA 3W5NA 3VXSA 4NFBA 3NTCH 2ZQKA 4QRQA 4YLBA 3E8UL 1CG9A 3TIDA 2IPKA 1IJ9A 3BZ4A 3QUYD 4G6JH 1VKXA 5EEXA 3MRQB 5C97A 2ZWZA 4RGMC 5C0CB 4G11A 4PGCB 3U9WA 4RLDA 3VWJD 5HYJD 1OF0A 4ZUVA 3WTSA 4N87A 1NWOA 1A6ZA 5C0IB 1KEGH 4R7NA 4F8PA 5JW5B 4WKZA 5CUSL 1R5IB 4RESB 4CNIB 2XTLA 3CMOH 4HXAL 3SPVA 2WYTA 4M6ML 1BF8A 4N2HA 4V11A 1XL4A 2VZOA 2Y25A 5HHOA 1LEKB 2IDUA 2NW3B 4UQ2B 2NMSA 4X99A 3O2VH 1SLUA 2GHWB 2MPAH 3U1SH 4DQAA 1SFDA 5LGHL 3KYKH 3IFNL 5HHOE 1L9QA 4JJHA 4X6DF 4FQIL 4TLKA 2Y6SD 2CKNA 1CDYA 2XTSA 1CQYA 3EDFA 5TH2A 1T21B 4NO3B 1BOYA 4XN1A 2WZ0A 4ONGL 3QH3B 4MA1B 3VVWA 2CKBA 3V4PL 3TL5A 3LEXB 3IXTA 3M1BB 1DUZB 4MAZA 1RK1A 3QXAA 1T0MB 2CBTA 3GNMH 3ZRFC 4JG1L 3FYIB 3MUGB 4QHNB 3L7FB 1CWVA 2PPEA 1GJIA 4WK4B 1J9RA 5E2JA 2DKDA 3WFEH 2CLRA 2JCCB 4LEXL 3DHJA 4S2SB 5TD4A 4YFLI 3V6OE 5F3HA 5LUMA 3FQ1A 1XF4B 5KAQF 3ZE0E 4JRLA 3V52H 4FEMA 5JHDE 4JBSA 3TPKA 2ZOWA 1G7LA 3KYOA 4GRWH 3BRDA 2L7UA 3UJJL 3SGEH 2FEDC 4AJWA 3EOAA 1UA6H 4JUSA 4N2IA 2ICWI 2EINB 2H1PH 3FSWA 1IKFL 4PJEA 4I89A 1TEFA 3RURA 2J3SA 4YHKH 2FL5A 1LXTA 3EYOB 5TGBA 2R1XB 1AKJB 2P24B 1O6TA 5HHOD 3CBRA 3DVGA 4G8GE 4B9FA 3T2QA 4PJEE 2V17H 5T5FA 2JMRA 2YAEA 2BK8A 4XPFH 3HZVA 3C60D 1BBDH 3EH2A 5CN1A 5T3ZH 3WFZA 2F0CA 1V3LA 5JPNA 1AQDA 2BNQB 4M5YH 5IB4B 4UZUA 5C0FA 3ZSSA 3MRFA 2Z92B 2ZYSA 1W0WB 3HN5A 3KJ6H 3OPUA 3QDME 1A7BA 1BQLL 1E43A 3MDJA 1DFXA 4LVNB 3WTYA 1T66D 2AQ2A 1UB6A 3FW6A 5AAMC 4JAMB 1LE9A 3FTGB 4PJFE 3UAJC 3IU4L 3SO3C 3WBDA 1OB1A 2EDTA 3H42L 4PJCE 5HVHC 4GMTH 4TL4A 4K94L 3MUUA 2Z7YA 1T22A 5TE7H 4UIMA 4BCXA 4IBSA 2GITB 3LEVL 3UERA 2OJZH 3MHZA 5DI8A 5IROC 1HQRA 2G5BB 3PS6A 4JPIA 1IM3D 5MEOB 4J3BA 1RSFA 3GZQA 3DX1A 3KPLA 3F6IA 1L9OA 4RETB 3VFOA 1FDLL 2IADB 4G8GD 2B4CH 2XPGB 1OALA 1VZGA 1A7QH 3MC0A 3ZDXF 2R1YB 4XZUA 2DTML 1S5IL 4TNFA 2K6ZA 1MHHB 1PNDA 2CO6B 4MXVF 2OMYB 3KPSE 5F9JA 2VDML 3VFUB 1ZLVK 4LPCA 5FCSH 1PF3A 2A4CA 3D4GA 5K1VA 4QRRA 4OF7A 1KGJA 4GRWE 4NKMB 1IQDB 5D72L 4MZ3A 1H8LA 3O3UN 1FNHA 2NZ1A 2OW6A 3LPPA 1ADQH 2F5BH 3ZKNC 4MCMA 2WNWA 2NX5A 1AGDB 5A7EA 5K9KB 2X4SA 1KV7A 1WFIA 2ZYIA 4I77H 4ZTOH 1RURL 2L4OA 1VESA 1MXGA 1QA9A 5T3ZE 4JREB 4MDIB 1M7XA 1I7TA 3D0AA 3UTTB 1QSEB 2C1PB 4GKSA 2C7UA 5DWPA 2HYMA 5IB1B 1R5WA 4KTYA 1FZOA 3BUBA 4F8NA 1JTOA 1WZLA 2ARJA 3PAZA 1B0RB 2NXYB 4IU3A 1ASQA 4NO5A 3SDAA 4BCZA 4DK3A 4YDJA 4NC0B 5KSBE 3MR9A 3D50A 3HZYA 1LM8V 2WP3O 1FO0A 3K46A 3UZEC 2R4SH 4N1EA 5EZIH 5FYLE 5L2KE 4Q4IA 1YAIA 1YHPA 2YUXA 4QHLB 3JWOH 2O5ZL 3O41A 4YMPA 4POYA 5CGTA 4DN3L 4HGWA 1RZJH 2BZ7A 3G3LA 1SEQH 2ENJA 1WAAF 4CVZB 3CVHH 5IBTL 4QRRD 4ESKA 4PJAF 5DCCA 5JIMA 4K3EH 1OY3B 3I6GB 3CXFA 1UT1A 1JDDA 2G2NA 2HX7A 1K8DB 1G6VK 3H3PL 1H3GA 3CHXA 4H8PA 3EYFA 4R7LA 3RVVC 2F18A 5ILTL 1YMMA 2NX5D 3ARFD 3QC6X 1YPZF 5T3ZD 5DUML 4MA3A 1T1ZB 5C8JB 5HHME 5IMLA 3FQ4A 4GXUN 2BOLA 1T3FA 4ALAH 1P5GX 1UZ8A 2J7LA 3FONB 1HL9A 4KV5E 5DZAA 3HS0C 4I18B 4GKNB 3O4OB 5CEYA 1T1YB 1BFVH 3FU7B 4XPTH 4OR1A 3IE9A 3CDYA 4TUJB 2NUPA 3UBXG 5FO2A 5L2KD 3SODB 4IRZL 5KVGL 4P23A 3SDAD 3CWTA 2Q5BA 3TNMB 1SY6H 1V3MA 1U0QA 5JOEA 2DJ4A 2DRUA 2CJ3A 2JJTA 5EZJA 4B3VA 3HB3B 3VA2C 1DJWA 3SYOA 4GQQA 4AVKA 2YWYA 1IE5A 4LLWA 1TZIA 2ZOOA 4NAJA 3FDWA 2BLFA 3UZQB 1HL8A 1S9WA 2M2DA 2WUBL 3KLDA 1XSJA 4GNKB 4JZNB 4X7SL 5BRQA 2R29L 3HLAB 1BEYL 3FRUA 3IDJB 4CSSA 3W0WB 3LNFA 5E08H 4QY8A 3PDGA 4Y5YC 3L6FA 2V2XB 1T04A 3LKNB 2Q8BH 1VKLA 4JJ5B 4PJ9A 4XNZB 5ESQB 1NBCA 3MA7B 3P73B 3I6KA 1EFQA 2VJ8A 2HRPH 3CVHA 3QZWA 3KYNB 5FPIA 5HHMD 4U1NA 1RUQL 4OJAA 3CMGA 3BKCL 3OC8A 3QPXH 1S7TA 2B59A 4HF5L 4Y1TA 1OT1A 4GI8A 2IDCA 1C5DA 4Q9RH 3VN5A 1TNNA 2GK0B 1Y0LB 1DVFC 1N59B 4WJKB 3OKKB 2F8XC 4PB9L 3SGDH 4HG4K 5D2LB 1ZTXL 2O26U 2Z34A 3NRQA 3QUYB 4R26L 1TQBC 1U8IA 4Z77B 5FO8B 2XICA 3UO1L 2F1EA 3NABH 4GXUM 4M00A 3VI3B 3NZ8B 5T3XH 4P9ML 3VWJB 2YS4A 5HYJB 4H88L 4Z18A 1NFDE 3BH4A 4IMKA 3D4CA 1WUNT 3P3TA 4XMLH 4ZS7L 3CV5A 5GSRB 1ET5A 3UL4A 4NZJA 3UG3A 3MFGB 2AMUA 4LSVH 3IJSB 3BP6B 5DHVH 3RX9A 1KULA 4H2AA 3OJDA 4L2LA 4J1UA 2BSEA 3GJEA 43C9A 4LDEB 4PTUB 1C9BB 1MRDH 1QLRB 4CSZA 1RZFL 1W8NA 5I1DA 1NPJA 3CSPA 3HI6L 4HJJL 3ULVH 2DEXX 4PRDB 4U1HB 1JNLL 1GZQB 2XBDA 2R69L 3HCVA 4LKXB 4FNLL 3LAFA 3T2PA 3DPDA 3BMVA 4F7PB 1EWHA 1MVYA 5DHYB 5DO2C 2D9CA 4GKOA 1REIA 4AVIA 4KK9D 3QIBA 4MMXB 4POZD 4NOBA 3FQRB 3VXSB 2E0PA 5CR8A 4UT7L 3WIFA 1QRKA 1CG9B 3TIDB 1RP9A 2IPKB 2CGRH 4JFDA 3BZ4B 3V4PH 1YEIL 2HUEA 2HTKD 4HEPA 3PXHA 1LK3H 4W9HC 4ZUVB 4NI3A 1SJEA 3AG1B 4EBQL 1LWHA 1A6ZB 2XVLA 4HHAA 4R7NB 4NIKB 4OQTL 4WKZB 1AHWB 2F54E 2DJSA 4WI8A 4QXUL 4Y1AE 3SPVB 5KBNC 3NSXA 3ESPA 2P4AB 1OIOA 4PP1C 3QEHA 1UXWA 1N3AA 1IGCL 4HPOL 2XJKA 4FI7A 5T3XE 5HHOB 1BJ8A 1HJBC 5DHVA 3E7JA 5EC2A 2XXFA 4PN6A 3IGKA 3UBXA 4X99B 3QO0A 3NZHL 3QUZA 1XGZA 5DMYA 3C60B 3L5HA 1LTXA 4FI6A 4L1TA 1OCWL 4I9WE 2Y06H 3BJLA 4N25A 2A6IA 4BJUA 4NPKA 1JVOA 3M8OL 3L4VA 2A9MH 2DH2A 3P0YH 5ANHA 5EBWA 3CZFA 4HOMA 4AQAA 3CNKA 4FYTA 3ZHKA 5IG7A 2WANA 3D18A 5H94A 4R5XA 1SNRA 3ARZA 3TO2A 2CKBB 5T1MB 1OAYL 4OV6F 3IXTB 3ULVE 3D39A 1UATA 1RK1B 3QXAB 5CHNA 3JTBA 3ZE0F 1G84A 2E9IA 1A4KA 4Z76A 3BSZL 3KBHE 2EAEA 2NUTA 1AO7E 4JFDD 4L4VA 1NM4A 1AZZC 1S7UA 2ARJQ 4NN6B 3D39E 5CBEA 4AQEA 2CLRB 2HX9A 1ZLSH 3D07A 3MGOA 5F3HB 2NOBA 1OK0A 1G9HA 5I30H 3V4PA 2PNDA 4Y1AD 2VQUA 4QTIL 4QHUA 3RAJL 4UV7L 1G7LB 4QHMA 4YX2H 3I3DA 3KYOB 5AALA 3EOAB 4D7QA 5E6IC 5T3XD 3VFSA 4MQSB 3NGBB 5SX4I 4JFTA 5I0DA 1A7OH 1NLDH 4PJEB 4KZEL 3T2NH 2MEJB 4KJQD 2WD0A 2FL5B 4BRJA 4NM4H 3C8DA 4X8GA 4BSWA 3F05A 3DVGB 4Y9CA 1CLYL 4JDTL 5KVMC 3TBWB 1V3KA 4EUPG 3QFJE 4AMKL 3N85L 1DJZA 3ZDZB 1U93A 4R4FL 1CGWA 3HZVB 3QUZD 5DD0L 3HC4L 1UACH 3DYMA 4F37K 2CGZA 4C59B 4OGAC 2K4WA 5JPNB 4HS3A 3V0EA 1AQDB 1UASA 3PWPE 1MLCA 1SRDA 1RL1A 2BVYA 2J1KA 3MRFB 5D5ME 5C0FB 3ULVD 3RX7A 2RJMA 4G9FE 4PJFB 1KJMB 4FZEL 4A39A 3D25A 1AO7D 1PNCA 2VXUL 2FJSA 2QDVA 2W38A 3TZVC 3WXVL 3D39D 1LE9B 4F7TB 4GI6A 2YGOA 4YK4B 3BOVA 1ZS8A 3TURA 2ZP8A 1NEPA 1OB1B 4XP1H 4WTZG 3RB7A 4R0LA 4L4VD 1K72A 2JCWA 4P49A 4U49A 4XOAA 5A6LA 2B39A 1T22B 4KNQA 1GYAA 4UIMB 1CE6A 2LLLA 5TFSH 3T0EE 4OFIA 3R7QA 4JM2F 1QLFA 2NT1A 5T1DL 2ZWSA 5DI8B 2V6HA 4PY7A 4M5ZH 3F04A 1HQRB 4JPIB 1S5HA 4PHXA 3KPLB 3VFOB 1BAFH 1EJ8A 5C0EA 4XZUB 1GAFL 3N43B 3WS6C 3BD4A 5I6NA 2LU5A 4LP4A 4ZUWA 1NMBH 2NLVA 1KYDA 5F9JB 1A8JH 2EO9A 4DN3H 4QRRB 1GC1H 3PWPD 1QAWA 4UOZA 4LBAA 1WD8A 1K5NA 4ZW7A 4S1SL 5JHLH 1CGXA 2QGBA 3ES6A 2CXGA 4EUPH 5D8JL 1QN8A 3N6YA 2NX5B 4GAGH 3DHUA 1WC7A 4HGKC 2X4SB 1AYOA 4L9LC 5HI3D 6TAAA 4J23A 1X7TA 2N3JA 4FXKA 4GB9A 5C2BH 3F6JA 4NENA 1QA9B 3T0ED 2FUVA 4PU2A 1DBAH 4GKSB 4ODSH 2C7UB 5GRUL 2ESVE 1BOGA 2QZ5A 4OFPA 4Y9BA 1R5WB 2IMMA 3TP4A 1FZOB 4ZOBA 3K8LA 5HBBA 1DSWA 4YQXH 3TJHD 3ATDA 3JQOB 3DLQR 3REWA 4HBQA 1G7HA 3SDAB 1UCTA 1M57B 4IU3B 4NO5B 2MJ7A 2H7WA 4YDJB 3EIKA 3KWXA 3MR9B 1R3JA 1SXCA 1WG3A 1RHFA 3HZYB 3OTTA 5FGBA 1FO0B 1A6UL 3VXUA 4B0AA 1N12A 4I13B 2YA0A 3BE1L 4JCMA 3KLKA 4LASH 4Q6YA 2VXQL 4QI3A 5CLZA 5CSGA 3BVNA 3AC0A 3O41B 3E3QC 4YS4A 3IGLA 4E68A 4KKAC 1PW3A 4JHUA 2A9DA 3OSKA 5KW9L 3BGAA 3VXUE 3VG9C 3FT1A 3LB6C 3QQ9D 4G8AC 3L3OC 3NCMA 4AH2B 4AYDC 1BV8A 2JHNA 2X10A 1L9SA 3E1ZA 4JZJA 5IVOA 4CDHA 3O6LL 3ISRA 3BQVA 3GMOB 3DURA 3AS3A 4BEIA 4Y8AA 2GJ6A 4X4KA 1DJYA 5HHMB 1OK8A 2CCWA 2H32A 4KV5F 4M8RA 2ARWA 1CLOL 1E90A 4FQ1L 3EYFB 4DP6X 2EIZA 5CIPH 4CC4A 2E8YA 2VM4A 1MSPA 2DQIH 1LWRA 5JHLA 1WUZA 3US9A 4MA3B 3FT3A 1RUQH 2JB6A 2Y7SA 3BN9C 5IMLB 2ESVD 3BKCH 4EUPA 4XRCA 4KRMB 3EJTA 3GS4A 1T3FB 1UZ8B 4IOFC 2WVSA 1Q0XL 2RTTA 4ZMQA 3ZBMA 5CEYB 4GRMA 3O4LE 1B6DA 3LNHA 1CS6A 1TLKA 1ZTXH 4N26A 3SOBL 2NY1C 3TVMC 2NUPB 3CN3A 4CRPA 4ZUSA 1KELH 3UO1H 4KRPC 4P23B 1QD0A 2Z0BA 2WNGA 3BUQA 5ANMA 1M1XA 2LE9A 4KFZC 1BEXA 3BKYL 5EZJB 3WFDL 3FN3A 1LL1A 4ISVA 5IB2A 1AR1C 3VXUD 1CXFA 1NQBA 3MNDA 5T5NF 3LPOA 2A77H 1TZIB 4LLWB 4MQTB 1KB3A 2EEDA 4WTZA 1S9WB 1T03L 4DETA 4DIXA 4JMXA 3FRUB 3DVNA 3ALPA 4QY8B 4N0CC 3L6FB 5CJ5A 1J8RA 1T04B 4P3CL 1YQLA 1UOKA 1TTGA 4KDVA 4PJ9B 2WTPA 4OTXL 4N2AA 4ANUA 3I6KB 4BFOA 2GJ6D 1WBYA 1WZAA 3S5ZA 3VXMA 3CVHB 4OI7A 3QZWB 3QXDA 1AY1L 2BRQA 2BVQA 2JB5L 4U1NB 1SGKA 2R29A 3GTTA 3HMXL 4PLJD 4BK8A 1S7TB 5BPPA 2DJUA 3DX4A 2VW7A 4LLYA 4TSBL 1C5DB 3SHSA 3X14B 1QNAA 2F8OA 5CJOH 5IZ7A 1XF3A 4G2AA 1AR2A 2AABL 2FGWL 3BIAX 4HALA 4UANA 4UOJA 1OKEA 2G3XA 5GS0L 1U8IB 1BVZA 4UT7H 1XH0A 4Q4EA 1CL7H 5J56B 2ZWKA 4OGQC 1N68A 5ESAA 4EIZC 2R56H 3CTTA 3THML 4PWFA 2JKJA 4Z7UF 1RPKA 1ZV5A 4KNSA 2J1WA 1MRCH 4WHYG 3GRWL 3QEQE 3QHTC 1IC7L 4CN4A 3QSKB 3OJDB 4Z0BH 5LNGA 4J1UB 1NDGA 2CDFA 3GJEB 3BAXA 43C9B 3L1OL 4IYKA 2QTEA 3F84A 2NTSP 3EUDA 4MQXD 2HTLD 2UVFA 4NRYB 5I1DB 2A4EA 3CX2A 2GJZA 2N0MA 5FHBL 5E6RB 3MV8A 4HCRH 2HZHA 3WLWD 3RY5A 4N2LA 4DCQB 3HCVB 2AEOA 3FTYA 5C3TA 4G80A 2RHEA 3VXMD 3I0XA 2XZAL 1PBYA 1UXMA 2ICWJ 2ZX8A 3GM0A 3MV8E 3QB7C 3W5MA 3M8OH 1BXVA 4PJHA 3MLSL 2YOCA 4JL1A 3QIBB 4HW6A 3SPGA 1JGUH 1H9DA 1NINA 1UWYA 3RJOA 2HKFL 1UD5A 1E8ZA 2HKHL 3WIFB 4F8LA 4JFDB 4XVTH 2A1WL 4YPJA 2WXKA 1BFSA 2GSIA 2CPUA 4X5RA 3ENOC 4IKJA 3BI9X 3F64A 3BSZH 3HN8A 2GQHA 4MVBC 4Y4FD 5E70A 3LH2L 1ZA6A 1MFAH 4LOFA 4X6CA 3WNLA 1YA5A 2X1PA 4IGBC 4UQDA 4Y1AB 1SJEB 5IUCA 4HHAB 3N1FC 5J57B 3DOSA 3ZDYF 1E3ZA 3KPNA 2OXGA 4L1SA 1B4RA 1A14L 4W9KC 4HWUA 1FP5A 3PUUA 2JLLA 3MJ6A 4FG0A 3QEHB 1UXWB 2BMKA 2JE8A 4OLZH 1ZE3H 1U3YA 2ED7A 4DVRH 4DP0X 3H9SA 5DHVB 5EC2B 2DQEH 5MHSD 3N0PB 4WHYH 1KN4L 5DRXA 3UBXB 1KBBA 3QO0B 2MQCA 3QUZB 3C5ZC 4OQTA 1L3NA 5CN2A 4C4BA 3MV8D 5JZ7D 3GHBL 4Y16A 4ZOEA 4AMKH 2A6IB 4F8TA 2Y2WA 5I1AA 3CCHA 4NZDA 2CJUL 2DWXA 3CZFB 3QUXD 5EBWB 4AQAB 4DP8X 1OP3H 3TBBA 2F58H 4BHUI 5IG7B 1A3LL 2G9KA 3D18B 5H94B 2DWDA 2V3EA 4OF5A 2B1OA 4NPYA 2Y07L 4JPWH 2APSA 3TO2B 5AB2A 3D39B 2XQBH 2AJVH 4M9OA 3GF8A 2CNZA 5CHNB 1A4KB 4Z76B 1UM6L 3HC0A 3IS0X 1G1OA 2NUTB 4MCYA 1ED3A 4U05A 4BQ6A 6PCYA 2F8VA 4L4VB 4W93A 1S7UB 5CBEB 1DBJL 4XC1L 4AQEB 2HPTA 4ODXA 5GGVY 4OJYA 1DQVA 4FGMA 2P43B 4QUOA 4G83A 4YHZL 2WLYA 2AQTA 3V4PB 2BVEA 3KBFA 4QHUB 4ZODA 5IR1A 5F0PB 1KTLA 4O2FA 4BFEA 4QHMB 1MHCA 2I7OA 3SYAA 2NTFB 3RUGA 4BJLA 3BSZA 2FYVA 4HJ1A 3VFSB 4HBCH 1NMCB 4JKPH 4DP5X 2AQPA 4FTVE 5ALCH 4TL5A 4JRYA 4BSWB 1IFHH 3RL2A 3VM5A 2NVMA 3H9SD 1CGSH 3WHXA 1U93B 3O0LA 4FI8A 2JKWA 4APQC 3PWLA 4UV4H 3LRGA 4PP2A 3VNYA 3O6FA 5TE6H 4HS3B 4Y16D 1CU4L 1MW1A 3TX4A 3EZJB 3ULSA 1MLCB 1GL4B 5EU6E 5CEZL 3VD1A 1CURA 5I66A 1INDH 3F7YA 3FULA 3QRGL 5E9DE 5A2JH 3FU5A 2DLGA 4RBPK 5I1JL 4R3SA 3T65A 1ZS8B 3SGKA 3N3EA 3BPOB 4R0LB 2IWKA 3F01A 2ZJSH 3LRSA 4D9LL 2P52A 4Q7DA 3D0LA 2WSDA 3AZUA 4JFSA 3BVVA 4JGUA 3VGGA 1CE6B 5ENWA 3VWKC 4KVPA 4V2BA 3PHOA 1QLFB 2WQUA 3U9PL 1JZJA 2VN7A 3DPTA 4LAQH 2X6AA 4PY7B 5ICYA 3QAQA 5D7EA 2WN3A 4FTVD 1XSIA 3UC0L 3JT0A 5DQ9A 5B38G 3S8WA 3ML9A 5K9OA 1T2QH 2OSWA 3J8F7 1N6QL 3DSFH 2A0LD 2HKPA 1QI4A 4KVNL 4WEMB 5C0EB 4TSAL 1A6UH 3MLWH 1FAIL 3H85A 3NPSC 4L3FA 2CBMA 1A6AA 4ZUWB 5E24E 3OWRA 3K5SA 5FW7A 4OJCA 2A3TA 1DBKH 1R0AH 4K7PY 3UTQA 4K3DL 3FN0L 4CBPA 7FABL 2ITCA 9CGTA 1KCRL 1K5NB 1N3CA 3ES6B 3O6FD 3OMAB 1UT7A 1K6QH 1Q8MA 3HI5L 1BPVA 35C8L 3MZGB 3LPGA 2B0SL 3WD5L 2Z31A 5E8DH 1CK0L 5KN5A 1A7NL 5EU7E 3RY6A 2LV4A 2PWGA 3OF6A 4J4PA 1C12A 2R0KH 2VGLM 4JFZH 3MXVH 1WC7B 3GXPA 3MRNA 4N5UA 3WNKA 1E9QA 2AP2A 2XFGB 2PWFA 1NCDH 2QFPA 4FXKB 2C3GA 1C8QA 1QFWL 1R33A 1WK0A 3QXTA 4NENB 2LU7A 4TUKH 5T1KA 4LSRH 1GZPA 3UBGA 4DP2X 1BOGB 1ZANH 3OAZH 3C6LA 1OOWA 2R4RL 1J8HA 3U0PA 1AXTL 4FQPA 5FM8A 3REWB 5F6IC 1G7HB 4GAYB 1GMIA 2K7PA 4X5XA 3W9EA 4H26A 3PY9A 3VXUB 1NGMA 4GUOA 4J3OC 3A4EA 1N3NA 3VI4A 4DO4A 3BVNB 3A6OA 5BZXA 5BV7H 1GGYA 4AV0A 1X9QA 3BD5A 4LVEA 1PZ3A 3MBEC 4YVNA 3R19A 3X17A 3G04A 4AM0Q 3VFGH 3R06A 3RDTC 2YXFA 3EH4B 3F65A 4JZJB 3B9EA 3GLEA 4PWIA 4NUGH 2VXQA 2Y1YA 3BISA 3DURB 3Q43A 4M5TA 4QIRA 5EUKA 4LHUA 2GJ6B 5I26A 2R2HA 1NCCL 5F1IA 5A16B 4E9LA 4Z3GA 3H3BC 4OTXH 3EJSA 1DCEA 2EIZB 1KFAH 1I9RL 4ZO6A 5LBGA 1AANA 1G7MA 3OF6D 4J4PD 3TNNA 5C0RH 3P3RA 5E8PA 1AY1H 1PZ2A 2JB6B 3HI1A 5IJBC 4EUPB 4XRCB 3U1PA 4K2UL 2FTAA 2ISDA 5LXGH 2GIXA 4GRMB 2FNBA 3MUY1 2NPLX 1AZUA 1IBYA 3LZRA 4YDVA 3GJFA 5GS0H 1B3JA 4H8WC 4ZUSB 5INDA 2DQFA 1DLFL 1E42A 5DEGA 3I9PA 5IESL 1RUAH 1M1XB 5ANMB 3LXAA 4QWWD 3QARA 5CD5C 5IB2B 1W91A 4ISVB 2HH0L 3L2LA 3QQ4B 5EBMA 4YXLL 1BGXL 3BQUA 4OGZA 3V7MA 1GVIA 3T0VA 5I8OH 1CQKA 2ZWLT 4YSDA 1KY7A 2MTAA 2BS71 3DVNB 3JXAA 4P3WA 4M29A 5B1CA 1BX2A 3MSPA 1ETZA 4XC3L 5J7CC 3MLZH 2VR3A 3IKKA 4H4NA 1ND0A 3FBQA 2A5UA 3FHQA 1WBYB 3VXMB 4RSYA 2OTWB 3ABLB 2CCVA 3PV6A 4ODWA 3UBHA 3VQ2C 4WDIA 3OH9A 4I0KA 2BVQB 4JFXA 1S3KL 5KYWA 1HZHL 2DS4A 2OCJA 3K81A 2XZAH 1ADWA 1J5DA 2VLRE 1H5BA 1PMYA 4LLYB 5E95B 1E50A 4DGYL 4EAGA 1DZ0A 2DLIA 1XF3B 1QFUH 1ZHBA 1PLGL 1OXYA 5CJXA 3ARSA 1JYXA 2OBGA 1NUDA 3E2HB 1EAJA 3O3EA 3HMXA 5E99H 4ELDA 3KS0H 4FLOA 5DJDA 1J8SA 5ESAB 2BOBA 4IU2A 4QRTA 3L2MA 1DQJA 1QUPA 2TRYA 4NQEE 3S97C 1MVFA 1H8OA 4GS7C 1Q0EA 2YO3A 3ECQA 3VD5A 3ARWA 3BQUD 4F58L 3T08A 2EH7H 4KROC 1NDGB 2CDFB 1GTNA 3L7EA 5ITFB 3NCWA 4NNPH 4GRLA 4BFGA 3JWDC 4C4KO 3VW3L 1E0OB 1YJDC 2GJZB 3MLYL 2FO1A 4PUBH 3MV8B 4GSRA 4G71B 2UY7A 3W56A 2WZ6A 3HE7C 4OZFG 4G80B 2AW2A 3LS5H 2EDNA 5EOCH 5HHVL 3RVTD 3LNIA 3OKYA 4B27A 4M7ZC 2BNUA 3PXJA 4KK6C 2VERN 4PJHB 3S35H 1I1AC 4LOEA 2YRZA 4X9BA 1HHKA 4Q9BA 4UMGA 3S5LG 3CH1A 3EH3B 3AG4B 2ADFL 1RPUA 1LNUA 4EN3C 4W9EC 2QQKH 2Q86A 2VWEE 1MY7A 3AW5A 3ARRA 5B8CC 2GSIB 4Z7NE 4UQAA 2KQNA 5DC4B 3CFNA 2Q3ZA 2HMIC 4FLRA 4NQED 1DCLA 1ZA6B 4OBRA 1IAKA 4X6CB 1PD0A 4ZFFB 3K7UA 3N1GC 2PN5A 1PZSA 1S7VA 1K2YX 2ERJB 3DOSB 3MBXL 3KPNB 1EMTL 3QWRA 2OXGB 5GS0D 1I3RA 1QYGL 4P0DA 4NWUH 2BMKB 3FTUA 4KJWD 2BJML 4NAQA 1SOXA 1WFJA 4YC2B 4KI5E 3H9SB 4AYSA 3WN5A 1FL6A 2AJUL 4AIOA 3WAKA 5DRXB 3JYCA 2NY0C 1XTMA 4MKMA 1X5AA 2FBJL</