2VJ0A

Crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, in complex with an fxdnf peptide from amphiphysin1 and a wvxf peptide from synaptojanin p170
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
246
structure length
246
Chain Sequence
ILAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVINIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
publication title Solitary and Repetitive Binding Motifs for the Ap2 Complex {Alpha}-Appendage in Amphiphysin and Other Accessory Proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 68
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vj0A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2vj0A02
4RODB 1CDWA 1GYWA 1QN3A 1QN7A 1KYDA 5CN2A 1VOLB 4WZSD 1QNAA 1TBAB 1KY6A 4B0AA 1PZDA 2D0BA 1B9KA 2VJ0A 5IYDP 1VOKA 1P4UA 2IV8A 1QN8A 1PCZA 1JFIC 1VTLE 2DWYA 2A7BA 1QNEA 1KYFA 2IV9A 3HS9A 5IYBP 1QN4A 4BCXA 5CN1A 2D0CA 2DWXA 2G30A 3OCIA 1QNBA 1KYUA 3MNMA 1QN9A 1D3UA 1RM1A 2E9GA 1TBPA 1NA8A 1OM9A 3H1ZA 4PY5A 3VN5A 1NH2A 3ASMA 4ROEB 1QN5A 1W80A 1QTSA 1QN6A 1YTBA 4ROCB 1GYUA 1GYVA 3HS8A 3OC3C 1C9BB 1MP9A 5IYCP 2Z8UA 2D0AA 1IU1A 1QTPA 3ZY7A 2MJ7A 2YMTA 1QNCA 1NGMA 1NVPA 1YTFA 3EIKA 1E42A 1R4XA 3ZHFA 1KY7A 1AISA 1VTOA 1TGHA
chains in the Genus database with same CATH superfamily
1MHCB 4YE4L 5L7XL 1ONQB 3LOWA 5EF1A 1H0DA 3JTTA 4W9DC 2Z93B 4ZOEA 5DLML 4Y4KC 2VDQL 2X9ZA 4IRJC 4PGDA 3Q2CA 4Q9QL 4WDIA 4WHCA 1OT1A 3MNWB 4GRLA 3PWNA 3WUWB 4DKAA 1FZOA 4IS6A 3BDXA 4L3EE 1RZJC 4NZ8A 1JGUH 4YH6A 3QG6B 4W9GC 3PV6A 1C4GA 2JCWA 1PDKB 2B9BA 3VWKD 4PVNA 3SZ6A 2F5BL 2H6OA 1BEYL 3L54A 5AUMB 4JK0D 1VTLE 1YEJH 4MJ5B 1MKFA 2WLYA 5GRXG 4EN3A 5I15H 1GC1C 1BX2B 1YMMB 1NMAH 3IXTA 3K8LA 4HP5A 3ZKMD 2G2RB 1CICD 3ML8A 3OAZK 5IVNA 1SN2A 4JHUA 4ANWA 1V3KA 1A21A 3ATDA 3KYOA 2LQRA 1DN0A 4FS0A 3UC0L 3ULUD 3C6LD 5KUMA 4X4MA 3RVTD 5D7LD 3S88L 1Y6NR 4EJZA 3VXMD 2NDFA 3AB0C 4M8RA 3QYMA 1I8IB 3HKZA 2VDOL 3Q8CA 4J8QA 1M1XA 3FOLB 4AZ8B 5TGBB 3CX5K 5EOQH 3DPUA 3K4AA 1YQ2A 5TE6H 5C08D 5B1JA 4MYPA 1MWAL 2VLRA 3UMTA 5LNDA 2QDVA 2MOVA 4YE0A 2X6BA 3DO7B 1IKNC 5E95B 4JDZB 4R5VA 3WAKA 1QTYT 4ZFOB 1XTMA 1EWHA 1S2EA 3RDJA 5JQIB 1KJMA 2CHXA 4FQIL 4NOBA 1S7SB 3P9MB 4X9YA 4N1HB 2DQHL 2IFFL 3Q5TA 3QXVA 5FYKD 3RBGA 3U0TA 5KS9B 3BZ4B 3IMWA 2VDKB 3AVEA 2VR6A 3BHBA 3QEHB 2R0KH 2V3FA 3FUNA 2P8PA 1YMHA 3T8MA 2G3XA 4KGLA 2GTZA 5DK2A 3EGDA 3UIYA 4KKPA 2EE3A 3KLLA 3S0PA 4NP9A 2BOLA 3U6RB 1OGAA 2GPZA 2R83A 4GMTH 4RSYA 5M94B 1FA4A 2YMOA 5TF0A 4HXBL 4O02B 3ARDA 1NDGA 1HYSC 5LGHL 3ZUCA 1XSKA 1HNGA 5E8EB 4GKOA 2LLNA 3L4XA 2VERA 3CH1B 4NO5A 1S7RA 4OJCA 4G8GD 3SBWC 5DQ9A 5EZLB 2ZWLT 3DYOA 4MA1B 4X4ME 2N0KA 4HHGA 5ADOL 3VFPA 1NVPA 1N0XL 2ZD0A 2P28B 4HGKC 4Y4HD 2BZ7A 3CNKA 2UZIL 2GQHA 5DUPL 1IGMH 2YXWA 4DK5A 5HJDA 5HYIA 1A5FH 5AOIA 2VLRE 4KKCD 2AJYH 4JKLA 5AZEL 5HHQB 4JW3A 4K71B 4JRFA 5EZJB 4Y1TA 4LQFL 2XJLA 3P0GB 5EU7E 4WZSD 3GNML 3L2LA 4LU5L 4QO1A 5KVGE 1M3HA 1V7NH 3V0GA 1X5GA 3MRRB 1G7QB 5TDNA 1S7VB 4HK3J 4I0KA 1YEIH 2ICCA 4F33B 4ELMF 4MNQA 5DC4B 3R06B 4PJBA 4KKBD 3D09A 1FBIH 1R46A 3LN5B 3FN0H 4M5TA 5DD6B 3NABL 3D9AH 4NAQA 5C0CE 3DX9A 1NAML 1OGAE 3BIKB 5A43C 2MEJB 1W8EA 4M9PA 2FWOA 3MMEB 5IVXF 3GXUB 1T1YA 1PVHA 2RH0A 3DGGB 2VQ1B 4HH9A 4GW4B 3GHEH 1MCRA 2CMRL 4LPYA 5FYJD 4C55A 1TEGA 5D2LB 3KPRB 4KK9D 6FABL 2AS5M 3ZT7A 5B3JE 2PWGA 2VLJA 3GSWA 3LQZB 5DRXB 3E7JA 3UTSB 1WTGT 3ABGA 3HC3H 1U8MB 4LCWA 1XH3B 1ORQB 4HX1B 2PCPA 4XPAL 4XTRC 1IGFL 1VCBC 4AYDC 4HJSA 3V4PL 5M95B 2Y1VA 2QQNH 4O2EA 4JFOB 3MUGB 2IOMA 5JO5B 4XI5C 3EFDL 3BCFA 3UGUA 2NYKA 3VXSA 4S2SA 1Q90A 4U1JA 5EUKB 4BFNA 5DMKA 4LO9A 1FG9C 5E0QA 4P2CG 5F7EH 2H9GB 1NM4A 4LGRB 4FE9A 2ZXCA 4H7VA 5D72L 4PW3A 3BYTA 1EEUA 1ZAGA 5D5MB 5FIEA 4EI5C 2IPKB 3HAEG 3ZE0E 2PXYB 3FB6A 4MNQE 1DLHB 4PJBE 5E6ID 4F57H 4XVTL 5DRWB 4OV5A 1G7PA 2YJQA 1BREA 1RZJL 3EIFA 3AXLB 4G71B 5J57B 3W0WD 4P23A 3KYNB 2BM3A 3U36A 3Q01A 3O41A 4L9LC 4LVNB 1IKOP 2CRZA 1ROCA 5KZCB 3FULA 1F4HA 2AXHA 1QNCA 1ZANL 1RIHL 1GC1L 2WUCL 3K72A 3LIZA 4PRBA 1A4JA 1JHKL 2Z31D 5EPMB 2ARJQ 2C3XA 1KCRL 1U2CA 3SJVA 3HI5L 4LCCB 1F8TL 4HZLA 3REWA 3OJDA 5BJTB 3TO2B 3GMOA 4LPCA 2VLJE 1ZK5A 1G7MA 3EYFB 3SE3C 3UPRA 1EANA 4WHTA 2XSKA 4GIAA 4LCWE 3KPOA 3D39B 1QLRA 2BVPB 4LASL 4XPHL 1RULH 5ICUA 3U4KA 1XF5A 3KLSA 4UILH 2QV4A 3IEAA 5DT1H 1YLBB 1CI5A 5D4HA 4JM2C 4LSRH 4AV5A 2GHWB 3G5XB 3MR9A 5H4YA 4IJ3B 2Q8BL 3KM1A 3VXSE 4YAQA 2XV3A 1IC4L 1TZAA 2X70B 5JOPE 1DQKA 1N12A 3IYLW 1I1CA 5CJOH 4DGWC 3D85B 1NCCH 3PWVA 2J1ZA 2CE6A 1HZHL 2FBJL 5I5MA 1GTFA 2QGDA 1J1PH 4TRPH 3RX7A 4X9BA 1QWUA 4K8RL 2FJGB 3RA7H 3DBXA 5I5RA 3WIFB 5JOEA 1OE1A 4O2CB 1TZOA 4K7PX 2OMUB 1CLYH 2HPOA 3BDYL 3ULSB 3MRCB 4X6FA 4AQZA 2YIHA 3PQYA 2GI0A 3BAWA 1S7XA 2BIQA 2Z8VC 3HLAA 2AK4D 1L0YA 2IF7A 3CPLA 2ZTBA 5IG7A 5JHDD 5BXFA 2IADB 1QI3A 1K5NB 4NUMA 5FC9A 5FYLH 5DA4A 5IBTL 3UO8B 2NTSP 4NFBA 5CLYA 2JB5H 3K6IA 4M5ZL 5T1LD 5GS2D 1FFTB 5FM5O 5EIIG 1I8MA 1ETJA 5F97E 3LRKA 2ODIA 1QSEA 4OCRH 3SJVE 2XQYK 3FTWA 5L0QB 3BVTA 3W1ZA 3ILQC 3SQOL 2MCG1 3P3YA 4KJYA 3AS2A 4UT9H 2FATH 3T04D 2KQNA 5L9DL 2C9RA 5AG9A 1T3FA 4L3EB 1LWJA 2A5UA 4EI5A 1FYHB 3UACA 2PTTA 3F83A 1QLEB 1NZRA 2WTRB 4TVPE 1A9VA 5KG9A 3P77B 3GI8H 4XPBL 1RK7A 4P46B 2F5AL 4QMEA 1CDHA 3M86A 4JDTL 2VL5B 4XVJH 4JRLA 5IW3A 2VSCA 4G59C 5HHXL 3VU1A 4O9HL 1IU1A 1IEBA 3NJXA 3PGCA 1GW6A 1F02I 1LO4H 4NI3A 4P9HH 3IMTA 3PQYE 4HIJA 1FVDA 3INOA 5FUZH 3GLAA 1ZA3B 2WWKT 1NOFA 1VACB 4LGSB 5FKAB 4UBDC 4UQEA 4Z8FL 1VIWA 3BP5A 1XF3B 2J1KA 4KKAC 2UX6A 4LEOA 1KN2H 4O5LH 3PFQA 3ARGC 4ICXA 4DCQA 2IGTA 5IFHH 1R47A 3AREC 2VISA 1N2RB 5CD5C 2APWA 3T6WA 1BVLB 1EO5A 1DE4A 2EKSB 3U0PB 2CKNA 4PJGA 3VFUB 3VD0A 5E1GA 1QSEE 4OCXH 5GRUL 3V6BR 1H0DB 3VFTA 2ED7A 3V52H 1MNNA 4OBRA 2EH8L 4PGDB 3WMSA 5KJ7E 2Q76A 3P02A 5T5FH 1HI6A 4GRLB 2FLBT 2C9UA 3PWNB 1TVHB 4NWTH 3RY6A 2XVLA 3PV6B 2Z0BA 5EIQA 3RWGB 5ANMA 3WFCH 4YIQB 4HJTA 4QWWD 5KYYB 2QKSA 3O8XB 4EN3B 5E8PA 5FFLA 1U6AL 3QFJB 3IXTB 4P3DB 5AVWB 3ARPA 3GJFH 3MLZL 4K94H 4QHMA 1F4AA 3FH7A 1DN0B 3HZKA 4XXCA 3MUJA 2AMGA 4QT5A 1BVKA 1IAKB 3QI9C 4PBVC 2FO8A 1W72L 3BEVA 5HSHA 4BFEA 1XH2A 3O6FD 1ZVNA 3B7TA 5IBUB 4NQDA 4OD3H 5AAWC 3AM8A 3ZE1E 1U9KA 4YXLL 3HZVB 2VLRB 2EXSA 1BFVH 1WHOA 4Q9RL 1RIUL 2JKIS 4G42B 3NACH 3TP4A 3LVTA 1AHWA 4NGHL 4TPRH 1TR7A 3U25A 3SYAA 1ZMYA 5ID0B 1G6RB 3FTYA 1C7SA 1VADA 1HCFX 4BH7B 4JO3L 2AEIT 1F4YH 4PJGE 5C97A 3F6LA 2YRZA 4KXBA 2FB4H 3QO1A 2RGSA 1M57B 3U0TB 3RNKA 1A9EA 3N91A 3RX8A 2WVVA 3BHBB 3HZMA 2F58L 4GIOA 4E2OA 4FXGA 5F6HJ 2CXGA 5DO2C 3DO3A 1MFCL 5DK2B 1H8LA 3EGDB 3FB8B 3J27A 5C0CB 2XTLA 5CFHA 2V9QA 5I75B 5ANME 1GGBL 5TQ0L 5I73B 2JQZA 1I3GH 1JMZA 1ED3A 3HE6A 2B5IC 4BEIA 1TQWA 2EDEA 4KTGA 3ARDB 1NDGB 3CSYB 4Y5XC 3NIGF 2PP7A 4XO4A 3L3DA 2LAGB 4KI5C 4Q4EA 4H88H 1S7RB 3GRGA 2F0CA 2W60B 3WFZA 3T1WA 5DQ9B 1X5MA 4BCZA 4Z5RA 2XRAH 3VFPB 3L7FA 4LLQA 4GSUA 2EDYA 4LLWB 4B9PA 3S97C 3QZMA 1BIHA 3RFZC 1MJ7L 4NQDE 5I28A 1TJGH 1WQAA 1I1AC 1ES0B 4FLQA 5A1AA 5F7LB 1YMMD 3EBAA 4OD1L 4OGAC 2I5YL 1JVKA 1VOLB 3FCGA 4HG4J 2QREA 1YA5A 2D8KA 2OZNA 1LP9B 3HR6A 5AW5B 4GBXB 4EZKA 2BFVH 3AGVA 4QO1B 3FAXA 3HVDA 2BSEA 4A1RA 2QR1A 1S4IA 4RGNE 3PLYA 1GJIA 4KO7A 1LEGB 4FNUA 3VVVA 1M56B 2DPKA 1YUHA 5TDNB 3P0VL 2HMIC 4QDGA 3ZE0B 5HYEA 1USQA 4PJBB 3H54A 2VMFA 3TEYA 1QN4A 1BSIA 3QG7L 4TUOB 3D1MC 1QFWH 1QYGL 1A6AB 3DX9B 3MRIA 3TM6A 1U8PA 5HI3D 2OSXA 1Q9WA 1U91A 1R3KA 2FWOB 4X7SL 5EG6C 3VD2A 2BLFA 3U82B 1TVBB 1CPUA 1T1YB 1N3AA 3QULA 1ZWIA 3SYOA 1M71B 1KOAA 2Z65C 1IBHA 2YPKB 1BJ8A 1KENL 2XHNA 2JJTC 4K3DL 4YX2H 2XIIA 4G7YH 2WLMA 3FFCB 2VLJB 4IGBA 3VMOA 1KLUA 1PLCA 2O5YH 4O00A 1P9MA 1JGDB 2BZDA 3ETSA 1GTNA 4XNXH 1OPGH 4TOYL 3OC8A 4Z7VB 2WLZA 4HOXA 5DFAA 3QYCA 3WFDH 1ZGLB 2Y22A 4CN6A 2FEJA 3VXSB 1TMQA 4S2SB 5T3XH 1WQVT 1YQRA 5C7ZA 4WQOA 3Q13A 5DMKB 1IQWH 3ETTA 4NN6C 4EN2A 3FNKA 2IH3A 3VD1A 1FI8C 2X2JA 2FIRT 4NO2A 1RUPL 1SFHA 3NJHA 4XODA 1QO3A 3OG4B 1SZNA 2XN2A 3QJZA 3U7YL 2Z0FA 1OP5K 3B7RL 3VXUA 1QSZA 1IGYA 4DEPC 5D7SL 3HG1A 1KNOA 1HNYA 2J3SA 1G7PB 4HWZB 4P23B 2HH0H 5A2KH 3U36B 4PS4H 5IB3A 4PRHD 3O41B 5AVZB 1WWAX 4GKSA 2NSXA 5E6UB 2IBBA 3HTLX 3VWJA 2ENSA 4XNMB 3SQRA 2XZZA 4PRBB 5D6DC 3K72B 4HISA 1A4JB 5I8KL 2Q3XA 5JIKA 1IGIL 1KTLA 3QHZL 3SJVB 4D0DA 3D33A 1VKXA 2WQ8A 4G7RB 4JG9A 2HKFH 2FX9H 1T83C 4UV7L 2DMBA 1AZBA 1NCOA 3CK0L 2DQEL 3GMOB 3W81A 2VXVH 3OVUB 1KBGH 1WISA 2OKMA 4WHTB 1U58A 5J3HC 1PZDA 3K4DA 3IDIA 3KPOB 1QLRB 5C6WH 1XF5B 4X8XA 2HWZL 1QI5A 3T2NH 4DQOL 3KM2A 3N3EA 1J0ZA 2F15A 3MR9B 5GGVH 5BRQA 3AS1A 4PUBL 2VDNL 1MVFA 2FCBA 4YAQB 1T4WA 2R0ZH 1ZGLM 5ADPH 4YHNA 1PPIA 2ZG1A 5FHAH 5CEZD 3KPRD 5GS0L 4LKCA 4YEEA 1SRDA 1AO7A 3DBXB 2VE6A 3LV3B 3H7LA 4TSBL 4J8RA 4MXVF 5E5MA 5GGSB 3UTSD 4FFZA 4Y7OC 4N2CA 2FSDA 4X6FB 1XVSA 2BXZA 3PQYB 4KMLB 3VXUE 5IEKB 3D12B 3HG1E 4U7KA 3HLAB 3HI1A 5IG7B 4OQ1A 3E2HC 3ABKB 1A3LL 5DGQA 3D0VB 5D6CA 3T8XB 2NSMA 1I3RB 2EUZA 4HLJA 1KCVL 2KLTA 3Q3GA 3QFDA 2D3VA 3NH7H 1FLRL 3BPOC 2MPVA 2X89A 2BIPA 1LLAA 1PVSA 4PD4K 1KEGL 3MLTA 1A9BB 1QSEB 2PXYD 3FONA 4Q56A 4HIEB 1OARL 4RBPK 5IQLA 2GW5A 2GT9A 2V9TA 1TQVA 2A4EA 1VZGA 2OL3B 3DX7A 4L48A 1FORH 4E41B 4KJYB 3ZYOA 1MN4A 3FQRA 2MKLC 1JD7A 5INDA 3HB3B 4JRXA 1GYUA 4WNSA 3T5WA 2PTTB 1WICA 4OI7A 5KG9B 2A2QT 3ECVA 1UWXH 4CKQA 3IN2A 2OR9H 4LNVA 3T3PE 5B3NA 4PP1C 4PJEF 4XNYL 1UXSA 1A2YA 4QGTA 1AO7E 1VFAB 2PW2A 3PGCB 2BY1A 1E2ZA 3BWUC 2NXYC 4DZBA 4HIJB 4MXWH 4JO4L 3F0ZA 1FVDB 2R2BA 1P0SE 4GRWH 3QZOA 5HBBA 1TFPA 3LNHA 4HIXH 4JFEA 1U3YA 2V17H 2XTJE 4Z76B 3BP5B 3QUZA 1IE5A 1BYNA 1UWFA 2CIKA 1ZT7A 4G6FB 4LEOB 4Y9CA 3DX1A 3WHXA 2IIJA 12E8H 1LVEA 2ZXEB 4DCQB 4DF9A 2AJSH 2VISB 4FL4B 2F7QA 4UINH 3NFNB 4BD4A 4V2CB 1IVLA 2E7MA 4ZDHA 2DB8A 2CBQA 4ZUTA 3SDAA 2V7NA 4JDVA 1YN6A 3QQ3B 3GRWH 3VFTB 3CVHA 2BOBA 4FTDA 4N28A 2DIEA 5JZ7D 3C2AH 1UGNA 3IU4L 5F6HI 1DQLH 3AMKA 1HI6B 1T5XA 1AVAA 2TAAA 4NZRH 1NUNB 2VZVA 4ZW6A 1JGVH 1AZZC 4UAHA 3TYGL 4JRXE 4TQIA 4M6AA 1F42A 1YEFL 4HOZA 2CDGB 3V4VL 4NAMA 2DYSB 3WO4B 4N8CL 4NX0A 3VX0A 2WV3A 2YA2A 2ZJSH 4UQ9A 5CN1A 1NGQL 5CBEB 2AQSA 5E8PB 2EXWC 1B0GA 2FR4A 3FT4B 5HHOA 1U42A 4P2OB 1RZKC 3U2SA 3DRTA 4ZFZA 4JE4B 4HDIA 1AQKL 4QKXB 1BWWA 4L3ED 1BVKB 4RDQF 3OKMA 4D9LL 1FN7A 5EOTB 3UBXG 4L0PB 3MGTB 3LTVA 2DIJA 3D6GA 3AT8A 4JFEE 1EXHA 4P46D 2V33A 1H3TA 4E9TA 5G4OA 1F4WH 3FRPG 4BZ2A 2V5RA 3MRFA 4YBHA 4QJ4B 5F72S 2XQBL 1ZS2A 4CAGA 5I0WA 3FUMA 5H37A 2E7LC 4AITA 3QUXB 3VD4A 4NWUH 3VRIA 2BSRA 1OM3L 5I6KA 3D2UA 4EAJA 4P5SA 2AK1L 2BP5M 3RNKB 2VZUA 1A9EB 1IM3B 1SMAA 2VERN 3IKKA 3QDJA 4OJYA 3S37L 5HYJA 1TNNA 4FXGB 2WN3A 4IDJH 4YHLL 4HH8A 4KQ3L 2DYPB 5HDQH 1MCNA 3EHBB 2KZBA 1FV1A 3IGAA 3SOBH 4CADA 1NANH 1DQMH 1TEYA 2FEEI 3U4EA 2WXQA 1CS6A 4WFED 2Q6WA 2WJ7A 3ZPDA 4YC2B 1QATA 3V6FB 2QPDB 4E36A 3KTUA 3N04A 3B3IB 1ED3B 5HJBA 2AEWA 5HHOE 2BSTB 4WHYG 3NP3A 4I3SL 2Z4TA 3L3DB 3PAZA 5E8DH 1H8NA 1CLZL 1KN4L 2R69A 4LRIC 3EKCA 3IJYA 2P1YA 1OGPA 2IOOA 4OZFA 4Z5RB 1JPST 3CZLA 4FQJL 3L7FB 4LLQB 5ALBH 4DKFH 3L5JA 1NMCB 5B4MD 1ANUA 2Z92A 3AROA 4DP5X 3O8XD 2ADYA 5CN2A 4KRLB 4EN3D 2MCMA 3OSEA 4GRWF 3QFJD 1MRFH 4LPTA 1FNGA 1BQHG 4BWUA 4LSTH 4ONOA 3DTXA 3WFBL 4ES8A 3HE7A 3QS3A 4IKJA 1SEQL 1N6UA 2Y36H 1M7XA 3V5HB 5EU5B 1F3DJ 5EEVA 1E5CA 1ZS8B 1W6LA 4DO6A 4OCWL 5F8RC 4N20A 4M8VA 4FHJA 3U0WL 5FB8A 4JPSA 4WSJA 4CW1A 1YUHB 3HBPA 4J4PD 2IMMA 1GCFA 5CZXC 3WKYA 3VXTA 1JCKA 3CN2A 4NUPA 5H2BA 3AC0A 3QDJE 4F27A 3GZKA 3EFOB 2Z7YA 5HYJE 2VLRD 4O51A 3QHFH 2IGFH 5T3ZH 1RK1B 3NCBB 4W9KC 4Z0BL 5EF2A 2BVOA 3TBWA 2ADJB 2MNJB 4X2UA 5AYUL 5FOBB 2NY1C 3GPSA 4G83A 2DQIH 4PWKA 3ELAT 3MRIB 1TZIB 2LTQB 3SE8L 1U91B 2QSCL 2ERJC 3GSRA 1R3KB 4OIIL 4Z0XA 3IXAB 1RZIB 5GGTA 1NUFA 3F65A 4KZ0A 1RURH 3GIVA 3L2MA 1MF2L 1INDL 1ID2A 4R9HA 1ZWIB 3F5WA 1AG6A 2NQ3A 4Y88A 1E5BA 5C0AD 1KTJA 3X3GL 1CQYA 3V0JA 5F9OL 1MCOH 4J1UA 4AGPA 3ESVF 5DUML 3FFDB 4IGBB 1KLUB 5C0CD 1DBKH 4PH8A 3U30C 4OLYL 1EO8L 1T0NB 1G9NL 3FB5B 3RTQA 4DGIL 2BHZA 4F2EA 3TTYA 2OQJA 3PHAA 4GAGH 3MLYH 5E5RB 4HPOH 1QN6A 1OAUH 3N43B 5CINL 1NFDF 3KPNA 1RZ7H 4D9RE 3JUYA 1CXFA 1H19A 1UCTA 4MA8L 2E9JA 2VXUH 3T0DA 4DP6X 2PWDA 1EA9C 4Y2DA 1DUYA 3DV4A 2R1XA 4TULL 3CHPA 5E4IA 3ZKND 2IH3B 4NO2B 3A23A 5CCHE 5IVXA 3L3OA 1XQ4A 3ESMA 3FBQA 3VXUB 3N5AA 1IGYB 3P0YL 3B5GA 3HG1B 4GEJA 1D5MA 1B6UA 4PJDA 4WI4A 1KNOB 4FMKA 1YPZF 3Q1SH 4FI6A 4PCKA 4AKQA 1TYEB 3RVWD 1J8KA 3OPZL 3TC9A 2B0SH 3DDFA 2V2WA 1R5IA 4GKSB 3QJFB 4GBXD 3IDMA 4JREB 1AMYA 1YQKA 4ODSL 1QSFB 4NC1E 2CDFA 2AQTA 1RZKL 2XOTA 3SQBA 1VKXB 1UQSA 1DANT 2OJZH 1S46A 3RJDA 1CBVL 1ZTXE 1DVFC 4IMKA 1UKSA 2XCMC 2ARJA 1XZWA 5L7XH 1BDYA 2E56A 2O5NA 3HS0A 3IJEB 1BIIA 1U58B 3ZX1A 5C0NC 3IDIB 3RDTD 5JTWA 1YNTB 3UH8A 1PCXA 1CI3M 2F7RA 5E2JA 1PEWA 1Z5YD 5SWSA 4CVZA 1BP3B 1Q0EA 2PN5A 1YEGL 2CM5A 3OXSA 4WKZB 4BUQA 2VR7A 3B3BA 1DR9A 4EXKA 4YHNB 1GGUA 5I24A 2J8UF 1BEYH 4LKCB 3CFTA 3ZDYF 3FFCD 1AO7B 3HVNA 4N8VA 2DQCL 2VE6B 4NQSA 5DVLA 1WC7A 2FBRA 3ENOC 4XNBA 2NY5C 4J8RB 5E5MB 5IVXE 3VGDA 4X7TA 3AWFA 4B9ZA 3B34A 3PUCA 2Q2LA 4HGMA 2OMNA 4PJDE 3WNKA 1M2OA 2WGXA 3L95A 3HI1B 3LH8A 3S88H 2XTJB 4K2UL 3QJRB 3VXSD 5D6CB 2E9GA 1L7TL 1VDGA 4HC1L 3ZGHA 3TASA 5F7UA 3CHSA 1NBYA 3WGUB 1SFDA 4DN4L 4LOEA 4KQ4H 4M93C 1MVUA 3C08H 3Q3GB 3KVQA 1H15A 4B7LA 1H3VA 1UUNA 9CGTA 5CXPA 4MDIA 4QRSB 1IC5L 5CP7B 1H8SA 3IGKA 1MW2A 4YLQT 1A1NA 4J3VA 3WFEL 4WJG3 4FQIH 2GT9B 1J18A 3MV9A 1NANI 5FHBL 3DX7B 4N8PA 3OKYA 3EH4B 1XR8B 4L8SA 3MKGA 4I3RL 3QFGA 2IFFH 1DUZB 2X09A 1CLOH 1NIAA 3FQRB 3JWNE 4UWQB 5INDB 1BAGA 3PHOA 4I13B 4JRXB 5L2JA 2X4QA 5B7EA 1F97A 4H0GA 2ZUQC 2E27H 1M6OB 5SWSE 1CD8A 4PS8A 3PAVA 4KK5D 5D1XA 5MI0B 4BK5C 3A6CL 5D70H 2DQMA 1YYCA 4FYQA 2YAOA 2DWEB 4N2LA 1A6VL 1ZE3H 1I3UA 3O2WL 4P99A 2G3ZA 3AU0A 1JHLH 4ZO8A 2ATKA 3UBGA 1ACZA 4AIZB 2PW2B 4FQLH 2R0LL 4MQ7A 3TT1H 5BV7C 2BNRA 2FO4B 5AW3B 4MS8D 4ZFGH 4AQ8A 3TBBA 2EC9T 2WW8A 3N06B 5JIHA 4JFEB 2AGJL 5ADOH 1JI1A 4PGCB 1N0XH 3TEZA 3RPJA 4FC3E 4KJWC 3A6BL 2EDXA 1ADQH 2CIKB 1YJDC 1ZT7B 1IAIH 2HFEB 3UZQA 3WHXB 2I85A 4HF5L 2FX8H 4JDEA 5B1BB 3CFKB 5AZEH 3P3SA 3HW7A 3QCVH 4FX5A 4K7FA 1P7HL 4ZUTB 3SDAB 4JDVB 1BXXA 2J25A 4BKLA 4LQFH 1BF5A 3HFML 3KXFA 1UZ6F 3GNMH 3MV9E 3QQ9D 3BUPA 4LCUA 4BA8A 1T5XB 3MRQA 3D69A 1S9WA 1UHVA 2V5YA 3NIDF 2GK0B 2EIKB 1YVLA 2BIIA 2AEPL 3EBGA 3QZBA 2YD2A 3ZUNC 4J6IA 4KJPC 4NBZB 4PCSA 3GF8A 1PZBA 5D1XE 3THML 2R59A 1QSED 3NABH 5I74C 2QMKA 2M2DA 4JN1L 4PLNC 1MSPA 3CFEA 1B0GB 2OTWA 5F1OB 4QAMB 5HHOB 2QQKH 3U2SB 4WI7A 4E41D 5IR1A 3DRTB 4TVUA 4PJ8A 5DEGA 4ZFZB 4EVNA 1JD9A 2IWKA 3CWUA 4HDIB 2NY2C 4MKMA 2AVGA 3ENCA 5I82A 4AE1A 2DTML 2FX7L 3ARQA 3HB3D 2W9LA 3MGAA 3OKMB 2BNRE 5AW0B 5TE4L 5K33A 3LCYA 2CMRH 1KXQA 4FNSA 3WU1A 6FABH 5DEFB 1F6LL 4J3OH 1N68A 1U8QA 4JBSA 4N85A 1JNHA 4YDLC 1LK2A 3MRFB 4XPAH 5EN2A 4XCNA 1IGFH 1RUMH 3A24A 3HHMA 1CGWA 2Q7NA 3V4PH 3RPKA 3UP6A 2F54D 4RAUA 1JFHA 3SIKA 1QRNB 4Q6IA 3BFQG 3UCRA 4Z7AA 2ZUSA 3APMA 3BVVA 5IWLC 3KXFE 3GLDA 4NYLB 3HNVL 3INUH 3LZRA 2EECA 4QHLB 4ACTA 1HT6A 4LB8A 2WXPA 3QDJB 2Y2TA 1DJIA 3L5WA 5D72H 2F68X 3RURA 5HYJB 1W8OA 1EMTL 1Q0YH 1P7QB 1A3RL 3K6DA 1G7LA 1F1AA 4R2GB 1FV1B 3IGAB 4CADB 4GAAA 4XVTH 5J13B 3O4OC 4C8XA 2VN7A 1I8KA 3QH3B 3V0VA 4OZIA 3EIKA 1JXDA 4U1KA 1KCLA 2GSMB 3BSZL 4OIFA 4WWPA 2ZKHL 4UTAL 1WPCA 1RIHH 3NSYA 2WUCH 1GC1H 4ZZFA 2NY5L 3HC0A 4OZFB 4NHCL 1KCRH 3SDCC 1HJBC 3KW7A 3UPCA 1GYWA 1F8TH 1KXQE 2VTFA 1KYDA 3IETA 1G0DA 5IROC 3IE9A 2Z92B 5JQHC 3FDWA 1RZ8A 1UM5H 2CJUL 2CBOA 4XBEL 5K9KA 3CQFA 3UADA 2P8LA 4P2OD 4LASH 3HE7B 3ILPB 2IXQA 4PRDB 3OKLA 2V5TA 3C60C 4DT2A 3VTAA 3AG2B 1VSCA 5GZNC 2Q8BH 1D6VH 3RVVC 3B9KC 4POYA 1IC4H 2ATPA 4LOFA 2BY3A 5FB8B 4NZFA 2DQDL 1IJ9A 3MRDA 4A7GF 4IIZA 3VXTB 1C8PA 5H2BB 1QW9A 4K8RH 4ZFQA 1U8JA 2ED8A 1D5IL 4W4OC 5D96B 1M2VA 3B7UX 4O51B 4F8QA 4WO0A 3EDDA 5D1QA 4M7JH 5T1KA 2HTLC 1J0YA 4K3GA 1FRGH 5D8JH 1XGUA 1CLVA 4NDMB 1IJNA 1F6AA 5G55A 1RV6X 3X1FA 3GSRB 5I9QB 1IEHA 3MV11 3QUXD 4OZIE 5IBTH 5DVPA 3TDHA 2EE6A 1AOHA 2H0PA 4ZX3A 1P5VB 3DMMA 3P3RA 1IM3D 4LSDA 1JYVA 3F5WB 5JQ6L 3I6SA 1CIUA 1GR7A 5AW2B 2W92A 1MFDH 1W15A 2Y7SA 3IAPA 1CF1A 3IAQA 5FYLE 1NH2A 2IMNA 3CFBA 1XCXA 5BV7L 2DYPD 2CH8A 2K70A 1AQ8A 3EHBD 5A2JH 3NQIA 4JKPH 4PR5A 4X80H 4Y16A 1J8RA 3SQOH 3M1OA 3RIAF 5BOZG 1CE1H 1BEXA 5GZOA 4A2FA 4ELMB 1IBBA 3KPNB 1YJDL 5K1VA 4CU6A 4J3OF 1MFEL 4NNYB 1XD0A 3QRGL 1IL1A 2WQWA 3FZUC 4BGLA 4TNVK 5IESL 1HFUA 2YOAA 4Y2DB 1XR9A 3DV4B 3IFLH 1LWVA 2JJWA 2GTWA 4TNEA 4XPBH 4EOWH 1FSKC 1Y6MR 5BVJA 5KSAB 3GTVA 1Z5LA 1KJ2L 2ADIA 5I1GH 1U93A 4JMNA 1XCQB 5IVXB 1IAII 3QAZB 2PO6C 5HHXH 3NIGE 3EYOA 3CWGA 1H8OA 1OB0A 1N7ML 2FSEB 2TRYA 1Q38A 2R1WB 5D1QE 3C8DA 1S7TA 4IU3A 3GJFA 3EW3B 2WO2B 2D3JA 5TF1L 1R5IB 5FUOL 4FNLL 2YFNA 4MJJA 3UXFA 3PWJA 1UT9A 2FT6A 3IDMB 4Z8FH 3GS4A 4M7KL 4E5XA 4FADA 2CDFB 3KYMA 4BZ1L 2V6HA 3SQBB 1OP3H 3S5LG 4R7LA 4GP5B 3MRBA 1UQSB 1AXSA 2CKBH 3MCLL 2GIYA 4MJ2A 1G1KA 3NN8A 2MIZA 3JWOC 3QXDB 4K3JL 4ES9A 2YKKA 2WC7A 1OE3A 1NUGA 4RFOL 4DGYL 4NO3A 4TNGA 1UD8A 4Y5YB 1I8AA 1K4CA 4LLVA 3EG9A 3P11H 1E8ZA 4UIMA 3SGKC 3DVFA 4PV1C 1P6WA 5SWSB 3SYCA 3NEOA 2DJMA 4LAJH 3IVKB 3OXSB 1A6UL 2NY6D 4WK4B 3ZW3A 3OL2A 3P54A 1ZLVK 3HEIB 3AJ7A 3MRHA 3WNLA 4N8VB 4NQSB 4PLJC 4IGBD 4U2ZA 1TEFA 1WC7B 2PUQT 4U0QB 5LNEA 2CLRB 1L3NA 4X7TB 4A7QA 3FO2A 1RAMA 3GHPA 3CFJA 3FB7A 1DO6A 2VZTA 1D5BA 4M6OH 3VU2A 3CTTA 1YECL 3RE0A 1TZGH 1QEXA 3EO1A 3CDYA 3OBAA 5J06A 1NBYB 1CZ8L 3N0AA 1MUJA 2Q2EB 2PP9A 1EV2E 4HW6A 2KC0A 3BPCA 1DLFH 1H15B 3WEXB 1Q4NX 4F8LA 2R4RH 2YAEA 4BFOA 4ZNCD 4PB9H 2A6IB 3Q8EA 4LHUA 4MDIB 4U6HB 1UJ3A 4RMUA 2P24A 3C5SB 4KRNA 2PMZA 4HSQA 2CO3A 4N0UA 1R3IL 1JZFA 4DUXA 3EDFA 4NGHH 1A1NB 3VXUD 5EDSA 2A9NH 3HG1D 3MV9B 1R75A 3OMIB 1TJHH 2ZP9A 3WO3B 4BM7A 1RSYA 4L8SB 4R90H 1NLDL 5DGRA 5D2NC 1C1EH 1MAJA 2YRLA 2A0LC 1MCPH 4ZI8A 2VSMB 4LLYA 2DKSA 5L2JB 3Q5OA 1VRSA 2X4QB 3I85A 3V2AR 1QSFD 4TUKL 4YSDA 5DZVA 4P5TC 4YDVB 4F92B 1PLAA 4IU2A 5D1XB 3OSVA 1BAFL 5HDRA 4G5ZH 1N6VA 4XGZA 3QDAA 4XOAA 2HX9A 1OF2A 1XCTB 3LRMA 3ZHDA 5JHLL 1Q9KA 2ATKB 2H4EA 3MV7B 3K0YA 4HPYL 1S8DA 2ZPKL 2WBJA 3NA9H 1P4BL 1FYTA 2CGRL 2XX1A 4XHJD 1E42A 4MQ7B 5AFAA 1ROWA 5J7CC 2BNRB 1P5UA 1G7HA 3NK3A 4LRNH 1NPNA 2QZQA 4Y9FA 4PS3A 4ISVA 5FYKU 3JUZA 2DQJL 4TNWK 2BNUB 1J9TA 4Z18A 1RLWA 4KH2A 4X5LA 1XGPB 4O58L 2OSLB 3WLBA 1J86A 3UZQB 1CDIA 2QT6A 3LD8B 3MOAL 1MJ7H 3B9VA 1T6AA 3TIDA 1JDAA 4BFBD 4ZTPL 3OKKA 4WI6A 1ZPUA 3QEGL 4OD1H 4D8PB 4PJ9C 2JKWA 2HFTA 4K7FB 4N0UE 2WXOA 4YBQD 1DN2A 4BKLB 4FFYL 1PGRB 1QZ1A 1RK0A 3V6ZA 3CUPA 3KXFB 5DR5L 4MCNA 4L4VA 4FOMA 4PJEA 5T5NF 4LARL 2F19L 2GBVA 4LNRB 3ZZ1A 5EO9A 4HAGA 4G8IA 1Q0XH 1S9WB 1E4WH 2YRBA 3D69B 4F2FA 2Y7QA 5BW7C 1CDCA 1B2WL 4LF3B 4MXVE 4W9IC 3WJLC 2HVBA 2KBGA 3CXHJ 4D9QE 4BELD 1CFMA 2VLME 2ITCA 3AG3B 1NDTA 4ZW5A 3DSFH 4DVRH 2APFA 1X5YA 2G3MA 3CFEB 4G1MA 2OTWB 2J57A 4BJLA 5T1MA 1ET7A 4KNTA 4L8BB 1JPFA 1PZ2A 2FLMA 4EVNB 1OAQH 2ZAGA 4MX7A 5J6HA 1FYTE 1R3LA 4NSKA 4IOIA 4JO8A 4OCNC 2EVIA 1DL7H 3WTWA 1UM4L 3GDCA 3TPUB 2NT1A 4CNIA 5GGQL 4I8OA 1TJIL 4K3DH 3V8CA 5DI8A 2XA8L 3MUZ1 3MLVH 3S96A 1O7VA 1U8QB 4LAQH 2AC0A 3FSAA 2V5MA 4JPIA 2YK1L 4APQA 1ZVSA 4M4PA 4DUVA 4XNDA 1TITA 1LK2B 3ET9F 1TZHA 3GMLB 5AL0A 5EN2B 4XCNB 3V9CA 5AOJA 4TOYH 4PY7A 3TJPA 1LQSR 1TXKA 2WWMC 4RAUB 4DIXA 3ARUA 5SWZB 3L7EA 4I0PC 2NW3A 3U1PA 4NN5B 4PWEA 1IC7L 4H8QA 5FW8A 3JWOL 1G7JB 4L4VE 1XSIA 4TQ8A 2ADGA 4PJEE 1OW0C 3L5WB 2PWWA 2DI9A 5FYJU 5FYKH 4AX3A 1BF2A 3BAYA 5KSBF 4F7KA 2NZ1A 1MEXL 1G7LB 3N2JA 1HCVA 1QKZL 3PWLA 5GPRA 2IH1A 5AW8B 1CGSH 5D7SH 1HEZA 3OSMA 3MA7A 5JR1L 3WV0A 3KDMB 5HHME 1LXMA 1S3KL 1R4XA 3LQAH 5F0MB 3KVPA 2YD3A 4OZIB 3AITA 1NSNL 1A6ZA 3SKMB 1Z5HA 3JWDC 3ZTNL 3L48A 4FQXB 1BLNA 1JG9A 5J56B 3IDXL 4FG2A 4RGOL 3MC0A 5I8KH 5LDUA 4BUGA 4QXUL 4N3UA 3IETB 1SM3L 2GJRA 3UERA 1WFOA 5E6RB 5BUGA 4KTYA 1RZ8B 3I3DA 4L1SA 5BO1L 1T2XA 3T65A 2JOIA 2DQEH 5CSBA 1JCVA 1O0VA 4X8JA 3ESNA 3WD5H 1RCYA 1PIFA 1SQ2N 2DM7A 2P8LB 1U3HD 2FBOJ 4A39A 2IXQB 3OKLB 1AKJA 2HWZH 3NMEA 4BH8A 4XMLH 4OLUL 4I18B 2Q10A 1KXHA 2AJXH 2VDNH 5IYBP 2VWEE 3GM8A 2X10A 2ATPB 2ZUXA 2WZ0A 2FWUA 1DQVA 1P2CB 3C6LC 2J73A 3MRDB 5GS0H 3RVTC 4KZDL 1IC1A 2HZSA 2AKRA 3NIGB 4EUPH 4OJFL 3HJ0A 3OCIA 2A38A 1M2VB 1R17A 2WWOA 3NEXA 4TSBH 1D5XB 3UYRH 4G1EB 2DD8H 3MNMA 5D1QB 2XZQH 1DIZA 5D7JD 1A6TA 1XGUB 1KIRA 4NHUA 5JXED 1TQCC 5D7IF 1F6AB 3QCUL 3QXAA 1QRND 4U0RB 4JFWA 3OKOA 2WXHA 2D4FA 2B8OT 3DX8A 5LLIC 4TTGA 2XVKA 4B60A 1DQQA 2M83A 1JDCA 5B39B 1ZXQA 2N1TE 1YN7A 4XP9L 5C0IA 1J87A 5HYJD 3BRFA 4W6XB 2GJ6B 1P7QD 3L4TA 1FNEA 1MIMH 1AGDA 3OR6B 4DH2A 2N7BA 5FYJH 3TCLA 3P4OA 3O3BA 3BUBA 4PR5B 1MJ8L 3RBSA 3BN9C 4U4IA 3RFRA 3OAUL 5B7MA 2J4WH 5E2WL 3D05A 5JLZA 2WSKA 3EF7A 3QIBB 5DS8A 1VENA 4YHMH 4DO5A 3WTUA 5DJZB 2WKLA 2ITDA 1IL1B 4AYBA 2W0FA 2Y5TB 2R2EA 1CQKA 2A9AA 3E9TA 3RGVC 1QTPA 2EDKA 3MYJB 3EJRA 4NM8H 1X5AA 2X4RA 4QRTA 1JF1B 1MCFA 1M42A 2XDHA 3KWXA 4WUUD 1OGSA 2ADIB 4R97B 1KCBA 1NCWH 1U93B 5DMGC 5BUPA 3NCEB 3L3IA 4OUOA 1ICTA 2QFPA 4Y4HC 2XFXA 5FLUA 1XL6A 4IBWA 1NMBH 2PLTA 4BWTA 4UT7L 5LJYH 1ZLUK 1LWYA 2F8XC 2E9BA 1SDAB 3HE7D 4G2AA 4NIKB 4JO4H 3GJFB 3BIAX 1UADC 4BGDA 4KKCC 3QE5A 2IAMB 2UVFA 5KVFL 3A0OA 3BD4A 5DSCA 2A74C 4I89A 2X38A 5IFJA 1VGKB 5GS1A 2BZCA 5IK3A 1B9KA 3MZGB 4IRSC 5FO9A 3MRBB 3NA4A 3OHXC 4FKKA 3ZQXA 3NN8B 5AB2A 2QLVA 2VGLM 2YPVH 2OOYA 5DRNA 1IGCL 4KJQD 2JCCA 3JT2A 4NO3B 4Y4FA 5EH1A 4KKBC 1K4CB 4LLVB 4UB0L 3EG9B 4JPWL 4QOKA 3IU4H 4UIMB 3RIFF 1FGNL 3G9VA 3CWTA 2VMDA 5KANI 4CJ1A 4FQCH 2WK2A 2CUAA 1YY8A 3TYGH 1SYSA 1YEFH 3TBSB 4YXHL 2FEDD 2J2ZA 3V4VH 4QXWA 1JNNL 3ARRA 1BOGA 5AL8A 5EUOA 4M7LL 2D03L 1KELL 2YO3A 3N1PC 1GGCL 1ECYA 3SDDD 4Y19B 1LO5B 4BFIA 5HHPA 1ZDQA 4ODVH 1MHHA 3BUDA 4KK9C 3SPVA 3MACH 4IW4C 3CFJB 3FB7B 1PU0A 1HH6A 2O5XL 2HAZA 5ITFA 3EO1B 3B2VL 4GW5B 4XPGH 1GY1A 3LRLA 3ZTEA 2XBZA 3CBJB 3VFNA 4BHUI 3TA3A 4Y2DD 1IBZA 4MYWB 4WTZA 4UTCA 1MUJB 5LGKA 2X7LB 1TSRA 4KC3B 1UACL 3BPCB 5KSAD 2ZCHL 4JQIL 3QQDB 2FH6A 1IM9A 3OWRA 4ORGA 4JG1H 1FAIL 2P24B 4N0UB 4IOFC 5GJTL 3JWDL 1SF3A 4UM9B 1HL8A 2H3XC 4JKWA 3CD4A 2OP4L 4WO4A 2ZWNA 4HGWA 1XIWA 4AYGA 3T0EA 4YHYC 2ZONA 2JCCE 3EBHA 4RDQG 2J8UA 5EOCJ 1PQZB 1EPFA 4N6RB 4EDWL 1VFUA 4Q14A 4QOKE 4LLYB 5IJKC 3D25A 3S37H 1OVZA 5IHZA 3BAEL 2FECI 2Y5QA 4NZTL 4S1RH 4FFVD 4YHLH 3QEQA 4IU2B 1MQKH 4F20A 1PFOA 4XGZB 3EJYD 3ZIMA 4MAUL 3HMWH 4U7MA 1OF2B 2QGBA 2BP8B 5EUOE 4TTDC 1BAWA 4NENA 4WV1A 4XMWA 3K71B 5TE7H 1DVUA 2LT9A 3VXPA 1KCSH 1S8DB 2OZ4L 1EUUA 2WBJB 1X4ZA 1YEEL 4I88A 5CIPH 4HT1H 1P5UB 1G7HB 2BERA 1CLZH 4N87A 1ZV9A 4ZUUA 3H2PA 3MNVA 4R8WH 5HGBB 2AXJA 3NIFF 4KVCH 4ISVB 5AZUA 4TKWA 1EDHA 2QPUA 5SWSD 3SDYH 5I16B 2VDML 4FQJH 4ZOCA 3VE0A 3CHOA 4U4BA 1JVOA 4X8CA 3UDWC 4MAYC 4HZAA 3QWRA 1JL8A 3WLBB 5DK0B 4HYTB 4X42A 2IG2L 5KYXB 2H26A 4MJ6A 2Q87A 1B4JH 2J21A 3TIDB 4AUUA 1KC5H 5LCVL 2UY6A 2KPWA 4XMKL 5D71L 2EVFA 4Q6YA 2A7BA 1SEQH 5IHUH 1RK0B 3V6ZB 5HDBF 4QTHA 3MBXL 1P4IL 2IWEA 1TCRB 3LNDA 3T0EE 3VFSA 1NLBL 4PJEB 2XWCA 1I9JH 1HAWA 2BY2A 3Q43A 2LV4A 4BUHA 3HRZA 4G8IB 4ZAKC 3U0WH 2J8UE 1JZ4A 1R5WA 4C4KT 2Y7QB 4Y5VC 4E0RB 3WKPA 4OGXH 1N3CA 3SDXF 1DVQA 5EOCH 1WBYB 4FZEL 3O2DH 3I6KA 1ACYL 3UEQA 3QARA 2ITCB 4G9DB 5AYUH 4M00A 2ICES 4Q89A 1EDQA 1RUAL 4GOSA 4Q4IA 2QSCH 3SHSA 1JPFB 4KUZL 5F1IA 4YLBA 1A7PH 1I53A 1IT9H 1KT2A 2X9YA 2Z8SA 1LNUA 2ZSWA 4N25A 1R3LB 5J6HB 4NSKB 1MF2H 4LE8A 4CC4A 1QFWM 1P84K 3UBFA 4FLHA 3X3GH 4AM0B 1B0IA 5EEUA 4P4KC 5DI8B 3KD4A 5D1XD 5DUMH 4GKZA 4APQB 1BJ1H 1NKGA 2PR9A 4K7PY 4UUJB 4DGUA 3AG4B 2UZXA 1G9NH 2P9RA 1HAUA 5IIEA 1TZHB 2A77L 4CU7A 3KDPB 1RQ5A 1MP9A 5BZWA 2OXHA 1MFBL 1PKOA 3MV7D 5H94B 4EEEA 1J1XH 4JQVA 1GA2A 4PY7B 2NDGA 4KOCA 3S3DB 1QVOA 4MA8H 3L7EB 2BNRD 4JR9H 4PTUA 1UVQA 5CU9A 4HSCX 3EO9L 4V11A 1HSAA 2AI0L 2EEXA 1T7YA 3QBTB 1GS8A 2AV7A 7FABH 4XP4H 3OJ2C 1I31A 2JWYA 4LBEA 2OJEA 1CGYA 5MENB 5EBGA 1DBJL 2CK0L 3PWLB 4NCC1 4YUEL 3P0YH 2X44D 2Q7AA 4QHUA 3DPDA 4OR1A 3MA7B 2EINB 5C6TH 2OJ1A 5E23A 3JTSA 2YFOA 2VABA 3RWEB 3IDGA 1T22B 3KXFD 5C8JA 3TFKD 1NBVL 1A6ZB 5DC0A 2AEOA 5L4IA 4MKTA 1T20A 3WS3A 4ODSH 4J2QA 3P2DA 1D9KA 4XAKD 3TZVA 4YSEA 2V2TA 4TQHA 3F7YB 4FXKA 4WFHD 5ALCH 5FDYA 3BQUD 2ED6A 5ISZD 2CD0A 1PX3A 4I4WA 2Z34A 3PABA 2QSVA 3EJJX 1OAJA 4APXA 3BVWA 5EBWA 1UZ6E 3FO0L 1BBJA 3T65B 3BKYH 4NUJA 4JKNA 1Z9SB 2P4AB 2CBMA 1N6QL 5EEYA 3GXNA 2SEBB 3NIDE 1AKJB 2PP8A 5C0BD 1RHFA 5CP3H 4HFUH 4YK4B 4BH8B 1K8DA 4EI0A 4C4BA 3VYNA 3RWFA 2WMPA 4L0YA 2OBGA 1W91A 2OMTA 2IAND 4CGUB 4XPTL 3Q2VA 1A7OL 1FVEB 4NRXA 1C9SA 4AQ1A 4KZCA 2AKRB 3MA9L 2VC2L 2XXFA 5SX4H 1ZVHA 4HXAH 2PF6A 2ALAA 2GB2A 4L3AA 5I18L 4F58L 2G60L 2ZE0A 3F05A 4PI2A 3WN6A 1AP2A 4P9ML 1A6TB 1PS3A 3BEWA 3KBEA 2EQDA 4NHUB 3HHSB 3LNIA 2YN5A 3H9YA 5SWZD 3QXAB 5D7HA 3DX8B 5E2VL 3GSNB 4QYOB 2EP6A 3LYRA 1TPXB 2B14A 4GRWB 3QJXA 3DJRA 4OD2A 1JK9A 5C0IB 4QRQA 4NQQA 3TO4B 3S34H 1A3QA 1ZPLA 1ADQA 3ULVE 1AGDB 4XNQA 3TCLB 1C9BB 3O3BB 3O9WA 3HG2A 5FHBH 2G5BA 1NCJA 4JFQA 2AQ1A 1DZBA 5F71A 2QKIA 5JLZB 1WZ1H 3ZHLA 2ZT9C 4A7GA 2WUBH 3RKDD 5DS8B 2BHUA 1NEZG 2JIXA 4NKOA 1BQLL 2VZ1A 4RRPA 4TF4A 2ITDB 1RJLB 3BPNB 1JK8B 2W0FB 2VO5A 3T2PA 3FT2A 4FABL 3REVA 5C07A 4PJHF 4FQXD 3S3CB 2X4RB 1FPTH 3A6CH 5KYUB 1A64A 1BGXL 1KBWA 2DLGA 3W5NA 2VXTH 1M1SA 2BS71 1A6VH 3GMNA 4PIBA 3IF1B 3K4ZA 2F1EA 1HQ4B 3WLWD 2E6QA 1UURA 2VQTA 2XFXB 3QUYB 4G6JL 1XBDA 5IVZA 2C4XA 4QTFA 2UX7A 5D9SB 3R18A 1YQVL 4NFCA 1TQUA 2AGJH 3TFBA 3A6BH 3S2CA 5GGUA 5IFJB 5HDLA 4MA7H 5LO7A 2E47A 5IK3B 3OWEA 4JY5L 4GXUM 4JVWA 1XB3A 4NCDA 3BVNA 5E1HB 3OB0H 2QLVB 4B0MB 5DRNB 4YSOA 2VKWA 4PRPA 5HXMA 2HRPL 4U1LA 3S36X 2ZZUT 3NFSH 4KPHL 4Q11A 4LVHB 2R29L 1SJMA 3M17B 1KIPB 2Y23A 5ES4B 1K5WA 3ZLQC 5G4NA 1CD1B 3B7YA 1QD0A 5A3ID 5F7DA 4XWGH 4EDXA 1LTXA 5IMMA 1J88A 1SYSB 4HAKA 1YPZB 4ILDA 2YEZA 5ECGA 4D0CB 2B1AL 2J2ZB 5E56A 5GISL 5C07E 4PRAA 1BOGB 2GJ6D 4HS3B 4BXSV 2VUKA 1F13A 3THMH 1O9VA 3H3PL 4A6YL 1GIGH 5DD3H 3E38A 4BFIB 1EEYB 1LJMA 5CEZH 5KBPA 1MHHB 3SPVB 4XP6H 3N44F 1PG7X 3BISA 1HIMH 3QIBD 1ITBB 2HB0A 5JUEH 3VW3H 1J0IA 5ITFB 2DTMH 4U3HA 3TA3B 3QIWA 3EJSA 4A67A 1W0VA 3QDGA 4B9FA 1EGJL 2Y06H 4LSUL 4ODUB 5IB1A 3LXUX 4JCMA 5I6PA 3MLWH 2P3YA 3WKML 5A2FA 2JKNA 3EYSH 2VLKA 4NKMA 5DF0A 4J3XA 2VDLL 5BRZB 3MJ8A 1HDMA 3EUDA 1RERA 1JFQL 1UXLA 3EDEA 1UH4A 1O7DE 1CFQB 1EEZA 4PRPE 2J8UB 4B0MM 4CSZA 3HZ3A 2F08A 3HNVH 1PX4A 4OI9A 5DLLA 3ZDYB 5A2CA 5I2IB 4WW2A 4K71C 1GHFH 1XGQB 2EIZB 2IAMD 3D25B 3LEXB 1RVFH 4OM1H 4QTIL 3VH8A 1ZLEA 3ES6A 4AGLA 4TL4A 3VI4F 4B53A 3AY4A 3F6IA 1XGTA 3L1FA 5CILL 4XVSH 5JW3H 3H2WA 3EYQD 1NPUA 1OGTA 5DD1L 5AWNH 2CBPA 2UWEF 4WV1B 3O6KL 3VXPB 2ALWA 3IDUA 2HN7A 4ZTOL 3UPAA 2ZKHH 5IMOB 4KNUA 4EJYA 1F18A 1UA6H 2A9CA 3MNVB 3NZUA 4ZUUB 1E9PA 5J4MA 4JFZL 1TU2A 1BFOB 5KWYC 1Q9LA 1BVOA 3EOTH 3TL5A 1T04A 2VJ0A 4YDJB 5GGRY 4UDTA 1INEH 2VR5A 3QDGE 3DETC 1VGEH 25C8H 2ZCLH 1JPEA 3OF6D 1KLGB 3HBZA 4XBEH 4E9WA 1DJXA 5IHBA 3TURA 4Y19D 1EEQA 4EIZC 1QNEA 2JH2A 1QFHA 4YHOH 1DO5A 3U6XA 3GRBA 3ARBC 3RX9A 3UTTE 3OH6A 4BCXA 5CFAA 2VLKE 3PJNA 1WFTA 4QTHB 4OFQA 3VFSB 2IDTA 4CL7A 2HT3D 1MLCA 3EGXA 3JVGC 1EIBA 1LD9A 2JKTM 4FXTA 4K9EH 3DSNA 4NM4L 5TTRA 3SB3A 4AZUA 2R8SL 2DQDH 1R5WB 1TVDA 5C0DA 1T6BX 1HK6A 3HPLA 3L16A 4XMZA 1V5SA 2AQRA 3DXAA 1UB5B 3TLRA 4PLKC 5HGDA 3I6KB 3FSWA 4GPVA 5GSRA 2WWNA 1S6NA 5E2TL 2OLDA 2RQ8A 2YJLA 3MRMA 3QNZA 3ZL4L 4UM9D 5E2UL 3K7UA 3L1GA 4GMSH 3N1GC 5F1IB 3HN3A 3NDYE 3F6JA 2GBUA 3CFDA 1KT2B 3B6SA 1LNUB 5JORB 2CO4A 1QTSA 3OJMB 5LVEA 3DROA 2PYEA 2ENQA 4JEGB 4OKVA 3LZFL 5BZZA 4HEPA 4OM0H 5JW5A 2X87A 4KK8C 4LVNC 5F3HA 3H9SA 3ARFB 3K2IA 1AS8A 5BV7H 1GYVA 4GKZB 2GC7C 3AT0A 2Z91A 4EI6A 2CKBA 1Q94B 4YN3A 5IIEB 1I8UA 4FFWD 1CL7I 2OXHB 3NIDB 2YPLA 4LCCC 2NY7H 1LEIA 3S3BB 4I3GA 4HIHB 3H7BB 5EA0H 5FOJA 1GGTA 5IESH 4HWEL 4PTUB 4NZUH 1UVQB 4HS8L 4S1SL 3V6OA 2YBGA 3EJZC 5IW1A 4G7QB 1HSAB 3RTLA 1YYLH 4ZQTA 4Y8DC 2AV7B 3ARVA 1E3FA 4C59B 1SLXA 2YLKA 1KJ2H 3V55A 4L4JA 4JLRA 1DBBH 2D9CA 1K72A 4EE2A 1KTDA 3HAEH 4IJ3C 4XHQA 1T7WA 4ZFOL 2BHFA 4QHUB 3DXAE 3C6SA 3PP4L 3G6DH 5I1LB 4M61B 3DLQR 1KTBA 3JTSB 2YQGA 3ZTDC 1KPRA 1OPOA 4PLOB 3ZRCC 3IDGB 2YAPA 4OU3A 5C8JB 3H4HA 3W2DL 1NC4A 4O4YL 4KWUA 3R7RA 3BAKA 1U92A 3WS3B 1D9KB 4TL5A 5T3XD 2V2TB 1F00I 4FXKB 1CFSA 5BW7A 2B4CL 3VQ2C 3WJLA 2PYEE 5JN5A 1AACA 3P30H 3PABB 4I4WB 1O5DT 3MROA 4DP1X 3KPQA 1X7SA 4APXB 5EBWB 5I6XB 4FDWA 3H9SE 5ENWA 2HLAA 3GSQB 1WT5A 2PYFA 3DOIA 4O02L 4N0CC 1BD2A 4YR6B 5CD3A 5T8IA 1KCWA 1ET5A 2X2YA 3PREA 4OJEH 3TU6A 2YPLE 4TSCH 1PZAA 5L0QC 1YG9A 4XT1C 5JPNA 1K8DB 2VL4A 1K2YX 5HY9B 4QXTA 1CL7L 2YMXL 4ODBD 1G7IB 2YA1A 4MD5B 2WMPB 4HCIA 3V6OE 1N59B 2OMTB 2VQUA 4GXUN 3MJGX 4FNPA 2EICA 1DQJA 2BSSA 4AQ1B 4NO0A 4WW1A 1E4XH 3RVXD 4APQD 1OSZA 5EB9A 1JMXA 2G5UA 4HIIA 3QUKA 1E2VA 1AP2B 1YECH 3BEWB 3RB5A 3MO1B 4X5XA 4Y2OB 1NCHA 4AEFA 1QSVA 2EDRA 5MEQB 2G0LA 4JJ5A 1CZ8H 4G6AD 5EV7A 1WHPA 3GO1H 4J3TA 1SOXA 1HKFA 4OD2B 3BAIA 2BMKB 2CO2A 1B0RA 1JK9B 1ML0A 5AZ2H 4GG8A 4IRZH 4QRQB 3L9EA 3SO5A 3UZVB 4L3FA 3GXDA 4XNQB 5MEND 2YEVB 3O3UN 4E9QA 1BZDA 3Q2LA 3OC5A 4JFPB 3O9WB 4G9FE 4FNTA 2CHWA 4JFQB 4JM0A 2X3CA 1E6JH 1EJOL 1MY7A 1NLDH 3L4CA 1A4KB 3MJWA 4PBWD 3FCSA 3MRGA 3FOMA 3ZZQA 3VI3F 2O1AA 1U8IA 4NKOB 4NEHB 1BD2E 3LH2H 4MNHB 3RZCD 3BUYA 3N1MC 5IOPA 2LFEA 1U8NA 3GGWA 4JY4A 3WDJA 3A67L 4MJID 1HXYA 1MHEA 2P80D 3ZK0A 5CZRA 4H4NA 2AEQH 2EEBA 1BAFH 2YAMA 3SD5A 1D2OA 5D7IA 1JXKA 2WO3B 4OIBA 4RVBA 3DX4A 3HHRB 1OZTG 1K4DA 4GRLC 4P8QA 4RGMC 3UCQA 2OMWB 3QXTA 1QHQA 4DW2H 4KITB 4P2QA 5ERWA 4A7UA 1E3XA 1GZHA 2YGVA 2CGRH 2CK2A 4X6EB 3KVDD 5B4MC 4HHAB 3ZGIA 5IVZB 2JTDA 3VWKA 2BJML 8PAZA 3BC9A 4JJOA 1G5GA 1JPSH 4HCRL 1AKJD 4XC1L 4EN3C 2IDQA 1ECZA 4ZPTA 2DQJH 1NJ9A 1XSZA 4EIBA 1CICA 1GS6X 5FWQA 1AI1H 4XC3H 4O58H 2N01B 4AGMA 1QA9A 1OAZL 4XMTA 3TXAA 2E3VA 2XKNB 3MCKA 3MOAH 4JHWH 3DVGB 1X9LA 3GHBH 4JPVL 4OF8A 3V0DA 3BVNB 3RIKA 5HHNA 3VXMA 3QEGH 5FO8B 4UIKH 1GSKA 3RHWF 3N1QC 5HGAA 4FFYH 4U1LB 2DBLL 1IAIM 2N4IA 2X9XA 4HJJH 3V4PB 3WAJA 5L4JA 1KO9A 4XZUA 4AEHH 3ZZSA 2A6KA 1DANU 2F19H 3C5JB 1GL4B 2EO1A 2NR6D 4QXGH 4BHUA 2ED9A 1NGXA 5TD4A 5F7DB 5EU7C 1FL6A 3H0TA 5LGJB 4HV8A 4EDXB 1B2WH 3D4GA 2FT8A 5DDHA 2BXYA 4RRPM 2ADFH 5BVPH 3TO4D 3B8YA 4NIYE 4TSAH 3WELA 2IAAC 3K2UL 5E9DB 1BWMA 1G6VK 1WEJL 3BX7C 4Y4KB 5D7IE 5FA4B 3VXNA 2NCMA 5L4MA 1CYGA 4UNUA 3JWNG 5BPPA 4N2MA 1SGKA 4XN9A 2EVHA 4GT0A 4P2QE 2W88A 5T5NG 4HKBA 3HN5A 2G2NA 2YUWA 1PZSA 5J1SC 3CCHA 2EDBA 5EWIH 1Z3GL 2D7TH 5KTEH 1FZJA 1UM4H 3QIWB 5KAQF 5TQ2H 4UANA 5GGQH 4KY1H 1W0VB 3ARDC 1TJIH 3QDGB 4W68A 4JL2A 2B1HH 4MBOA 4KTEL 4H8WC 1BZ8A 3QA3B 4I9WD 5F1SA 5HP5A 5IB1B 1C5CH 5LQBH 3TV3L 2C1OA 5IYCP 4PMEA 3ULUE 2EJ1A 1IARB 3DTUB 4K73A 2WKGA 3ZKNC 3UTTB 5B38B 4UM8A 3VXME 4NKMB 4F7MA 4Z78B 4CKVX 3KYAA 3QUYD 1WA1X 2GBAA 1HDMB 3QSKB 4Y4HA 5DZPA 2XBDA 1EEZB 4G8AC 3H9ZA 2WO4A 4MD0A 3TJHD 3MZTA 5F6IB 3ROLB 3MXVL 1U8LA 1IC7H 4MCZA 2H1PL 1TG8A 4WW2B 3X1GA 3JV6B 5FA3A 4L9DA 4RQQB 4GW1A 3WY3A 4AK1A 3VH8B 4KDTA 1ET8A 3ES6B 1NC2A 4XO5A 5CLWA 4HWUA 2WPGA 2JK5A 1J05A 4DFIA 3PWPA 4EUPA 4HCGA 1XDTT 4NXKA 2YGQA 5FYKE 2Y3NA 1B9ZA 2D7OA 2G9HB 1FO0L 2H5UA 1T66C 1QN3A 5FF6B 1KGYE 2AXFB 2HVKA 5C1MB 4JY6A 4YGVB 4PREB 3B5HA 1SY6H 4NKQB 4X4YB 5HVWA 4F7CA 1LXTA 4M43L 2V92A 1GPOL 4F91B 5K39B 1E9PB 1PY4A 1QLEL 1TU2B 2FJFA 3PDOA 1Q9LB 1FC2D 2B3RA 3STLA 1T04B 2J71A 3QZWA 1I9IH 5F96H 2BRRH 4UDTB 3T4AA 3D8MA 1QFUL 3K91A 5BO1H 3QJUB 5IKCB 4AMWA 2FQEA 2EC9U 3LSOB 2FUVA 2EYRA 2NQDA 2J5LC 1E4XI 3CSFA 4M6NH 1HILA 1T1ZB 4ZMWA 3GM0A 2VZOA 2HZMA 2OMXA 3AFLA 2B9AA 3QEUA 5F7MC 5L8KB 3MRLA 1Q9OA 4OLUH 4PJIA 3DSNB 1WIUA 3D52A 1NCGA 3TA3D 3BVDB 5KJ4A 2L7EA 2QDWA 1KB5A 4OB5L 3CFMA 4RNRA 3V0IA 5AD0A 2CJTA 4NERA 5TFSL 3ECBA 5C0GA 5E03A 3AGWA 2H47C 5HGDB 2I9LA 4BRJA 1ZJBA 4XN8A 3R8BB 1XZ0A 1K8IB 1A66A 3MLUL 3TA4D 3SOTA 3MRMB 3QNZB 3PWPE 4UTBA 2X6MA 3QPXL 4GAJL 5BRZD 3K8MA 4JZOB 4AC4A 3CVTA 3B6SB 5E6IA 4H2AA 1H3PH 3C87A 1IVTA 1QBAA 1S7WB 2Z1KA 1BM7A 2K4AA 4ZMPA 2VXSL 5CEXA 5IJKA 4QRFA 4P23C 2VLLA 3U7WL 4UOW0 5JW5B 2C26A 3HS8A 3TEWA 4YHKH 5F3HB 4KAQL 3PJSA 4L1LA 5CJQH 4YHPB 5DYOA 3H9SB 4ALAC 1N5YH 2BSBA 1Z0NA 5AB9A 3ALXA 2Z91B 1MJ8H 4EI6B 2CKBB 1A0QL 3TWYA 4H8HA 3FQNA 4KK5C 3BFWA 2Z31A 1E8YA 1F4XH 3QZPA 2YPVA 5T3ZD 1BQSA 4LMQE 1LEIB 2ZNXA 1SYVA 5FYJE 4DJMA 1CDBA 3FQUB 1KXVA 4H0IA 4JG5A 1RJZB 3NEEA 3TESA 1YY9D 3FCBA 4NPKA 2R56L 2OULB 3TBTB 3GMMB 1KFAH 5CZKA 2W07A 4MS8C 5LBSH 4IHOA 3RKPA 4JFFA 4ORZC 4E9VA 5F3BA 3P9WB 2LU5A 3ZDXF 3APFA 2AQNA 5H8DA 4NZJA 2DMHA 2EO9A 1FNSH 4FYSA 3DIDA 3BOVA 1K35A 1ERNA 3LMJL 5L8JB 4B3EA 2VDPH 4UT7H 3AS0A 3WE6A 3U1SL 1MW3A 3NIFE 3BW9A 3WXWL 5KVGL 4ZJ9A 4AIOA 2JMRA 1KPRB 4XN7A 4G3YL 1JV2B 3LZPA 5CCKL 4LPUA 2UY7A 1NC4B 4LSVL 3IWUA 3LKRA 5KVFH 4EI5B 2R2CA 2F61A 2Q7YA 4HQQL 4MMXA 1V10A 4FQQA 5GGRA 1LWWA 1INQA 1CFSB 4CBZA 3QQ9C 1JGIA 5DHVA 2AK4A 4WY7H 5JHDA 1PZ5B 1XH0A 2CIIA 4LQ1A 4XN4A 4GQ9H 1BMZA 4G9FB 1C47A 5HDBE 4ZOAA 5GHWL 4RMTA 5ENWB 4G80A 4UQ2B 2OYKA 3AY2A 3T3MF 2PYFB 4U6VH 2NW2A 5CD3B 2NXZD 1SXBA 4JPWH 1T0MA 4X6CF 4CU8A 5I30L 5KSBB 4HWBL 2H2SD 4H8WL 1MCIA 3CC5A 3PYCA 2EABA 4U1MA 5JPNB 3SDXE 4QXTB 1CFNA 5HHVH 3RI5F 4MGXA 3IFNH 5ETUB 5K9JL 2HXAA 3D50A 3NP4A 4N5UA 4LGPB 2D03H 1DQJB 1KELH 2BSSB 5IQMA 3ARFD 3HB3C 1EHLL 1GGCH 4WW1B 2W65B 1G4RA 1UCBL 1UOKA 2EO7A 1DDHA 4HJUA 1WZKA 4JFFE 3VSQA 2GFBA 2FO1A 2XKSA 3VN5A 3QUKB 1T7XA 1HHHA 3NJJA 1MG2C 4Z77B 4X5XB 3OQRA 5CIPA 4YDZA 2XWRA 4MZ3A 2ZXAA 4D7BA 3L5IA 3BH9A 4JJ5B 5FWRA 2Y6TE 1YNKL 4JQIH 1B0RB 2DZEA 4IBSA 3BGAA 4GG8B 3K74B 1JZIA 3BIBX 3CZJA 1PL3A 4PV8B 4X4XA 4Y2NA 1EHKB 4WWID 2J56A 3T6XA 5JHDE 1RP9A 1PAZA 4JFTA 5DVNA 1MRDL 3IAGC 3CVIH 4OFPA 1J9RA 4ZO7A 2GY7B 1FFPB 2OP4H 3GPEA 4WEUD 4M6ML 5I76A 4ZBJA 1RJYB 5KSVA 2DY2A 4NNXB 4DZ8A 1UTDA 2HYMA 4JGMA 3FCSB 3RPBA 3FOMB 5AB1A 1U8IB 2DMKA 3CU1A 4EDWH 5C7XH 4JL1A 2B20A 3CLFH 3M46A 5K9OB 2WINA 1U8NB 3CFNA 3GGWB 2C9PA 4L0ZA 1MHEB 2X1XR 1OK8A 4PAZA 5DUBA 1NFAA 3D87B 3JV0A 5D7IB 3PFUA 4XNUL 1H3UA 4MAUH 3DTDA 3O2DA 2D7QA 2CXKA 1WH0A 4P2QB 1DSFL 2NPLX 1G84A 1QR1A 3RQ3A 3RAJL 3KBHE 2Y07H 3WO4C 2MH4A 4B0AA 1V3JA 4L8CA 1FIGH 1AHKA 3UAJD 2AZUA 5CUSL 3WNNA 4F2MA 3IB4A 4H8PA 3FQTA 4ZPTB 2ZX6A 1NJ9B 1RFDL 3UG5A 5BQ7B 4R7DA 3OKNA 1EHXA 1Z3RA 1QA9B 4XXCC 1MCCA 4KO6A 4X99B 5CR8A 1X5XA 3MCKB 4TQEL 1WVZA 3BP7A 3NJFA 5AW7B 2AJ3A 3QCTH 2BP3A 5HHNB 3NJGA 5LCVH 3IJHA 5AOKA 5LN4A 4XMKH 4FNRA 3Q0HA 5DJ8A 1RPUA 5D71H 3CLEH 4N2NA 4PJHA 4W9FC 5HGAB 4AKPA 2WB1A 4X6DF 3O6FA 1U8KA 4UNIA 3AM8C 5GJSL 1X5ZA 2H32A 4XZUB 3O3DB 3TH2T 1X7QB 2A6KB 3ARGB 2WQXA 3DIFA 4KX9A 4OCYL 5G5DB 3UABA 1AHWC 3AREB 3BKQX 2NOLA 1GGIL 1RZGA 4HV8B 5DDHB 43C9A 1JDYA 4H1LG 4RGNC 1ILSA 4RISL 1CDYA 3V5DA 2XICA 4FZEH 3VXQB 2YS4A 2J20A 3HUJF 3FUHA 4GQQA 3G6JA 2HUHA 2V8LA 4S1QH 1D7CA 1TTBA 3VXNB 1UH3A 5I8OL 4FXGC 4ZOBA 2X4SA 1I9RL 2Q8AL 1FUNA 1OAYL 2EZ0D 4KUZH 5LG1A 1J8HA 3DGDA 4LCYA 4P3CH 5I1EL 5I1IL 1AGFB 4I77L 5EBLA 4TVPL 4MQTB 3KL3A 4GUOA 3P4MA 2DQUH 2HZHA 1MCKA 1FZJB 3KPTA 1MHCA 4F2ME 3HE6C 1ONQA 2YOCA 2CGZA 4Y2LA 3C5XA 2CO1A 1KBKA 3Q5YA 2VUYA 5CR1A 1Q72L 2X1OA 3MNWA 2C1OB 4LCVA 2A77H 2DDQL 5DHYB 3WUWA 5JIDA 1MCEA 4UM8B 4F7MB 4JG0L 4U1NA 3QG6A 3QI9B 1KFGA 3I50L 1GJUA 5ILTH 1NMCC 3DC0A 3IMBA 2YAHA 2ORBH 4PJHE 4WUKL 4MD0B 1OHQA 3J07A 3EO9H 1U8LB 4MJ5A 2AI0H 3M1CA 4QRBA 5CP3A 3A4AA 4GXVL 5E94A 1AJ7L 5FA3B 2VDNB 3US0A 4BA0A 4AYID 4BFGA 2WSPA 3MFGB 1MXDA 1NC2B 1UD3A 2R0WL 4NNPL 2CK0H 4YUEH 4BSJA 2JK5B 1J05B 1CYXA 4GLRH 4J3OD 3MV8D 3PWPB 5IT2H 4EUPB 1AYOA 3B83A 3BKJL 3QNYB 5BZXA 5J6SA 3LB6C 4ONGL 3R1GL 3G6JE 2AJVL 4ZW8A 5TGBA 3GIZL 4MQXD 4YDIL 1ASQA 2HVKB 4KROD 2CM6A 4JY6B 1H3XA 2A83A 3ERXA 1ZHKB 3GBMH 3EJPA 1FH5L 4WHYH 3RILA 2ZX7A 2B1OA 4ECNA 1J8HE 3PL6D 4CDHA 2EADA 3V0FA 4Z7NE 5IB2B 2LTQC 4U1SA 3QZWB 2IVFC 3T4AB 3VFGH 2B5IB 3EH2A 4OLVH 3N85L 4UV4H 1ZEAH 5E9DD 4Y4KD 4AGNA 1OTSC 3QPQC 5FFOA 5BNXD 1DJYA 3E6HB 5JIMA 5ABZA 2Y2WA 2AHIA 3SO3B 5FEBA 2OMXB 3VI4A 3NJLA 1YNLL 2M1KA 3HNSH 4IGBC 2PABA 4ONFL 3MRLB 4D7QA 1IEAB 3ZRSA 3U6RA 1HN1A 1P9MC 3RUGF 2JKSA 3RFZB 2VN5A 3IT8D 1Z7JA 3PU7A 1YZZA 1A7OH 2K3HA 2D31A 3QDGD 6TAAA 4RNRB 1CXHA 5AD0B 3MA9H 3UTPD 3ECBB 3Q9QA 5C0GB 1XF2A 4WXAA 3II1A 5J1AB 1NCDH 3GMRA 1IUZA 2I9LB 4PY5A 1N4XL 1XZ0B 3NIFB 3GI9H 1MAML 5E4AA 2HFGL 2G60H 5I1JL 5KVDH 3UTTD 1P6AB 1ZA6B 2D7MA 2YQBA 3LPGA 2H8PB 3IJ9A 2W9DL 1TLKA 1T0PB 2VXQH 5SX5H 5FDWB 1MCDA 3FT9A 5CBAA 2Z8WC 4S0TD 5EEWA 1E90A 1KB3A 2FJHA 3SSGA 1R33A 2MPAH 1UB6A 1CIDA 2E4FA 1QAWA 4XE0A 2VLLB 1JZDC 4LCIL 4IIQA 4PRHA 4YXKH 3PJSB 3GSOB 5DYOB 5HDBB 5HYFA 2Z8UA 4JREC 3CJJA 4AL8H 1AY1L 3VWJC 3GDBA 2WQAA 4N5ED 4K8RD 4W9EC 2P45B 3I74A 4Q58C 5EIVA 1KYOJ 1MNUL 1SBSL 2H0FA 2XN9D 1S7VA 2Z31B 1HXMA 2CG9X 3RWIA 2O3OA 3CSGA 2X6VA 3WKNA 1U21A 1SYVB 2R39A 4FRWA 3SDXB 3E0GA 2RJMA 4ZXBA 1J12A 1CGUA 3H42H 2BINA 5I8EB 3VI4E 3ZRFC 1T2QH 1L9TA 3G5WA 5GGSY 3WTVA 3WOVA 1IFRA 4JJHA 2VO8A 1BG1A 2HT2C 3RJQB 3CFQA 2TRHA 2W07B 4IHOB 3HC4L 3MMEA 3V4VB 2X0VA 4JFFB 2JI1A 1HYSD 5I1DA 4WAFA 1A7NH 2WAHA 4GW4A 4AYSA 1U41A 5FCUL 3KPRA 2VJXA 3X2QB 3E9UA 2DKUA 4WWKA 2Z9TA 4ZPVB 3D08A 1YQVH 1TTCA 1WBZB 2L7UA 1XH3A 3OMAB 4HX1A 5JA9A 1SN0A 4MMXB 3JT0A 3WY4A 3DKHA 5GGRB 3BRDA 5HDOA 3ZHNA 5JHDB 2MQGA 1AMXA 2XTJC 3O0RH 2ITEA 1FFOB 2W5PA 5GSVB 4G7SB 1CDUA 4PRHE 5EUKA 3A4FA 4HLEA 4FG4A 4G6MH 4WFGD 4AMKL 3CVDA 3KW8A 4IBLT 4B7IA 3TN0A 2KLRA 1T0MB 4YS4A 5DJXB 1RUQH 5DJCA 2PXYA 4KRPC 4U1MB 4IL8A 4M5YL 2QELA 1BCIA 4ZQKB 3I2CL 3L8QA 4GQPH 4PWJA 1CFNB 1G1CA 5EORL 4QLRA 3UBXI 3ASWA 1ZHLB 2IQAB 3C6EA 3H9SD 4OVVA 5T33H 5FS5A 4KI1A 1CWVA 3SNSA 3VD9A 5I6OA 2NYYD 4NP4L 2GFBB 1RMFL 3A6OA 5LAPA 3BP4B 3LDBB 5EPMA 3VA6A 5MI0C 2V3EA 1OSEA 3X3FL 3CQQA 1G9MC 4B41A 1NGPH 5T1DL 4AW4A 2I26N 4P2AA 3JTBA 5CIPB 5CEZE 1BQ5A 3KPRE 3MX0A 1TSHA 1MCWM 3U79A 3BH9B 2YUVA 5F2FA 4Q9BA 1EGJH 4L1DA 2AAVA 3K0WA 1LO2L 5F7AA 2BVPA 4X6BB 3VB8A 1ODUA 1W0YT 4NJAL 3E8UL 4XI5D 4R0LA 3G5XA 1D7FA 5HGHB 4U6YB 4Q52A 1PD6A 2X70A 4FD0A 1EZSA 5KSVB 1M3IA 3GS7A 1WAAF 1GGYA 1OTUD 1BHGA 1L9MA 2A73A 2FJGA 2QLYA 4XXDA 4O2CA 4OLWL 1EXUA 1O6VA 1QABA 4EI5D 1F0LA 2ICWB 3NZ8B 3SDAC 1NAKL 3ULSA 5K93A 1LMIA 2VR8A 3CX5J 4RODB 3ARXA 1SJXA 1H6TA 5CILH 1KG0A 3D4VA 3B43A 4YQXH 1G9HA 2IADA 1K5NA 4G9FD 4NUGH 4X4KA 2IPTH 1QR1B 3GSUA 1PYWA 3GYRA 3U9WA 2XZAL 5C0RL 5E99L 4ZTOH 2M8XA 3I6LE 2J88H 5JW4R 1X6NA 1JZJA 2IDSA 3MODL 1KBBA 5FM4A 1QNZH 1TTFA 2ZKYA 4N9GA 3HZYB 3N9GH 2DL9A 3FYEB 3UOAB 1FVCA 3FQTB 3VQMA 4LSQH 1QBML 2HG0A 4PIRF 1QUNB 2C5DC 3OKNB 4R7DB 1BFSA 1D2PA 1K9TA 5C2UB 1EVTC 3PG2A 4FHKA 2H3NA 5MHSD 4FP8L 4TLSA 2AJ3B 1VEMA 3BDBA 4AENA 1FNAA 2KERA 3IJHB 1RP8A 5B22A 3OAYK 1UT7A 3DIVA 4PJHB 3FCUB 1UXMA 2QL1A 1U8KB 4P46A 4QGYA 2DM3A 3WEBA 2VL5A 4JFDD 5HSFA 2YZ1A 4XWOC 5HPOA 2VDRH 3DIFB 4Q74A 4PBDA 3R4RA 3VG9C 5EMYA 1AHMA 2R8SH 3OAZH 1OCWL 1RZGB 3KNBB 4PG2A 2K6YA 1CU4L 4BK4A 4PG9A 3V5DB 2D0GA 4GAYB 4LSSH 4KTDH 3VQLA 1ID5I 1J1OH 2DJSA 5FKAA 3HAEA 1ACCA 3IGFA 5I19L 2KH2B 3GSVA 3FUFA 1U3NA 3BMWA 2YEQA 1FL3B 2X4SB 4AVJA 4NLHA 4WHDA 2NMSA 4KXZI 1J8HB 4R2GC 4LCYB 2RB8A 4PYGA 3QK0A 2R4SL 5C9JB 3VA2C 4F7TA 3FCTA 4A04A 1BVLA 1WCBB 3P4MB 1HE8A 5F7WC 2EKSA 3U0PA 1NIEA 3C2SA 1XGYL 3ZZLA 1CF8L 2RCSH 3LZFH 1F56A 1C8QA 4Y89A 5GQBA 5IHLB 5C0FA 1HU0A 2JE8A 3CXFA 1A14H 1KDJA 1RY7B 1WBXA 5B7FA 3W56A 2DLFH 2ENPA 4ODTH 2J6EA 1TVHA 4FFZL 4P2QD 3SPIA 3POCA 4YFLF 4U1NB 1QFOA 1CR9L 3ZTCC 5CZVL 3P3TA 1AS7A 2ZICA 3RWGA 5C86A 4YIQA 1E5AA 1KBPA 3AQXA 4HS8H 5KYYA 3O8XA 5A7BA 5AVQB 2VZ3A 3DV6B 2C9AA 4OLEA 4WTZG 4OFKA 1Y07A 4M62H 3QFJA 5E94B 4W93A 1BA9A 3AWGA 1AISA 4P3DA 1JIBA 1A4BA 3HE7C 1X3DA 3N42F 3BGFB 2J44A 3N44B 4JUTA 2P42B 4TXVB 3ZKXB 5C2BL 5J9PA 4ZODA 3BLBA 4RZCA 1NL0L 3GKWL 1IKFH 5MEPB 3S36H 1VKLA 3X12A 3L4YA 1RUKH 3D4ZA 4U1GB 1IAKA 3IE4A 3PP4H 5KVEH 2FTAA 2D7PA 3RL1A 4J4PA 4NI6A 4UBDD 2O61A 2KS0A 1EJFA 3SYQA 3IRPX 5D96C 7CGTA 3HZVA 2A83B 4KKAD 4O4YH 3U4AA 3EGSB 3V4UH 2PNDA 3MHZA 3MRKB 3ARGD 4G42A 4KJQC 3WIHH 3DPBA 4BFKA 4NC0B 3ARED 4ABWA 5ID0A 5CD5D 3MLSL 1K6QL 4PB0L 1NCAH 1ZOXA 1G6RA 1MCSA 2B4CH 2RIKA 4IDJL 4U1SB 4WFEE 4BH7A 4NC1C 5I9QC 3CZUB 1G9ML 4IRZA 4TUUA 1MZZA 1PG7H 4Z3JA 5EIIA 2BS9A 2WLKA 1TYRA 1XTLA 3S5YA 4QIRA 5C0AA 2C3GA 3NCJL 1E67A 3VI4B 2BC4B 5AOMA 4DGVL 1KACB 3FB8A 4OAWA 5C0CA 1AZRA 4LOUC 3RTQC 2YMXH 4POZC 5FO7B 1MI5D 1V3LA 2UWEB 4ELDA 5J12C 1QACA 2FKFA 1OM9A 5C3TA 3QFJE 2D31B 3CSYA 4E9XA 1HCZA 4AGOA 2VAAB 1XF2B 2CR3A 4RWYL 2IALA 4JFVA 4Y2DC 3GMRB 1YEKL 4QAWA 1JI2A 2W60A 2G75A 3VG0L 2VAJA 4DN3H 1G5AA 3QI9D 5F89A 1RU9L 3LS4L 2ZOTA 2JJUA 3KPMB 2QGEA 3CVHL 3L3OC 4LLWA 3WSQL 1SF5A 3QAZC 5CBAB 1S9XA 1AANA 4EZJA 4AVHA 5DQDL 5LN8A 3D7QA 2FJHB 4GNKB 1ES0A 1UB6B 2MJ7A 1JBJA 1V8HA 3ZYJA 5GXBB 2WLLA 1XT5A 4DTGH 1Z32X 3KPLB 2L0DA 1HC1A 4IIQB 1LP9A 1MRCH 1NC2D 2OI9B 4J23A 4PRHB 3EZJB 1AFVL 5CO1A 4GBXA 5GS0D 2ERJB 3PWPD 4AWJC 1LEGA 4FFVC 4HUMB 4OZHF 4FA8A 5HYSG 1HXMB 5L2KA 1KF9B 3AWEA 3DJZA 3RWIB 1A7QH 4OFDA 4G82A 5BQDA 4HOWA 3KR3H 1BG9A 4GO8A 5C0AE 4ZD3L 3OSTA 4K4KA 4ZXBB 2BOCB 5DO2D 3PCYA 1PD1A 3U9PH 4IMKC 5CCGE 5BOJA 3WXVL 1R3JB 3JYCA 3A67H 4XAWH 1JXJA 4HMEA 2HFFA 4TUOA 3KLDA 1GKOA 1ZIBA 3HS0C 3LEVL 3JWNC 5DTFA 1A6AA 1UZGA 3RLSA 2HKPA 3RDTA 2XTSA 1R0AL 4OGQC 4H25A 5DVKA 3B9DA 1L0PA 4X7DC 1FFNA 3NTCH 4AT6A 1TVBA 3QJHA 4BZ2L 5I1DB 1URZA 1CFVH 1HKLL 3I9IA 1M71A 3U2IA 1OAKH 3ZXAC 1U3JA 2YPKA 5FECA 4XO8A 3G5ZA 4WWKB 5HYQA 5DHDA 3V4LA 4XC1H 3RRQA 1L9RA 3FFCA 3GXTA