2VJJA

Tailspike protein of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN
total genus 232
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjjA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjjA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjjA02
1IDKA 4NK8A 4U4BA 2BSPA 1X0CA 1OGOX 1PE9A 4OZYA 4AVZA 3LMWA 2NT9A 3GQ9A 4W8SA 3GRHA 3T9GA 2PYHA 1IB4A 1KTWA 4YZXA 1AIRA 1BHEA 4EW9A 2INVA 2ODLA 2UVFA 1O8FA 3ZPPA 3VMWA 1RWRA 3JURA 4Z03A 2NSTA 4YZQA 4XMYA 3UW0A 1JTAA 4YELA 1CZFA 1HG8A 2NSPA 2O1DA 2QXZA 1GQ8A 4U49A 2NTBA 1O8HA 4HWVA 2X6XA 4XKVA 3GQAA 4XONA 4XORA 3VSUA 1O8LA 2PYGA 4XLHA 1KCCA 1PXZA 4I84A 2O0VA 2X6WA 1PLUA 2VBEA 1IA5A 3KRGA 4XM3A 4W8RA 1DBOA 1OGMX 2NTPA 4C2LA 4OJPA 1XG2A 4XOPA 2NT6A 1O8MA 2VBMA 4Z06A 4URRA 3WWGA 4OJ6A 1OFMA 1IDJA 4XQFA 4XN0A 3EQNA 1O8EA 3GQ7A 1WMRA 2O04A 2X6YA 2PECA 4OJ5A 5C1EA 4OJOA 1O8KA 1OFLA 1QCXA 4XLFA 2O17A 2O0WA 4MXNA 2VBKA 4PMHA 2QX3A 5C1CA 1H80A 1DBGA 3SUCA 2X3HA 1KCDA 3FY3A 1O8IA 1VBLA 2Z8GA 4YEJA 2UVEA 3VSVA 2INUA 1O8DA 4W8QA 2NZMA 2VJJA 4Z05A 3VSTA 2EWEA 1JRGA 4W8TA 1BN8A 1NHCA 4XN3A 2VJIA 3GQ8A 3ZSCA 5AMVA 4XLEA 4XLAA 3B8YA 1RMGA 4YZAA 4XR6A 2NTQA 1K5CA 3VMVA 1O88A 4XOTA 3EQOA 1EE6A 1QJVA 3B4NA 3B90A 1O8GA 1O8JA 2X85A 4XKWA 2IQ7A 4OJLA 4XNFA 4MR0A 4NK6A 1RU4A 1OOCA 4YZ0A 4XL9A 4XLCA 2QY1A 4OZZA
chains in the Genus database with same CATH superfamily
3SEQA 1MNDA 1BMFA 2I10A 3CCVI 2F43A 4U4BA 3QPLA 1FP1D 3RCOA 5CPRB 3LOCA 1AHDP 1PJ5A 4P3IA 3HHHA 2N8GA 4WZKA 1D0XA 4B47A 1WOOA 1OYWA 1S72I 1J09A 1YS7A 4HA8A 3VOEA 4V19K 2TDXA 1H8AC 5JBQA 2ADUA 1VQ5B 1ONVA 3ZPPA 1COWA 1W5TA 2E1RA 4I6ZA 5TJJA 3L2VA 4HNUA 5H6QA 2KPMA 3PENA 5J8CA 2PEXA 3CC4I 4YELA 2HLDA 3AKZA 3LSRA 1WJDA 2XOKA 3ZGKA 1U9NA 3CLQA 3HKZA 4DNCA 1U2RA 3LA3A 2NVQJ 3G71B 3C7JA 1GVDA 4GYGA 4HQMA 2R6HA 1MSEC 2M7AA 4MEYF 5K7ZA 1HXDA 1X1PA 1UHSA 1K4TA 3JQRA 2F6CA 3GF2A 3ML6A 4NQWB 2A5YB 5IYWA 5E3MA 1B9MA 3V8KA 4CYDA 1W87A 3R6JA 1IA5A 1Y0UA 1A04A 1Q86D 2ISYA 3BTIA 4ENMA 4ESFA 5JI6A 3TOAA 4N4OB 1VQ5I 3CB4A 4Z2YA 3RKYA 4G8XA 2DOEA 3GX4X 4A3LJ 3CUQB 2VQHA 3P9CA 2GM4A 2CK3A 2V26A 1R1UA 1MNMC 3ASTA 2V9PA 2FOKA 2BV6A 1D5VA 4ASNA 1FNCA 5FD6A 4IF4A 4XIDA 1WKMA 2JQ7A 1AMOA 3OIOA 2ME0A 1PP7U 2IS4A 1Q1HA 5HLHA 4IVNA 3OOUA 2HPMA 1DGRM 3C2HA 3W3CA 4P1VA 4LB5A 3BR3A 2G9WA 2G7HA 2WAQA 2X6YA 2CMPA 3D5LA 5EG0B 4A3IJ 1W0TA 1VQ4B 2O6WA 4X05A 5GPCA 4Y17A 3DU5A 4OINF 2ZBVA 1DBGA 1IN7A 4X7FA 2X3HA 1FBUA 5ERIA 3OL4A 1KCDA 5E1XA 2QF7A 3UNGC 1YW8A 1GV2A 2M3AA 2OAZA 1U9OA 2F4OB 4KT5C 3ZPLA 1ZAOA 1K78A 4XKBA 1H9TA 2ZTNA 2INUA 1KONA 1R4MB 3LSHA 1ZGAA 5D8LB 3VSTA 4AU7A 4W8TA 3H09A 2Z5UA 1ITYA 5GAEJ 2DI3A 4LLNA 3LAPA 2Z6BD 5L3CA 1KQ9A 1E2XA 3Q38A 2KIFA 3B8YA 4LK0F 4XRFA 2YWEA 3OEEA 1J75A 4YFKF 2E60A 4ENKA 1I1SA 1V4RA 1DQUA 2RN7A 3T5XA 1DG1G 1O88A 3EQOA 3I59A 3CZ6A 2BN4A 3B4NA 1WPCA 2C78A 1VQKI 4YAWA 4HIZA 3WNDA 3I9V2 2BM0A 3ZMUA 2KISA 4Z4VA 2F5EA 3MN2A 2HR3A 1CGPA 2Q2EA 3K1MA 5F6FA 4XL9A 2XB5A 4ANJA 5IY5H 4PC6A 2WB1N 5EGOB 3OPOA 3V8LA 5F0CA 3OYHA 2FQ3A 2XAGA 4IEJA 3SQNA 3S15J 1P4MA 1YO5C 4NK8A 4AM3A 1JT0A 1JGSA 1G3YA 2P5KA 4RD2A 2DMNA 3F0CA 1I8DA 2ZNYA 2ZL6A 1J0RA 4IRHA 3B6AA 1T6SA 2O7OA 1BC8C 1IXCA 4YFNF 2E2IJ 4KKUA 1FOYA 4IOAF 1JNYA 1BC7C 3WTUC 4P26A 2PIAA 1F5TA 4QIWN 3KEQA 1CZFA 3MKYB 2HQ5A 2E36A 2K4JA 2DA6A 2DQRA 3SLDA 1T6ZA 1ZM3A 4U49A 1HCRA 4KIBA 1RC9A 4HBLA 1SVOA 4XRSG 1PUFA 2DT5A 2E5ZA 1FTTA 2NTBA 1OLTA 2DAOA 4WK8F 1ETWA 4FN5A 2XSDC 1SMTA 4ZH4F 1UD4A 1IRFA 4PC3A 1W5CC 1K4ZA 4EH1A 3ZUGA 1PLUA 2GQQA 2Y69H 1ZREA 3KL9A 3EUHC 3WE2A 4WCGA 5KCMA 4E0FA 2VE9A 3BR6A 2R5ZB 2QGGA 3L7WA 3PFIA 3PJRA 3A02A 1XGMA 2HTSA 3LSTA 4BUPA 1FX7A 2EZLA 2ZSHB 5D8KB 4W1UA 3CMEI 3NE5B 4Z4SA 3CP8A 2K02A 1HA3A 2MG4A 5H5JA 1BX0A 2EV5A 1R22A 1VQMB 2LKSA 3PUBA 2KVOA 2DQLA 4LBWA 1YX3A 3I64A 1FWZA 4WXDA 2VB6A 1D8KA 1G2HA 4G7HF 1WTHD 3GFMA 1BIAA 5D5UB 2KMUA 3VO1A 2QLZA 2R3SA 4G94A 3HXLA 5B1AH 1ZR2A 5E17F 2VBTA 3CC2I 4UUSB 3HTSB 2MFZA 2VQGA 1YJ9I 1UHMA 1B8IA 4V02C 1X3UA 2YS9A 5CVUA 1H9GA 3FISA 5F4MA 2XAQA 2GREA 4UUSA 2M9HA 3FBNB 1NTCA 5BSXA 2NNNA 1O3SA 3JR9A 1QPMA 1MMAA 3CD6B 1EFUA 1YW7A 1R00A 2DCEA 4UV9A 1QNTA 2NOJB 2OTLB 3K4KA 3ZSCA 3W5VA 4AUXA 4R1HA 2TCTA 1QHGA 1GXQA 2PMZN 4BJ5C 3WBJA 2NTQA 2QDXA 5BQTA 3WTYC 3RSNA 1Q81D 2DMUA 3L1PA 5F1JA 3B78A 1H88C 2QYOA 3H3ZA 4MO7A 2DCUA 3C2BA 2KLOA 5LRRA 3MZYA 5IPAA 3H94A 2EPFA 2MW8A 2VXZA 4DYCA 3CCSI 4IHSA 3H92A 4BE0A 4M3EA 5LFAA 2DPUA 2BM1A 2V7QA 1ETKA 3WXMA 2JN6A 2BYVE 3PSFA 4ZV4A 3PSZA 1Z21A 3RYRA 1J5YA 4DW6A 1G3TA 1J59A 2R5YB 3I56B 5CYVA 4XRMA 4HF1A 1V55H 3PNYA 4F92B 3CC7I 1TNSA 3TO9A 2GXGA 2VBXA 3K4BA 1MBFA 4FX4A 3CLOA 1UD8A 2FSWA 3FBIB 1GAQA 4ZGNB 3BNWA 2CU7A 2XKPA 1HQCA 1FSEA 2BW3B 3JSOA 3K4MA 2CS3A 2LLKA 3ISPA 4I99C 3H1CA 1YITI 1V0EA 1XFOA 3TW6A 3S3OA 1SKQA 2GA1A 4LFUA 1ZRDA 2QBYB 4L5EA 3W2AA 3VFZA 5BPIA 3JQPA 4YG2F 3LA2A 2XAFA 3LQ6A 2BGCA 3A35A 2QA4I 2VT2A 5F4JA 1EFTA 2MC3A 1MRZA 3VSUA 3J80K 4MTDA 2XEXA 1PVEA 2DN0A 3HIFA 1Y1VJ 3K6GA 3BC8A 2M5WA 5E18F 1FOXA 3L2UA 1X2MA 2MD0A 3DV8A 1TLLA 4RMNA 3HRMA 2H1KA 2X0KA 3S1NJ 4IW3B 1DBOA 1S7AA 1YYVA 2NTPA 4PFOA 2PE3A 3K4LA 1XX5A 2IXSA 4G5GA 2YX4A 4P3YA 3M8EA 2QYUA 1AWCA 3HOVJ 4OJ6A 1S5LC 2HXOA 4MEXF 4A93J 1MBGA 2Z33A 2O3FA 2QSHX 4BNCA 2WAEA 2ZB9A 4ZYEA 4M3FA 1Q7YD 3T8TA 1K8AD 4FK8A 3FZVA 1ZKGA 4E6KG 2E71A 3JRFA 1VQ6I 3VYUB 4NHJA 5M5XJ 4RGUA 4D7NA 5ICCA 1BR2A 5EDNA 3QYEA 1Z1DA 5FFZA 4J19A 3BC9A 4M9ZA 5BS6A 1B2RA 1TYWA 4KH3A 1SD5A 2MLGA 3RJPA 3K70D 2QWWA 1EZGA 5FD5A 5F1RA 1LKXA 3RKWA 3IKTA 2M1BA 3IWZA 3VSLA 1FRQA 3VNUA 1VQPI 3G05A 2UVEA 2E2JJ 5DUIA 1IUYA 3WTSC 4LD5A 1KZLA 5KSWB 2ECBA 1R7JA 2J7KA 1IRGA 3BPXA 3A03A 2B7CA 4GO1A 4CZCA 2X9DA 4ESBA 2QBYA 4ACAA 2WJYA 2CH0A 2L7MP 4IJAA 3DKYA 1FEXA 2VJIA 4EGYA 2ZMEB 1K28D 5THXA 3W2EA 1BW5A 2DK8A 4FXUA 1XSDA 2A6TA 1NK3P 2V1UA 4XR6A 1YJWB 3VMVA 4L18B 4HNTA 4M3GA 4OWRB 5L3GA 1VQ6B 3VDXA 2V1DA 4FASD 2KIUA 3RPUD 1G59A 3IRRA 1MMSA 2EIXA 2Z1DA 2B5OA 2NPFA 3JRBA 4E7JA 2FBHA 3K4CA 1T0FA 2A68F 3U2RA 4PJMA 1R49A 3TDZC 1YQAA 5J4VA 1TC3C 4IQJA 4OOIA 4TV7A 2ME6A 3LO8A 3WE3A 5DN6A 1OFCX 2WAQN 2JA8J 5IP6A 3RQ4A 3SXYA 5IYPA 5JLXA 3BQYA 1VQ7I 1B6AA 5C4XJ 1E64A 1VQ9B 2STWA 1G8XA 3MVPA 2IGKA 4NQWA 5K7FA 5E8GA 5LHGA 2RREA 3G1MA 4KFCA 4OZYA 3LMWA 4MGRA 4DYQA 1XS9A 4B3GA 3GRHA 5FKMA 2BHYA 3SYJA 2ISZA 2ZL5A 2K9NA 3ZBUA 4FCYA 2H09A 3W6KB 1E0EA 1BHEA 3W2WA 3CW2A 5HZBA 5CJ9A 2R7XA 5A89A 4X6AJ 2L9RA 2YWHA 3CC2B 1WXRA 2RQQA 2V7XA 1P92A 2B7EA 3ABUA 4BYYA 4B09A 3QFCA 2DA7A 4G1BA 1G3WA 3W2FA 1BJZA 5J3OA 1OPCA 2E1MB 3B02A 4DNRB 3IC7A 3FJOA 3VNVA 5CVVA 1O8HA 1DU6A 5H59A 4IOCF 5A88A 1QU3A 1EH8A 4M2LA 4F3QA 2O8XA 4M74A 3CRZA 1MH3A 5F0FA 1KCCA 4CQJA 4IX7A 2DA5A 2P4WA 3CCLI 4BH9A 3CCLB 5D5XB 2P7VB 2FX0A 1ZM9A 3E5UA 3PA1A 3LQQA 1OGMX 1ZG1A 4LG3A 1R5ID 3ZQGA 2F4NA 3FXUA 3CO7C 2HVRA 3O6BB 1GVJA 2JPBA 4PJNA 1ZM4A 1I39A 3R6KA 2F3LA 2Z3YA 3TW7A 4A69C 3E5QA 2JTVA 3NWSA 3DKWA 1KZHA 3OYLA 3HM5A 2W25A 4H0EA 3CCVB 3CO6C 5LGUA 1OQYA 1UD2A 1O8EA 1TWCJ 3VO2A 5JVGF 1TQMA 1S8NA 3OAAA 4Z4WA 2O17A 1OMIA 2DMQA 1PDNC 2KJBA 2OZUA 2MA3A 4YDTA 2IAIA 4E7LA 2VNIA 3ASQA 1EP3B 3GZ6A 1FX0A 5F08A 3F8BA 2EWNA 1U3EM 1R1TA 4YIIA 1J2XA 1VBLA 3ZN0A 4W8QA 4OAYA 4DZPA 4M73A 3OW7A 5HKKA 2EWEA 1KU3A 3BZCA 4BHPA 3I4NJ 3CDLA 1NK2P 1PUFB 3U2QA 2LK2A 2RNJA 4D9JA 1SAXA 4PZJA 3T51B 1VJSA 3CCSB 5JVTA 2MH9A 1LE8B 1XGOA 2LY2A 2ZBKA 2P6TA 2A69F 2DW4A 3D5RC 3DQVC 4AWXB 1RMGA 4HLYA 3EDPA 4OIRF 2JUGA 3RI4A 1EP1B 4K1XA 2J5OA 4EQQA 1HVXA 3PA2A 2MLKA 1IAWA 5M5YJ 5IYRA 4Q47A 2V4DA 3GQBA 3CCQB 3F72A 4L0YB 4BQAA 4PSXA 1T2KA 1REPC 1FYMA 4AIKA 3VR6A 1QBJA 4LJZF 1BPLA 4XKWA 3G73A 2F4MB 1XDSA 3MKZA 2VIXA 1JUMA 5B66C 4X06A 3KYDB 1ETVA 1SD7A 3SHFA 5KHDA 5EYRA 1T5EA 1ACIA 1F43A 2Y31A 3SZTA 1VQPB 4L9NA 2M7BA 4L9TA 3EUAA 4A5NA 1CF7A 3W5UA 2VFQA 2DY1A 3OJWA 2H8RA 2NT9A 1KU7A 3P7NA 2M30A 1WVRA 2NV4A 3R6SA 1DDIA 2L7KA 2HQAA 1WJEA 2CUJA 2ZMEC 4HW0A 2W6IA 4BPRA 3OL3A 2M87A 3HEFA 1EFRA 1P4AA 2ELHA 2HYJA 4KDPA 4J0QA 2F4IA 3CMAB 3OKXA 5EEGA 5J4YA 4M3DA 3WGHA 1HG8A 2NSPA 5KAIC 3GZNB 3G6EI 5M5WJ 1ZLKA 4N3NA 2O03A 3KP4A 1LM1A 1ZARA 4Z4TA 2DOFA 3SZPA 1A35A 2VBVA 2ZZFA 2PN6A 3K1NA 5EF6A 5J8FA 3SYTA 1ODDA 2E1CA 3VMFA 1PYVA 1X4PA 2NVUB 2VN2A 2CQNA 2DFFA 3H5NA 3IHUA 4R79A 4S04A 1KMHA 3K2ZA 3M4OJ 3AG3H 2X6WA 2LY9A 5GAGJ 2DEUA 2VBEA 4WX9A 3KRGA 2ZXHA 2DMPA 4M3BA 2QMUA 4P12A 1RRJA 1N0VC 1QZZA 2X3UA 3GTOJ 1SKYB 2X8KA 3FIWA 3FXOA 4EJOA 3MWMA 1W0UA 2IJLA 3WWGA 1HOMA 4G6DA 4Y9UA 1EA0A 5HZAA 4JMQA 3P9IA 3V7SA 3BCBA 2LF7A 3D5SC 1E1QA 1JA1A 4IHYA 2HQNA 3WTXC 2FJ1A 1QZYA 1DUXC 3V42A 4YEIA 3O2PE 3COAC 2O04A 1QVTA 4C9YA 2JVHA 2LVSA 2VI6A 2LBFA 3U9GA 3HOUJ 4AIDA 1W34A 1R58A 1OGIA 5FROA 3H0DA 2VQLA 1E3ZA 1FC3A 4G6TB 1S7EA 2VONA 4KKTA 3LFUA 5FJ8J 2P81A 3AFHA 3OYKA 2HYGD 1IGNA 2DPDA 2YU9J 1VLYA 2XV4S 3V76A 2DYRH 2Y48A 3A8IA 2BHZA 3BPVA 1TQIA 2P6SA 1JKPC 3CP2A 4HE5A 3QE2A 3DTIA 1QFZA 3PIPF 1NB0A 1BN8A 1WQ2A 2DOAA 3CDHA 3RKXA 5E3OA 2NS7A 1KD1D 1MJ9A 1FMWA 2HU9A 3JU4A 2DDAA 5FLXZ 1OISA 4CCMA 1VQKB 5ICFA 5L3DA 5B5EC 1TBXA 2OQGA 5HVQC 4P6YA 2WPDA 1TLHB 1Z67A 2XRLA 1EE6A 3MEXA 2BBYA 2LFBA 3CJQB 4NBQA 1HC8A 4OPVA 3V8JA 4PJ0C 4JYKA 4R71A 1IF1A 3REOA 2X53S 2XZOA 1Y0NA 2VBWA 3RY8A 1D8TA 1HSTA 5E79C 5HOOA 2FOWA 3X2QH 2AQFA 4N4NB 2Q6OA 1KQSB 3RIQA 3N4MA 5DD4A 3Q0WA 4U7BA 3KETA 4JX5A 4UUTA 3VB2A 4AC0A 2PLYA 2DLLA 4RB2C 4A6DA 3TL4X 2R92J 4AVZA 4KUMA 3U1KA 1QUEA 2GOXB 1AKHB 2CO5A 3HPHA 2FNAA 3ZPNA 2PYHA 3GVKA 2CV0A 1X1BA 2E2HJ 4WWVA 2HZTA 2F5DA 3A2KA 1K8FA 1AIRA 3FMRA 3CCRB 2XB0X 4Q7JB 1IB0A 2P5VA 4ZDOA 1E3XA 4AIHA 5EMNA 5DYMA 2CUZA 2EFOA 3N90A 2QQ8A 4JP0A 2DIEA 2A07F 3FKSA 2ZO4A 4A3CJ 2XZPA 1YIJB 5LHIA 4PABA 1ELOA 1A8PA 3CMAI 4B43A 5A8AA 4RGSA 1HW5A 2DBBA 4ZC3A 3ZN1A 3F8MA 4ZDPA 1STZA 1N07A 4RCZA 1M90D 1CNEA 3CCJI 4E7SA 3RPQA 1B8IB 1NBMA 2GWRA 2ZFUA 3J7AO 3GEZA 4EJUA 2HKXA 3H0GJ 5GAHJ 2IW5A 1FOKA 2KFDA 5C44J 2L7ZA 1W7PD 3Q9VA 1LEBA 2L5QA 1BX1A 1ZRCA 5E20A 4Z06A 1O8MA 3VYRB 2X51A 4XK4A 3SDBA 4NK6A 2B63J 2DA3A 4DK1A 5IOYA 4NC7A 4ZYHA 3SFZA 2DERA 3GW2A 2OBSA 2KZVA 2X48A 3LAJA 3Q3AA 1K6OA 3GVAA 3C1DA 3NEUA 5DUKA 1XPXA 5JFRA 3EQNA 1LJ9A 4S05A 1XD7A 3K1PA 1YLFA 2YUHA 3BJOA 5B6IA 4CSWA 4M1KA 2XTXA 1ZLJA 2EFWA 2DT7B 3WNBA 4BHCA 3F9KA 1T33A 4Z4YA 4UVBA 2VBKA 3FXJA 1VQLB 2GOMA 4ZCLA 1TP4A 1E3HA 1XSXA 2EFGA 2GJKA 1F60A 1R6RA 2CF4A 2R7UA 2OCCH 1Y0RA 1OB2A 3S32A 2M4GA 1FSHA 1B1BA 1UG0A 3VSVA 5JHUA 3L2QA 3FHZA 3C18A 4KJZA 1ZGWA 2JDIA 1OFDA 1XTAA 1XMXA 3MMPA 3ASOH 5DEQA 4FETA 5FO5A 4AD9A 4KNYA 4IHWA 3K10A 1N78A 2BY0A 4GXOA 2LBFB 3SEJA 3BROA 1K7AA 1SEUA 1A6IA 4HAMA 3VWBA 3ZIAA 3CCMB 3PSIA 3WHBA 2EZHA 3CESA 3MAJA 1IXRC 3TMOA 1PP8F 3FXLA 3I3LA 2C77A 3CMEB 2L01A 4FISA 3OYMA 2CUEA 5GP9A 5LBQA 3L2WA 3OJXA 3ZRGA 3ABLH 2BVMA 4ACBA 3B90A 1K6YA 3K69A 2EV0A 4L8JA 1WPKA 2W82A 2R9VA 1HKQA 4Z6YA 1FOWA 3WY9A 3QFSA 5EZGA 2W7ZA 5FGMA 5BMZA 3A3GA 2W84A 1VQMI 4CYCB 1D1NA 1OCPA 3CDIA 3KCCA 1IV6A 2L02A 4IRGA 2MABA 2V79A 1APLC 1XSVA 1TWAJ 2A05A 3GLLA 2PJPA 1W5SA 4P25A 2A61A 1MH4A 3M8JA 2D5VA 2ZBUA 3DBRB 2V1NA 1MDMA 4G6QA 2ODLA 2HGCA 1O8FA 1WJ5A 1F4KA 5IYBJ 4EM2A 3JREA 2DOGA 3KEYA 2XROA 1A31A 3ZQLA 3S1QJ 3H9JA 4RM0A 3IRQA 1LEAA 4CCJA 3H9NA 2K27A 1RKWA 1Y8RB 2KRHA 3LSMA 4RB0A 2JA7J 4EMSA 1WOSA 4RD0A 4ROXA 2F1MA 4F55A 1X4OA 1XCVA 1GUUA 3Q0VA 3LSIA 5A2QZ 4XKVA 4EM0B 2V7VA 2V4JC 3I55B 3W2HA 4II3A 1YTYA 2PJRB 4N9IA 2HDWA 3KPHA 3SJZA 1EV7A 3S2WA 3GTMJ 3HBLA 4DBRA 5AN9A 4PGHA 2L9NA 2Q2EB 3H9QA 2V9VA 5LGNA 3GVLA 3JTHA 3OE7A 4S0HB 1Z91A 2BGJA 2XTYA 1EKEA 2O5RA 1QQ1A 4C3JJ 2HDCA 1U78A 4A0ZA 1FP2A 1Z3XA 4EGZA 2IT0A 3GBGA 2ZC2A 3M9AA 4YRVA 2QEXB 3DF8A 1ZHFA 2HEOA 3I53A 3GIRA 3CJNA 3CUQA 1BJKA 4HSTA 2O8KA 4WWCA 3G3ZA 1BW6A 5C1EA 4RS8A 1BOBA 1YX5A 1O8KA 1HDDC 1QCXA 2OCEA 3KIOA 3H5AA 3ZXSA 1S72B 4U87A 2IVMA 3OS2A 2K7LA 3O3KA 3OZUA 1T6YA 2NS0A 3L00A 3D1NI 2P3MA 2XF5A 2Q6KA 1WJCA 1B59A 3FKJA 1FYLA 1AOYA 2Q1ZB 2VJ4A 2COBA 2ZSIB 1EA3A 5CLSA 1OYYA 1HLVA 1YRNB 2WYRA 4ASUA 1EP2B 2LZJA 1DP3A 2XGJA 2Z8GA 4GQNA 4C2UA 4F91B 1O8DA 1VZ0A 1JUPA 1XG1A 4D0PA 4MYTA 4OPOA 3AAFA 4IO9F 3PETA 1YIJI 1FT9A 1YJNB 2BY2A 4XSZF 1I1GA 4Y3OA 3FM3A 3F6VA 1O3TA 4M6XA 3ZR8X 1WORA 1NHCA 2ZL7A 1B72A 3GYHX 1YFHA 5CVJA 4E7KA 3BOQA 3GTLJ 2XASA 1JKRC 3NWTA 3FPPA 2EFPA 3CC4B 1VQNI 3DDYA 5DS9A 5H20A 4BXFA 2DODA 5HNHA 1OCZH 3T1BA 1ZN2A 2EK5A 2VLAA 4IRIA 2CW7A 4DOZA 3F8CA 4BKXA 4ZZLA 2R93J 5J6XA 1PJ6A 5ILVA 1GAWA 2IS6A 4LIVA 3IH4A 3ISXA 5J35A 1N08A 1D1CA 2VOPA 2OYNA 2QN6A 2ZZEA 4MR0A 3DKXA 1OOCA 2DTZA 1P2FA 4ABZA 3DEWA 1RUNA 4M6YA 4OZZA 4X7DA 1R4NB 2PBIA 2PJRA 2Q0OA 3A3BA 2BSPA 2PMZA 3EUKL 2LH9A 4A0XA 5C4JJ 4KICA 4PFPA 1U5TA 4MHGA 3ZQQA 3JRIA 4U0YA 5FNZA 4ZGQB 1D0ZA 1KTWA 1BN5A 2M0MA 4FWTA 5E1ZB 4BS9A 2LD5A 1MBKA 3AG2H 1QRCA 4L5IA 3P9KA 1RWRA 3JURA 2X6OA 4Z03A 2W00A 4XMYA 3KYCB 3OSGA 4IL6C 4ZJZA 3CCUB 4A5MA 2ZJQF 2ZJRF 1W36C 1B72B 1C0WA 1GVHA 4QVAA 5IP9J 1CNFA 4HV5A 3GWZA 4BQOA 2Y30A 3I5UA 1QA3A 2WAFA 2DFHA 3L9FA 4M6VA 4DJAA 2E19A 3DPUA 2FU4A 2QVOA 4RM3A 3AVXA 4A3MJ 3U6KA 2BY1A 1HBXG 5D4SA 4O5VA 1QH0A 1Z3YA 4OMZA 3KP2A 5CDFA 3T56B 1SFUA 2PYGA 5HS8A 2EH3A 2DA2A 2K9QA 1UD6A 1WSVA 5TV2A 1BL0A 2ZCWA 3VODA 4QWQA 5EZHA 2WADA 2D3NA 1F36A 4WXHA 1I50J 3LSKA 2L4AA 3T0YA 2HVSA 2HMAA 2RC5A 3BH6B 4P96A 4OJPA 1JT6A 1S9HA 3E6BA 5CQEA 1HDPA 4HX7A 1AU7A 3HDDA 2CG4A 4HSRA 4LG0A 5HDGA 3HL2A 1Y1WJ 5LMZA 1H85A 3LMMA 4QHYA 2XDVA 4KITB 2LSOA 1X1AA 5DNSA 4PK4A 2PMHA 4B4CA 1DGWY 2ESHA 5EEAA 1JHHA 3BDDA 4YC5A 3ZMSA 1I27A 2WV1A 4I02A 1JHFA 2NOGA 2IS1A 4IZZA 3BTLA 2P5LC 4RDLA 3BQJA 2C5BA 2XTWA 4XLFA 4CCNA 1JGGA 2O0WA 3DU1X 2VKHA 2VQCA 3BP8A 4J00A 2WA0A 2DO7A 2QX3A 1TVCA 3MCZA 1QG0A 1BOAA 4IXAA 2DJIA 4U7DA 4Z4RA 2DYSH 3KP7A 1WP6A 4TMXA 4Y33A 3OYIA 2ID6A 4AC9A 4X07A 4Z05A 4ZYDA 5LEJA 2K86A 3VSKA 1G7TA 2OUMA 3DU6A 1VF7A 4PJLA 4AVPA 4P2NA 4GGGA 2F1LA 1RKTA 4BEHB 1A36A 3HOYJ 1MMDA 1P4XA 2Y2ZA 4LBVA 3BCDA 3K70C 3S8PA 1K4SA 3OOCA 4I09A 4CH7A 4P22A 1WWXA 5A2QK 1JKOC 2RC6A 1FLIA 5LLQA 1POGA 2BVNA 4Y13A 1H89C 2GJRA 1MMGA 2AXTC 2GBYA 1XMAA 2R7TA 2EFQA 3ZMVA 4BDYA 1QGZA 4AF7A 1O8GA 3ABTA 1WSRA 4OP7A 2HOSA 5D5WB 1E63A 2E1NA 1G4DA 2HS5A 2HQRA 2XSJC 1WZ2A 3GZ5A 3WODF 5DS0A 3BZKA 2C6YA 3S93A 2V9KA 1JTYA 2ZXWH 3G1OA 3HJEA 3QAHA 1QRBA 3QSYA 1SVMA 4PGGA 3B82A 1F1ZA 2X1CA 2IBDA 2RC4A 4XSXF 3OYEA 3MKWB 1OGOX 2ZXIA 5FB2A 4UB6C 5L3EA 2DFIA 2EZKA 2BV3A 2IP2A 1XN7A 4DNTB 2H27A 1ZQ3P 3QOEA 3I58A 5L3BA 4YZXA 4Z1MA 3RKQA 5J40A 1VHEA 1BJAA 4NBSA 3VMWA 4ZYAA 3OZVA 2D3LA 3BH7B 2E7XA 2MC4A 3A1PA 1WDTA 3UW0A 4M9XA 3QPTA 3A01B 3TH0A 2IA0A 1L1IA 2ZMEA 3S3NA 2LOOA 2QQAA 1WSUA 2E34A 3QPSA 2VKDA 3PQJA 2NVYJ 2L0KA 3I56I 1BBYA 4TN1A 1OYIA 2DMTA 2JN9A 2HI3A 2VJ5A 1VQNB 4B3XA 3HTUA 4A3GJ 4QFMA 2V7FA 2R5YA 2BM6A 4RJLA 4LITA 4XLHA 4GCVA 3P27A 3PNTA 4XICA 2K85A 3E5XA 2RGVA 2JVGA 3CJTB 1VTNC 3OY9A 2AS5F 1FDRA 5GTIC 3KYLA 2A3SA 2ZJ2A 3HOTA 4YAOA 4A2UA 1MBEA 1R5OA 4J01A 1F20A 1ETOA 1KYZA 3N6ZA 4G1VA 2H8WA 3AGQA 2M5SA 5HS7A 4OIOF 3HGGA 2XPUA 1H42A 1OFMA 4MFEA 2LY1A 2Z9OA 1IDJA 3DPLC 3K4JA 1MNEA 2JUCA 1F9NA 1RR7A 4XN0A 4EVIA 2CBXA 3OS1A 3Q5FA 2IA1A 2F5VA 1WMRA 5D6EA 1TQPA 2Q6IA 2WSSA 2VFMA 3CPXA 3CUOA 2JIZA 3TGNA 1YW9A 1EH7A 1WJFA 4CA0A 3LNQA 3OYFA 1DDNA 2LG4A 3DWLE 2Z2SB 2XAJA 1SANA 4KN7X 4HYEA 3E7LA 4LMYA 1W7PA 1G7RA 1W4MA 4CDGA 1BQEA 5FFXA 1X3ZB 3V7RA 2Y0MA 5ILUA 4HDUA 2WV0A 3QU3A 4RA2A 5K7HA 1KJZA 1CQTA 3HC7A 1Z05A 4TMVA 3JSPA 4QSHA 3ZCOA 2VJJA 3H9GA 3AVWA 3KZIC 2VFNA 1LQ1A 5FLVA 4G7OF 3OWTA 1N05A 1RQPA 2VUMJ 2XZLA 2XPVA 4C2MJ 2VT3A 3M7GA 1MGTA 2VKVA 4RLZA 3NB2A 5LEKA 4TMTA 3EPZA 3LQEA 5AMVA 1K61A 1ENHA 4EATA 4OIQF 4L5JA 2MGQA 2VASA 1TUIA 2FD5A 4Y7CA 4MFDA 3DLLF 3F22A 2G0EA 3ASSA 4KIFA 4A12A 1YG2A 4DQ2A 2PFBA 4D1QA 1SFEA 2WC2A 3V7CA 3WG7H 3ZOBA 1VQ9I 5IYDJ 1V0FA 3DP7A 4B3AA 2BPOA 1GXPA 3SFIA 4BBRJ 2VC0A 5AIQA 4M4SA 3DBHB 4G7ZF 4NB5A 2M34A 4RB1A 5M3FJ 4B4DA 1GT0C 1XE1A 1L0OC 1IN6A 2VL8A 5B1BH 1FZPB 2C2WA 1MSFC 1WHUA 3ZC3A 1VLOA 4CUGA 3E6DA 2GQFA 4HZFA 4WZTA 2R7SA 3GO5A 3R61A 4JOMA 1U0JA 2Y9ZA 3H36A 2XAHA 3SKBA 1Z7UA 2K4BA 4PC2A 3HOWJ 1QA2A 5DCMA 3PUFA 4LLLA 3BY1A 3GTPJ 4EW9A 3HOSA 4XKCA 2INVA 3P5JA 3G71I 4BE1A 1OKRA 4XLPF 5DM6F 1UD3A 1DDGA 4YZQA 1ETXA 4ZDLA 3OZWA 5FO0A 2HXIA 2ZITA 3OYDA 1D1BA 4TSFA 3CCEI 3TO7A 4P9UA 2HOAA 5DCFA 3QRFF 2DK5A 3E3VA 2IOUG 3JRAA 1RETA 3SJPA 5LD2C 3FK6A 3CMYA 1SM4A 2ICWG 4I0BA 3R60A 5TISC 2FEZA 2P0WA 2BF4A 1BR1A 3GQAA 4B48A 4UHTA 5FKNA 1SFOJ 2HKOA 2QENA 3ONUA 3OIPA 2STTA 3DTKA 2HCJB 4M72A 2QSGX 4RD4A 5L46A 4IHXA 4XM3A 3J80Z 2HVQA 3ABKH 4JK1X 3ULQB 5F04A 3JRHA 3NAWA 3P26A 1QX4A 2EINH 2RQPA 3FPKA 2EJRA 3DFGA 3JW4A 3PM1A 5L3FA 2DFEA 3CCEB 3AVTA 2MH2A 1DPUA 3F8FA 3BR5A 1QO0D 3KP5A 2EIMH 4LBZA 4MQ9F 1LVKA 4LBYA 4UVAA 3V7AA 3HKZN 2EB7A 5HODA 2A6HF 3JAMK 2OU2A 3WTWC 4A3FJ 1XGNA 4DYRA 3MMYB 1J9ZA 4RDUA 2W6JA 2VNKA 3CCRI 1X2NA 3S2DJ 4YCQA 5CKTA 3VYSB 4LG0B 4B3FX 3S1MJ 2OV7A 2ESNA 2X1DA 3MHPA 1OFEA 3S16J 2XNDA 2IGMA 1FIAA 4BXXJ 5HXBA 3BY2A 1ZYRF 1LE8A 1KQ5A 4ZTJA 3GSIA 3IH3A 4BEHA 5E1WA 4PMHA 3RQIA 1IDYA 2O6GE 3ERED 2QA4B 1H8HA 4UXNA 4BU2A 4RD1A 2A5WA 2DETA 4I7HA 2LP0A 4YEJA 1ETYA 2LRDA 5IOZA 1KK3A 2JJ2A 4RD3A 2ID3A 2GXAA 4HQEA 2M8GX 2HPIA 3R4KA 5FLXK 3OP1A 1FYKA 2GA2A 1S4MA 3HSFA 3W2IA 3FXQA 2H6BA 4ITVA 1UZCA 2DXIA 5EEHA 4RDJA 4XLNF 3FF5A 2VC1A 2XF6A 1WI9A 2EA2A 1J7KA 5FL7A 1B23P 3CD6I 2YR2A 1BI0A 3MCAA 2DA1A 1P4WA 2QKMB 4RGXA 1UD5A 2CWEA 5DM7F 2CV2A 1ON2A 1UB9A 2M4KA 3AG1H 3WHCA 2FBKA 3ZQ7A 3GVJA 1UAAA 1T8IA 1R36A 1GO2A 2WY8Q 5FA6A 3ZMDA 4YZ0A 5H2FC 2WBMA 4QPOA 2R7WA 3OEHA 2GIZA 1N0UA 5DD8A 3ASPA 3JX8A 3DBLB 3FHNA 3NARA 4RAZA 2VBSA 3HUGA 2RAEA 3BR2A 3KP6A 4WQMA 3OYGA 2HDNB 4HLXA 1HF2A 1XQBA 3NQOA 1SD4A 2OQRA 1TTYA 1R5BA 3E20A 3G6EB 4OPWA 3A0HC 3E6MA 1W0KA 3HOXJ 4A3BJ 1N8RD 4CXFA 3RZOJ 4P9FA 3OSFA 2PLFA 5HS9A 3NRVA 3ROUA 1JTAA 4GRIA 1QGYA 5EJCA 2CQXA 2HNHA 5H6RA 4TKOB 1WRJA 2J5PA 3KLNA 3Q9SA 4LGWA 1KC8D 1U8RA 2F5CA 1Y39A 2ZJPF 2FUG2 3LSGA 1OCRH 2PMDA 2KIMA 1UFMA 4JX4A 3BG5A 4PCQA 3F23A 3QPHA 1YHQI 2YWGA 3HRSA 3PFYA 2LMDA 1HKTA 3T53B 2QEXI 1O8LA 1V5VA 2Y75A 5LGTA 1XC5A 2COMA 1IV8A 2WJVA 6PAXA 2QUFA 5J1YA 3PVDA 3HRTA 4RLQA 2W7NA 1E62A 2JA2A 1TW3A 3A1YA 2EILH 2KQRA 2NAZA 4BJTA 2UZKA 1LPQA 5EG0A 1LFUP 4C2LA 2XF7A 2FMYA 4GYIA 2LC2A 2LYCA 1S6LA 3WTTC 3UKGA 2OA4A 3MD2A 4CGZA 2OJED 1BI2A 3W2VA 4RDKA 3QFRA 1WH5A 3CPWB 3I55I 1G7CA 4P55A 4H4KC 3WNCA 4EJTA 3IWFA 3G4SB 4TT3A 4HPQA 4N0BA 1FNDA 1X1CA 3OOPA 1YLOA 2PECA 2XGDA 3WGIA 1LFBA 5BOXA 2CGPA 2NRAC 4L0ZB 1RPWA 1JJ8C 4KISA 1OFLA 1FNNA 2R4GA 1G6NA 5CVRA 2B9SA 4P6VF 2O9LA 3F8NA 3CCUI 4BGDA 1IC8A 1PUEE 1L3LA 3ZZTA 2CYYA 5FKKA 2IRFG 2VPRA 1E43A 4HEA2 4PGOA 4RAFA 5KK1A 1OCCH 3OIQA 5HDNA 1VQ4I 2OK8A 3BG3A 1W7PB 1Y56A 5JR3A 3BQZA 4UV8A 2XPWA 2OC6A 3B73A 3HYIA 2AXLA 5ED4A 1QHHD 4E4HA 2IPQX 3ZQFA 2JA6J 1NHAA 2VKEA 1T0FC 4ZCIA 4Y7NJ 2QZ8A 3WGGA 2PMUA 3FX3A 4BE2A 4HF2A 1T08B 1DARA 5HLGA 1FMVA 4BL0B 1RQRA 2BEOA 4L9VA 2LTPA 1AA7A 3ZQIA 3GXOA 4KA4A 4BY7J 2XGEA 5LHHA 1I3QJ 4Q48A 2OTJB 2DYIA 2X85A 4C3HJ 4IQ4A 1VQLI 4DQLA 4OJLA 1LDDA 1ZG5A 4IPAA 2CRGA 4RPBA 2AQEA 2V7UA 3JQQA 1I5ZA 2FNPA 3MFKA 2WTEA 4UAJA 4NC8A 3BY6A 4II2A 1JTXA 4BXUA 4CCKA 1QUFA 1LDKB 5F64A 4UZFA 2QTLA 3TP0A 1E1RA 3VYTB 4P9SA 1X1DA 4N3GA 1X19A 2AHQA 2MYSA 5J47A 3HAGA 5D4RA 2BOLA 3I4MJ 1TYXA 2FA5A 3GCMA 1ZTRA 3GTQJ 4Y4RA 4G7WA 3RPUA 4HNVA 1YX2A 3D26A 4X1EA 1KTVA 2Q8KA 3HPGA 1ORKA 4X7EA 3WU0A 2JSPA 2UWMA 4KKSA 1Z0XA 4O3MA 3PL8A 4TMWA 5BNGA 2QXZA 1M1EB 3A8KA 1H0MA 1FNBA 1GQ8A 3SY2A 3QOPA 4X0CA 4YIRX 2P8TA 1SFXA 4E7HA 1MDMB 2QGUA 4HWVA 2O1DA 2X6XA 3CTAA 1O4XA 1RESA 3GMEA 4LB6B 2HZDA 1QRYA 3BTCA 2FVGA 4UZUA 1K79A 3WTVC 3I71A 4DIQA 4HDVA 1YRNA 3DLAA 4CYCA 3E1YE 5HNFA 1VFCA 1TT0A 4F93B 2QCOA 2X4HA 3QYFA 4X0GA 1RIOH 4DQKA 1VQOB 2VFOA 1MJBA 1G3SA 4HV6A 1OGJA 4XOPA 3FK7A 4ENJA 2VBMA 1HKSA 2BE5F 3OR1C 1GR1A 2CW0F 4URRA 5E8IA 4AYBN 1SAUA 1YI2B 1YJWI 2XGXA 1W35A 2I1LA 3ECOA 1IZ1A 1MW7A 1SC7A 2QE7A 3N05A 3VPRA 4CCLA 3CF2A 2X0LA 1P7IA 3Q0UA 2FBIA 1FNMA 4OJ5A 2AHOA 5CVIA 4C3IJ 3ZMTA 5K5QA 2RKHA 1XB4A 1BM9A 4XD7A 5C1CA 2YUSA 2BMWA 4XBFA 5M3MJ 2XIGA 3F3XA 4U0VA 4CICA 2YWFA 3SUCA 2IA2A 1IUFA 3IAS2 1KK0A 4DBQA 2CQKA 2KDOA 5IT9Z 3IUOA 3ZP5A 3LA7A 4RAYA 4M53A 4Z4UA 3BCAA 4RAGA 4TMZA 4PDKA 5E6TA 1TL8A 3UR3C 1FY7A 2D2WA 2PI0A 4EV0A 1W1WE 1I6XA 3E0JB 2AO9A 5K5OA 1OB5A 1I18A 3IAM2 9ANTA 4D5FA 1YE9A 3GQ8A 1TTTA 2I5UA 3OYCA 4JBAA 4Y9RA 5D6FA 3N97A 1QA1A 3A01A 5BPDA 2XVCA 3L2RA 2FXAA 3K2AA 3OYJA 3U6BA 3RIRA 1ZG3A 1VNDA 5DCMB 2ELKA 4QTRA 5FRMA 4YFOA 3BG9A 3A4CA 1IDZA 1S0UA 2ZFWA 1H8EA 1ETQA 3CC7B 3BR1A 2EIKH 2E5NA 2R7DA 2XC7A 1E3OC 3HSRA 2UXXA 3DPTA 5J1RA 1K83J 5FRNA 1W0JA 5GTHC 1G7SA 2NVTJ 1YJNI 2DT6A 3QP5A 2J8IA 2GXBA 4U0WA 1Y6IA 4BQQA 3ONQA 1TNTA 4E7IA 3WU1B 1IO2A 2H1LA 2VBZA 1X0CA 1J9IA 3BH4A 2BXZA 2V31A 2FMLA 2BM7A 3IL2A 1GV5A 5B3SH 1WU8A 3CCYA 5HLIA 1Y0YA 3S1RJ 3EETA 3M1EA 2XHKA 4PC7A 3CQZJ 4M0LA 3JTGA 4MQVA 2JK3A 2HFHA 1HF0A 1CQXA 1HW2A 2E1BA 2ZXJA 1S29A 3FMSA 4BBSJ 4YAUA 2GPJA 1OR7A 2WB1A 4F52A 3GFLA 3D0SA 1TT5B 4V2FA 4A0YA 5IT3A 1V5FA 2IGOA 3L2CA 2R7OA 1KA8A 3AL0C 3EUHA 3H35A 5TY0A 3HHGA 1WOPA 2XAUA 1EFCA 2BVLA 1N75A 1BI1A 1M1KD 4W97A 2W85A 4N9HA 3VEPA 2KT0A 2KZGA 1P9QC 1ZH5A 2C5HA 2D45A 4G7XA 3R0AA 1VQ8I 3PSSA 3H3VK 1DABA 3MZHA 3GFIA 1KK2A 4OOXA 1ON1A 2V7WA 2E7WA 3SZEA 2J8KA 2K3FA 1V5EA 3J81K 2OD5A 3C3WA 4A3JJ 2OF7A 2B0LA 3S3MA 3HB9A 1RNLA 1TYUA 2L54A 4H9GA 1IG7A 2OTJI 2JJ1A 1YHQB 1I6HJ 1E3PA 1WGXA 1YIOA 1MBHA 3TBIA 1NH3A 4HE6A 1QVFB 5ICGA 2F2EA 1WI3A 2FRHA 3BJ6A 2NVXJ 4X8IA 3PQKA 1B9NA 2K3PA 2EIJH 5TRDA 1I7PA 2OZ6A 2F5FA 4V2GA 5ILSA 1V5GA 3I59B 1FTZA 4G9YA 2WY7Q 4CCOA 1U6GA 3AL0B 3HOZJ 1UG2A 3GQ7A 1HW1A 4MLOA 2IGNA 2CC2A 2B0RA 3AK5A 3HSEA 1O7LA 3HG9A 2LR8A 2C4UA 4YIFA 3BLYA 2KDZA 5GADJ 3ZQCA 3E1SA 2EQRA 1X58A 3FY3A 1O8IA 2KRFA 1Z6RA 1T98A 1V3FA 4IHVA 3G1LA 2VNJA 5F27A 3KEWA 1WCMJ 1PJ7A 1XDUA 4MIMA 2LKXA 4OM9A 2ZZQA 4OMYA 1WH7A 1JJ2B 1T95A 1TWFJ 2HYFA 3JCUC 1QVGB 2JJ7A 2Q6LA 1XMKA 3ZBTA 1NDHA 3SEZA 5GV7A 4BJ6C 4HG2A 3OR2C 1DP7P 2K9SA 5FLMJ 1E79A 2W57A 4A3DJ 4RLFA 3GTKJ 2DU9A 1Q82D 1K9MD 4UUVA 4LK1F 4NUBA 5CQGA 4KIGA 4UB8C 3CMMA 1NJID 2OBRA 4XOTA 2BXYA 2Y0SA 2QTZA 4XRSA 2ZZGA 2FQ4A 3GLXA 3KEOA 4HRIA 2PG4A 2W4SA 1R5GA 1E17A 2IQ7A 2TRTA 3Q6QA 1OJLA 4CHUA 5FO1A 1UHWA 2VE8A 3MZ8A 2E35A 5IYCJ 4XLCA 3K9TA 2RDPA 1YJ9B 1TYVA 4P5OA 1D8JA 3A8JA 4RPDA 4DGWB 1U5TC 5K5RA 4OOSA 4FT8A 2JRTA 3U21A 3SJMA 5KW9A 3QU6A 5TGTA 1KYWA 4F7ZA 2L9VA 4PC1A 1IN8A 3ONYA 1IRXA 2GK7A 3OMYA 3J81k 3T9GA 2Z99A 4I2OA 3OS0A 3ZMZA 1MBJA 1MJAA 3J7YJ 3WTZA 1UMKA 1FJLA 3CCJB 2EFNA 2FE3A 5AONA 4ZZDA 2VXDA 4I01A 3M8FA 2VNHA 3TOBA 4LC0A 4RD6A 3R0JA 1XCBA 1EXMA 3CUQC 1BA5A 2GJPA 2QZAA 4PSWA 2EBIA 5E3LA 2ZTGA 2Y0SN 1S3JA 1N06A 4YAFA 3W2GA 4A3KJ 3TO6A 4JRAC 2NYXA 2KKOA 2CW8A 2RV8A 1A5JA 4A3EJ 2CW5A 4NC6A 3BR0A 3BTJA 4HF0A 5GPAA 3RZDJ 2L3DA 2VFPA 3BT9A 3F21A 1PJRA 1U5TB 4XONA 1K73D 1HA8A 1T39A 4L9JA 5BSYA 3ZZ0A 3WBKA 2BM4A 4I84A 2O0VA 3L09A 4A6EA 2NS8A 2QQ9A 5J3LA 3BG6A 1KU2A 4BHBA 2M45A 5KAFC 3FKIJ 3PNVA 5KNLA 3J81Z 4ENNA 2HDDA 3WQZA 2LDUA 2XT4A 2M2EA 2CSOA 1P6RA 3FWEA 3IV5A 1ZK8A 1CLWA 4FQGA 2CFXA 1QGAA 2VYQA 1QPIA 2XNCA 2UXNA 4RBOA 1Q9SA 3ERMA 2O0YA 4B8XA 4KT6A 1KQ0A 4PAAA 2QM3A 1WFXA 2F48A 3FXRA 2ELJA 4LIUA 2CFOA 2CJJA 2VBYA 3NAUA 4JX6A 1WJBA 1W9XA 2JZYA 2CNDA 5E3NA 1JI8A 4MXNA 2XUBA 2L4MA 2LF8A 1H80A 1FPQA 4R8HA 1D5YA 2FX3A 4Y52J 1KGSA 2V7TA 2JSCA 3KFWX 4PJJA 2WZPP 3JRGA 5K1YA 1USTA 3RDIA 4CO8A 1TWGJ 4UZEA 4UVCA 1TSPA 5IYNA 4O6JA 2LREA 1ZRFA 3S2HJ 2PX9A 3HZJA 2L2OA 3MQ0A 2VBUA 4B44A 3FXMA 3PO3J 3ES9A 1LLWA 1OCTC 3KZZA 3SQVA 4E70A 4DK0A 2EZIA 3AVUA 2E1MC 2UV1A 1FIPA 2VZLA 1TZLA 3KE2A 1FBQA 5DSZA 1JE8A 1MIJA 4U88A 4WF2A 4CZZA 5ICEA 1JJ6C 4XLAA 3J7AY 4OPSA 4YZAA 5FKLA 4Y15A 3LVBA 2CRVA 2G7UA 1DU0A 4G6IA 4HOBA 4YXWA 1W36D 2KJCA 3I0TA 3P4GA 3DTEA 3BWGA 3CXCB 2W1OA 3HGYA 1T38A 1IW7F 4KMFA 2BSAA 1QFJA 3LSJA 4C2TA 4XNFA 3M07A 4BY1J 3FM5A 3HUGB 4BQNA 4KYWA 4OIPF 3S17J 3B6CA 2R7QA 2D1HA 1O7FA 3EYIA 2M0CA 4K2EA 1VHOA 5GV8A 2C4TA 3AGPA 1KK1A 1SD6A 2DA4A 3V4GA 1BLIA 3LNNA 1YOVB 4U9UA 2QY1A 2A6EF 1UCRA 2I8DA 4QVJA 3PUNA 1D3YA 1Z9CA 1P7JA 3K0LA 1PE9A 1S7OA 1R5HA 2ZKZA 3WU2C 1ZUNB 3IKVA 2L7FP 3FMQA 5HLTA 3JRCA 5IT9K 2K9LA 4X7CA 2LKPA 1TWHJ 3KX2A 2O61A 3ML3A 1JUSA 4FHTA 1DPRA 1O57A 3RYPA 3W6VA 2OTLI 2NSTA 1KU9A 2JRMA 2PQ8A 5JHFA 4EEFG 3FDYA 1GLNA 4HX4A 2Y9YA 3LYCA 1LUJB 1ULYA 2BX6A 1EF4A 4MTEA 1U8BA 1YI2I 2CUFA 4B1RA 4AYBA 3WYAA 4E7ZA 1QZEA 2GK6A 3AVVA 4C0SA 1LB2A 1VQ8B 1VF9A 3LQRA 3E6CC 2CQQA 2DDBA 1RZ4A 2WWYA 2MBFA 2X1EA 3H5RA 3LFKA 2ETHA 3IH2A 3RTRA 4FTHA 4QV2A 2H94A 3HRUA 2DTRA 4RM2A 2L9SA 1NG6A 2K40A 3PUMA 3H3UA 2UUZA 1GHCA 1BI3A 3JRDA 4ZCMA 2HOEA 1WJAA 3QYBA 3OW2B 4DZJA 1XG2A 5DV5A 2HTJA 3ELKA 3T8RA 1BIBA 3F6OA 2JMWA 3TQNA 2MSYA 5JLVC 3U1DA 1GDTA 2OPTA 2BGIA 5DDGA 4UY8I 3DEEA 4GFBA 4XQFA 1OCOH 3GFJA 3C2GA 1FBSA 2MD5A 3A0BC 1SMYF 3AG4H 1AIPA 3FXKA 2HWVA 5TR9A 4RB3C 1ZGJA 4I98B 4WXCA 3CCQI 2XRNA 1JA0A 4D5CA 4GDFA 1QFYA 1FRNA 1U2WA 1UMQA 5IK2A 4OJOA 2WR8A 4YHBA 1YITB 2P7CB 2R7FA 3B8HA 3BG7A 2BZTA 4ON0A 1MZBA 1N77A 4RCYA 1VI0A 2XT2A 1XB2A 4LLGF 3KP3A 3K7AJ 2V6EA 3O8GA 1ERDA 2NZMA 2HOTA 2VODA 2V5IA 5JMCB 2GLOA 2M8EA 3M1CA 5J1UA 2JT1A 1MKMA 2ECCA 1QGPA 4FX0A 3WG9A 5IYQA 1MD0A 2K9MA 3I54A 5D5VB 4YALA 3O8HA 5DTDA 4XLEA 2OBPA 2NXNB 1K5CA 3Q3SA 2VPLA 3ZZUA 4NNJA 2WZNA 2RNGA 4BDZA 1X3WB 1HZEA 3EYYA 4WZEA 3I4PA 1OR7C 2RVCA 1JXSA 3W6JB 2Z16A 4ETSA 2ZNZA 3OYAA 3EQLF 1PKVA 5C3EJ 1LLZA 1EWYA 1O8JA 1LVAA 3PIOF 1IJWC 2DJNA 1OHHA 3KZYA 5FKOA 4WZLA 1RU4A 4D7MA 1N25A 2JPCA 3CJRB 4BAYA 4C43A 1QA6A 4M9SA 3OYBA 1D2EA 1IDKA 4RGRA 2KL4A 3I1FA 2FF4A 4ZTFA 3GTGJ 3OV8A 1YS6A 1Z77A 2D74A 3GQ9A 4LOCA 4W8SA 3ZQHA 1IB4A 1R9TJ 2QKLB 2KHMA 2D1VA 3QP6A 2UVFA 3SZGA 4I76A 3G2BA 2KP6A 4C30A 3ESWB 1JKQC 3QQAA 3DCFA 4AIJA 4W8RA 2XKOA 2D9RA 4FE4A 3GUDA 4FE7A 3G4SI 1BR4A 4Q4ZF 1ZELA 1IJFA 4MNUA 1ZR4A 2JWTA 3ECHA 3KLOA 4I0AA 1O3RA 1SVLA 3LSPA 2R0QC 1KQ8A 4G12A 2K5CA 1QVUA 1Q1VA 3E97A 1O3QA 1IN4A 1AKHA 3IP4B 1MMNA 4XORA 5F0HA 2CQ7A 4KMUX 1R71A 2JA5J 1A6QA 2YPRA 1R23A 1B4AA 2XGCA 1PXZA 1RI7A 2GZWA 1RR8C 5FIUA 1V54H 3DXJF 3CF5F 4OU0A 5EGOA 2R7ZJ 1TW2A 4F7DA 2IEKA 1VQ7B 3GTJJ 1T6XA 4QLCU 3PO2J 2NT6A 3QODA 4MYUA 4AF6A 4UNOA 3LWFA 2R7VA 1NRKA 2G0YA 1LDJA 4YFXF 2KIQA 2B7BA 1EH6A 1R1VA 1HSJA 1XGSA 2YU3A 3TEDA 2QSFX 4BACA 1Z7LA 3OYNA 3J7ZI 3Q39A 1W2BB 4QPQA 1LFPA 2GAUA 1OB0A 3QFTA 2XNJA 4Q5SF 2E1OA 2NNYA 4JQFA 1IRZA 3W5HA 2YX7A 1IJEA 3OFNA 4OOVA 2BY3A 4OAZA 4EM1A 3ASRA 3DEUA 3S14J 4EJWA 2VOOA 1QQIA 4KN4X 3BJAA 2V6CA 4HX8A 2ACJA 1IHMA 3MKLA 4PUSA 2KRCA 1UELB 3BZ6A 5KVRA 3BCFA 5HDKA 2QQBA 2OK7A 4P1WA 1K78B 3Q6RA 3QWLA 2LNBA 4IHTA 2EV6A 3TDUC 4NCNA 1JRGA 1Z6TA 1NG7A 2EA4A 5F4OA 2V1XA 3JAMZ 1UJ8A 4XN3A 1MABA 1USSA 1IXSB 1Y8QB 5AIPA 2BW3A 2IS2A 3AVYA 1NB9A 1D0YA 2H6CA 1R5NA 4ESJA 2YSRA 2W24A 4Z4ZA 2XC1A 4M71A 1SFKA 1T56A 2CV1A 3LJYA 3ASNH 4ZYGA 1KRHA 3SLNA 1QJVA 5IP7J 1D1AA 4NDLA 3K4NA 5JLWA 2BM5A 2GIVA 3LL7A 3CCMI 1LNWA 3TP3A 1EJ9A 4IKFA 5LRSA 2OBTA 4EJVA 3M3YJ 2W48A 1JB9A 1VQOI 1CF7B 1I3AA 1ZM2A 3ABMH 2R5ZA 3TKYA 1RUOA 2R7RA 4QUZA 3SDGA 1GJRA 1IN5A
chains in the Genus database with same CATH topology
4BQQA 1Y6IA 3SEQA 5KHDA 1T5EA 3ONQA 1MNDA 4E7IA 1BMFA 2F43A 4U4BA 1X0CA 3RCOA 2M7BA 2X1CA 3EUAA 5CPRB 1OGOX 3BH4A 3OYEA 3MKWB 2V31A 2ZXIA 2NT9A 1D0XA 4B47A 4DNTB 3QOEA 2L7KA 4YZXA 4Z1MA 1J09A 2HQAA 1WJEA 2CUJA 2W6IA 3ZPPA 3VMWA 1COWA 4ZYAA 2D3LA 3OL3A 1EFRA 3L2VA 4HNUA 2MC4A 2KPMA 2E1BA 2F4IA 3UW0A 2WB1A 4YELA 4F52A 2HLDA 1HG8A 3AKZA 2NSPA 3S3NA 2LOOA 1WJDA 2XOKA 2VKDA 1V5FA 2IGOA 3ZGKA 2R7OA 3HKZA 3AL0C 3H35A 2ZZFA 2VJ5A 2XAUA 2BVLA 1N75A 3SYTA 4B3XA 2V7FA 1PYVA 1X4PA 2M7AA 1P9QC 4C2LA 3H5NA 4G7XA 4R79A 1KMHA 2F6CA 4LITA 4XLHA 4NQWB 3PNTA 2X6WA 1V5EA 2JVGA 2VBEA 3OY9A 3KRGA 1IA5A 2ZXHA 3HOTA 3KYLA 3S3MA 4J01A 1SKYB 2JJ1A 2X8KA 4N4OB 3TBIA 2M5SA 3WWGA 2VQHA 2CK3A 2V26A 4JMQA 1OFMA 2K3PA 2LY1A 3BCBA 1IDJA 3D5SC 3DPLC 1V5GA 3K4JA 1MNEA 1E1QA 2WY7Q 4XN0A 4CCOA 2IS4A 3AL0B 3OS1A 3OOUA 2F5VA 1DGRM 3C2HA 3W3CA 2HPMA 3V42A 1WMRA 2WSSA 3GQ7A 4MLOA 2IGNA 2X6YA 2O04A 2WAQA 2JIZA 4C9YA 2CMPA 3D5LA 1WJFA 2JVHA 4CA0A 3OYFA 3HG9A 2LBFA 2LG4A 3DWLE 2Z2SB 3DU5A 5FROA 3H0DA 1DBGA 2VQLA 3BLYA 1E3ZA 4G6TB 4KKTA 3E1SA 2X3HA 1KCDA 3LFUA 3OL4A 3AFHA 3OYKA 3FY3A 3UNGC 1VLYA 2M3AA 1O8IA 4XKBA 2ZTNA 2INUA 3HC7A 1KONA 3LSHA 3ZCOA 2VJJA 3H9GA 3VSTA 3KEWA 2XZLA 3CP2A 3OWTA 4AU7A 2ZZQA 4W8TA 1T95A 3DTIA 1BN8A 2DOAA 3EPZA 3SEZA 2Z6BD 4BJ6C 1FMWA 2HU9A 5AMVA 4HG2A 3OR2C 3JU4A 4EATA 1E79A 4CCMA 4RLFA 3B8YA 3OEEA 2VASA 4NUBA 2E60A 5CQGA 5HVQC 3CMMA 1DQUA 1O88A 4XOTA 2WPDA 3EQOA 2Y0SA 3CZ6A 1EE6A 3B4NA 2ZZGA 1WPCA 4D1QA 3CJQB 4HRIA 2W4SA 2X53S 4HIZA 1V0FA 2XZOA 3I9V2 2IQ7A 5HOOA 2AQFA 4N4NB 4XL9A 4XLCA 4ANJA 4P5OA 3OPOA 4U7BA 4DGWB 2VL8A 3OYHA 4NK8A 3U21A 4CUGA 3TL4X 5TGTA 4AVZA 2R7SA 1I8DA 4JOMA 1U0JA 2GOXB 3ZPNA 3HPHA 3T9GA 1IRXA 2GK7A 3OMYA 3GVKA 2PYHA 2CV0A 1X1BA 3OS0A 3A2KA 1AIRA 3HOSA 4EW9A 4XKCA 2INVA 2VXDA 4BE1A 4ZDOA 1E3XA 1UD3A 4KKUA 4YZQA 4ZDLA 2CUZA 2GJPA 4PSWA 3OYDA 2ZTGA 2DIEA 3MKYB 1CZFA 3FKSA 2XZPA 1D1BA 4TSFA 4B43A 4U49A 2CW8A 2NTBA 2E5ZA 1OLTA 5LD2C 4ZC3A 4ZDPA 2P0WA 1PJRA 1BR1A 3GQAA 4XONA 4B48A 1HA8A 4E7SA 1NBMA 2ZFUA 1UD4A 4I84A 2O0VA 3OIPA 3DTKA 1PLUA 4XM3A 2HVQA 3BG6A 4OJOA 4W8RA 3EUHC 2L5QA 5KCMA 4E0FA 3PNVA 5KNLA 4Z06A 1O8MA 3VYRB 3PJRA 2X51A 3SDBA 3WQZA 4DK1A 1LVKA 4NC7A 4BUPA 2ZSHB 3NE5B 2KZVA 3CP8A 3MMYB 2W6JA 4KT6A 3EQNA 5CKTA 3VYSB 3PUBA 2KVOA 4B3FX 2OV7A 2X1DA 1WFXA 1YX3A 2ELJA 4LIUA 2IGMA 2CFOA 4CSWA 2XNDA 2VB6A 1WJBA 1W9XA 1WTHD 4ZTJA 1JI8A 2DT7B 4BEHA 2KMUA 3F9KA 4MXNA 4PMHA 2VBKA 3HXLA 1H80A 2GOMA 2GJKA 1H8HA 1R6RA 2MFZA 2VQGA 4PJJA 2A5WA 4BU2A 2R7UA 4YEJA 2WZPP 3S32A 2M4GA 3VSVA 1UG0A 2LRDA 2JJ2A 3L2QA 4KJZA 2JDIA 2LREA 3FBNB 2L2OA 4FETA 3K10A 4B44A 2HPIA 1N78A 1MMAA 2LBFB 4DK0A 2DCEA 2E1MC 2UV1A 2NOJB 3VWBA 1TZLA 3K4KA 3ZIAA 3ZSCA 3PSIA 3J7AY 4ITVA 4XLAA 3CESA 2DXIA 1QHGA 4YZAA 2NTQA 3TMOA 4BJ5C 3I3LA 2XF6A 3OYMA 4G6IA 3RSNA 4YXWA 5FL7A 1W36D 3L2WA 3ZRGA 2QKMB 1UD5A 2BVMA 3B90A 1K6YA 3DTEA 4L8JA 2W1OA 2CV2A 2KLOA 2M4KA 2W82A 4C2TA 4XNFA 2R9VA 1UAAA 2VXZA 3GVJA 3H94A 3HUGB 2WY8Q 4BQNA 4BE0A 5LFAA 2R7QA 2V7QA 4YZ0A 2WBMA 4QPOA 3PSFA 2R7WA 3A3GA 2QY1A 3OEHA 1BLIA 3LNNA 1Z21A 3FHNA 2I8DA 1PE9A 2MABA 3OYGA 3PNYA 4F92B 3M8JA 5HLTA 2V1NA 2K9LA 3KX2A 1W0KA 3K4BA 2ODLA 1O8FA 1WJ5A 1UD8A 3FBIB 2NSTA 3KEYA 2BW3B 5JHFA 1JTAA 3FDYA 3K4MA 1GLNA 2CS3A 3H9JA 4GRIA 1V0EA 4CCJA 2O1DA 2HNHA 2KRHA 3LSMA 3S3OA 4TKOB 3W2AA 2F1MA 4AYBA 4E7ZA 2GK6A 2FUG2 3LSGA 4F55A 1X4OA 3A35A 3LSIA 2X1EA 3H5RA 4XKVA 3PFYA 3RTRA 3T53B 3VSUA 2V4JC 1O8LA 4II3A 2PJRB 4RM2A 3K6GA 3BC8A 2WJVA 3L2UA 2HDWA 2L9SA 2MD0A 1NG6A 4RMNA 4RLQA 2UUZA 4DBRA 2W7NA 1DBOA 2NTPA 2JA2A 2KQRA 2L9NA 3A1YA 1WJAA 2Q2EB 3H9QA 3K4LA 3QYBA 2IXSA 4PFOA 4BJTA 2XF7A 1XG2A 3GVLA 3OE7A 2LC2A 2LYCA 3MD2A 2O5RA 4OJ6A 3DEEA 3W2VA 1Z3XA 3GBGA 2WAEA 4XQFA 4YRVA 4H4KC 3C2GA 4TT3A 4HPQA 1X1CA 4E6KG 4HSTA 3VYUB 2PECA 5C1EA 1BR2A 1BOBA 4KISA 5IK2A 1YX5A 3QYEA 2R4GA 1O8KA 1OFLA 1QCXA 3H5AA 3ZXSA 3BC9A 4U87A 3OS2A 3BG7A 4BGDA 3K70D 1N77A 1LKXA 2XF5A 1WJCA 3FKJA 2Q1ZB 2VJ4A 2ZSIB 3VSLA 1EA3A 4ASUA 2Z8GA 3G05A 2XGJA 2UVEA 2LZJA 1DP3A 2V6EA 4GQNA 4C2UA 4F91B 4HEA2 1VZ0A 1ERDA 1E43A 1KZLA 1O8DA 2NZMA 3OIQA 1Y56A 3M1CA 2OC6A 4CZCA 4Y3OA 1QHHD 4E4HA 2WJYA 3ZR8X 2CH0A 1NHCA 3DKYA 2VJIA 2K9MA 1K28D 1T0FC 4XLEA 4E7KA 4FXUA 2A6TA 1K5CA 4XR6A 3NWTA 3FPPA 2VPLA 4BE2A 3DDYA 4NNJA 2RNGA 4BXFA 4BDZA 4HNTA 3VMVA 4OWRB 1HZEA 1FMVA 3VDXA 4BL0B 4FASD 5HNHA 2VLAA 1OR7C 3RPUD 1AA7A 2CW7A 2Z16A 4DOZA 1G59A 2Z1DA 3OYAA 1PKVA 4E7JA 1O8JA 2X85A 3K4CA 4IQ4A 4PJMA 2IS6A 4OJLA 4LIVA 1OHHA 4IQJA 4MR0A 4NK6A 1D1CA 2ZZEA 1RU4A 5DN6A 3DKXA 1OOCA 2AQEA 3CJRB 3RQ4A 4OZZA 4NC8A 4II2A 3OYBA 4CCKA 1IDKA 2PJRA 2KL4A 1G8XA 2IGKA 3A3BA 1LDKB 2PMZA 2BSPA 2RREA 3EUKL 4OZYA 2LH9A 4ZTFA 3LMWA 4PFPA 1E1RA 3VYTB 3ZQQA 1X1DA 1X19A 2MYSA 4B3GA 3GRHA 3HAGA 3GQ9A 4W8SA 1D0ZA 1KTWA 1IB4A 2M0MA 2BOLA 2QKLB 4BS9A 2KHMA 1E0EA 1BHEA 2UVFA 3W2WA 4Y4RA 3SZGA 4G7WA 1RWRA 3G2BA 3JURA 2R7XA 2KP6A 4C30A 4Z03A 2W00A 4XMYA 2RQQA 3HPGA 4ZJZA 2JSPA 1W36C 2UWMA 4KKSA 1BR4A 1ZELA 3PL8A 2QXZA 4BQOA 1GQ8A 2WAFA 4DJAA 4E7HA 2E1MB 4DNRB 2K5CA 1O8HA 4HWVA 3DPUA 2X6XA 4RM3A 3IP4B 1MMNA 2HZDA 4XORA 1Z3YA 1QU3A 5CDFA 3T56B 4UZUA 2PYGA 4F3QA 4DIQA 1KCCA 1PXZA 3DLAA 1UD6A 4IX7A 5HNFA 1TT0A 4F93B 2WADA 2D3NA 3QYFA 2HVSA 3LSKA 4X0GA 1OGMX 4LG3A 4OJPA 2HVRA 1S9HA 4XOPA 2NT6A 2VBMA 3QODA 5CQEA 3OR1C 4PJNA 2R7VA 1NRKA 4URRA 4HSRA 3HL2A 4BACA 1Z7LA 3LMMA 1SAUA 3OYNA 2XDVA 4KITB 1X1AA 3NWSA 1LFPA 4QPQA 1OB0A 4PK4A 1MW7A 2QE7A 1DGWY 4JQFA 3N05A 3OYLA 4CCLA 3OFNA 3CF2A 1O8EA 1UD2A 4OAZA 2IS1A 4IZZA 4OJ5A 3OAAA 2O17A 4XLFA 4CCNA 2O0WA 4XD7A 5C1CA 2VKHA 2VQCA 4J00A 2QX3A 2WA0A 4PUSA 4E7LA 2KRCA 1UELB 2DJIA 1FX0A 3SUCA 3IAS2 3BCFA 4DBQA 1VBLA 2KDOA 3IUOA 1WP6A 4P1WA 4W8QA 4Y33A 4OAYA 3BCAA 3OYIA 4Z05A 3OW7A 5HKKA 3VSKA 2EWEA 2OUMA 3UR3C 3DU6A 1JRGA 1NG7A 1VF7A 4PJLA 4D9JA 3E0JB 3T51B 1VJSA 1I18A 3IAM2 4XN3A 4BEHB 1YE9A 1MMDA 1MABA 3OYCA 3GQ8A 2LY2A 2BW3A 3D5RC 3K70C 2IS2A 3S8PA 1D0YA 3DQVC 3BCDA 3OOCA 3L2RA 1RMGA 2JUGA 4CH7A 4P22A 1HVXA 3OYJA 1SFKA 2CV1A 2V4DA 3GQBA 2GJRA 1MMGA 1QJVA 4PSXA 2R7TA 5FRMA 1D1AA 4BDYA 3K4NA 3VR6A 3A4CA 3LL7A 1O8GA 1BPLA 4IKFA 1H8EA 4XKWA 2XC7A 2E5NA 5FRNA 3DPTA 2XSJC 3MKZA 1W0JA 2R7RA 2VIXA 2DT6A 3S93A 2V9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDK A;  4NK8 A;  4U4B A;  2BSP A;  1X0C A;  1OGO X;  1PE9 A;  4OZY A;  4AVZ A;  3LMW A;  2NT9 A;  3GQ9 A;  4W8S A;  3GRH A;  3T9G A;  2PYH A;  1IB4 A;  1KTW A;  4YZX A;  1AIR A;  1BHE A;  4EW9 A;  2INV A;  2ODL A;  2UVF A;  1O8F A;  3ZPP A;  3VMW A;  1RWR A;  3JUR A;  4Z03 A;  2NST A;  4YZQ A;  4XMY A;  3UW0 A;  1JTA A;  4YEL A;  1CZF A;  1HG8 A;  2NSP A;  2O1D A;  2QXZ A;  1GQ8 A;  4U49 A;  2NTB A;  1O8H A;  4HWV A;  2X6X A;  4XKV A;  3GQA A;  4XON A;  4XOR A;  3VSU A;  1O8L A;  2PYG A;  4XLH A;  1KCC A;  1PXZ A;  4I84 A;  2O0V A;  2X6W A;  1PLU A;  2VBE A;  1IA5 A;  3KRG A;  4XM3 A;  4W8R A;  1DBO A;  1OGM X;  2NTP A;  4C2L A;  4OJP A;  1XG2 A;  4XOP A;  2NT6 A;  1O8M A;  2VBM A;  4Z06 A;  4URR A;  3WWG A;  4OJ6 A;  1OFM A;  1IDJ A;  4XQF A;  4XN0 A;  3EQN A;  1O8E A;  3GQ7 A;  1WMR A;  2O04 A;  2X6Y A;  2PEC A;  4OJ5 A;  5C1E A;  4OJO A;  1O8K A;  1OFL A;  1QCX A;  4XLF A;  2O17 A;  2O0W A;  4MXN A;  2VBK A;  4PMH A;  2QX3 A;  5C1C A;  1H80 A;  1DBG A;  3SUC A;  2X3H A;  1KCD A;  3FY3 A;  1O8I A;  1VBL A;  2Z8G A;  4YEJ A;  2UVE A;  3VSV A;  2INU A;  1O8D A;  4W8Q A;  2NZM A;  2VJJ A;  4Z05 A;  3VST A;  2EWE A;  1JRG A;  4W8T A;  1BN8 A;  1NHC A;  4XN3 A;  2VJI A;  3GQ8 A;  3ZSC A;  5AMV A;  4XLE A;  4XLA A;  3B8Y A;  1RMG A;  4YZA A;  4XR6 A;  2NTQ A;  1K5C A;  3VMV A;  1O88 A;  4XOT A;  3EQO A;  1EE6 A;  1QJV A;  3B4N A;  3B90 A;  1O8G A;  1O8J A;  2X85 A;  4XKW A;  2IQ7 A;  4OJL A;  4XNF A;  4MR0 A;  4NK6 A;  1RU4 A;  1OOC A;  4YZ0 A;  4XL9 A;  4XLC A;  2QY1 A;  4OZZ A; 
#chains in the Genus database with same CATH topology
 3SEQ A;  1MND A;  1BMF A;  2I10 A;  3CCV I;  2F43 A;  4U4B A;  3QPL A;  1FP1 D;  3RCO A;  5CPR B;  3LOC A;  1AHD P;  1PJ5 A;  4P3I A;  3HHH A;  2N8G A;  4WZK A;  1D0X A;  4B47 A;  1WOO A;  1OYW A;  1S72 I;  1J09 A;  1YS7 A;  4HA8 A;  3VOE A;  4V19 K;  2TDX A;  1H8A C;  5JBQ A;  2ADU A;  1VQ5 B;  1ONV A;  3ZPP A;  1COW A;  1W5T A;  2E1R A;  4I6Z A;  5TJJ A;  3L2V A;  4HNU A;  5H6Q A;  2KPM A;  3PEN A;  5J8C A;  2PEX A;  3CC4 I;  4YEL A;  2HLD A;  3AKZ A;  3LSR A;  1WJD A;  2XOK A;  3ZGK A;  1U9N A;  3CLQ A;  3HKZ A;  4DNC A;  1U2R A;  3LA3 A;  2NVQ J;  3G71 B;  3C7J A;  1GVD A;  4GYG A;  4HQM A;  2R6H A;  1MSE C;  2M7A A;  4MEY F;  5K7Z A;  1HXD A;  1X1P A;  1UHS A;  1K4T A;  3JQR A;  2F6C A;  3GF2 A;  3ML6 A;  4NQW B;  2A5Y B;  5IYW A;  5E3M A;  1B9M A;  3V8K A;  4CYD A;  1W87 A;  3R6J A;  1IA5 A;  1Y0U A;  1A04 A;  1Q86 D;  2ISY A;  3BTI A;  4ENM A;  4ESF A;  5JI6 A;  3TOA A;  4N4O B;  1VQ5 I;  3CB4 A;  4Z2Y A;  3RKY A;  4G8X A;  2DOE A;  3GX4 X;  4A3L J;  3CUQ B;  2VQH A;  3P9C A;  2GM4 A;  2CK3 A;  2V26 A;  1R1U A;  1MNM C;  3AST A;  2V9P A;  2FOK A;  2BV6 A;  1D5V A;  4ASN A;  1FNC A;  5FD6 A;  4IF4 A;  4XID A;  1WKM A;  2JQ7 A;  1AMO A;  3OIO A;  2ME0 A;  1PP7 U;  2IS4 A;  1Q1H A;  5HLH A;  4IVN A;  3OOU A;  2HPM A;  1DGR M;  3C2H A;  3W3C A;  4P1V A;  4LB5 A;  3BR3 A;  2G9W A;  2G7H A;  2WAQ A;  2X6Y A;  2CMP A;  3D5L A;  5EG0 B;  4A3I J;  1W0T A;  1VQ4 B;  2O6W A;  4X05 A;  5GPC A;  4Y17 A;  3DU5 A;  4OIN F;  2ZBV A;  1DBG A;  1IN7 A;  4X7F A;  2X3H A;  1FBU A;  5ERI A;  3OL4 A;  1KCD A;  5E1X A;  2QF7 A;  3UNG C;  1YW8 A;  1GV2 A;  2M3A A;  2OAZ A;  1U9O A;  2F4O B;  4KT5 C;  3ZPL A;  1ZAO A;  1K78 A;  4XKB A;  1H9T A;  2ZTN A;  2INU A;  1KON A;  1R4M B;  3LSH A;  1ZGA A;  5D8L B;  3VST A;  4AU7 A;  4W8T A;  3H09 A;  2Z5U A;  1ITY A;  5GAE J;  2DI3 A;  4LLN A;  3LAP A;  2Z6B D;  5L3C A;  1KQ9 A;  1E2X A;  3Q38 A;  2KIF A;  3B8Y A;  4LK0 F;  4XRF A;  2YWE A;  3OEE A;  1J75 A;  4YFK F;  2E60 A;  4ENK A;  1I1S A;  1V4R A;  1DQU A;  2RN7 A;  3T5X A;  1DG1 G;  1O88 A;  3EQO A;  3I59 A;  3CZ6 A;  2BN4 A;  3B4N A;  1WPC A;  2C78 A;  1VQK I;  4YAW A;  4HIZ A;  3WND A;  3I9V 2;  2BM0 A;  3ZMU A;  2KIS A;  4Z4V A;  2F5E A;  3MN2 A;  2HR3 A;  1CGP A;  2Q2E A;  3K1M A;  5F6F A;  4XL9 A;  2XB5 A;  4ANJ A;  5IY5 H;  4PC6 A;  2WB1 N;  5EGO B;  3OPO A;  3V8L A;  5F0C A;  3OYH A;  2FQ3 A;  2XAG A;  4IEJ A;  3SQN A;  3S15 J;  1P4M A;  1YO5 C;  4NK8 A;  4AM3 A;  1JT0 A;  1JGS A;  1G3Y A;  2P5K A;  4RD2 A;  2DMN A;  3F0C A;  1I8D A;  2ZNY A;  2ZL6 A;  1J0R A;  4IRH A;  3B6A A;  1T6S A;  2O7O A;  1BC8 C;  1IXC A;  4YFN F;  2E2I J;  4KKU A;  1FOY A;  4IOA F;  1JNY A;  1BC7 C;  3WTU C;  4P26 A;  2PIA A;  1F5T A;  4QIW N;  3KEQ A;  1CZF A;  3MKY B;  2HQ5 A;  2E36 A;  2K4J A;  2DA6 A;  2DQR A;  3SLD A;  1T6Z A;  1ZM3 A;  4U49 A;  1HCR A;  4KIB A;  1RC9 A;  4HBL A;  1SVO A;  4XRS G;  1PUF A;  2DT5 A;  2E5Z A;  1FTT A;  2NTB A;  1OLT A;  2DAO A;  4WK8 F;  1ETW A;  4FN5 A;  2XSD C;  1SMT A;  4ZH4 F;  1UD4 A;  1IRF A;  4PC3 A;  1W5C C;  1K4Z A;  4EH1 A;  3ZUG A;  1PLU A;  2GQQ A;  2Y69 H;  1ZRE A;  3KL9 A;  3EUH C;  3WE2 A;  4WCG A;  5KCM A;  4E0F A;  2VE9 A;  3BR6 A;  2R5Z B;  2QGG A;  3L7W A;  3PFI A;  3PJR A;  3A02 A;  1XGM A;  2HTS A;  3LST A;  4BUP A;  1FX7 A;  2EZL A;  2ZSH B;  5D8K B;  4W1U A;  3CME I;  3NE5 B;  4Z4S A;  3CP8 A;  2K02 A;  1HA3 A;  2MG4 A;  5H5J A;  1BX0 A;  2EV5 A;  1R22 A;  1VQM B;  2LKS A;  3PUB A;  2KVO A;  2DQL A;  4LBW A;  1YX3 A;  3I64 A;  1FWZ A;  4WXD A;  2VB6 A;  1D8K A;  1G2H A;  4G7H F;  1WTH D;  3GFM A;  1BIA A;  5D5U B;  2KMU A;  3VO1 A;  2QLZ A;  2R3S A;  4G94 A;  3HXL A;  5B1A H;  1ZR2 A;  5E17 F;  2VBT A;  3CC2 I;  4UUS B;  3HTS B;  2MFZ A;  2VQG A;  1YJ9 I;  1UHM A;  1B8I A;  4V02 C;  1X3U A;  2YS9 A;  5CVU A;  1H9G A;  3FIS A;  5F4M A;  2XAQ A;  2GRE A;  4UUS A;  2M9H A;  3FBN B;  1NTC A;  5BSX A;  2NNN A;  1O3S A;  3JR9 A;  1QPM A;  1MMA A;  3CD6 B;  1EFU A;  1YW7 A;  1R00 A;  2DCE A;  4UV9 A;  1QNT A;  2NOJ B;  2OTL B;  3K4K A;  3ZSC A;  3W5V A;  4AUX A;  4R1H A;  2TCT A;  1QHG A;  1GXQ A;  2PMZ N;  4BJ5 C;  3WBJ A;  2NTQ A;  2QDX A;  5BQT A;  3WTY C;  3RSN A;  1Q81 D;  2DMU A;  3L1P A;  5F1J A;  3B78 A;  1H88 C;  2QYO A;  3H3Z A;  4MO7 A;  2DCU A;  3C2B A;  2KLO A;  5LRR A;  3MZY A;  5IPA A;  3H94 A;  2EPF A;  2MW8 A;  2VXZ A;  4DYC A;  3CCS I;  4IHS A;  3H92 A;  4BE0 A;  4M3E A;  5LFA A;  2DPU A;  2BM1 A;  2V7Q A;  1ETK A;  3WXM A;  2JN6 A;  2BYV E;  3PSF A;  4ZV4 A;  3PSZ A;  1Z21 A;  3RYR A;  1J5Y A;  4DW6 A;  1G3T A;  1J59 A;  2R5Y B;  3I56 B;  5CYV A;  4XRM A;  4HF1 A;  1V55 H;  3PNY A;  4F92 B;  3CC7 I;  1TNS A;  3TO9 A;  2GXG A;  2VBX A;  3K4B A;  1MBF A;  4FX4 A;  3CLO A;  1UD8 A;  2FSW A;  3FBI B;  1GAQ A;  4ZGN B;  3BNW A;  2CU7 A;  2XKP A;  1HQC A;  1FSE A;  2BW3 B;  3JSO A;  3K4M A;  2CS3 A;  2LLK A;  3ISP A;  4I99 C;  3H1C A;  1YIT I;  1V0E A;  1XFO A;  3TW6 A;  3S3O A;  1SKQ A;  2GA1 A;  4LFU A;  1ZRD A;  2QBY B;  4L5E A;  3W2A A;  3VFZ A;  5BPI A;  3JQP A;  4YG2 F;  3LA2 A;  2XAF A;  3LQ6 A;  2BGC A;  3A35 A;  2QA4 I;  2VT2 A;  5F4J A;  1EFT A;  2MC3 A;  1MRZ A;  3VSU A;  3J80 K;  4MTD A;  2XEX A;  1PVE A;  2DN0 A;  3HIF A;  1Y1V J;  3K6G A;  3BC8 A;  2M5W A;  5E18 F;  1FOX A;  3L2U A;  1X2M A;  2MD0 A;  3DV8 A;  1TLL A;  4RMN A;  3HRM A;  2H1K A;  2X0K A;  3S1N J;  4IW3 B;  1DBO A;  1S7A A;  1YYV A;  2NTP A;  4PFO A;  2PE3 A;  3K4L A;  1XX5 A;  2IXS A;  4G5G A;  2YX4 A;  4P3Y A;  3M8E A;  2QYU A;  1AWC A;  3HOV J;  4OJ6 A;  1S5L C;  2HXO A;  4MEX F;  4A93 J;  1MBG A;  2Z33 A;  2O3F A;  2QSH X;  4BNC A;  2WAE A;  2ZB9 A;  4ZYE A;  4M3F A;  1Q7Y D;  3T8T A;  1K8A D;  4FK8 A;  3FZV A;  1ZKG A;  4E6K G;  2E71 A;  3JRF A;  1VQ6 I;  3VYU B;  4NHJ A;  5M5X J;  4RGU A;  4D7N A;  5ICC A;  1BR2 A;  5EDN A;  3QYE A;  1Z1D A;  5FFZ A;  4J19 A;  3BC9 A;  4M9Z A;  5BS6 A;  1B2R A;  1TYW A;  4KH3 A;  1SD5 A;  2MLG A;  3RJP A;  3K70 D;  2QWW A;  1EZG A;  5FD5 A;  5F1R A;  1LKX A;  3RKW A;  3IKT A;  2M1B A;  3IWZ A;  3VSL A;  1FRQ A;  3VNU A;  1VQP I;  3G05 A;  2UVE A;  2E2J J;  5DUI A;  1IUY A;  3WTS C;  4LD5 A;  1KZL A;  5KSW B;  2ECB A;  1R7J A;  2J7K A;  1IRG A;  3BPX A;  3A03 A;  2B7C A;  4GO1 A;  4CZC A;  2X9D A;  4ESB A;  2QBY A;  4ACA A;  2WJY A;  2CH0 A;  2L7M P;  4IJA A;  3DKY A;  1FEX A;  2VJI A;  4EGY A;  2ZME B;  1K28 D;  5THX A;  3W2E A;  1BW5 A;  2DK8 A;  4FXU A;  1XSD A;  2A6T A;  1NK3 P;  2V1U A;  4XR6 A;  1YJW B;  3VMV A;  4L18 B;  4HNT A;  4M3G A;  4OWR B;  5L3G A;  1VQ6 B;  3VDX A;  2V1D A;  4FAS D;  2KIU A;  3RPU D;  1G59 A;  3IRR A;  1MMS A;  2EIX A;  2Z1D A;  2B5O A;  2NPF A;  3JRB A;  4E7J A;  2FBH A;  3K4C A;  1T0F A;  2A68 F;  3U2R A;  4PJM A;  1R49 A;  3TDZ C;  1YQA A;  5J4V A;  1TC3 C;  4IQJ A;  4OOI A;  4TV7 A;  2ME6 A;  3LO8 A;  3WE3 A;  5DN6 A;  1OFC X;  2WAQ N;  2JA8 J;  5IP6 A;  3RQ4 A;  3SXY A;  5IYP A;  5JLX A;  3BQY A;  1VQ7 I;  1B6A A;  5C4X J;  1E64 A;  1VQ9 B;  2STW A;  1G8X A;  3MVP A;  2IGK A;  4NQW A;  5K7F A;  5E8G A;  5LHG A;  2RRE A;  3G1M A;  4KFC A;  4OZY A;  3LMW A;  4MGR A;  4DYQ A;  1XS9 A;  4B3G A;  3GRH A;  5FKM A;  2BHY A;  3SYJ A;  2ISZ A;  2ZL5 A;  2K9N A;  3ZBU A;  4FCY A;  2H09 A;  3W6K B;  1E0E A;  1BHE A;  3W2W A;  3CW2 A;  5HZB A;  5CJ9 A;  2R7X A;  5A89 A;  4X6A J;  2L9R A;  2YWH A;  3CC2 B;  1WXR A;  2RQQ A;  2V7X A;  1P92 A;  2B7E A;  3ABU A;  4BYY A;  4B09 A;  3QFC A;  2DA7 A;  4G1B A;  1G3W A;  3W2F A;  1BJZ A;  5J3O A;  1OPC A;  2E1M B;  3B02 A;  4DNR B;  3IC7 A;  3FJO A;  3VNV A;  5CVV A;  1O8H A;  1DU6 A;  5H59 A;  4IOC F;  5A88 A;  1QU3 A;  1EH8 A;  4M2L A;  4F3Q A;  2O8X A;  4M74 A;  3CRZ A;  1MH3 A;  5F0F A;  1KCC A;  4CQJ A;  4IX7 A;  2DA5 A;  2P4W A;  3CCL I;  4BH9 A;  3CCL B;  5D5X B;  2P7V B;  2FX0 A;  1ZM9 A;  3E5U A;  3PA1 A;  3LQQ A;  1OGM X;  1ZG1 A;  4LG3 A;  1R5I D;  3ZQG A;  2F4N A;  3FXU A;  3CO7 C;  2HVR A;  3O6B B;  1GVJ A;  2JPB A;  4PJN A;  1ZM4 A;  1I39 A;  3R6K A;  2F3L A;  2Z3Y A;  3TW7 A;  4A69 C;  3E5Q A;  2JTV A;  3NWS A;  3DKW A;  1KZH A;  3OYL A;  3HM5 A;  2W25 A;  4H0E A;  3CCV B;  3CO6 C;  5LGU A;  1OQY A;  1UD2 A;  1O8E A;  1TWC J;  3VO2 A;  5JVG F;  1TQM A;  1S8N A;  3OAA A;  4Z4W A;  2O17 A;  1OMI A;  2DMQ A;  1PDN C;  2KJB A;  2OZU A;  2MA3 A;  4YDT A;  2IAI A;  4E7L A;  2VNI A;  3ASQ A;  1EP3 B;  3GZ6 A;  1FX0 A;  5F08 A;  3F8B A;  2EWN A;  1U3E M;  1R1T A;  4YII A;  1J2X A;  1VBL A;  3ZN0 A;  4W8Q A;  4OAY A;  4DZP A;  4M73 A;  3OW7 A;  5HKK A;  2EWE A;  1KU3 A;  3BZC A;  4BHP A;  3I4N J;  3CDL A;  1NK2 P;  1PUF B;  3U2Q A;  2LK2 A;  2RNJ A;  4D9J A;  1SAX A;  4PZJ A;  3T51 B;  1VJS A;  3CCS B;  5JVT A;  2MH9 A;  1LE8 B;  1XGO A;  2LY2 A;  2ZBK A;  2P6T A;  2A69 F;  2DW4 A;  3D5R C;  3DQV C;  4AWX B;  1RMG A;  4HLY A;  3EDP A;  4OIR F;  2JUG A;  3RI4 A;  1EP1 B;  4K1X A;  2J5O A;  4EQQ A;  1HVX A;  3PA2 A;  2MLK A;  1IAW A;  5M5Y J;  5IYR A;  4Q47 A;  2V4D A;  3GQB A;  3CCQ B;  3F72 A;  4L0Y B;  4BQA A;  4PSX A;  1T2K A;  1REP C;  1FYM A;  4AIK A;  3VR6 A;  1QBJ A;  4LJZ F;  1BPL A;  4XKW A;  3G73 A;  2F4M B;  1XDS A;  3MKZ A;  2VIX A;  1JUM A;  5B66 C;  4X06 A;  3KYD B;  1ETV A;  1SD7 A;  3SHF A;  5KHD A;  5EYR A;  1T5E A;  1ACI A;  1F43 A;  2Y31 A;  3SZT A;  1VQP B;  4L9N A;  2M7B A;  4L9T A;  3EUA A;  4A5N A;  1CF7 A;  3W5U A;  2VFQ A;  2DY1 A;  3OJW A;  2H8R A;  2NT9 A;  1KU7 A;  3P7N A;  2M30 A;  1WVR A;  2NV4 A;  3R6S A;  1DDI A;  2L7K A;  2HQA A;  1WJE A;  2CUJ A;  2ZME C;  4HW0 A;  2W6I A;  4BPR A;  3OL3 A;  2M87 A;  3HEF A;  1EFR A;  1P4A A;  2ELH A;  2HYJ A;  4KDP A;  4J0Q A;  2F4I A;  3CMA B;  3OKX A;  5EEG A;  5J4Y A;  4M3D A;  3WGH A;  1HG8 A;  2NSP A;  5KAI C;  3GZN B;  3G6E I;  5M5W J;  1ZLK A;  4N3N A;  2O03 A;  3KP4 A;  1LM1 A;  1ZAR A;  4Z4T A;  2DOF A;  3SZP A;  1A35 A;  2VBV A;  2ZZF A;  2PN6 A;  3K1N A;  5EF6 A;  5J8F A;  3SYT A;  1ODD A;  2E1C A;  3VMF A;  1PYV A;  1X4P A;  2NVU B;  2VN2 A;  2CQN A;  2DFF A;  3H5N A;  3IHU A;  4R79 A;  4S04 A;  1KMH A;  3K2Z A;  3M4O J;  3AG3 H;  2X6W A;  2LY9 A;  5GAG J;  2DEU A;  2VBE A;  4WX9 A;  3KRG A;  2ZXH A;  2DMP A;  4M3B A;  2QMU A;  4P12 A;  1RRJ A;  1N0V C;  1QZZ A;  2X3U A;  3GTO J;  1SKY B;  2X8K A;  3FIW A;  3FXO A;  4EJO A;  3MWM A;  1W0U A;  2IJL A;  3WWG A;  1HOM A;  4G6D A;  4Y9U A;  1EA0 A;  5HZA A;  4JMQ A;  3P9I A;  3V7S A;  3BCB A;  2LF7 A;  3D5S C;  1E1Q A;  1JA1 A;  4IHY A;  2HQN A;  3WTX C;  2FJ1 A;  1QZY A;  1DUX C;  3V42 A;  4YEI A;  3O2P E;  3COA C;  2O04 A;  1QVT A;  4C9Y A;  2JVH A;  2LVS A;  2VI6 A;  2LBF A;  3U9G A;  3HOU J;  4AID A;  1W34 A;  1R58 A;  1OGI A;  5FRO A;  3H0D A;  2VQL A;  1E3Z A;  1FC3 A;  4G6T B;  1S7E A;  2VON A;  4KKT A;  3LFU A;  5FJ8 J;  2P81 A;  3AFH A;  3OYK A;  2HYG D;  1IGN A;  2DPD A;  2YU9 J;  1VLY A;  2XV4 S;  3V76 A;  2DYR H;  2Y48 A;  3A8I A;  2BHZ A;  3BPV A;  1TQI A;  2P6S A;  1JKP C;  3CP2 A;  4HE5 A;  3QE2 A;  3DTI A;  1QFZ A;  3PIP F;  1NB0 A;  1BN8 A;  1WQ2 A;  2DOA A;  3CDH A;  3RKX A;  5E3O A;  2NS7 A;  1KD1 D;  1MJ9 A;  1FMW A;  2HU9 A;  3JU4 A;  2DDA A;  5FLX Z;  1OIS A;  4CCM A;  1VQK B;  5ICF A;  5L3D A;  5B5E C;  1TBX A;  2OQG A;  5HVQ C;  4P6Y A;  2WPD A;  1TLH B;  1Z67 A;  2XRL A;  1EE6 A;  3MEX A;  2BBY A;  2LFB A;  3CJQ B;  4NBQ A;  1HC8 A;  4OPV A;  3V8J A;  4PJ0 C;  4JYK A;  4R71 A;  1IF1 A;  3REO A;  2X53 S;  2XZO A;  1Y0N A;  2VBW A;  3RY8 A;  1D8T A;  1HST A;  5E79 C;  5HOO A;  2FOW A;  3X2Q H;  2AQF A;  4N4N B;  2Q6O A;  1KQS B;  3RIQ A;  3N4M A;  5DD4 A;  3Q0W A;  4U7B A;  3KET A;  4JX5 A;  4UUT A;  3VB2 A;  4AC0 A;  2PLY A;  2DLL A;  4RB2 C;  4A6D A;  3TL4 X;  2R92 J;  4AVZ A;  4KUM A;  3U1K A;  1QUE A;  2GOX B;  1AKH B;  2CO5 A;  3HPH A;  2FNA A;  3ZPN A;  2PYH A;  3GVK A;  2CV0 A;  1X1B A;  2E2H J;  4WWV A;  2HZT A;  2F5D A;  3A2K A;  1K8F A;  1AIR A;  3FMR A;  3CCR B;  2XB0 X;  4Q7J B;  1IB0 A;  2P5V A;  4ZDO A;  1E3X A;  4AIH A;  5EMN A;  5DYM A;  2CUZ A;  2EFO A;  3N90 A;  2QQ8 A;  4JP0 A;  2DIE A;  2A07 F;  3FKS A;  2ZO4 A;  4A3C J;  2XZP A;  1YIJ B;  5LHI A;  4PAB A;  1ELO A;  1A8P A;  3CMA I;  4B43 A;  5A8A A;  4RGS A;  1HW5 A;  2DBB A;  4ZC3 A;  3ZN1 A;  3F8M A;  4ZDP A;  1STZ A;  1N07 A;  4RCZ A;  1M90 D;  1CNE A;  3CCJ I;  4E7S A;  3RPQ A;  1B8I B;  1NBM A;  2GWR A;  2ZFU A;  3J7A O;  3GEZ A;  4EJU A;  2HKX A;  3H0G J;  5GAH J;  2IW5 A;  1FOK A;  2KFD A;  5C44 J;  2L7Z A;  1W7P D;  3Q9V A;  1LEB A;  2L5Q A;  1BX1 A;  1ZRC A;  5E20 A;  4Z06 A;  1O8M A;  3VYR B;  2X51 A;  4XK4 A;  3SDB A;  4NK6 A;  2B63 J;  2DA3 A;  4DK1 A;  5IOY A;  4NC7 A;  4ZYH A;  3SFZ A;  2DER A;  3GW2 A;  2OBS A;  2KZV A;  2X48 A;  3LAJ A;  3Q3A A;  1K6O A;  3GVA A;  3C1D A;  3NEU A;  5DUK A;  1XPX A;  5JFR A;  3EQN A;  1LJ9 A;  4S05 A;  1XD7 A;  3K1P A;  1YLF A;  2YUH A;  3BJO A;  5B6I A;  4CSW A;  4M1K A;  2XTX A;  1ZLJ A;  2EFW A;  2DT7 B;  3WNB A;  4BHC A;  3F9K A;  1T33 A;  4Z4Y A;  4UVB A;  2VBK A;  3FXJ A;  1VQL B;  2GOM A;  4ZCL A;  1TP4 A;  1E3H A;  1XSX A;  2EFG A;  2GJK A;  1F60 A;  1R6R A;  2CF4 A;  2R7U A;  2OCC H;  1Y0R A;  1OB2 A;  3S32 A;  2M4G A;  1FSH A;  1B1B A;  1UG0 A;  3VSV A;  5JHU A;  3L2Q A;  3FHZ A;  3C18 A;  4KJZ A;  1ZGW A;  2JDI A;  1OFD A;  1XTA A;  1XMX A;  3MMP A;  3ASO H;  5DEQ A;  4FET A;  5FO5 A;  4AD9 A;  4KNY A;  4IHW A;  3K10 A;  1N78 A;  2BY0 A;  4GXO A;  2LBF B;  3SEJ A;  3BRO A;  1K7A A;  1SEU A;  1A6I A;  4HAM A;  3VWB A;  3ZIA A;  3CCM B;  3PSI A;  3WHB A;  2EZH A;  3CES A;  3MAJ A;  1IXR C;  3TMO A;  1PP8 F;  3FXL A;  3I3L A;  2C77 A;  3CME B;  2L01 A;  4FIS A;  3OYM A;  2CUE A;  5GP9 A;  5LBQ A;  3L2W A;  3OJX A;  3ZRG A;  3ABL H;  2BVM A;  4ACB A;  3B90 A;  1K6Y A;  3K69 A;  2EV0 A;  4L8J A;  1WPK A;  2W82 A;  2R9V A;  1HKQ A;  4Z6Y A;  1FOW A;  3WY9 A;  3QFS A;  5EZG A;  2W7Z A;  5FGM A;  5BMZ A;  3A3G A;  2W84 A;  1VQM I;  4CYC B;  1D1N A;  1OCP A;  3CDI A;  3KCC A;  1IV6 A;  2L02 A;  4IRG A;  2MAB A;  2V79 A;  1APL C;  1XSV A;  1TWA J;  2A05 A;  3GLL A;  2PJP A;  1W5S A;  4P25 A;  2A61 A;  1MH4 A;  3M8J A;  2D5V A;  2ZBU A;  3DBR B;  2V1N A;  1MDM A;  4G6Q A;  2ODL A;  2HGC A;  1O8F A;  1WJ5 A;  1F4K A;  5IYB J;  4EM2 A;  3JRE A;  2DOG A;  3KEY A;  2XRO A;  1A31 A;  3ZQL A;  3S1Q J;  3H9J A;  4RM0 A;  3IRQ A;  1LEA A;  4CCJ A;  3H9N A;  2K27 A;  1RKW A;  1Y8R B;  2KRH A;  3LSM A;  4RB0 A;  2JA7 J;  4EMS A;  1WOS A;  4RD0 A;  4ROX A;  2F1M A;  4F55 A;  1X4O A;  1XCV A;  1GUU A;  3Q0V A;  3LSI A;  5A2Q Z;  4XKV A;  4EM0 B;  2V7V A;  2V4J C;  3I55 B;  3W2H A;  4II3 A;  1YTY A;  2PJR B;  4N9I A;  2HDW A;  3KPH A;  3SJZ A;  1EV7 A;  3S2W A;  3GTM J;  3HBL A;  4DBR A;  5AN9 A;  4PGH A;  2L9N A;  2Q2E B;  3H9Q A;  2V9V A;  5LGN A;  3GVL A;  3JTH A;  3OE7 A;  4S0H B;  1Z91 A;  2BGJ A;  2XTY A;  1EKE A;  2O5R A;  1QQ1 A;  4C3J J;  2HDC A;  1U78 A;  4A0Z A;  1FP2 A;  1Z3X A;  4EGZ A;  2IT0 A;  3GBG A;  2ZC2 A;  3M9A A;  4YRV A;  2QEX B;  3DF8 A;  1ZHF A;  2HEO A;  3I53 A;  3GIR A;  3CJN A;  3CUQ A;  1BJK A;  4HST A;  2O8K A;  4WWC A;  3G3Z A;  1BW6 A;  5C1E A;  4RS8 A;  1BOB A;  1YX5 A;  1O8K A;  1HDD C;  1QCX A;  2OCE A;  3KIO A;  3H5A A;  3ZXS A;  1S72 B;  4U87 A;  2IVM A;  3OS2 A;  2K7L A;  3O3K A;  3OZU A;  1T6Y A;  2NS0 A;  3L00 A;  3D1N I;  2P3M A;  2XF5 A;  2Q6K A;  1WJC A;  1B59 A;  3FKJ A;  1FYL A;  1AOY A;  2Q1Z B;  2VJ4 A;  2COB A;  2ZSI B;  1EA3 A;  5CLS A;  1OYY A;  1HLV A;  1YRN B;  2WYR A;  4ASU A;  1EP2 B;  2LZJ A;  1DP3 A;  2XGJ A;  2Z8G A;  4GQN A;  4C2U A;  4F91 B;  1O8D A;  1VZ0 A;  1JUP A;  1XG1 A;  4D0P A;  4MYT A;  4OPO A;  3AAF A;  4IO9 F;  3PET A;  1YIJ I;  1FT9 A;  1YJN B;  2BY2 A;  4XSZ F;  1I1G A;  4Y3O A;  3FM3 A;  3F6V A;  1O3T A;  4M6X A;  3ZR8 X;  1WOR A;  1NHC A;  2ZL7 A;  1B72 A;  3GYH X;  1YFH A;  5CVJ A;  4E7K A;  3BOQ A;  3GTL J;  2XAS A;  1JKR C;  3NWT A;  3FPP A;  2EFP A;  3CC4 B;  1VQN I;  3DDY A;  5DS9 A;  5H20 A;  4BXF A;  2DOD A;  5HNH A;  1OCZ H;  3T1B A;  1ZN2 A;  2EK5 A;  2VLA A;  4IRI A;  2CW7 A;  4DOZ A;  3F8C A;  4BKX A;  4ZZL A;  2R93 J;  5J6X A;  1PJ6 A;  5ILV A;  1GAW A;  2IS6 A;  4LIV A;  3IH4 A;  3ISX A;  5J35 A;  1N08 A;  1D1C A;  2VOP A;  2OYN A;  2QN6 A;  2ZZE A;  4MR0 A;  3DKX A;  1OOC A;  2DTZ A;  1P2F A;  4ABZ A;  3DEW A;  1RUN A;  4M6Y A;  4OZZ A;  4X7D A;  1R4N B;  2PBI A;  2PJR A;  2Q0O A;  3A3B A;  2BSP A;  2PMZ A;  3EUK L;  2LH9 A;  4A0X A;  5C4J J;  4KIC A;  4PFP A;  1U5T A;  4MHG A;  3ZQQ A;  3JRI A;  4U0Y A;  5FNZ A;  4ZGQ B;  1D0Z A;  1KTW A;  1BN5 A;  2M0M A;  4FWT A;  5E1Z B;  4BS9 A;  2LD5 A;  1MBK A;  3AG2 H;  1QRC A;  4L5I A;  3P9K A;  1RWR A;  3JUR A;  2X6O A;  4Z03 A;  2W00 A;  4XMY A;  3KYC B;  3OSG A;  4IL6 C;  4ZJZ A;  3CCU B;  4A5M A;  2ZJQ F;  2ZJR F;  1W36 C;  1B72 B;  1C0W A;  1GVH A;  4QVA A;  5IP9 J;  1CNF A;  4HV5 A;  3GWZ A;  4BQO A;  2Y30 A;  3I5U A;  1QA3 A;  2WAF A;  2DFH A;  3L9F A;  4M6V A;  4DJA A;  2E19 A;  3DPU A;  2FU4 A;  2QVO A;  4RM3 A;  3AVX A;  4A3M J;  3U6K A;  2BY1 A;  1HBX G;  5D4S A;  4O5V A;  1QH0 A;  1Z3Y A;  4OMZ A;  3KP2 A;  5CDF A;  3T56 B;  1SFU A;  2PYG A;  5HS8 A;  2EH3 A;  2DA2 A;  2K9Q A;  1UD6 A;  1WSV A;  5TV2 A;  1BL0 A;  2ZCW A;  3VOD A;  4QWQ A;  5EZH A;  2WAD A;  2D3N A;  1F36 A;  4WXH A;  1I50 J;  3LSK A;  2L4A A;  3T0Y A;  2HVS A;  2HMA A;  2RC5 A;  3BH6 B;  4P96 A;  4OJP A;  1JT6 A;  1S9H A;  3E6B A;  5CQE A;  1HDP A;  4HX7 A;  1AU7 A;  3HDD A;  2CG4 A;  4HSR A;  4LG0 A;  5HDG A;  3HL2 A;  1Y1W J;  5LMZ A;  1H85 A;  3LMM A;  4QHY A;  2XDV A;  4KIT B;  2LSO A;  1X1A A;  5DNS A;  4PK4 A;  2PMH A;  4B4C A;  1DGW Y;  2ESH A;  5EEA A;  1JHH A;  3BDD A;  4YC5 A;  3ZMS A;  1I27 A;  2WV1 A;  4I02 A;  1JHF A;  2NOG A;  2IS1 A;  4IZZ A;  3BTL A;  2P5L C;  4RDL A;  3BQJ A;  2C5B A;  2XTW A;  4XLF A;  4CCN A;  1JGG A;  2O0W A;  3DU1 X;  2VKH A;  2VQC A;  3BP8 A;  4J00 A;  2WA0 A;  2DO7 A;  2QX3 A;  1TVC A;  3MCZ A;  1QG0 A;  1BOA A;  4IXA A;  2DJI A;  4U7D A;  4Z4R A;  2DYS H;  3KP7 A;  1WP6 A;  4TMX A;  4Y33 A;  3OYI A;  2ID6 A;  4AC9 A;  4X07 A;  4Z05 A;  4ZYD A;  5LEJ A;  2K86 A;  3VSK A;  1G7T A;  2OUM A;  3DU6 A;  1VF7 A;  4PJL A;  4AVP A;  4P2N A;  4GGG A;  2F1L A;  1RKT A;  4BEH B;  1A36 A;  3HOY J;  1MMD A;  1P4X A;  2Y2Z A;  4LBV A;  3BCD A;  3K70 C;  3S8P A;  1K4S A;  3OOC A;  4I09 A;  4CH7 A;  4P22 A;  1WWX A;  5A2Q K;  1JKO C;  2RC6 A;  1FLI A;  5LLQ A;  1POG A;  2BVN A;  4Y13 A;  1H89 C;  2GJR A;  1MMG A;  2AXT C;  2GBY A;  1XMA A;  2R7T A;  2EFQ A;  3ZMV A;  4BDY A;  1QGZ A;  4AF7 A;  1O8G A;  3ABT A;  1WSR A;  4OP7 A;  2HOS A;  5D5W B;  1E63 A;  2E1N A;  1G4D A;  2HS5 A;  2HQR A;  2XSJ C;  1WZ2 A;  3GZ5 A;  3WOD F;  5DS0 A;  3BZK A;  2C6Y A;  3S93 A;  2V9K A;  1JTY A;  2ZXW H;  3G1O A;  3HJE A;  3QAH A;  1QRB A;  3QSY A;  1SVM A;  4PGG A;  3B82 A;  1F1Z A;  2X1C A;  2IBD A;  2RC4 A;  4XSX F;  3OYE A;  3MKW B;  1OGO X;  2ZXI A;  5FB2 A;  4UB6 C;  5L3E A;  2DFI A;  2EZK A;  2BV3 A;  2IP2 A;  1XN7 A;  4DNT B;  2H27 A;  1ZQ3 P;  3QOE A;  3I58 A;  5L3B A;  4YZX A;  4Z1M A;  3RKQ A;  5J40 A;  1VHE A;  1BJA A;  4NBS A;  3VMW A;  4ZYA A;  3OZV A;  2D3L A;  3BH7 B;  2E7X A;  2MC4 A;  3A1P A;  1WDT A;  3UW0 A;  4M9X A;  3QPT A;  3A01 B;  3TH0 A;  2IA0 A;  1L1I A;  2ZME A;  3S3N A;  2LOO A;  2QQA A;  1WSU A;  2E34 A;  3QPS A;  2VKD A;  3PQJ A;  2NVY J;  2L0K A;  3I56 I;  1BBY A;  4TN1 A;  1OYI A;  2DMT A;  2JN9 A;  2HI3 A;  2VJ5 A;  1VQN B;  4B3X A;  3HTU A;  4A3G J;  4QFM A;  2V7F A;  2R5Y A;  2BM6 A;  4RJL A;  4LIT A;  4XLH A;  4GCV A;  3P27 A;  3PNT A;  4XIC A;  2K85 A;  3E5X A;  2RGV A;  2JVG A;  3CJT B;  1VTN C;  3OY9 A;  2AS5 F;  1FDR A;  5GTI C;  3KYL A;  2A3S A;  2ZJ2 A;  3HOT A;  4YAO A;  4A2U A;  1MBE A;  1R5O A;  4J01 A;  1F20 A;  1ETO A;  1KYZ A;  3N6Z A;  4G1V A;  2H8W A;  3AGQ A;  2M5S A;  5HS7 A;  4OIO F;  3HGG A;  2XPU A;  1H42 A;  1OFM A;  4MFE A;  2LY1 A;  2Z9O A;  1IDJ A;  3DPL C;  3K4J A;  1MNE A;  2JUC A;  1F9N A;  1RR7 A;  4XN0 A;  4EVI A;  2CBX A;  3OS1 A;  3Q5F A;  2IA1 A;  2F5V A;  1WMR A;  5D6E A;  1TQP A;  2Q6I A;  2WSS A;  2VFM A;  3CPX A;  3CUO A;  2JIZ A;  3TGN A;  1YW9 A;  1EH7 A;  1WJF A;  4CA0 A;  3LNQ A;  3OYF A;  1DDN A;  2LG4 A;  3DWL E;  2Z2S B;  2XAJ A;  1SAN A;  4KN7 X;  4HYE A;  3E7L A;  4LMY A;  1W7P A;  1G7R A;  1W4M A;  4CDG A;  1BQE A;  5FFX A;  1X3Z B;  3V7R A;  2Y0M A;  5ILU A;  4HDU A;  2WV0 A;  3QU3 A;  4RA2 A;  5K7H A;  1KJZ A;  1CQT A;  3HC7 A;  1Z05 A;  4TMV A;  3JSP A;  4QSH A;  3ZCO A;  2VJJ A;  3H9G A;  3AVW A;  3KZI C;  2VFN A;  1LQ1 A;  5FLV A;  4G7O F;  3OWT A;  1N05 A;  1RQP A;  2VUM J;  2XZL A;  2XPV A;  4C2M J;  2VT3 A;  3M7G A;  1MGT A;  2VKV A;  4RLZ A;  3NB2 A;  5LEK A;  4TMT A;  3EPZ A;  3LQE A;  5AMV A;  1K61 A;  1ENH A;  4EAT A;  4OIQ F;  4L5J A;  2MGQ A;  2VAS A;  1TUI A;  2FD5 A;  4Y7C A;  4MFD A;  3DLL F;  3F22 A;  2G0E A;  3ASS A;  4KIF A;  4A12 A;  1YG2 A;  4DQ2 A;  2PFB A;  4D1Q A;  1SFE A;  2WC2 A;  3V7C A;  3WG7 H;  3ZOB A;  1VQ9 I;  5IYD J;  1V0F A;  3DP7 A;  4B3A A;  2BPO A;  1GXP A;  3SFI A;  4BBR J;  2VC0 A;  5AIQ A;  4M4S A;  3DBH B;  4G7Z F;  4NB5 A;  2M34 A;  4RB1 A;  5M3F J;  4B4D A;  1GT0 C;  1XE1 A;  1L0O C;  1IN6 A;  2VL8 A;  5B1B H;  1FZP B;  2C2W A;  1MSF C;  1WHU A;  3ZC3 A;  1VLO A;  4CUG A;  3E6D A;  2GQF A;  4HZF A;  4WZT A;  2R7S A;  3GO5 A;  3R61 A;  4JOM A;  1U0J A;  2Y9Z A;  3H36 A;  2XAH A;  3SKB A;  1Z7U A;  2K4B A;  4PC2 A;  3HOW J;  1QA2 A;  5DCM A;  3PUF A;  4LLL A;  3BY1 A;  3GTP J;  4EW9 A;  3HOS A;  4XKC A;  2INV A;  3P5J A;  3G71 I;  4BE1 A;  1OKR A;  4XLP F;  5DM6 F;  1UD3 A;  1DDG A;  4YZQ A;  1ETX A;  4ZDL A;  3OZW A;  5FO0 A;  2HXI A;  2ZIT A;  3OYD A;  1D1B A;  4TSF A;  3CCE I;  3TO7 A;  4P9U A;  2HOA A;  5DCF A;  3QRF F;  2DK5 A;  3E3V A;  2IOU G;  3JRA A;  1RET A;  3SJP A;  5LD2 C;  3FK6 A;  3CMY A;  1SM4 A;  2ICW G;  4I0B A;  3R60 A;  5TIS C;  2FEZ A;  2P0W A;  2BF4 A;  1BR1 A;  3GQA A;  4B48 A;  4UHT A;  5FKN A;  1SFO J;  2HKO A;  2QEN A;  3ONU A;  3OIP A;  2STT A;  3DTK A;  2HCJ B;  4M72 A;  2QSG X;  4RD4 A;  5L46 A;  4IHX A;  4XM3 A;  3J80 Z;  2HVQ A;  3ABK H;  4JK1 X;  3ULQ B;  5F04 A;  3JRH A;  3NAW A;  3P26 A;  1QX4 A;  2EIN H;  2RQP A;  3FPK A;  2EJR A;  3DFG A;  3JW4 A;  3PM1 A;  5L3F A;  2DFE A;  3CCE B;  3AVT A;  2MH2 A;  1DPU A;  3F8F A;  3BR5 A;  1QO0 D;  3KP5 A;  2EIM H;  4LBZ A;  4MQ9 F;  1LVK A;  4LBY A;  4UVA A;  3V7A A;  3HKZ N;  2EB7 A;  5HOD A;  2A6H F;  3JAM K;  2OU2 A;  3WTW C;  4A3F J;  1XGN A;  4DYR A;  3MMY B;  1J9Z A;  4RDU A;  2W6J A;  2VNK A;  3CCR I;  1X2N A;  3S2D J;  4YCQ A;  5CKT A;  3VYS B;  4LG0 B;  4B3F X;  3S1M J;  2OV7 A;  2ESN A;  2X1D A;  3MHP A;  1OFE A;  3S16 J;  2XND A;  2IGM A;  1FIA A;  4BXX J;  5HXB A;  3BY2 A;  1ZYR F;  1LE8 A;  1KQ5 A;  4ZTJ A;  3GSI A;  3IH3 A;  4BEH A;  5E1W A;  4PMH A;  3RQI A;  1IDY A;  2O6G E;  3ERE D;  2QA4 B;  1H8H A;  4UXN A;  4BU2 A;  4RD1 A;  2A5W A;  2DET A;  4I7H A;  2LP0 A;  4YEJ A;  1ETY A;  2LRD A;  5IOZ A;  1KK3 A;  2JJ2 A;  4RD3 A;  2ID3 A;  2GXA A;  4HQE A;  2M8G X;  2HPI A;  3R4K A;  5FLX K;  3OP1 A;  1FYK A;  2GA2 A;  1S4M A;  3HSF A;  3W2I A;  3FXQ A;  2H6B A;  4ITV A;  1UZC A;  2DXI A;  5EEH A;  4RDJ A;  4XLN F;  3FF5 A;  2VC1 A;  2XF6 A;  1WI9 A;  2EA2 A;  1J7K A;  5FL7 A;  1B23 P;  3CD6 I;  2YR2 A;  1BI0 A;  3MCA A;  2DA1 A;  1P4W A;  2QKM B;  4RGX A;  1UD5 A;  2CWE A;  5DM7 F;  2CV2 A;  1ON2 A;  1UB9 A;  2M4K A;  3AG1 H;  3WHC A;  2FBK A;  3ZQ7 A;  3GVJ A;  1UAA A;  1T8I A;  1R36 A;  1GO2 A;  2WY8 Q;  5FA6 A;  3ZMD A;  4YZ0 A;  5H2F C;  2WBM A;  4QPO A;  2R7W A;  3OEH A;  2GIZ A;  1N0U A;  5DD8 A;  3ASP A;  3JX8 A;  3DBL B;  3FHN A;  3NAR A;  4RAZ A;  2VBS A;  3HUG A;  2RAE A;  3BR2 A;  3KP6 A;  4WQM A;  3OYG A;  2HDN B;  4HLX A;  1HF2 A;  1XQB A;  3NQO A;  1SD4 A;  2OQR A;  1TTY A;  1R5B A;  3E20 A;  3G6E B;  4OPW A;  3A0H C;  3E6M A;  1W0K A;  3HOX J;  4A3B J;  1N8R D;  4CXF A;  3RZO J;  4P9F A;  3OSF A;  2PLF A;  5HS9 A;  3NRV A;  3ROU A;  1JTA A;  4GRI A;  1QGY A;  5EJC A;  2CQX A;  2HNH A;  5H6R A;  4TKO B;  1WRJ A;  2J5P A;  3KLN A;  3Q9S A;  4LGW A;  1KC8 D;  1U8R A;  2F5C A;  1Y39 A;  2ZJP F;  2FUG 2;  3LSG A;  1OCR H;  2PMD A;  2KIM A;  1UFM A;  4JX4 A;  3BG5 A;  4PCQ A;  3F23 A;  3QPH A;  1YHQ I;  2YWG A;  3HRS A;  3PFY A;  2LMD A;  1HKT A;  3T53 B;  2QEX I;  1O8L A;  1V5V A;  2Y75 A;  5LGT A;  1XC5 A;  2COM A;  1IV8 A;  2WJV A;  6PAX A;  2QUF A;  5J1Y A;  3PVD A;  3HRT A;  4RLQ A;  2W7N A;  1E62 A;  2JA2 A;  1TW3 A;  3A1Y A;  2EIL H;  2KQR A;  2NAZ A;  4BJT A;  2UZK A;  1LPQ A;  5EG0 A;  1LFU P;  4C2L A;  2XF7 A;  2FMY A;  4GYI A;  2LC2 A;  2LYC A;  1S6L A;  3WTT C;  3UKG A;  2OA4 A;  3MD2 A;  4CGZ A;  2OJE D;  1BI2 A;  3W2V A;  4RDK A;  3QFR A;  1WH5 A;  3CPW B;  3I55 I;  1G7C A;  4P55 A;  4H4K C;  3WNC A;  4EJT A;  3IWF A;  3G4S B;  4TT3 A;  4HPQ A;  4N0B A;  1FND A;  1X1C A;  3OOP A;  1YLO A;  2PEC A;  2XGD A;  3WGI A;  1LFB A;  5BOX A;  2CGP A;  2NRA C;  4L0Z B;  1RPW A;  1JJ8 C;  4KIS A;  1OFL A;  1FNN A;  2R4G A;  1G6N A;  5CVR A;  2B9S A;  4P6V F;  2O9L A;  3F8N A;  3CCU I;  4BGD A;  1IC8 A;  1PUE E;  1L3L A;  3ZZT A;  2CYY A;  5FKK A;  2IRF G;  2VPR A;  1E43 A;  4HEA 2;  4PGO A;  4RAF A;  5KK1 A;  1OCC H;  3OIQ A;  5HDN A;  1VQ4 I;  2OK8 A;  3BG3 A;  1W7P B;  1Y56 A;  5JR3 A;  3BQZ A;  4UV8 A;  2XPW A;  2OC6 A;  3B73 A;  3HYI A;  2AXL A;  5ED4 A;  1QHH D;  4E4H A;  2IPQ X;  3ZQF A;  2JA6 J;  1NHA A;  2VKE A;  1T0F C;  4ZCI A;  4Y7N J;  2QZ8 A;  3WGG A;  2PMU A;  3FX3 A;  4BE2 A;  4HF2 A;  1T08 B;  1DAR A;  5HLG A;  1FMV A;  4BL0 B;  1RQR A;  2BEO A;  4L9V A;  2LTP A;  1AA7 A;  3ZQI A;  3GXO A;  4KA4 A;  4BY7 J;  2XGE A;  5LHH A;  1I3Q J;  4Q48 A;  2OTJ B;  2DYI A;  2X85 A;  4C3H J;  4IQ4 A;  1VQL I;  4DQL A;  4OJL A;  1LDD A;  1ZG5 A;  4IPA A;  2CRG A;  4RPB A;  2AQE A;  2V7U A;  3JQQ A;  1I5Z A;  2FNP A;  3MFK A;  2WTE A;  4UAJ A;  4NC8 A;  3BY6 A;  4II2 A;  1JTX A;  4BXU A;  4CCK A;  1QUF A;  1LDK B;  5F64 A;  4UZF A;  2QTL A;  3TP0 A;  1E1R A;  3VYT B;  4P9S A;  1X1D A;  4N3G A;  1X19 A;  2AHQ A;  2MYS A;  5J47 A;  3HAG A;  5D4R A;  2BOL A;  3I4M J;  1TYX A;  2FA5 A;  3GCM A;  1ZTR A;  3GTQ J;  4Y4R A;  4G7W A;  3RPU A;  4HNV A;  1YX2 A;  3D26 A;  4X1E A;  1KTV A;  2Q8K A;  3HPG A;  1ORK A;  4X7E A;  3WU0 A;  2JSP A;  2UWM A;  4KKS A;  1Z0X A;  4O3M A;  3PL8 A;  4TMW A;  5BNG A;  2QXZ A;  1M1E B;  3A8K A;  1H0M A;  1FNB A;  1GQ8 A;  3SY2 A;  3QOP A;  4X0C A;  4YIR X;  2P8T A;  1SFX A;  4E7H A;  1MDM B;  2QGU A;  4HWV A;  2O1D A;  2X6X A;  3CTA A;  1O4X A;  1RES A;  3GME A;  4LB6 B;  2HZD A;  1QRY A;  3BTC A;  2FVG A;  4UZU A;  1K79 A;  3WTV C;  3I71 A;  4DIQ A;  4HDV A;  1YRN A;  3DLA A;  4CYC A;  3E1Y E;  5HNF A;  1VFC A;  1TT0 A;  4F93 B;  2QCO A;  2X4H A;  3QYF A;  4X0G A;  1RIO H;  4DQK A;  1VQO B;  2VFO A;  1MJB A;  1G3S A;  4HV6 A;  1OGJ A;  4XOP A;  3FK7 A;  4ENJ A;  2VBM A;  1HKS A;  2BE5 F;  3OR1 C;  1GR1 A;  2CW0 F;  4URR A;  5E8I A;  4AYB N;  1SAU A;  1YI2 B;  1YJW I;  2XGX A;  1W35 A;  2I1L A;  3ECO A;  1IZ1 A;  1MW7 A;  1SC7 A;  2QE7 A;  3N05 A;  3VPR A;  4CCL A;  3CF2 A;  2X0L A;  1P7I A;  3Q0U A;  2FBI A;  1FNM A;  4OJ5 A;  2AHO A;  5CVI A;  4C3I J;  3ZMT A;  5K5Q A;  2RKH A;  1XB4 A;  1BM9 A;  4XD7 A;  5C1C A;  2YUS A;  2BMW A;  4XBF A;  5M3M J;  2XIG A;  3F3X A;  4U0V A;  4CIC A;  2YWF A;  3SUC A;  2IA2 A;  1IUF A;  3IAS 2;  1KK0 A;  4DBQ A;  2CQK A;  2KDO A;  5IT9 Z;  3IUO A;  3ZP5 A;  3LA7 A;  4RAY A;  4M53 A;  4Z4U A;  3BCA A;  4RAG A;  4TMZ A;  4PDK A;  5E6T A;  1TL8 A;  3UR3 C;  1FY7 A;  2D2W A;  2PI0 A;  4EV0 A;  1W1W E;  1I6X A;  3E0J B;  2AO9 A;  5K5O A;  1OB5 A;  1I18 A;  3IAM 2;  9ANT A;  4D5F A;  1YE9 A;  3GQ8 A;  1TTT A;  2I5U A;  3OYC A;  4JBA A;  4Y9R A;  5D6F A;  3N97 A;  1QA1 A;  3A01 A;  5BPD A;  2XVC A;  3L2R A;  2FXA A;  3K2A A;  3OYJ A;  3U6B A;  3RIR A;  1ZG3 A;  1VND A;  5DCM B;  2ELK A;  4QTR A;  5FRM A;  4YFO A;  3BG9 A;  3A4C A;  1IDZ A;  1S0U A;  2ZFW A;  1H8E A;  1ETQ A;  3CC7 B;  3BR1 A;  2EIK H;  2E5N A;  2R7D A;  2XC7 A;  1E3O C;  3HSR A;  2UXX A;  3DPT A;  5J1R A;  1K83 J;  5FRN A;  1W0J A;  5GTH C;  1G7S A;  2NVT J;  1YJN I;  2DT6 A;  3QP5 A;  2J8I A;  2GXB A;  4U0W A;  1Y6I A;  4BQQ A;  3ONQ A;  1TNT A;  4E7I A;  3WU1 B;  1IO2 A;  2H1L A;  2VBZ A;  1X0C A;  1J9I A;  3BH4 A;  2BXZ A;  2V31 A;  2FML A;  2BM7 A;  3IL2 A;  1GV5 A;  5B3S H;  1WU8 A;  3CCY A;  5HLI A;  1Y0Y A;  3S1R J;  3EET A;  3M1E A;  2XHK A;  4PC7 A;  3CQZ J;  4M0L A;  3JTG A;  4MQV A;  2JK3 A;  2HFH A;  1HF0 A;  1CQX A;  1HW2 A;  2E1B A;  2ZXJ A;  1S29 A;  3FMS A;  4BBS J;  4YAU A;  2GPJ A;  1OR7 A;  2WB1 A;  4F52 A;  3GFL A;  3D0S A;  1TT5 B;  4V2F A;  4A0Y A;  5IT3 A;  1V5F A;  2IGO A;  3L2C A;  2R7O A;  1KA8 A;  3AL0 C;  3EUH A;  3H35 A;  5TY0 A;  3HHG A;  1WOP A;  2XAU A;  1EFC A;  2BVL A;  1N75 A;  1BI1 A;  1M1K D;  4W97 A;  2W85 A;  4N9H A;  3VEP A;  2KT0 A;  2KZG A;  1P9Q C;  1ZH5 A;  2C5H A;  2D45 A;  4G7X A;  3R0A A;  1VQ8 I;  3PSS A;  3H3V K;  1DAB A;  3MZH A;  3GFI A;  1KK2 A;  4OOX A;  1ON1 A;  2V7W A;  2E7W A;  3SZE A;  2J8K A;  2K3F A;  1V5E A;  3J81 K;  2OD5 A;  3C3W A;  4A3J J;  2OF7 A;  2B0L A;  3S3M A;  3HB9 A;  1RNL A;  1TYU A;  2L54 A;  4H9G A;  1IG7 A;  2OTJ I;  2JJ1 A;  1YHQ B;  1I6H J;  1E3P A;  1WGX A;  1YIO A;  1MBH A;  3TBI A;  1NH3 A;  4HE6 A;  1QVF B;  5ICG A;  2F2E A;  1WI3 A;  2FRH A;  3BJ6 A;  2NVX J;  4X8I A;  3PQK A;  1B9N A;  2K3P A;  2EIJ H;  5TRD A;  1I7P A;  2OZ6 A;  2F5F A;  4V2G A;  5ILS A;  1V5G A;  3I59 B;  1FTZ A;  4G9Y A;  2WY7 Q;  4CCO A;  1U6G A;  3AL0 B;  3HOZ J;  1UG2 A;  3GQ7 A;  1HW1 A;  4MLO A;  2IGN A;  2CC2 A;  2B0R A;  3AK5 A;  3HSE A;  1O7L A;  3HG9 A;  2LR8 A;  2C4U A;  4YIF A;  3BLY A;  2KDZ A;  5GAD J;  3ZQC A;  3E1S A;  2EQR A;  1X58 A;  3FY3 A;  1O8I A;  2KRF A;  1Z6R A;  1T98 A;  1V3F A;  4IHV A;  3G1L A;  2VNJ A;  5F27 A;  3KEW A;  1WCM J;  1PJ7 A;  1XDU A;  4MIM A;  2LKX A;  4OM9 A;  2ZZQ A;  4OMY A;  1WH7 A;  1JJ2 B;  1T95 A;  1TWF J;  2HYF A;  3JCU C;  1QVG B;  2JJ7 A;  2Q6L A;  1XMK A;  3ZBT A;  1NDH A;  3SEZ A;  5GV7 A;  4BJ6 C;  4HG2 A;  3OR2 C;  1DP7 P;  2K9S A;  5FLM J;  1E79 A;  2W57 A;  4A3D J;  4RLF A;  3GTK J;  2DU9 A;  1Q82 D;  1K9M D;  4UUV A;  4LK1 F;  4NUB A;  5CQG A;  4KIG A;  4UB8 C;  3CMM A;  1NJI D;  2OBR A;  4XOT A;  2BXY A;  2Y0S A;  2QTZ A;  4XRS A;  2ZZG A;  2FQ4 A;  3GLX A;  3KEO A;  4HRI A;  2PG4 A;  2W4S A;  1R5G A;  1E17 A;  2IQ7 A;  2TRT A;  3Q6Q A;  1OJL A;  4CHU A;  5FO1 A;  1UHW A;  2VE8 A;  3MZ8 A;  2E35 A;  5IYC J;  4XLC A;  3K9T A;  2RDP A;  1YJ9 B;  1TYV A;  4P5O A;  1D8J A;  3A8J A;  4RPD A;  4DGW B;  1U5T C;  5K5R A;  4OOS A;  4FT8 A;  2JRT A;  3U21 A;  3SJM A;  5KW9 A;  3QU6 A;  5TGT A;  1KYW A;  4F7Z A;  2L9V A;  4PC1 A;  1IN8 A;  3ONY A;  1IRX A;  2GK7 A;  3OMY A;  3J81 k;  3T9G A;  2Z99 A;  4I2O A;  3OS0 A;  3ZMZ A;  1MBJ A;  1MJA A;  3J7Y J;  3WTZ A;  1UMK A;  1FJL A;  3CCJ B;  2EFN A;  2FE3 A;  5AON A;  4ZZD A;  2VXD A;  4I01 A;  3M8F A;  2VNH A;  3TOB A;  4LC0 A;  4RD6 A;  3R0J A;  1XCB A;  1EXM A;  3CUQ C;  1BA5 A;  2GJP A;  2QZA A;  4PSW A;  2EBI A;  5E3L A;  2ZTG A;  2Y0S N;  1S3J A;  1N06 A;  4YAF A;  3W2G A;  4A3K J;  3TO6 A;  4JRA C;  2NYX A;  2KKO A;  2CW8 A;  2RV8 A;  1A5J A;  4A3E J;  2CW5 A;  4NC6 A;  3BR0 A;  3BTJ A;  4HF0 A;  5GPA A;  3RZD J;  2L3D A;  2VFP A;  3BT9 A;  3F21 A;  1PJR A;  1U5T B;  4XON A;  1K73 D;  1HA8 A;  1T39 A;  4L9J A;  5BSY A;  3ZZ0 A;  3WBK A;  2BM4 A;  4I84 A;  2O0V A;  3L09 A;  4A6E A;  2NS8 A;  2QQ9 A;  5J3L A;  3BG6 A;  1KU2 A;  4BHB A;  2M45 A;  5KAF C;  3FKI J;  3PNV A;  5KNL A;  3J81 Z;  4ENN A;  2HDD A;  3WQZ A;  2LDU A;  2XT4 A;  2M2E A;  2CSO A;  1P6R A;  3FWE A;  3IV5 A;  1ZK8 A;  1CLW A;  4FQG A;  2CFX A;  1QGA A;  2VYQ A;  1QPI A;  2XNC A;  2UXN A;  4RBO A;  1Q9S A;  3ERM A;  2O0Y A;  4B8X A;  4KT6 A;  1KQ0 A;  4PAA A;  2QM3 A;  1WFX A;  2F48 A;  3FXR A;  2ELJ A;  4LIU A;  2CFO A;  2CJJ A;  2VBY A;  3NAU A;  4JX6 A;  1WJB A;  1W9X A;  2JZY A;  2CND A;  5E3N A;  1JI8 A;  4MXN A;  2XUB A;  2L4M A;  2LF8 A;  1H80 A;  1FPQ A;  4R8H A;  1D5Y A;  2FX3 A;  4Y52 J;  1KGS A;  2V7T A;  2JSC A;  3KFW X;  4PJJ A;  2WZP P;  3JRG A;  5K1Y A;  1UST A;  3RDI A;  4CO8 A;  1TWG J;  4UZE A;  4UVC A;  1TSP A;  5IYN A;  4O6J A;  2LRE A;  1ZRF A;  3S2H J;  2PX9 A;  3HZJ A;  2L2O A;  3MQ0 A;  2VBU A;  4B44 A;  3FXM A;  3PO3 J;  3ES9 A;  1LLW A;  1OCT C;  3KZZ A;  3SQV A;  4E70 A;  4DK0 A;  2EZI A;  3AVU A;  2E1M C;  2UV1 A;  1FIP A;  2VZL A;  1TZL A;  3KE2 A;  1FBQ A;  5DSZ A;  1JE8 A;  1MIJ A;  4U88 A;  4WF2 A;  4CZZ A;  5ICE A;  1JJ6 C;  4XLA A;  3J7A Y;  4OPS A;  4YZA A;  5FKL A;  4Y15 A;  3LVB A;  2CRV A;  2G7U A;  1DU0 A;  4G6I A;  4HOB A;  4YXW A;  1W36 D;  2KJC A;  3I0T A;  3P4G A;  3DTE A;  3BWG A;  3CXC B;  2W1O A;  3HGY A;  1T38 A;  1IW7 F;  4KMF A;  2BSA A;  1QFJ A;  3LSJ A;  4C2T A;  4XNF A;  3M07 A;  4BY1 J;  3FM5 A;  3HUG B;  4BQN A;  4KYW A;  4OIP F;  3S17 J;  3B6C A;  2R7Q A;  2D1H A;  1O7F A;  3EYI A;  2M0C A;  4K2E A;  1VHO A;  5GV8 A;  2C4T A;  3AGP A;  1KK1 A;  1SD6 A;  2DA4 A;  3V4G A;  1BLI A;  3LNN A;  1YOV B;  4U9U A;  2QY1 A;  2A6E F;  1UCR A;  2I8D A;  4QVJ A;  3PUN A;  1D3Y A;  1Z9C A;  1P7J A;  3K0L A;  1PE9 A;  1S7O A;  1R5H A;  2ZKZ A;  3WU2 C;  1ZUN B;  3IKV A;  2L7F P;  3FMQ A;  5HLT A;  3JRC A;  5IT9 K;  2K9L A;  4X7C A;  2LKP A;  1TWH J;  3KX2 A;  2O61 A;  3ML3 A;  1JUS A;  4FHT A;  1DPR A;  1O57 A;  3RYP A;  3W6V A;  2OTL I;  2NST A;  1KU9 A;  2JRM A;  2PQ8 A;  5JHF A;  4EEF G;  3FDY A;  1GLN A;  4HX4 A;  2Y9Y A;  3LYC A;  1LUJ B;  1ULY A;  2BX6 A;  1EF4 A;  4MTE A;  1U8B A;  1YI2 I;  2CUF A;  4B1R A;  4AYB A;  3WYA A;  4E7Z A;  1QZE A;  2GK6 A;  3AVV A;  4C0S A;  1LB2 A;  1VQ8 B;  1VF9 A;  3LQR A;  3E6C C;  2CQQ A;  2DDB A;  1RZ4 A;  2WWY A;  2MBF A;  2X1E A;  3H5R A;  3LFK A;  2ETH A;  3IH2 A;  3RTR A;  4FTH A;  4QV2 A;  2H94 A;  3HRU A;  2DTR A;  4RM2 A;  2L9S A;  1NG6 A;  2K40 A;  3PUM A;  3H3U A;  2UUZ A;  1GHC A;  1BI3 A;  3JRD A;  4ZCM A;  2HOE A;  1WJA A;  3QYB A;  3OW2 B;  4DZJ A;  1XG2 A;  5DV5 A;  2HTJ A;  3ELK A;  3T8R A;  1BIB A;  3F6O A;  2JMW A;  3TQN A;  2MSY A;  5JLV C;  3U1D A;  1GDT A;  2OPT A;  2BGI A;  5DDG A;  4UY8 I;  3DEE A;  4GFB A;  4XQF A;  1OCO H;  3GFJ A;  3C2G A;  1FBS A;  2MD5 A;  3A0B C;  1SMY F;  3AG4 H;  1AIP A;  3FXK A;  2HWV A;  5TR9 A;  4RB3 C;  1ZGJ A;  4I98 B;  4WXC A;  3CCQ I;  2XRN A;  1JA0 A;  4D5C A;  4GDF A;  1QFY A;  1FRN A;  1U2W A;  1UMQ A;  5IK2 A;  4OJO A;  2WR8 A;  4YHB A;  1YIT B;  2P7C B;  2R7F A;  3B8H A;  3BG7 A;  2BZT A;  4ON0 A;  1MZB A;  1N77 A;  4RCY A;  1VI0 A;  2XT2 A;  1XB2 A;  4LLG F;  3KP3 A;  3K7A J;  2V6E A;  3O8G A;  1ERD A;  2NZM A;  2HOT A;  2VOD A;  2V5I A;  5JMC B;  2GLO A;  2M8E A;  3M1C A;  5J1U A;  2JT1 A;  1MKM A;  2ECC A;  1QGP A;  4FX0 A;  3WG9 A;  5IYQ A;  1MD0 A;  2K9M A;  3I54 A;  5D5V B;  4YAL A;  3O8H A;  5DTD A;  4XLE A;  2OBP A;  2NXN B;  1K5C A;  3Q3S A;  2VPL A;  3ZZU A;  4NNJ A;  2WZN A;  2RNG A;  4BDZ A;  1X3W B;  1HZE A;  3EYY A;  4WZE A;  3I4P A;  1OR7 C;  2RVC A;  1JXS A;  3W6J B;  2Z16 A;  4ETS A;  2ZNZ A;  3OYA A;  3EQL F;  1PKV A;  5C3E J;  1LLZ A;  1EWY A;  1O8J A;  1LVA A;  3PIO F;  1IJW C;  2DJN A;  1OHH A;  3KZY A;  5FKO A;  4WZL A;  1RU4 A;  4D7M A;  1N25 A;  2JPC A;  3CJR B;  4BAY A;  4C43 A;  1QA6 A;  4M9S A;  3OYB A;  1D2E A;  1IDK A;  4RGR A;  2KL4 A;  3I1F A;  2FF4 A;  4ZTF A;  3GTG J;  3OV8 A;  1YS6 A;  1Z77 A;  2D74 A;  3GQ9 A;  4LOC A;  4W8S A;  3ZQH A;  1IB4 A;  1R9T J;  2QKL B;  2KHM A;  2D1V A;  3QP6 A;  2UVF A;  3SZG A;  4I76 A;  3G2B A;  2KP6 A;  4C30 A;  3ESW B;  1JKQ C;  3QQA A;  3DCF A;  4AIJ A;  4W8R A;  2XKO A;  2D9R A;  4FE4 A;  3GUD A;  4FE7 A;  3G4S I;  1BR4 A;  4Q4Z F;  1ZEL A;  1IJF A;  4MNU A;  1ZR4 A;  2JWT A;  3ECH A;  3KLO A;  4I0A A;  1O3R A;  1SVL A;  3LSP A;  2R0Q C;  1KQ8 A;  4G12 A;  2K5C A;  1QVU A;  1Q1V A;  3E97 A;  1O3Q A;  1IN4 A;  1AKH A;  3IP4 B;  1MMN A;  4XOR A;  5F0H A;  2CQ7 A;  4KMU X;  1R71 A;  2JA5 J;  1A6Q A;  2YPR A;  1R23 A;  1B4A A;  2XGC A;  1PXZ A;  1RI7 A;  2GZW A;  1RR8 C;  5FIU A;  1V54 H;  3DXJ F;  3CF5 F;  4OU0 A;  5EGO A;  2R7Z J;  1TW2 A;  4F7D A;  2IEK A;  1VQ7 B;  3GTJ J;  1T6X A;  4QLC U;  3PO2 J;  2NT6 A;  3QOD A;  4MYU A;  4AF6 A;  4UNO A;  3LWF A;  2R7V A;  1NRK A;  2G0Y A;  1LDJ A;  4YFX F;  2KIQ A;  2B7B A;  1EH6 A;  1R1V A;  1HSJ A;  1XGS A;  2YU3 A;  3TED A;  2QSF X;  4BAC A;  1Z7L A;  3OYN A;  3J7Z I;  3Q39 A;  1W2B B;  4QPQ A;  1LFP A;  2GAU A;  1OB0 A;  3QFT A;  2XNJ A;  4Q5S F;  2E1O A;  2NNY A;  4JQF A;  1IRZ A;  3W5H A;  2YX7 A;  1IJE A;  3OFN A;  4OOV A;  2BY3 A;  4OAZ A;  4EM1 A;  3ASR A;  3DEU A;  3S14 J;  4EJW A;  2VOO A;  1QQI A;  4KN4 X;  3BJA A;  2V6C A;  4HX8 A;  2ACJ A;  1IHM A;  3MKL A;  4PUS A;  2KRC A;  1UEL B;  3BZ6 A;  5KVR A;  3BCF A;  5HDK A;  2QQB A;  2OK7 A;  4P1W A;  1K78 B;  3Q6R A;  3QWL A;  2LNB A;  4IHT A;  2EV6 A;  3TDU C;  4NCN A;  1JRG A;  1Z6T A;  1NG7 A;  2EA4 A;  5F4O A;  2V1X A;  3JAM Z;  1UJ8 A;  4XN3 A;  1MAB A;  1USS A;  1IXS B;  1Y8Q B;  5AIP A;  2BW3 A;  2IS2 A;  3AVY A;  1NB9 A;  1D0Y A;  2H6C A;  1R5N A;  4ESJ A;  2YSR A;  2W24 A;  4Z4Z A;  2XC1 A;  4M71 A;  1SFK A;  1T56 A;  2CV1 A;  3LJY A;  3ASN H;  4ZYG A;  1KRH A;  3SLN A;  1QJV A;  5IP7 J;  1D1A A;  4NDL A;  3K4N A;  5JLW A;  2BM5 A;  2GIV A;  3LL7 A;  3CCM I;  1LNW A;  3TP3 A;  1EJ9 A;  4IKF A;  5LRS A;  2OBT A;  4EJV A;  3M3Y J;  2W48 A;  1JB9 A;  1VQO I;  1CF7 B;  1I3A A;  1ZM2 A;  3ABM H;  2R5Z A;  3TKY A;  1RUO A;  2R7R A;  4QUZ A;  3SDG A;  1GJR A;  1IN5 A; 
#chains in the Genus database with same CATH homology
 4BQQ A;  1Y6I A;  3SEQ A;  5KHD A;  1T5E A;  3ONQ A;  1MND A;  4E7I A;  1BMF A;  2F43 A;  4U4B A;  1X0C A;  3RCO A;  2M7B A;  2X1C A;  3EUA A;  5CPR B;  1OGO X;  3BH4 A;  3OYE A;  3MKW B;  2V31 A;  2ZXI A;  2NT9 A;  1D0X A;  4B47 A;  4DNT B;  3QOE A;  2L7K A;  4YZX A;  4Z1M A;  1J09 A;  2HQA A;  1WJE A;  2CUJ A;  2W6I A;  3ZPP A;  3VMW A;  1COW A;  4ZYA A;  2D3L A;  3OL3 A;  1EFR A;  3L2V A;  4HNU A;  2MC4 A;  2KPM A;  2E1B A;  2F4I A;  3UW0 A;  2WB1 A;  4YEL A;  4F52 A;  2HLD A;  1HG8 A;  3AKZ A;  2NSP A;  3S3N A;  2LOO A;  1WJD A;  2XOK A;  2VKD A;  1V5F A;  2IGO A;  3ZGK A;  2R7O A;  3HKZ A;  3AL0 C;  3H35 A;  2ZZF A;  2VJ5 A;  2XAU A;  2BVL A;  1N75 A;  3SYT A;  4B3X A;  2V7F A;  1PYV A;  1X4P A;  2M7A A;  1P9Q C;  4C2L A;  3H5N A;  4G7X A;  4R79 A;  1KMH A;  2F6C A;  4LIT A;  4XLH A;  4NQW B;  3PNT A;  2X6W A;  1V5E A;  2JVG A;  2VBE A;  3OY9 A;  3KRG A;  1IA5 A;  2ZXH A;  3HOT A;  3KYL A;  3S3M A;  4J01 A;  1SKY B;  2JJ1 A;  2X8K A;  4N4O B;  3TBI A;  2M5S A;  3WWG A;  2VQH A;  2CK3 A;  2V26 A;  4JMQ A;  1OFM A;  2K3P A;  2LY1 A;  3BCB A;  1IDJ A;  3D5S C;  3DPL C;  1V5G A;  3K4J A;  1MNE A;  1E1Q A;  2WY7 Q;  4XN0 A;  4CCO A;  2IS4 A;  3AL0 B;  3OS1 A;  3OOU A;  2F5V A;  1DGR M;  3C2H A;  3W3C A;  2HPM A;  3V42 A;  1WMR A;  2WSS A;  3GQ7 A;  4MLO A;  2IGN A;  2X6Y A;  2O04 A;  2WAQ A;  2JIZ A;  4C9Y A;  2CMP A;  3D5L A;  1WJF A;  2JVH A;  4CA0 A;  3OYF A;  3HG9 A;  2LBF A;  2LG4 A;  3DWL E;  2Z2S B;  3DU5 A;  5FRO A;  3H0D A;  1DBG A;  2VQL A;  3BLY A;  1E3Z A;  4G6T B;  4KKT A;  3E1S A;  2X3H A;  1KCD A;  3LFU A;  3OL4 A;  3AFH A;  3OYK A;  3FY3 A;  3UNG C;  1VLY A;  2M3A A;  1O8I A;  4XKB A;  2ZTN A;  2INU A;  3HC7 A;  1KON A;  3LSH A;  3ZCO A;  2VJJ A;  3H9G A;  3VST A;  3KEW A;  2XZL A;  3CP2 A;  3OWT A;  4AU7 A;  2ZZQ A;  4W8T A;  1T95 A;  3DTI A;  1BN8 A;  2DOA A;  3EPZ A;  3SEZ A;  2Z6B D;  4BJ6 C;  1FMW A;  2HU9 A;  5AMV A;  4HG2 A;  3OR2 C;  3JU4 A;  4EAT A;  1E79 A;  4CCM A;  4RLF A;  3B8Y A;  3OEE A;  2VAS A;  4NUB A;  2E60 A;  5CQG A;  5HVQ C;  3CMM A;  1DQU A;  1O88 A;  4XOT A;  2WPD A;  3EQO A;  2Y0S A;  3CZ6 A;  1EE6 A;  3B4N A;  2ZZG A;  1WPC A;  4D1Q A;  3CJQ B;  4HRI A;  2W4S A;  2X53 S;  4HIZ A;  1V0F A;  2XZO A;  3I9V 2;  2IQ7 A;  5HOO A;  2AQF A;  4N4N B;  4XL9 A;  4XLC A;  4ANJ A;  4P5O A;  3OPO A;  4U7B A;  4DGW B;  2VL8 A;  3OYH A;  4NK8 A;  3U21 A;  4CUG A;  3TL4 X;  5TGT A;  4AVZ A;  2R7S A;  1I8D A;  4JOM A;  1U0J A;  2GOX B;  3ZPN A;  3HPH A;  3T9G A;  1IRX A;  2GK7 A;  3OMY A;  3GVK A;  2PYH A;  2CV0 A;  1X1B A;  3OS0 A;  3A2K A;  1AIR A;  3HOS A;  4EW9 A;  4XKC A;  2INV A;  2VXD A;  4BE1 A;  4ZDO A;  1E3X A;  1UD3 A;  4KKU A;  4YZQ A;  4ZDL A;  2CUZ A;  2GJP A;  4PSW A;  3OYD A;  2ZTG A;  2DIE A;  3MKY B;  1CZF A;  3FKS A;  2XZP A;  1D1B A;  4TSF A;  4B43 A;  4U49 A;  2CW8 A;  2NTB A;  2E5Z A;  1OLT A;  5LD2 C;  4ZC3 A;  4ZDP A;  2P0W A;  1PJR A;  1BR1 A;  3GQA A;  4XON A;  4B48 A;  1HA8 A;  4E7S A;  1NBM A;  2ZFU A;  1UD4 A;  4I84 A;  2O0V A;  3OIP A;  3DTK A;  1PLU A;  4XM3 A;  2HVQ A;  3BG6 A;  4OJO A;  4W8R A;  3EUH C;  2L5Q A;  5KCM A;  4E0F A;  3PNV A;  5KNL A;  4Z06 A;  1O8M A;  3VYR B;  3PJR A;  2X51 A;  3SDB A;  3WQZ A;  4DK1 A;  1LVK A;  4NC7 A;  4BUP A;  2ZSH B;  3NE5 B;  2KZV A;  3CP8 A;  3MMY B;  2W6J A;  4KT6 A;  3EQN A;  5CKT A;  3VYS B;  3PUB A;  2KVO A;  4B3F X;  2OV7 A;  2X1D A;  1WFX A;  1YX3 A;  2ELJ A;  4LIU A;  2IGM A;  2CFO A;  4CSW A;  2XND A;  2VB6 A;  1WJB A;  1W9X A;  1WTH D;  4ZTJ A;  1JI8 A;  2DT7 B;  4BEH A;  2KMU A;  3F9K A;  4MXN A;  4PMH A;  2VBK A;  3HXL A;  1H80 A;  2GOM A;  2GJK A;  1H8H A;  1R6R A;  2MFZ A;  2VQG A;  4PJJ A;  2A5W A;  4BU2 A;  2R7U A;  4YEJ A;  2WZP P;  3S32 A;  2M4G A;  3VSV A;  1UG0 A;  2LRD A;  2JJ2 A;  3L2Q A;  4KJZ A;  2JDI A;  2LRE A;  3FBN B;  2L2O A;  4FET A;  3K10 A;  4B44 A;  2HPI A;  1N78 A;  1MMA A;  2LBF B;  4DK0 A;  2DCE A;  2E1M C;  2UV1 A;  2NOJ B;  3VWB A;  1TZL A;  3K4K A;  3ZIA A;  3ZSC A;  3PSI A;  3J7A Y;  4ITV A;  4XLA A;  3CES A;  2DXI A;  1QHG A;  4YZA A;  2NTQ A;  3TMO A;  4BJ5 C;  3I3L A;  2XF6 A;  3OYM A;  4G6I A;  3RSN A;  4YXW A;  5FL7 A;  1W36 D;  3L2W A;  3ZRG A;  2QKM B;  1UD5 A;  2BVM A;  3B90 A;  1K6Y A;  3DTE A;  4L8J A;  2W1O A;  2CV2 A;  2KLO A;  2M4K A;  2W82 A;  4C2T A;  4XNF A;  2R9V A;  1UAA A;  2VXZ A;  3GVJ A;  3H94 A;  3HUG B;  2WY8 Q;  4BQN A;  4BE0 A;  5LFA A;  2R7Q A;  2V7Q A;  4YZ0 A;  2WBM A;  4QPO A;  3PSF A;  2R7W A;  3A3G A;  2QY1 A;  3OEH A;  1BLI A;  3LNN A;  1Z21 A;  3FHN A;  2I8D A;  1PE9 A;  2MAB A;  3OYG A;  3PNY A;  4F92 B;  3M8J A;  5HLT A;  2V1N A;  2K9L A;  3KX2 A;  1W0K A;  3K4B A;  2ODL A;  1O8F A;  1WJ5 A;  1UD8 A;  3FBI B;  2NST A;  3KEY A;  2BW3 B;  5JHF A;  1JTA A;  3FDY A;  3K4M A;  1GLN A;  2CS3 A;  3H9J A;  4GRI A;  1V0E A;  4CCJ A;  2O1D A;  2HNH A;  2KRH A;  3LSM A;  3S3O A;  4TKO B;  3W2A A;  2F1M A;  4AYB A;  4E7Z A;  2GK6 A;  2FUG 2;  3LSG A;  4F55 A;  1X4O A;  3A35 A;  3LSI A;  2X1E A;  3H5R A;  4XKV A;  3PFY A;  3RTR A;  3T53 B;  3VSU A;  2V4J C;  1O8L A;  4II3 A;  2PJR B;  4RM2 A;  3K6G A;  3BC8 A;  2WJV A;  3L2U A;  2HDW A;  2L9S A;  2MD0 A;  1NG6 A;  4RMN A;  4RLQ A;  2UUZ A;  4DBR A;  2W7N A;  1DBO A;  2NTP A;  2JA2 A;  2KQR A;  2L9N A;  3A1Y A;  1WJA A;  2Q2E B;  3H9Q A;  3K4L A;  3QYB A;  2IXS A;  4PFO A;  4BJT A;  2XF7 A;  1XG2 A;  3GVL A;  3OE7 A;  2LC2 A;  2LYC A;  3MD2 A;  2O5R A;  4OJ6 A;  3DEE A;  3W2V A;  1Z3X A;  3GBG A;  2WAE A;  4XQF A;  4YRV A;  4H4K C;  3C2G A;  4TT3 A;  4HPQ A;  1X1C A;  4E6K G;  4HST A;  3VYU B;  2PEC A;  5C1E A;  1BR2 A;  1BOB A;  4KIS A;  5IK2 A;  1YX5 A;  3QYE A;  2R4G A;  1O8K A;  1OFL A;  1QCX A;  3H5A A;  3ZXS A;  3BC9 A;  4U87 A;  3OS2 A;  3BG7 A;  4BGD A;  3K70 D;  1N77 A;  1LKX A;  2XF5 A;  1WJC A;  3FKJ A;  2Q1Z B;  2VJ4 A;  2ZSI B;  3VSL A;  1EA3 A;  4ASU A;  2Z8G A;  3G05 A;  2XGJ A;  2UVE A;  2LZJ A;  1DP3 A;  2V6E A;  4GQN A;  4C2U A;  4F91 B;  4HEA 2;  1VZ0 A;  1ERD A;  1E43 A;  1KZL A;  1O8D A;  2NZM A;  3OIQ A;  1Y56 A;  3M1C A;  2OC6 A;  4CZC A;  4Y3O A;  1QHH D;  4E4H A;  2WJY A;  3ZR8 X;  2CH0 A;  1NHC A;  3DKY A;  2VJI A;  2K9M A;  1K28 D;  1T0F C;  4XLE A;  4E7K A;  4FXU A;  2A6T A;  1K5C A;  4XR6 A;  3NWT A;  3FPP A;  2VPL A;  4BE2 A;  3DDY A;  4NNJ A;  2RNG A;  4BXF A;  4BDZ A;  4HNT A;  3VMV A;  4OWR B;  1HZE A;  1FMV A;  3VDX A;  4BL0 B;  4FAS D;  5HNH A;  2VLA A;  1OR7 C;  3RPU D;  1AA7 A;  2CW7 A;  2Z16 A;  4DOZ A;  1G59 A;  2Z1D A;  3OYA A;  1PKV A;  4E7J A;  1O8J A;  2X85 A;  3K4C A;  4IQ4 A;  4PJM A;  2IS6 A;  4OJL A;  4LIV A;  1OHH A;  4IQJ A;  4MR0 A;  4NK6 A;  1D1C A;  2ZZE A;  1RU4 A;  5DN6 A;  3DKX A;  1OOC A;  2AQE A;  3CJR B;  3RQ4 A;  4OZZ A;  4NC8 A;  4II2 A;  3OYB A;  4CCK A;  1IDK A;  2PJR A;  2KL4 A;  1G8X A;  2IGK A;  3A3B A;  1LDK B;  2PMZ A;  2BSP A;  2RRE A;  3EUK L;  4OZY A;  2LH9 A;  4ZTF A;  3LMW A;  4PFP A;  1E1R A;  3VYT B;  3ZQQ A;  1X1D A;  1X19 A;  2MYS A;  4B3G A;  3GRH A;  3HAG A;  3GQ9 A;  4W8S A;  1D0Z A;  1KTW A;  1IB4 A;  2M0M A;  2BOL A;  2QKL B;  4BS9 A;  2KHM A;  1E0E A;  1BHE A;  2UVF A;  3W2W A;  4Y4R A;  3SZG A;  4G7W A;  1RWR A;  3G2B A;  3JUR A;  2R7X A;  2KP6 A;  4C30 A;  4Z03 A;  2W00 A;  4XMY A;  2RQQ A;  3HPG A;  4ZJZ A;  2JSP A;  1W36 C;  2UWM A;  4KKS A;  1BR4 A;  1ZEL A;  3PL8 A;  2QXZ A;  4BQO A;  1GQ8 A;  2WAF A;  4DJA A;  4E7H A;  2E1M B;  4DNR B;  2K5C A;  1O8H A;  4HWV A;  3DPU A;  2X6X A;  4RM3 A;  3IP4 B;  1MMN A;  2HZD A;  4XOR A;  1Z3Y A;  1QU3 A;  5CDF A;  3T56 B;  4UZU A;  2PYG A;  4F3Q A;  4DIQ A;  1KCC A;  1PXZ A;  3DLA A;  1UD6 A;  4IX7 A;  5HNF A;  1TT0 A;  4F93 B;  2WAD A;  2D3N A;  3QYF A;  2HVS A;  3LSK A;  4X0G A;  1OGM X;  4LG3 A;  4OJP A;  2HVR A;  1S9H A;  4XOP A;  2NT6 A;  2VBM A;  3QOD A;  5CQE A;  3OR1 C;  4PJN A;  2R7V A;  1NRK A;  4URR A;  4HSR A;  3HL2 A;  4BAC A;  1Z7L A;  3LMM A;  1SAU A;  3OYN A;  2XDV A;  4KIT B;  1X1A A;  3NWS A;  1LFP A;  4QPQ A;  1OB0 A;  4PK4 A;  1MW7 A;  2QE7 A;  1DGW Y;  4JQF A;  3N05 A;  3OYL A;  4CCL A;  3OFN A;  3CF2 A;  1O8E A;  1UD2 A;  4OAZ A;  2IS1 A;  4IZZ A;  4OJ5 A;  3OAA A;  2O17 A;  4XLF A;  4CCN A;  2O0W A;  4XD7 A;  5C1C A;  2VKH A;  2VQC A;  4J00 A;  2QX3 A;  2WA0 A;  4PUS A;  4E7L A;  2KRC A;  1UEL B;  2DJI A;  1FX0 A;  3SUC A;  3IAS 2;  3BCF A;  4DBQ A;  1VBL A;  2KDO A;  3IUO A;  1WP6 A;  4P1W A;  4W8Q A;  4Y33 A;  4OAY A;  3BCA A;  3OYI A;  4Z05 A;  3OW7 A;  5HKK A;  3VSK A;  2EWE A;  2OUM A;  3UR3 C;  3DU6 A;  1JRG A;  1NG7 A;  1VF7 A;  4PJL A;  4D9J A;  3E0J B;  3T51 B;  1VJS A;  1I18 A;  3IAM 2;  4XN3 A;  4BEH B;  1YE9 A;  1MMD A;  1MAB A;  3OYC A;  3GQ8 A;  2LY2 A;  2BW3 A;  3D5R C;  3K70 C;  2IS2 A;  3S8P A;  1D0Y A;  3DQV C;  3BCD A;  3OOC A;  3L2R A;  1RMG A;  2JUG A;  4CH7 A;  4P22 A;  1HVX A;  3OYJ A;  1SFK A;  2CV1 A;  2V4D A;  3GQB A;  2GJR A;  1MMG A;  1QJV A;  4PSX A;  2R7T A;  5FRM A;  1D1A A;  4BDY A;  3K4N A;  3VR6 A;  3A4C A;  3LL7 A;  1O8G A;  1BPL A;  4IKF A;  1H8E A;  4XKW A;  2XC7 A;  2E5N A;  5FRN A;  3DPT A;  2XSJ C;  3MKZ A;  1W0J A;  2R7R A;  2VIX A;  2DT6 A;  3S93 A;  2V9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...