2VJJA

Tailspike protein of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN
total genus 232
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjjA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjjA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjjA02
4C2LA 5C1CA 2VBMA 4XLHA 2NSPA 3EQNA 3LMWA 1OFMA 3UW0A 3T9GA 4OJPA 4XLEA 4HWVA 3VMWA 1KTWA 4XLFA 4W8QA 4URRA 4XM3A 1GQ8A 1O8JA 4YZ0A 2NT6A 1XG2A 4XNFA 4U49A 1O8LA 2QY1A 3VSUA 2QXZA 3JURA 1OGMX 2X6YA 5AMVA 1O8FA 1OOCA 4XN3A 2X85A 4AVZA 1O8DA 1OFLA 4XOPA 1O8GA 2VJJA 4XONA 4XKVA 4NK6A 2NZMA 3KRGA 4OJLA 2UVEA 3FY3A 1NHCA 2UVFA 4OJ5A 4OZYA 1DBOA 2INUA 1AIRA 1X0CA 2QX3A 4Z05A 2BSPA 3GQAA 1IA5A 4OJOA 4OZZA 1IB4A 4EW9A 2NTPA 1QCXA 2NTBA 1RMGA 1O88A 3GQ8A 1PLUA 3VMVA 2X6XA 4XORA 4XLAA 3GRHA 4W8SA 1HG8A 2X3HA 3ZPPA 1JRGA 2Z8GA 1JTAA 4YEJA 1O8IA 2O0VA 1K5CA 1CZFA 1QJVA 1OGOX 1BN8A 4Z03A 1O8MA 2O1DA 3VSTA 1KCDA 4OJ6A 1RU4A 2PYGA 1O8EA 4XQFA 1O8HA 3VSVA 2ODLA 1IDJA 3ZSCA 1O8KA 2EWEA 4YZQA 1DBGA 2NSTA 4XLCA 2O04A 3SUCA 2INVA 2IQ7A 2VJIA 3B90A 4YZXA 4XR6A 4XKWA 4XN0A 1RWRA 4XMYA 4W8TA 4XL9A 4MR0A 3GQ9A 3B8YA 1PE9A 5C1EA 1IDKA 2VBKA 2X6WA 4YELA 4YZAA 4U4BA 4NK8A 1BHEA 1WMRA 2PYHA 3B4NA 2PECA 2VBEA 4PMHA 2NTQA 1KCCA 1H80A 1VBLA 4XOTA 2NT9A 4Z06A 4MXNA 3WWGA 4I84A 2O17A 3GQ7A 4W8RA 2O0WA 1PXZA 1EE6A 3EQOA
chains in the Genus database with same CATH superfamily
5ILUA 1VQ8B 2PMZN 2DU9A 2QQ9A 1U9OA 4BDZA 1GAQA 2XNJA 2KLOA 3QE2A 4ZYAA 1GVHA 5C1CA 1VHEA 2L4AA 3JX8A 3KP3A 2ZC2A 2HOTA 3FKIJ 3GUDA 3OV8A 2D2WA 4JX5A 1R1UA 2HQNA 2XUBA 3KP2A 4L9VA 3VYUB 3N97A 4KNYA 1ETQA 2D9RA 2KDOA 5EZGA 2NAZA 2XGDA 3O3KA 3QRFF 2GREA 2I8DA 3KFWX 1YRNA 3KEWA 5EMNA 2QKMB 3TP0A 4ZZDA 4C2UA 2WB1N 1OFDA 1R5GA 1O8LA 2UUZA 1LQ1A 2XTYA 2JVHA 4FX0A 3JURA 2XAFA 1JJ2B 3BCDA 3RKQA 3K70C 4Z4ZA 4CYDA 4Y52J 5E17F 4XONA 3OE7A 5H20A 2O5RA 3JRAA 5EYRA 4KA4A 1KU3A 3CCYA 1Y8RB 4RS8A 4PC1A 4OZYA 2DI3A 3HEFA 4KIBA 1MBJA 4M9SA 3ZN0A 4KH3A 5J4VA 4OMYA 2JJ1A 3Q9SA 3CLOA 3P9IA 4OPWA 4YFXF 3WQZA 4A6EA 5E3NA 2BSPA 1EH7A 3GQAA 2V9VA 2Z3YA 4BGDA 1EP1B 2VBYA 2BGJA 4OZZA 1BX0A 1T95A 5B6IA 2EB7A 2VQLA 1SD7A 2EFQA 3GMEA 1QBJA 1FT9A 3I4PA 2L9RA 2OA4A 2G7HA 3EUAA 1VQ7I 1M1EB 2EQRA 3MN2A 2V1UA 2FVGA 4Y7CA 3QU6A 1R58A 2X6XA 3OYKA 2E1MC 2L01A 3IH2A 2E1BA 3CDHA 1U8RA 2PI0A 2EIXA 3S2WA 1X4PA 4QPQA 1OCRH 3FHNA 4BHCA 5BSYA 4M3GA 1OISA 3GTJJ 3GLLA 4X7DA 3PSZA 2M87A 1S72I 4CZZA 1VNDA 3CCRB 1O8EA 2DTZA 4CQJA 5DNSA 4BBRJ 5FL7A 5M3FJ 4KYWA 3BWGA 4EM2A 5FLMJ 2KRCA 1LNWA 4EJOA 3HTSB 1ZK8A 1S7EA 3OYDA 1T0FA 3I59B 4ESJA 3CCUI 3JQPA 3R6SA 5FD6A 3A0BC 1V0EA 2BM0A 4KN4X 3DKXA 3FXOA 3AKZA 3COAC 3A3GA 2WY8Q 4ENNA 4WZEA 1FNDA 1FJLA 2R7UA 5CLSA 2KRHA 4KMUX 3V8KA 3OJXA 1Q9SA 1TT0A 1LLWA 2XV4S 4KKUA 4HNVA 2HCJB 5HS8A 4DYQA 2OBSA 3MQ0A 1Z0XA 3LQQA 5BS6A 3WHCA 1WMRA 1W5SA 4N9IA 4GYGA 4Z2YA 2QTZA 3BCFA 3OOCA 1V5FA 5ILSA 2Y0MA 1M1KD 3SZPA 1UCRA 2F5CA 1DDIA 2Z99A 5DCMB 2CFOA 2O03A 3V42A 4C9YA 4CDGA 1K73D 1QRCA 3H35A 2EFGA 2ZTGA 2R7DA 1X19A 2LBFB 5B1BH 3I4MJ 1JE8A 2YWGA 3G6EI 3KETA 4PFOA 1EFRA 4BQNA 4C2LA 3HUGA 4IRIA 3HOWJ 1OFMA 1YIJB 4HX8A 5IYQA 2VXZA 1ON2A 4XLEA 1IHMA 1R5NA 4JK1X 5K5QA 1OFCX 2MABA 1I3AA 3ZZUA 4XM3A 1MMNA 3BG9A 1J5YA 2BHYA 3F23A 4H0EA 2KIQA 4BE0A 3K4CA 1FDRA 2KP6A 3V7RA 1GJRA 2NT6A 3OMYA 1HF2A 1YX2A 2DFFA 2DW4A 2QWWA 3BZCA 5K7HA 1WDTA 4G7OF 4JP0A 3MKYB 3K4MA 3U1KA 2R7VA 4NC7A 4E7ZA 5LFAA 2O6WA 3AG3H 2K02A 2DPUA 3U1DA 4U0VA 1YHQI 3BH7B 3B6AA 3CCLI 4XKVA 3PNVA 4N9HA 4DQ2A 2UXXA 1XN7A 3CMAI 1UJ8A 3ZPLA 1KZHA 2DT6A 2HDNB 2PE3A 2IGKA 3GCMA 3LMMA 4BXFA 1ZM3A 5EGOB 5E8IA 2XGJA 3MHPA 4PC6A 3KZIC 2OU2A 3M1EA 2UXNA 3IUOA 4PAAA 1AMOA 3P27A 1UD5A 1X0CA 2XHKA 5J6XA 1E17A 4CYCA 5J1YA 1BN5A 4ZYDA 1A04A 2DYIA 1GXQA 2XEXA 4O3MA 4GO1A 5FLXK 2VASA 4B3XA 1J75A 4I99C 3ZXSA 3P5JA 2JA8J 4UVAA 4HDUA 2A68F 5JVGF 4DK1A 1JXSA 5FO5A 1CF7B 3M8FA 3WHBA 2WYRA 4DW6A 2FSWA 4P9SA 4XORA 1DARA 1IRZA 3GRHA 1E3HA 3N05A 3QPTA 3E1SA 4IPAA 1YLOA 3BY1A 1QJVA 3J80Z 2BM5A 1T6XA 5L3BA 1JKOC 1L0OC 3SFIA 5FO1A 3K7AJ 4OJ6A 2L02A 3P7NA 3CC7I 4OIRF 4OPSA 4OIOF 2MSYA 2YS9A 1ZRFA 1DPUA 2X3UA 4UZFA 1X1PA 5GAHJ 1CNFA 1IB0A 3WBKA 1JUSA 4RDKA 2RNGA 4L9JA 4A3LJ 3FXMA 2FBHA 3FXQA 4XKCA 2ETHA 3HGGA 4EVIA 5M5WJ 1PVEA 4CA0A 2R3SA 1SAXA 4ZDOA 3ASRA 2F5DA 2O04A 1R00A 3M8EA 2VJIA 3OR2C 2Q0OA 2MA3A 4OU0A 1RWRA 2Z2SB 2CWEA 3A8IA 1O3RA 1MKMA 2CS3A 3K4LA 4HDVA 4Y15A 1YJ9I 3GVKA 2GQQA 2V9PA 3H5NA 3S1NJ 3LYCA 3OYCA 2ZXHA 3DU6A 3VODA 4AU7A 2XKOA 4QTRA 1NG7A 2G7UA 3IH4A 3GVAA 3RIRA 5A88A 3B4NA 3CPXA 1SFEA 2XTXA 3R6JA 5HKKA 1BA5A 4CZCA 5LHHA 2ISYA 2V9KA 5M5XJ 3WWGA 1TQMA 4ACAA 1WWXA 2HMAA 2Z9OA 3FISA 2BW3A 3ZMSA 4RAYA 4LFUA 1GAWA 2X1EA 1D5VA 4GRIA 3C18A 4KICA 1COWA 3P26A 2QQAA 5FB2A 4XLHA 2W6IA 2BVNA 3EQNA 1MBGA 5C4XJ 2FF4A 3EYYA 1WVRA 2RVCA 3LFKA 4II3A 1K6OA 1TC3C 3CC2I 4TT3A 1XCVA 1G6NA 2DA1A 3TW7A 2WAFA 2M8GX 4B4CA 2EZLA 4QSHA 4FTHA 2CH0A 4EJVA 3GLXA 3A01B 4S0HB 1A5JA 4WXDA 3CC2B 1MRZA 3HSFA 3RYPA 4BHBA 5DD4A 1RUOA 2BM1A 2P7CB 3OOUA 5IY5H 5KVRA 3ECOA 5L3CA 3F21A 2YWHA 1YS6A 4FT8A 4BQQA 3JREA 1BJZA 1EKEA 3MD2A 4OOIA 4UUSB 1DU0A 2M4KA 4A3CJ 1FEXA 3SLDA 1DGRM 2MLKA 1O8GA 2Q2EB 3AVWA 1D1CA 2QF7A 4PJLA 1F43A 4DNCA 1SEUA 5H2FC 3B8HA 2BE5F 2VT2A 1FTTA 1LUJB 1RR8C 1FX0A 1BR1A 4IL6C 2EV0A 1IXCA 2WTEA 4A3EJ 2E7XA 4XRSG 1BIBA 5DD8A 1E3XA 3CW2A 3KZZA 3ELKA 1ZG5A 4DNTB 2DK8A 5E3LA 4ZV4A 2P6SA 1B23P 2VPRA 2E1RA 3DCFA 1LM1A 1IXRC 1BM9A 2PJPA 2K3PA 3BTCA 4NC8A 4A0XA 2Q6IA 5E6TA 3IH3A 2IOUG 4L5EA 4U88A 2NVUB 1L3LA 4BAYA 4LG0B 1O57A 4HLXA 4EM0B 3JRGA 4M6XA 3QPLA 2GJRA 1A36A 4G6IA 3ZPPA 2XPVA 4D1QA 3W2FA 1HG8A 2DFEA 2MG4A 2OQGA 3H1CA 1V55H 4Z4UA 1O8IA 1QA1A 1MH3A 2XC7A 1CZFA 2HZDA 3LSIA 4Z03A 5CVRA 5JBQA 2NYXA 1EA3A 4DZJA 1UELB 1I50J 3MCZA 4CCJA 2KVOA 2D45A 2RNJA 3B6CA 3FHZA 3A8KA 4BE1A 3HJEA 2L3DA 3WNCA 1JA0A 1OHHA 4A5NA 4LLLA 4E7SA 2P8TA 3RI4A 2PQ8A 1VTNC 3H3ZA 1VQ5B 3GZ5A 2I1LA 3TMOA 2BY0A 3ZMVA 2NSTA 1Z7LA 2GAUA 1N08A 2VLAA 3AG1H 3BQYA 4FISA 2ZO4A 4XR6A 4UUTA 3RTRA 4YFKF 1QFYA 1I3QJ 1R1VA 4LLGF 5EG0B 1FZPB 3N4MA 4XL9A 1W0UA 1XG1A 1MNMC 3CESA 2ME0A 4NBQA 1JHHA 3K2ZA 1KQ9A 1GR1A 4YZAA 4NB5A 5GTIC 3C1DA 2AS5F 4RM2A 3PO2J 4F91B 2M3AA 1QX4A 1B6AA 2EFOA 1WCMJ 5E1WA 4X1EA 5EEGA 2FBKA 4YIIA 3H0GJ 2WY7Q 2VXDA 1POGA 1ZELA 2ZNYA 2BXZA 2GPJA 5KAIC 4IOAF 2NV4A 4X05A 4B09A 3ZQIA 1H8HA 1F1ZA 4F7ZA 2Q8KA 1YLFA 1Z1DA 3FJOA 3J80K 2VBMA 3ZC3A 2W24A 3CDIA 3PQKA 1BW5A 1QUEA 5B66C 4WX9A 2LOOA 4HSRA 1E1QA 5BPIA 2E35A 2M7AA 1KTWA 1TL8A 4CCNA 3CQZJ 4IHTA 2OTJI 4ASUA 3SDGA 4B3AA 2HTJA 5ICCA 3ABTA 3LSRA 1Y1WJ 3PENA 2XZLA 5DM6F 4M2LA 3GTKJ 4HW0A 3TO9A 4CXFA 2ACJA 1KA8A 4YZ0A 1IN4A 4D7MA 2O8XA 2GJPA 2CW0F 1S8NA 2ECCA 1R5BA 2Y2ZA 2JA2A 2JSCA 3ASNH 4I0BA 4II2A 4NDLA 2QA4B 4ESFA 5LBQA 3JQQA 4HZFA 1FYLA 5CJ9A 2ZMEB 2P5VA 1QA3A 2XF7A 1J2XA 1MW7A 3CCMB 4FN5A 1QO0D 3A1YA 4LBVA 1OCZH 1VQ5I 6PAXA 4G1BA 3LA7A 4G7ZF 1ELOA 2ZCWA 1X2MA 3OY9A 1FOKA 4QHYA 3S8PA 2DMPA 2R7OA 3W5HA 5FA6A 2OTJB 3ABLH 4FQGA 4MNUA 2QSFX 2ZXIA 2EIKH 3M8JA 4FASD 1YTYA 2RN7A 4ZYGA 4BQAA 4G6TB 5HOOA 5FGMA 5E3OA 4LB6B 4HG2A 3OL3A 3QP5A 1ZG1A 4HF1A 1BMFA 3K10A 4Z05A 2ZJRF 3GZNB 1UMQA 1XB2A 2NNYA 4G7XA 3WXMA 2IAIA 2BY1A 4D9JA 1HW1A 3L1PA 2VKHA 4WWVA 3IAS2 1IB4A 1U2WA 3MWMA 3GVJA 4BYYA 4Q4ZF 1U9NA 4E7JA 1R9TJ 1U3EM 2CBXA 2KL4A 2L5QA 3DEEA 1FOWA 1HQCA 3G1MA 2DDAA 1WH5A 1EA0A 1YIJI 2R4GA 1DP3A 2MD5A 3G3ZA 1J9ZA 4X7FA 1IGNA 3L2VA 1PYVA 4A3IJ 2DOAA 1TZLA 5IP9J 2PMDA 1KCDA 3F3XA 3R61A 2E1CA 4V02C 4M9XA 4M4SA 2XAJA 3VPRA 2JJ2A 4TMZA 3HSEA 1JKPC 1KK1A 1V4RA 2KRFA 2M8EA 4UUSA 1UD2A 2BXYA 5IYBJ 3PIOF 4IKFA 2BF4A 2ZL6A 4JMQA 3AL0B 1YJWB 3OR1C 2LY2A 5AONA 5EJCA 1R22A 3S1MJ 2LLKA 1MH4A 1Z3XA 1WJDA 3K1PA 1U5TC 5GP9A 2P6TA 3OYMA 5HS7A 5BPDA 3I3LA 4ASNA 3D5LA 2WZNA 3G6EB 1RIOH 4WXHA 5FJ8J 3E0JB 3B8YA 4AF6A 2YSRA 1LEAA 1NRKA 1IDKA 3AGQA 4YFNF 4BKXA 3CO6C 2PJRB 4GFBA 1KD1D 2NVXJ 5LGUA 1ETWA 3BJ6A 3OW7A 2K9SA 3ABUA 3R4KA 1I8DA 3BPXA 4CO8A 2A61A 4P1WA 2QQBA 4TSFA 2NT9A 4XOTA 3EPZA 1SVLA 2O9LA 3BG6A 2JT1A 2MFZA 3L7WA 3LSKA 2ZFUA 4X07A 2QVOA 2OTLB 2O17A 1K28D 3W6KB 2KPMA 2XSJC 1LE8A 3JRCA 4IHSA 5J8FA 2O0WA 1WU8A 4RB3C 3ES9A 3DEUA 2W1OA 1VQ8I 1QG0A 2F4NA 1BC8C 5HDNA 3LMWA 3UW0A 2R7ZJ 3T9GA 5KNLA 2DPDA 4YC5A 5JMCB 3H09A 1APLC 1ZQ3P 3I56B 1MBKA 2MGQA 3GFMA 4PABA 2HQRA 1CNEA 1TNSA 1Z67A 1IUFA 1J59A 2FRHA 4G6QA 2M5SA 2HYJA 1G7TA 2C5HA 2EFWA 3L9FA 3BP8A 4ZGNB 1KQ0A 4J19A 4E4HA 2DBBA 2E5NA 4UVBA 2FX3A 1YG2A 4IHYA 1QVGB 5E18F 1KYZA 1KU2A 5GPCA 1MSFC 3CP8A 1V5EA 1DP7P 2JPBA 1QPIA 1FMVA 3VYRB 4XD7A 3MKWB 1G59A 2BHZA 3GF2A 1XD7A 2NS8A 3HXLA 2YWEA 2MYSA 4IRHA 3DBRB 1FRQA 2XNDA 4ROXA 2D5VA 4M3BA 1FYMA 2XDVA 4ON0A 1QVTA 3IRQA 4GGGA 2K86A 5CVJA 5GADJ 1KGSA 5BMZA 2E5ZA 3VDXA 3L2UA 1X1BA 1VLOA 3A03A 1XGSA 3OL4A 1GO2A 3H0DA 2VC1A 2DA5A 3LSMA 3Q9VA 4RD0A 3OEEA 1IA5A 1MGTA 4N4NB 4IZZA 1SM4A 5FD5A 2R93J 2HOSA 2M34A 1FOXA 2A3SA 2JA5J 5L3DA 3G05A 5GV7A 2A6TA 4E7HA 4FK8A 2ELKA 5IOYA 4K1XA 4P6VF 4MTEA 1TQIA 5HLHA 2EH3A 3OPOA 3TO6A 4TV7A 1I5ZA 1UFMA 1FBSA 3BZKA 4ZZLA 1OYYA 1QHGA 3K4JA 4EEFG 1TLHB 2ZZEA 1OCTC 4Y7NJ 1W7PB 2CUFA 1WH7A 2V4JC 1HC8A 2HPIA 2XAQA 4C0SA 2IVMA 3EETA 1UD8A 5F0FA 5HNFA 1IXSB 3ZPNA 1DBGA 1W0TA 3C3WA 2L7FP 1I1GA 2Y0SA 1W87A 1Z91A 4UZUA 2XC1A 1YI2I 4P25A 2CYYA 2BY2A 3RDIA 3BTLA 3MMPA 4BL0B 2DDBA 2KIMA 4J00A 4P2NA 5F04A 3VB2A 3GQ9A 2Q6KA 4BY7J 4KISA 1FBQA 1K78B 2F4OB 4Z4RA 2X6WA 4LIUA 5FNZA 1E3PA 4OINF 3EDPA 2MW8A 2Z1DA 4LK1F 4PGOA 3K1MA 3AGPA 3H9NA 5C3EJ 2VBUA 2KMUA 3R6KA 4Z06A 1ZKGA 2HOEA 1T98A 3GTQJ 5DYMA 1YIOA 2ZSIB 3J7AO 1WZ2A 2XGEA 1P7JA 4HSTA 2HDDA 4B1RA 3ZGKA 1NK2P 1YITB 3F8NA 2IA2A 5E8GA 1ITYA 5J35A 2BSAA 2EIMH 3FXRA 3G73A 1PUEE 3I1FA 3CD6B 1V5VA 3VMWA 2BV6A 3C2HA 3CJRB 1MIJA 5F4JA 4W8QA 1RZ4A 2FXAA 1GQ8A 3WGHA 4MIMA 1XMXA 2D3LA 2DN0A 4PFPA 1K78A 1CGPA 1VF7A 3BG3A 1TYVA 2R5YB 2XOKA 3FZVA 4KT5C 1TWHJ 4KIFA 1QU3A 3ASQA 4IF4A 2H8RA 5FIUA 1KQ5A 1D0YA 4R71A 1DUXC 3Q3SA 1PP8F 2CJJA 2LFBA 1PJRA 2HS5A 4Z4SA 1R4NB 3WBJA 5AMVA 1TYWA 1STZA 4XN3A 1Y1VJ 4LIVA 2X4HA 1O8DA 4OOVA 3FM3A 4S05A 1JTYA 3VNUA 3ZQCA 4IVNA 4M72A 2MH2A 2H8WA 2O7OA 3E3VA 1Z9CA 2J5OA 2YX4A 4G7HF 2J7KA 2OBRA 3RYRA 2DK5A 3H9QA 1CF7A 2VPLA 2HEOA 3FK6A 1G7RA 2LKSA 2A6HF 3CC4I 5IT3A 5DS0A 3H3VK 4G9YA 3H94A 2F5FA 1D0ZA 1VQ9B 1XC5A 2ZBUA 3BC8A 2LREA 1WSUA 1BOAA 1IRFA 3FPKA 2FE3A 2PMZA 4MHGA 1W36C 2BM6A 1AWCA 1WOSA 2X1DA 1S6LA 3ML6A 2M5WA 5D5XB 2D1HA 4U0YA 1XDSA 3OZWA 3HM5A 4M1KA 1WSVA 1YJ9B 3A4CA 2FA5A 2W57A 4NUBA 2LZJA 4P6YA 2Z8GA 2F1LA 4DQLA 2E2JJ 4M73A 4HV5A 5LHGA 2WV1A 4RD2A 1LFPA 2O6GE 3Q39A 2PYGA 1HF0A 2JA6J 5J3LA 4ABZA 2RC6A 1VFCA 1QNTA 5GAEJ 3DTIA 2VNKA 1QQIA 2BGIA 3LQ6A 1E2XA 3RKYA 3RPUD 4CH7A 9ANTA 2OBTA 3ZMZA 2YPRA 5M3MJ 1SD6A 2PN6A 2IS6A 3GTLJ 1MBEA 1KK0A 1YS7A 4HIZA 2KHMA 2OYNA 4XLNF 1OYWA 4LG3A 3CCMI 2VJ4A 1VQ9I 5K7ZA 3QFSA 2Y31A 3CUQB 4P26A 4HV6A 1IN7A 3QAHA 2QBYB 3S93A 5TRDA 3PQJA 2HZTA 2BW3B 2R5ZB 3EUHA 4QPOA 4NQWA 1N75A 2H1LA 3ZP5A 3O8HA 4LC0A 4OOXA 1ZG3A 3OFNA 2EIJH 1HCRA 4PC7A 1P4WA 5IYCJ 3LNQA 4OAYA 4K2EA 3GXOA 1RETA 1ZREA 3ECHA 2STTA 3VSKA 2L9SA 1FC3A 2BPOA 3OP1A 5IYPA 5GV8A 1WFXA 1MBFA 2KDZA 3CCVI 3FXUA 2QLZA 2LYCA 3QU3A 4RPBA 3FIWA 3W5VA 2ZZFA 2QQ8A 4ACBA 4AYBA 3IWFA 2PJRA 2QDXA 1A6QA 4RLZA 1VQPI 2P5LC 2CW5A 2V1XA 3KIOA 3BQJA 3L2QA 4C2TA 1KJZA 4MGRA 2W7NA 3U6BA 3BLYA 2H09A 2FNPA 3ZZ0A 5E3MA 3U2QA 4RDLA 3TQNA 4BY1J 1ZAOA 1ZRDA 3VR6A 1O8JA 3LAJA 3GFJA 1F4KA 4OWRB 1DG1G 4Y13A 1XG2A 1R71A 5CVVA 4A0YA 2A07F 2H27A 1VQOI 2CF4A 5IYDJ 3VNVA 1Y0NA 2Z5UA 1D5YA 1G2HA 1QVUA 2E1MB 2COBA 3WGIA 1HZEA 1XSXA 3OZVA 2KJBA 5LRRA 3TP3A 2K9QA 3WTVC 4A69C 3K9TA 1FNMA 2J5PA 4PUSA 4RB0A 3F8BA 4BBSJ 3KZYA 1TBXA 5IT9K 1HKQA 3LL7A 4WZTA 3IRRA 1Z6RA 4HOBA 2V5IA 2OBPA 3U2RA 3O2PE 3A3BA 1G4DA 2DJNA 3EQLF 5CKTA 3CB4A 4BU2A 2FJ1A 3CCSB 2E2IJ 1HSTA 3H5RA 1LDDA 3DF8A 3RCOA 2DMUA 5BSXA 3RPUA 4ENJA 2C6YA 2W48A 1RUNA 3PSIA 2XKPA 2NTPA 3CCQB 3FMQA 1J7KA 3TKYA 3CF5F 3M4OJ 1Q7YD 1N25A 2B7BA 3B02A 4PCQA 1JI8A 1O88A 1S7OA 4CUGA 2E7WA 1R7JA 4BH9A 1JGSA 2X3HA 5LRSA 2DEUA 3CJTB 3LA2A 3GTOJ 2GQFA 4B8XA 4A6DA 1EH8A 1RQRA 1QZEA 2ZITA 4B44A 4L8JA 4LK0F 3KE2A 5H59A 5F0HA 4I09A 2YR2A 1SFOJ 2Y48A 1AKHB 1R6RA 2JK3A 4Y17A 4AIJA 2JN6A 3DEWA 5BQTA 4URRA 3VO1A 4KT6A 5IYWA 1P4XA 3ASTA 1R1TA 1EFCA 3D1NI 5J3OA 2HYGD 4XLCA 4ZJZA 2YU9J 3JU4A 3QSYA 3BCAA 3B90A 4EM1A 1QUFA 4XRSA 2VN2A 2W00A 3DBHB 1DDNA 1YQAA 4XMYA 3CCJI 3BDDA 1JTXA 1FNBA 1XE1A 2K40A 3WYAA 3RIQA 2CQ7A 1ZUNB 3J7ZI 4TMVA 2LBFA 3S1QJ 2HLDA 2YU3A 1N06A 4XSZF 3V7CA 4UB8C 3CMYA 1S0UA 2KKOA 3TH0A 2VC0A 5D5VB 1TW2A 2Q6OA 1Q82D 3FMSA 3BZ6A 3RZOJ 4LD5A 2WBMA 1ZGJA 3P4GA 1Z05A 3S16J 4Z4WA 2J8KA 1WI3A 1OB5A 2DFIA 3FM5A 5CVUA 4EH1A 1NHAA 5FLVA 2E71A 1F20A 4UB6C 2VT3A 3K70D 4BJ5C 1IJWC 3TO7A 3OSGA 1E0EA 2GLOA 1N07A 3TDUC 3TOAA 5L3EA 3SZGA 4CCKA 2ELJA 5F4OA 3W2EA 1XSVA 3IWZA 1GVDA 5A89A 4RAGA 1KYWA 2JZYA 3AVXA 1WGXA 1SVMA 1OJLA 2WB1A 4MO7A 1N0UA 1H88C 1B72A 1SAUA 3SJZA 2XRNA 3L2CA 1X1AA 2M0MA 3SYJA 1EP3B 1HLVA 3UR3C 1B1BA 2AO9A 3K69A 4AD9A 3CD6I 3VEPA 1DGWY 3U9GA 1VQMB 5F08A 3DU1X 3M7GA 2R7XA 4XICA 4I2OA 4ZDPA 2R5ZA 1LVKA 2P3MA 4IQ4A 3FBNB 2ME6A 4YAFA 4WF2A 3ZQFA 2LF8A 1LB2A 1BR4A 1C0WA 3OYFA 4M3EA 3FWEA 3ZBUA 2VJJA 1VZ0A 3KRGA 2HYFA 5HS9A 1FPQA 2P7VB 4OJLA 4LBWA 2FU4A 1KRHA 3HUGB 4P96A 2LTPA 4E7IA 3FPPA 1NHCA 2UWMA 2QE7A 1TWFJ 5JFRA 3KEYA 4LBYA 1E3OC 1ORKA 4UAJA 3SFZA 3CMMA 1UG0A 2K85A 3T51B 4UNOA 2L9NA 1VQMI 5HDKA 2CQNA 1W5CC 1ACIA 3T8RA 5J4YA 3FBIB 2L9VA 4OJOA 2LKXA 3A2KA 3CMAB 3IP4B 1JHFA 1LEBA 3BJAA 2F5VA 1YI2B 3LA3A 2NTBA 2M2EA 3D5RC 3C2BA 2ZZQA 1SVOA 1WJEA 1OKRA 2CC2A 1TUIA 1NK3P 1MMSA 1LKXA 2GZWA 2ZZGA 4C43A 3G2BA 3F8FA 1QGPA 1BOBA 3WU2C 5B5EC 5LLQA 3N90A 2B63J 1Q1VA 3SKBA 3VSTA 5JI6A 1XDUA 2CUEA 3AG2H 1LJ9A 1YW9A 2BGCA 1N0VC 3CC4B 2XT2A 2R7SA 5DTDA 5CYVA 2DXIA 5ICGA 3E6BA 1UHMA 1G7CA 1O8HA 3TEDA 3GFLA 4E0FA 2ELHA 3L2WA 1IDJA 5E79C 2NVYJ 2HKOA 1YJWI 2EILH 1OCOH 2JN9A 4EGZA 4IO9F 5DSZA 2A5YB 1T6YA 4YDTA 2LF7A 3HL2A 3CCQI 3BR1A 3DPUA 4C2MJ 2F1MA 3DQVC 1BX1A 3KEOA 5KK1A 4AVPA 2IQ7A 1RNLA 4XKWA 4HE5A 3I71A 1YJNI 2CW8A 1MMDA 2NNNA 2XGCA 3HAGA 4W8TA 5DN6A 2IT0A 3ASOH 2K5CA 2VBSA 2ZSHB 2DCEA 2L2OA 1KU9A 3OIPA 5TGTA 3MEXA 3ZMTA 1BL0A 2GXBA 2VBKA 4BE2A 4DNRB 3ZQGA 1A8PA 3PVDA 2XB5A 3C7JA 5CQEA 2QYOA 4IXAA 2FD5A 3OSFA 1FOYA 2E34A 4QIWN 4ZYEA 1G8XA 3I64A 1PDNC 2IGMA 3DU5A 2F2EA 1LFUP 2LY9A 3DTEA 1AOYA 1JB9A 5LMZA 3QFTA 1VQNB 1SFUA 1MBHA 4OP7A 1G3TA 2R9VA 3BOQA 4CYCB 5DCMA 5FKLA 1FIAA 1E79A 1KK3A 2WAQN 3E7LA 2NSPA 1P4MA 3LQRA 1RKWA 4JX4A 2QENA 2PEXA 2WADA 5D6EA 5ICEA 4HWVA 2DTRA 3ONQA 3WG7H 5JHFA 1GV5A 4OPVA 1A35A 2JSPA 4A3KJ 4FCYA 3GWZA 2ZKZA 3GTGJ 3VOEA 2IP2A 2TRTA 3U6KA 1LE8B 2XZOA 2VFPA 1JGGA 3CXCB 1NDHA 4JRAC 4PJNA 1OR7A 4GQNA 4LGWA 4FX4A 2GIVA 1E62A 3JQRA 2X6OA 4MFEA 2WAEA 2JVGA 2CQKA 2HXOA 1OGMX 4TN1A 2AQFA 2CG4A 2OZ6A 1O8FA 1OOCA 1T56A 3QOPA 1B9NA 1K8AD 2CK3A 3E6DA 1IV6A 1MMAA 1VQ6I 3Q0VA 4XOPA 4CICA 2C4UA 3G4SI 1GXPA 4WWCA 4XBFA 5KW9A 2PFBA 3Q6QA 5CDFA 1Z21A 4DBRA 3HYIA 2BY3A 2XF5A 3RKXA 4EGYA 1DPRA 1USSA 2GXAA 1N77A 4G12A 4PJJA 1XX5A 3M3YJ 1K7AA 1ULYA 1WKMA 2LRDA 1ETYA 3MZYA 1QCXA 4YAWA 3LNNA 1R5ID 3ABMH 4IW3B 4PK4A 4M71A 2V7TA 3PUMA 3VMVA 4AIHA 3JRDA 4W8SA 4FHTA 2B0LA 3WE3A 3CCEB 2EK5A 3HIFA 5JLXA 2PLYA 3KLNA 1K5CA 4Y3OA 3ZBTA 5DEQA 4WK8F 1JA1A 1UHWA 2N8GA 2VBTA 3NE5B 1M90D 1O3SA 2XPUA 4QVAA 4DGWB 2QGUA 4KMFA 1Y0YA 2XAGA 1TTYA 2XT4A 3LQEA 3HOYJ 2STWA 3I56I 2D1VA 5IPAA 4AIDA 5C4JJ 1TT5B 2HFHA 4M9ZA 3W5UA 1IN8A 1W9XA 2LY1A 3QQAA 5L3GA 2EZHA 2EWEA 2QYUA 2COMA 3T1BA 1ZM9A 5KCMA 4XKBA 3K4KA 3OYGA 1BC7C 1TWAJ 3HRMA 1K6YA 3WG9A 5JVTA 3S2DJ 2IS4A 5F27A 2PBIA 4L9NA 5J47A 1N05A 1BJKA 3JAMK 3WTSC 3T0YA 3J81k 2WZPP 1JT0A 1P4AA 2HDWA 4ZYHA 2FQ4A 2X51A 2XVCA 2L54A 2L7ZA 2KIFA 3JRFA 2AHQA 1QH0A 3ZQHA 2LDUA 5J1RA 2XRLA 2IS1A 3WGGA 3E6CC 4Y4RA 4BS9A 5HODA 1ETXA 3A0HC 1W4MA 4A3GJ 1NG6A 2YUSA 4CHUA 1PXZA 4YZQA 1EE6A 4DZPA 5B1AH 3BH4A 4Q47A 2DO7A 1E1RA 1UD6A 2X48A 1I7PA 4UZEA 2LG4A 3ZQQA 2O0YA 2ZJ2A 2QA4I 4Y33A 3JTHA 2GBYA 1ZM4A 2XF6A 4OJPA 2NPFA 5CPRB 4RDUA 2R92J 1RKTA 5H5JA 1CQTA 2QSHX 3WU0A 2V7QA 2XSDC 3CPWB 2CW7A 2CU7A 5E1ZB 1MJ9A 3AAFA 4ZCIA 1D8KA 4HRIA 4YIFA 3HHGA 2FEZA 1NB9A 3V8JA 1RR7A 4U49A 2JWTA 5ERIA 5F0CA 3S15J 3MVPA 5TV2A 2CQQA 2NS0A 4UY8I 2CUJA 2QXZA 1KQSB 1WHUA 4XIDA 1W0JA 4MYTA 4CCMA 4N0BA 1REPC 4OOSA 3RY8A 4CCLA 3DPTA 3G71B 5HVQC 5FKMA 5FKKA 5DDGA 2JUGA 2MH9A 1QGAA 4N3NA 4P3IA 3MZ8A 4ZC3A 4P12A 2VNHA 5D4RA 3I55I 3HG9A 3PFIA 2B9SA 4DBQA 1GT0C 4YHBA 2G0EA 1HBXG 3Q6RA 1X4OA 1BLIA 1Z6TA 5JLVC 5DM7F 2KT0A 3K4BA 3B82A 2Y30A 3D26A 1KMHA 2BV3A 1MJAA 3F72A 2LK2A 1FX7A 3X2QH 3FXKA 4EW9A 3I0TA 2JUCA 1MD0A 4OIPF 1B59A 5K5RA 4X7CA 4WZLA 5LD2C 2VQCA 4R79A 2GA1A 2WJVA 4G7WA 4IRGA 4RJLA 2I10A 1PJ7A 3H9GA 1O7LA 4Z4VA 3RQIA 2VFQA 2QUFA 2OZUA 3ML3A 3BR6A 1IDZA 1U78A 1O8MA 1CQXA 1UHSA 1K4TA 1RU4A 3FKJA 4HPQA 1W35A 2DYRH 2RC4A 3QPSA 2BM7A 3V8LA 3JRIA 3PL8A 3VSVA 4WQMA 3N6ZA 3OJWA 1F36A 3ERMA 4U7DA 2BMWA 4Y9RA 4C3HJ 3LO8A 3LSGA 4X0GA 3HC7A 1SD5A 2RKHA 2CGPA 4X6AJ 3WY9A 3T56B 4TKOB 3BQZA 1S29A 2EFPA 1ZLKA 5JLWA 3KLOA 4PJMA 2INVA 3RQ4A 1OGJA 4N3GA 4NBSA 2OF7A 3U21A 3ZOBA 5JR3A 4BJ6C 2OV7A 4HBLA 5KHDA 2C4TA 3F9KA 1FRNA 1OB2A 1QFJA 1XMKA 1KONA 3KP7A 2WPDA 1OMIA 2EZIA 2KQRA 1A6IA 1O3QA 3G71I 1UZCA 2V1NA 3CMEI 4PMHA 2NTQA 2H6BA 3FXLA 3F0CA 2NXNB 1T6SA 1U6GA 4IOCF 2HNHA 1P7IA 2W6JA 2ID3A 1FLIA 1VQ4I 3ZQLA 1TYUA 5IYNA 2O8KA 1BW6A 4A93J 1JKRC 3FMRA 3HGYA 1VQPB 4PC3A 3BR5A 2O61A 3CJQB 3HOUJ 4MEYF 2VFOA 3I9V2 2ZNZA 1I18A 3PIPF 1WJCA 4KKSA 3LWFA 4HF0A 2BN4A 4XK4A 1XCBA 3W6JB 2MD0A 4A3JJ 1TWGJ 5FROA 4HNTA 3IKVA 2JQ7A 3CMEB 2K9MA 1H0MA 1EH6A 2Y0SN 1TVCA 1W0KA 2DIEA 1T5EA 4I01A 3KYCB 5HDGA 3IV5A 2HWVA 2V1DA 3NWTA 1F9NA 4AM3A 4KKTA 4ZCMA 1TSPA 2H94A 3VMFA 3F8CA 2IRFG 2Q1ZB 2KFDA 2M30A 3PA2A 1UD4A 1OFLA 3LFUA 4RM0A 3TOBA 1DDGA 1XGNA 2X1CA 3ISPA 5J40A 4U7BA 2Z33A 4MTDA 1OYIA 1B9MA 4KITB 3JTGA 4WXCA 3ZMDA 1T8IA 2J8IA 5F6FA 2GM4A 5CQGA 1IAWA 1Z7UA 2VKVA 1EFUA 4IX7A 1DBOA 2V7VA 1EFTA 1AIRA 1PKVA 1YO5C 2A05A 5CVIA 1NBMA 4QV2A 2VNIA 2B0RA 1H89C 3LVBA 1D1BA 1ZGAA 1GUUA 4C3JJ 3HSRA 2IGOA 4RD1A 1WJFA 4AC0A 4CCOA 4RBOA 4W1UA 1D8TA 2DY1A 1H8EA 3OKXA 3A35A 1G3SA 1O7FA 4BEHA 1W34A 2B5OA 1MJBA 5TISC 2LMDA 4A0ZA 1ZR2A 3KP6A 2Y9ZA 1PLUA 1Q1HA 1HDDC 3QYEA 4KN7X 3CUOA 1QVFB 3OWTA 2A6EF 3PUFA 3ABKH 3GSIA 3JR9A 4HQEA 3BY2A 1K8FA 2R7WA 1QGYA 3OS0A 1U0JA 5H6RA 3GYHX 1ODDA 3QYBA 4L5JA 3RKWA 4M53A 2ODLA 2CQXA 1X58A 2VKEA 1MDMB 2MC3A 1ON1A 3LSPA 2NVTJ 3Q38A 1T0FC 4LBZA 4AF7A 3KYDB 4U0WA 5FKOA 4H9GA 2R0QC 3AVTA 4A3BJ 1R5HA 4P9UA 2VYQA 3HOZJ 2Z6BD 3T8TA 4YCQA 5EGOA 2KIUA 5TY0A 3SUCA 4RLQA 1QA6A 1HW5A 2EPFA 3E5QA 3CCSI 3EUKL 3K2AA 4BEHB 3CC7B 2M0CA 1GDTA 4V19K 4MR0A 5B3SH 3W2IA 4EATA 2W84A 3PNYA 2AXLA 4DYRA 1Y0RA 4U9UA 3SY2A 4NK8A 2V6EA 2PIAA 3GVLA 4LB5A 4UUVA 3O6BB 1V3FA 1CLWA 2DOEA 5FLXZ 3I55B 2OK8A 2FMYA 5F1JA 2PECA 3S3OA 3PUBA 2QKLB 2AXTC 3SQNA 4I6ZA 1B2RA 3ZQ7A 1BIAA 4F93B 4ANJA 3AL0C 1FSHA 3HOVJ 4HQMA 1E3ZA 1KTVA 1UD3A 1EWYA 3BC9A 2FBIA 4ZGQB 1MZBA 3DP7A 2VUMJ 1EV7A 2V79A 1SKYB 4RGRA 1SMTA 2IJLA 4YFOA 1V5GA 3BH6B 1GLNA 2DAOA 1USTA 1U5TB 1VQNI 4Y9UA 3SJMA 2GWRA 3QP6A 2XIGA 5DV5A 2E1OA 4BXUA 1IUYA 3G4SB 1BR2A 4ZTJA 1D1NA 5DCFA 1FNCA 1J09A 5HXBA 4NHJA 1JUPA 3KPHA 4MQVA 3ZMUA 5D5UB 2W85A 2I5UA 1XTAA 4BDYA 2FX0A 3GX4X 1Y6IA 5IOZA 2HDCA 2LNBA 4YEIA 4HX7A 3MFKA 2QY1A 4OPOA 2E19A 3PJRA 2VJ5A 3GBGA 1HKSA 2TDXA 3OYHA 2K3FA 3KCCA 3O8GA 2CV0A 1HOMA 2O3FA 1XSDA 1QHHD 3QFCA 2X85A 3CTAA 2M7BA 2QEXB 3LAPA 1ZGWA 2HVRA 1FMWA 2ECBA 5FRNA 4ZDLA 1ZH5A 4OAZA 2E1NA 2DERA 2ID6A 5C44J 5E20A 1MNEA 3K1NA 4P22A 2OD5A 1VQLB 4DK0A 2LSOA 3WTZA 2INUA 1QRYA 1FIPA 5L3FA 1O4XA 3D0SA 4PGGA 1NH3A 1ZM2A 1NJID 2VE9A 1VQLI 4OMZA 2OAZA 4F92B 5GPAA 2IXSA 4P9FA 4AYBN 1F60A 2DETA 2VBXA 3SLNA 3GQBA 2DT7B 2RAEA 1FSEA 3BG5A 4KUMA 4RAFA 3RPQA 4AWXB 3CCUB 5IP7J 3CP2A 3A01A 4F52A 3SJPA 1A31A 4LG0A 1EZGA 3DLLF 1JRGA 3MMYB 2ZMEC 4D7NA 4QFMA 2K4BA 2CSOA 1EF4A 2YUHA 5DUKA 3J81K 1WJAA 4MEXF 3JRBA 3SEQA 4ENMA 2JRTA 2RQQA 2EWNA 3WTUC 2PLFA 4PSXA 1R4MB 2JMWA 3VFZA 3B78A 2GOXB 2PX9A 1ZN2A 3OYIA 4A12A 4M0LA 4YRVA 4Q7JB 3SQVA 1H9GA 2H1KA 2PMUA 3OYNA 2R7FA 1B4AA 3PFYA 3DLAA 4E70A 3DWLE 4UV8A 1OR7C 1BI2A 3DKWA 5LHIA 1LPQA 1XFOA 3QFRA 1KC8D 1YOVB 2IBDA 1B72B 3R0JA 5EG0A 4HNUA 1XPXA 1V54H 2DLLA 3W2VA 2OPTA 1ZR4A 4BACA 3K6GA 5IT9Z 3GO5A 2G9WA 2ZJQF 3OYAA 2XAHA 4HAMA 4Z4YA 1SC7A 1K61A 1ERDA 1ONVA 4NNJA 3JSPA 4YELA 4U4BA 2M45A 3R0AA 4RB2C 4XSXF 3W2AA 1FWZA 4I7HA 2XPWA 4M74A 3B73A 1I27A 2P81A 3KEQA 5K5OA 3ASSA 1KCCA 3L00A 1S3JA 1IDYA 4KFCA 1XGOA 3FDYA 1KU7A 2C78A 1RQPA 3TGNA 1HSJA 4D0PA 1FYKA 2OK7A 1IJEA 2MC4A 3RJPA 4W8RA 3Q3AA 1JT6A 1YE9A 5AIPA 3AVVA 4UVCA 1W1WE 2F43A 4V2GA 1I1SA 3BPVA 2F4IA 1UB9A 4KJZA 3WTYC 4OIQF 4HE6A 1VQOB 4MYUA 3H92A 4QUZA 2FOKA 1R49A 4A3MJ 3NAWA 4BUPA 1X2NA 3M9AA 3S3MA 2C2WA 3J81Z 2HPMA 5HLGA 2VZLA 3CRZA 2VFNA 2XGXA 1Z77A 1BI0A 3SZEA 4JOMA 3JW4A 4HEA2 2HTSA 3T53B 3J7AY 2DA3A 4PSWA 5TR9A 1W7PD 1VI0A 4I76A 1IO2A 1XMAA 4CSWA 2JA7J 1WP6A 4QVJA 1BJAA 1P9QC 1TNTA 1SKQA 4AVZA 3SHFA 1P92A 4IHXA 4NK6A 2NZMA 4A3FJ 2P5KA 3CDLA 1Z3YA 3GTMJ 4YAUA 3M1CA 4EMSA 5L46A 5BOXA 3HRSA 1MNDA 3W2GA 4A5MA 2IA0A 2QZAA 2UVFA 5KAFC 3CCRI 1S72B 5K1YA 4Z6YA 2LKPA 2WC2A 4O6JA 5FFZA 2QBYA 2V7FA 1H9TA 4Z1MA 2QX3A 2ZFWA 5HZAA 4LOCA 2UV1A 1N8RD 2JPCA 2ZB9A 3DPLC 4U87A 3J7YJ 4YALA 1JJ8C 3NRVA 4NCNA 1VQ7B 3K4NA 5F4MA 3FF5A 2ESNA 4H4KC 3P9KA 5DUIA 2JDIA 1AA7A 2BVLA 1TYXA 2E36A 2C77A 2LR8A 4A2UA 1IV8A 3HRTA 4R8HA 2X53S 3A1PA 1E43A 1OGOX 3DV8A 4BXXJ 4RDJA 3OIQA 1QFZA 3F6OA 3BCBA 1Y39A 2JJ7A 2HKXA 4Q48A 4TMTA 1T08B 4UV9A 3MKZA 3HB9A 4MLOA 5GAGJ 4ITVA 3CCVB 2WJYA 4PGHA 5IK2A 4F3QA 3WU1B 3DDYA 2VIXA 3H36A 2P4WA 1P6RA 1ZARA 5TJJA 2R7RA 2GK6A 4XLPF 3LSHA 3PNTA 2V7UA 3L09A 4BJTA 1K79A 2FNAA 1LDKB 2EV5A 3Q0WA 5HNHA 1YYVA 3HKZA 5HLTA 3SEZA 3HOSA 1B8IB 1BQEA 5HLIA 3ONYA 3FXJA 1EP2B 2RC5A 3A8JA 3IL2A 2EA4A 3CF2A 3HBLA 1YW8A 3HPGA 5BNGA 1S7AA 1HVXA 4RCYA 2G0YA 1YW7A 1KQ8A 3NQOA 1MABA 2V7WA 4UXNA 3PETA 3ULQB 3TDZC 1OPCA 4J01A 3S14J 3R60A 3MZHA 2PYHA 3SYTA 3W2WA 3OS2A 2WV0A 2ZMEA 2VONA 3BNWA 3SZTA 3OW2B 1IC8A 1PJ5A 3TW6A 1Y8QB 4I84A 1WJBA 3V7AA 4G6DA 4M6VA 1W7PA 3GQ7A 1RRJA 1GHCA 2K27A 1IN6A 1F5TA 1VJSA 2DQLA 2HXIA 2F3LA 3OOPA 1NTCA 1TLLA 1YJNB 4GXOA 1RC9A 2FQ3A 2HGCA 4DOZA 1D1AA 2LC2A 2M9HA 2XROA 1T38A 3W3CA 2QN6A 1QZZA 1BI3A 3LSTA 4AIKA 1OQYA 1TTTA 1OB0A 1QPMA 2EJRA 4M3FA 3VYTB 5THXA 1RPWA 1I6HJ 2ZBKA 1WOOA 2QMUA 2RQPA 1PUFA 3V7SA 1O3TA 4XNFA 3S32A 3JSOA 1EXMA 5F1RA 3IC7A 3HOTA 3GZ6A 2X0KA 4P55A 1XGMA 4JBAA 2X6YA 4XRFA 2OJED 4BHPA 2MBFA 2CRVA 5KSWB 1Y56A 3T5XA 4DJAA 5LEKA 3QWLA 3S3NA 3BY6A 5LGNA 3PM1A 3BJOA 4WZKA 2ADUA 3NEUA 2F48A 1DQUA 2NOGA 3I59A 1FBUA 2UVEA 3V4GA 2RREA 3WTWC 3QPHA 1S5LC 1T33A 3RSNA 3QYFA 3KL9A 3G1OA 2V6CA 4RCZA 3WTXC 4TMXA 2XTWA 3DXJF 4HA8A 2WR8A 2W7ZA 1K83J 2TCTA 2DOGA 5IYRA 4KIGA 1ZYRF 1K9MD 4B3FX 1UG2A 2VFMA 2DYSH 1PUFB 1XS9A 2L0KA 4L0YB 1HA3A 5A2QZ 3ASPA 1WI9A 5FKNA 4L0ZB 4F7DA 1ETOA 2IA1A 2A69F 1X1DA 2YX7A 2RGVA 4RLFA 4G8XA 4XLAA 4I02A 1WORA 5LEJA 2DOFA 2K7LA 2DT5A 1SFKA 1WTHD 2XNCA 1JTAA 3P9CA 4B43A 4DYCA 4HF2A 4GDFA 4JQFA 1ETKA 1FP1D 2LH9A 3F8MA 3ERED 1H8AC 3CJNA 1DABA 3LOCA 2VE8A 1I6XA 3A02A 1XQBA 2ZBVA 4EJWA 3S2HJ 5F64A 1DU6A 2CNDA 2WSSA 2L7KA 3JRHA 2F4MB 3HDDA 4I98B 2VBVA 1Q86D 4C30A 1FTZA 1G7SA 4DQKA 1O8KA 1OFEA 3ZSCA 2EBIA 4IHWA 3L2RA 4MQ9F 4ZCLA 2JRMA 3E5UA 2X8KA 3W2HA 4JX6A 3OYBA 2KISA 2QZ8A 1N78A 2HQAA 3S17J 3FK7A 2D74A 1D0XA 2EINH 2X9DA 3H9JA 2FOWA 3SXYA 1T39A 4Q5SF 1HA8A 2HU9A 1VQ6B 2BOLA 2IGNA 4QWQA 3OEHA 2F6CA 2PMHA 4PDKA 4GCVA 3I58A 1TWCJ 1WRJA 1HXDA 1PE9A 3NWSA 1KK2A 3MAJA 3KYLA 2EA2A 1KZLA 3I54A 1X1CA 3NB2A 1UAAA 2CV2A 1IRGA 1QGZA 2CUZA 4EJTA 4RGSA 2HVSA 2ISZA 3PO3J 1GV2A 1JKQC 4EV0A 2A5WA 4GYIA 4L9TA 1AU7A 4D5FA 4NC6A 3REOA 5EEAA 2M1BA 4YIRX 5ICFA 2GK7A 4F55A 3BG7A 4XRMA 4Z4TA 3WE2A 4FE4A 1IF1A 5K7FA 5D5WB 4BNCA 1IW7F 4FE7A 4X0CA 1IN5A 5AIQA 1HKTA 2VBZA 4C3IJ 5DS9A 2OTLI 4XLFA 1YFHA 4OM9A 1HDPA 2P0WA 2VQGA 3I5UA 2R5YA 2BVMA 1T6ZA 1R5OA 2EZKA 1JJ6C 2ICWG 3HZJA 1TW3A 1I39A 1FNNA 1B8IA 1YX5A 2ZXJA 3QOEA 1YITI 1K4SA 2V4DA 2DJIA 2DA7A 1U8BA 3NARA 3OYLA 1IRXA 2OCEA 4R1HA 3ROUA 1OCPA 2HI3A 2DA6A 3OYJA 3UKGA 3VSLA 3GEZA 2E2HJ 3TBIA 5IP6A 2CV1A 3ISXA 5AN9A 3JAMZ 3AVYA 4E7KA 3AVUA 1QA2A 3CZ6A 5J8CA 1VHOA 3K0LA 1SD4A 3FY3A 2EV6A 1W5TA 2K9NA 3BROA 1K4ZA 2GXGA 2OQRA 2Y9YA 4OJ5A 4RGUA 3DFGA 3M07A 3UNGC 4ZH4F 3ZR8X 3CLQA 3Q0UA 4RPDA 2GA2A 4RMNA 4AUXA 1IJFA 1U5TA 1P2FA 2Q6LA 4ETSA 3WTTC 1TQPA 4KDPA 4E6KG 2Q2EA 3ZCOA 2DA4A 2EFNA 1YRNB 1RESA 2XAUA 3FX3A 4E7LA 4MFDA 1SMYF 3BR2A 1RMGA 4HYEA 1J0RA 3GQ8A 1S9HA 3E20A 1QRBA 3S1RJ 5EZHA 3OZUA 3HKZN 1LFBA 2FUG2 1BN8A 2BEOA 3DBLB 1MMGA 1QZYA 5J1UA 2BZTA 2NVQJ 4X06A 4LITA 3RZDJ 4RB1A 3VWBA 3D5SC 2VOOA 2ZXWH 4XQFA 4RM3A 3E5XA 4ESBA 2F5EA 2XZPA 4G5GA 4ENKA 1R36A 2DMQA 2GJKA 1S4MA 1WOPA 1VF9A 4P1VA 2BX6A 2CRGA 2LD5A 4RD6A 1ZTRA 1G3YA 1OLTA 5HZBA 1E64A 2HOAA 1W36D 4P5OA 5M5YJ 4D5CA 1WPCA 1NB0A 2DCUA 5D8KB 3BTIA 4TMWA 2KZGA 2OCCH 4IHVA 2VOPA 2XB0X 2OC6A 3IAM2 3Q5FA 1VQ4B 4N4OB 1E63A 3C2GA 2YWFA 4L18B 1IZ1A 5C1EA 2BBYA 2LP0A 4IJAA 1IG7A 2R7TA 3HHHA 4EQQA 1GVJA 4YG2F 2RDPA 4NQWB 4ZTFA 2VBEA 3SEJA 1H80A 1H85A 3MKLA 1LLZA 4B4DA 3DTKA 4G1VA 3OYEA 3ZN1A 2JIZA 2VNJA 2WAQA 3H5AA 2HVQA 2IEKA 3I53A 2X0LA 4FXUA 5FO0A 2C5BA 3IKTA 2QTLA 5JHUA 4QLCU 3EQOA 5D4SA 3BTJA 1HW2A 4B3GA 1PP7U 2KZVA 2VKDA 2IS2A 1D8JA 3HTUA 5FRMA 1BI1A 2Z16A 2V7XA 4HX4A 1RI7A 2UZKA 3EYIA 3ZIAA 1D3YA 2L7MP 3PSFA 4V2FA 3BR3A 2WWYA 2IW5A 2Y69H 3GFIA 3KP4A 2WA0A 4M3DA 1ENHA 1SFXA 1G3WA 3LSJA 2B7EA 1SANA 4J0QA 1YHQB 4PZJA 2K9LA 4L5IA 2D3NA 2VB6A 2W4SA 4X8IA 2XASA 1VLYA 3BT9A 2R6HA 4S04A 3VSUA 1MSEC 4O5VA 3PSSA 3JCUC 1V0FA 5EDNA 3E97A 1ZLJA 4I0AA 1MDMA 1UMKA 2DODA 2KJCA 3F6VA 1VQKB 3CO7C 2QSGX 1X3WB 3ESWB 1T2KA 2K4JA 2CFXA 2DMTA 4P3YA 3WNBA 4X7EA 1X3UA 2IPQX 5LGTA 3NAUA 5D8LB 1ETVA 1WJ5A 2VQHA 2Y75A 4RA2A 2HQ5A 2GOMA 1FY7A 5E1XA 3I4NJ 3H3UA 3W6VA 4M6YA 4BQOA 4EJUA 2AHOA 1ZRCA 3CCJB 2V31A 4IQJA 4BPRA 3LJYA 4W97A 3WNDA 2NRAC 4FWTA 3E6MA 3CUQA 2ESHA 1ZHFA 2PG4A 3ZZTA 2BM4A 3HRUA 3AG4H 1D2EA 1Q81D 5EF6A 2VL8A 2BYVE 1VQKI 3AK5A 2VI6A 2QEXI 2NS7A 1FP2A 3HOXJ 3SDBA 1JUMA 2ZTNA 3GW2A 3KX2A 4FETA 4YEJA 1WPKA 1X3ZB 1JNYA 2HR3A 2DFHA 2O0VA 2CMPA 2R7QA 3GIRA 5ED4A 2QGGA 1AKHA 3G1LA 2W82A 3BR0A 1AIPA 2O1DA 3OS1A 2W25A 5ILVA 3CUQC 4B47A 4UHTA 4PJ0C 2ZL7A 1BPLA 1LDJA 4DIQA 1R23A 1XB4A 3ONUA 2VBWA 4AC9A 3QODA 2NOJB 4RAZA 3CCEI 4YAOA 2OUMA 4WCGA 4A3DJ 4LLNA 1H42A 2FMLA 2RV8A 2ZJPF 4IEJA 1WSRA 3OAAA 4PC2A 3CCLB 5H6QA 3PA1A 3TL4X 2DQRA 3F22A 1WXRA 2QM3A 1AHDP 2VODA 5FFXA 2V26A 3HPHA 4YZXA 2CO5A 1J9IA 4XN0A 4LJZF 5GTHC 1U2RA 4RD3A 5A8AA 2M4GA 4RGXA 2L4MA 2E60A 3KP5A 1BBYA 2DMNA 2JTVA 5EEHA 5A2QK 2GIZA 3WODF 2AQEA 1OCCH 3EUHC 2MLGA 3E1YE 3ZUGA 2H6CA 1EJ9A 3ZRGA 4B48A 1BHEA 3AFHA 3GTPJ 3MCAA 2QCOA 2B7CA 3VO2A 1TP4A 4JYKA 3OIOA 1QQ1A 1VBLA 4LMYA 3DKYA 2ZL5A 5D6FA 4MXNA 3VYSB 1L1IA 1YX3A 2LVSA 3PUNA 3FKSA 1Y0UA 1W2BB 4HLYA 4RD4A 3IHUA 2DA2A 4G94A 1OGIA 1LVAA 1PJ6A 1WQ2A 4YXWA 4CGZA 3V76A
chains in the Genus database with same CATH topology
1E79A 4BDZA 2W1OA 2F43A 5C1CA 2KLOA 4ZYAA 2F4IA 4KJZA 2NSPA 3LMWA 3UW0A 3T9GA 2WADA 5KNLA 4HWVA 3ONQA 5JHFA 3VYUB 4URRA 2JSPA 4BUPA 2XZOA 2KDOA 3S3MA 2HPMA 4PJNA 2I8DA 2M5SA 3KEWA 4GQNA 2QKMB 4JOMA 4C2UA 4HEA2 3T53B 3J7AY 1O8LA 2UUZA 4E4HA 4PSWA 2E5NA 2JVHA 2WAEA 3JURA 2JVGA 4CSWA 1OGMX 2AQFA 1WP6A 1O8FA 1OOCA 1P9QC 2CK3A 4AVZA 1MMAA 3CP8A 1V5EA 4XOPA 3BCDA 3K70C 3OE7A 4NK6A 4XONA 1FMVA 3VYRB 4XD7A 2NZMA 3MKWB 2O5RA 1G59A 1Z3YA 3HXLA 3M1CA 2MYSA 5CDFA 1MNDA 2XNDA 2UVFA 1Z21A 2XDVA 4DBRA 4OZYA 2XF5A 1N77A 4PJJA 2E5ZA 2V7FA 3VDXA 1X1BA 3L2UA 2JJ1A 4Z1MA 2QX3A 3OL4A 3WQZA 2UV1A 2BSPA 3H0DA 3LSMA 3GQAA 4BGDA 3OEEA 1IA5A 4IZZA 4N4NB 4U87A 3DPLC 4OZZA 1T95A 2LRDA 2VQLA 3K4NA 1QCXA 3LNNA 3EUAA 4H4KC 3G05A 4PK4A 2JDIA 2A6TA 3VMVA 3OYKA 1AA7A 2X6XA 2E1BA 2E1MC 2BVLA 4E7HA 4W8SA 1K5CA 2X53S 1X4PA 4QPQA 1E43A 3FHNA 4Y3OA 1OGOX 3OPOA 3OIQA 3NE5B 3BCBA 4DGWB 1O8EA 3K4JA 1QHGA 2ZZEA 3MKZA 5FL7A 4MLOA 2V4JC 4ITVA 2HPIA 2WJYA 5IK2A 2KRCA 4F3QA 1UD8A 5HNFA 3DDYA 2VIXA 3ZPNA 2Y0SA 3OYDA 1W9XA 2LY1A 2R7RA 2GK6A 4UZUA 2EWEA 3LSHA 1V0EA 3PNTA 3DKXA 3AKZA 3A3GA 5KCMA 2WY8Q 4XKBA 3K4KA 1LDKB 4BJTA 5HNHA 5HLTA 3HKZA 1K6YA 3OYGA 3SEZA 3HOSA 2IS4A 2R7UA 2KRHA 4BL0B 4J00A 1TT0A 4KKUA 3GQ9A 4KISA 3CF2A 3HPGA 1HVXA 2X6WA 4LIUA 2WZPP 1MABA 2HDWA 2Z1DA 1WMRA 2X51A 4J01A 2PYHA 3SYTA 3W2WA 3OS2A 3BCFA 3OOCA 1V5FA 2KMUA 4Z06A 2IS1A 4I84A 1WJBA 2ZSIB 4Y4RA 4BS9A 2CFOA 3V42A 4C9YA 3GQ7A 3H35A 4HSTA 1VJSA 1NG6A 2ZTGA 3ZGKA 2LBFB 1X19A 1PXZA 1EE6A 4YZQA 3BH4A 1EFRA 4PFOA 1E1RA 4BQNA 1UD6A 4C2LA 4DOZA 1D1AA 2LC2A 2LG4A 3W3CA 3ZQQA 1OFMA 2VXZA 4Y33A 4OJPA 2XF6A 4XLEA 3VMWA 3C2HA 5CPRB 3CJRB 4W8QA 2MABA 1OB0A 4XM3A 2V7QA 1MMNA 1GQ8A 2CW7A 3VYTB 2D3LA 4PFPA 3K4CA 4BE0A 2KP6A 1VF7A 4HRIA 3OMYA 2XOKA 2NT6A 1QU3A 4XNFA 3S32A 4U49A 1D0YA 3MKYB 3K4MA 3HOTA 4NC7A 2R7VA 2CUJA 4E7ZA 5LFAA 2QXZA 1PJRA 2X6YA 1W0JA 5AMVA 4CCMA 4XN3A 4LIVA 1Y56A 4DJAA 1O8DA 4CCLA 3DPTA 3S3NA 5HVQC 4XKVA 3PNVA 1DQUA 2JUGA 2UVEA 2DT6A 2IGKA 2RREA 3LMMA 4ZC3A 4BXFA 3HG9A 3RSNA 3H9QA 3QYFA 4DBQA 2VPLA 2XGJA 3IUOA 1X4OA 1BLIA 1UD5A 1X0CA 3K4BA 3H94A 1D0ZA 1KMHA 3BC8A 2LREA 2VASA 4B3XA 4B3FX 3ZXSA 2PMZA 1W36C 4EW9A 2X1DA 4DK1A 5LD2C 2VQCA 4R79A 2WJVA 1X1DA 4G7WA 4RLFA 4XORA 4XLAA 3A4CA 3H9GA 3GRHA 2LZJA 4NUBA 3N05A 1WTHD 1SFKA 2Z8GA 1JTAA 3E1SA 4B43A 1IDJA 1QJVA 4JQFA 2LH9A 1O8MA 1LFPA 4OJ6A 1RU4A 3FKJA 2PYGA 4HPQA 2WSSA 3PL8A 2L7KA 3VSVA 3DTIA 4C30A 3ZSCA 1O8KA 3RPUD 3L2RA 4CH7A 3LSGA 2RNGA 3HC7A 4X0GA 2IS6A 4HIZA 2X8KA 2KHMA 4XKCA 4TKOB 1DBGA 3OYBA 4LG3A 4CA0A 2VJ4A 4ZDOA 2O04A 1N78A 2HQAA 4PJMA 2INVA 1D0XA 2VJIA 3OR2C 3H9JA 3RQ4A 3U21A 2HU9A 1HA8A 1RWRA 2BOLA 3S93A 2IGNA 2OV7A 2Z2SB 4BJ6C 5KHDA 3OEHA 2BW3B 2F6CA 3K4LA 3F9KA 2CS3A 4QPOA 3GVKA 3H5NA 1PE9A 3NWSA 1N75A 3OYCA 2ZXHA 1KONA 3DU6A 4AU7A 3KYLA 1KZLA 2WPDA 2KQRA 3OFNA 1NG7A 1X1CA 3B4NA 1UAAA 4OAYA 2CV2A 2CUZA 2V1NA 4PMHA 2NTQA 3VSKA 2L9SA 5HKKA 4CZCA 2HVSA 2V9KA 1WFXA 3WWGA 2HNHA 2A5WA 2W6JA 2BW3A 2LYCA 2GK7A 3T56B 2ZZFA 2X1EA 4GRIA 4F55A 3BG7A 4AYBA 2PJRA 1COWA 4XLHA 2W6IA 3EQNA 3CJQB 3L2QA 4C2TA 3I9V2 2W7NA 1I18A 3BLYA 1WJCA 4II3A 4KKSA 4XLFA 4TT3A 2P0WA 2VQGA 2WAFA 2BVMA 2MD0A 3VR6A 1O8JA 5FROA 4OWRB 4HNTA 2CH0A 2K9MA 1XG2A 1W0KA 2DIEA 1YX5A 3QOEA 1T5EA 2V4DA 2DJIA 3OOUA 3OYLA 1IRXA 3NWTA 3OYJA 4KKTA 3VSLA 2E1MB 4BQQA 1HZEA 3TBIA 2Q1ZB 2CV1A 3MD2A 2M4KA 1UD4A 3LFUA 4E7KA 1OFLA 1DGRM 1O8GA 2Q2EB 2X1CA 3CZ6A 4PUSA 1D1CA 4PJLA 4U7BA 4KITB 3FY3A 1FX0A 3LL7A 1BR1A 5CQGA 4OJ5A 4IX7A 3UNGC 3A3BA 3ZR8X 1DBOA 5CKTA 1AIRA 1E3XA 4BU2A 1PKVA 4DNTB 4RMNA 3H5RA 3RCOA 1NBMA 1D1BA 2IGOA 1WJFA 4E6KG 3ZCOA 4CCOA 2K3PA 4NC8A 3PSIA 1H8EA 2XAUA 4E7LA 3A35A 2NTPA 4BEHA 1RMGA 1JI8A 1O88A 1PLUA 4CUGA 2GJRA 3GQ8A 1S9HA 3QYEA 4G6IA 3ZPPA 4D1QA 1HG8A 2X3HA 3OWTA 1O8IA 2XC7A 1CZFA 2HZDA 2FUG2 3LSIA 1BN8A 4Z03A 1EA3A 1MMGA 1UELB 4B44A 4L8JA 4CCJA 2R7WA 2KVOA 3OS0A 4LITA 1U0JA 3VWBA 3D5SC 3QYBA 4BE1A 4XQFA 1R6RA 2ODLA 4RM3A 1OHHA 2XZPA 1T0FC 4E7SA 4KT6A 2GJKA 1OLTA 2Z6BD 3TMOA 2NSTA 1Z7LA 1W36D 4XLCA 4ZJZA 4P5OA 4RLQA 3JU4A 3SUCA 3BCAA 2VLAA 1WPCA 3B90A 3RTRA 4XR6A 3EUKL 2W00A 4BEHB 4XMYA 4XL9A 4MR0A 2OC6A 3IAM2 3CESA 4N4OB 3C2GA 4EATA 3PNYA 5C1EA 2LBFA 2HLDA 4YZAA 4NK8A 2V6EA 2R7TA 4RM2A 3GVLA 4F91B 2M3AA 4NQWB 4ZTFA 2PECA 2VBEA 3S3OA 3PUBA 2QKLB 1H80A 4TSFA 2WBMA 3DTKA 4F93B 1UD3A 4ANJA 3OYEA 3AL0C 1E3ZA 3BC9A 2JIZA 2WY7Q 2VXDA 1ZELA 2WAQA 3H5AA 2HVQA 4FXUA 1SKYB 3K70D 1V5GA 4BJ5C 1H8HA 1GLNA 3EQOA 4B3GA 2KZVA 2VKDA 1E0EA 2VBMA 2IS2A 5FRMA 2LOOA 1BR2A 2Z16A 4HSRA 3SZGA 4CCKA 4ZTJA 1E1QA 2ELJA 2M7AA 3ZIAA 1J09A 1KTWA 4CCNA 4ASUA 3PSFA 2XZLA 2WA0A 2WB1A 4BDYA 1SAUA 1X1AA 2M0MA 4YZ0A 2GJPA 3UR3C 2JA2A 2K9LA 1Y6IA 1DGWY 4II2A 2D3NA 2VB6A 2QY1A 2W4SA 3VSUA 3PJRA 2R7XA 1VLYA 2VJ5A 2XF7A 1LVKA 4ZDPA 3GBGA 3FBNB 1MW7A 4IQ4A 3OYHA 2CV0A 1V0FA 3A1YA 1QHHD 1BR4A 2X85A 2M7BA 3OYFA 2HVRA 1FMWA 2VJJA 5FRNA 3OY9A 1VZ0A 4ZDLA 3KRGA 4OJLA 4OAZA 3S8PA 2R7OA 3HUGB 1MNEA 4E7IA 3FPPA 1NHCA 2ZXIA 2UWMA 4P22A 2QE7A 3KEYA 3M8JA 1WJ5A 4FASD 2VQHA 4DK0A 4G6TB 3CMMA 1UG0A 5HOOA 3T51B 2GOMA 2INUA 2L9NA 4HG2A 3OL3A 1BMFA 3K10A 4BQOA 4Z05A 2V31A 4F92B 4IQJA 2IXSA 4G7XA 3FBIB 4OJOA 3GQBA 4D9JA 2DT7B 2VKHA 3IAS2 3A2KA 1IB4A 3IP4B 3GVJA 2F5VA 2NTBA 3D5RC 2VL8A 4E7JA 2ZZQA 3CP2A 2KL4A 1WJEA 2L5QA 3DEEA 4F52A 2ZTNA 3SDBA 1JRGA 3KX2A 3MMYB 2R4GA 4FETA 1LKXA 4YEJA 1DP3A 2ZZGA 3G2BA 2CMPA 1BOBA 2O0VA 3L2VA 1PYVA 2R7QA 2DOAA 1TZLA 1WJAA 2O1DA 2W82A 3VSTA 1KCDA 3OS1A 3SEQA 2RQQA 2R7SA 2DXIA 4PSXA 2JJ2A 4B47A 2GOXB 1BPLA 1O8HA 3OYIA 4DIQA 4YRVA 4E0FA 3L2WA 3QODA 2NOJB 3OYNA 1UD2A 3PFYA 2OUMA 3DLAA 4IKFA 4JMQA 3AL0B 3DWLE 3OR1C 1OR7C 2LY2A 3OAAA 3TL4X 4HNUA 3HL2A 1Z3XA 3DPUA 1WJDA 3OYMA 3DQVC 2F1MA 3W2VA 2IQ7A 2V26A 3HPHA 3I3LA 3D5LA 3K6GA 4XKWA 4BACA 4XN0A 2CW8A 4YZXA 1MMDA 3HAGA 3OYAA 4W8TA 3E0JB 5DN6A 2M4GA 3B8YA 2K5CA 2E60A 2ZSHB 2DCEA 2L2OA 3OIPA 1ERDA 4NNJA 5TGTA 1NRKA 1IDKA 2VBKA 4YELA 4BE2A 4DNRB 4U4BA 2PJRB 2AQEA 3EUHC 1BHEA 5CQEA 3ZRGA 4B48A 3AFHA 3W2AA 3OW7A 1I8DA 1G8XA 4P1WA 1KCCA 2IGMA 3DU5A 4XOTA 1VBLA 3EPZA 3DKYA 2NT9A 4MXNA 3BG6A 3VYSB 2MFZA 3LSKA 2ZFUA 3DTEA 1YX3A 3FDYA 3FKSA 2O17A 1K28D 2KPMA 2XSJC 2MC4A 4W8RA 2O0WA 4YXWA 2R9VA 1YE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2L A;  5C1C A;  2VBM A;  4XLH A;  2NSP A;  3EQN A;  3LMW A;  1OFM A;  3UW0 A;  3T9G A;  4OJP A;  4XLE A;  4HWV A;  3VMW A;  1KTW A;  4XLF A;  4W8Q A;  4URR A;  4XM3 A;  1GQ8 A;  1O8J A;  4YZ0 A;  2NT6 A;  1XG2 A;  4XNF A;  4U49 A;  1O8L A;  2QY1 A;  3VSU A;  2QXZ A;  3JUR A;  1OGM X;  2X6Y A;  5AMV A;  1O8F A;  1OOC A;  4XN3 A;  2X85 A;  4AVZ A;  1O8D A;  1OFL A;  4XOP A;  1O8G A;  2VJJ A;  4XON A;  4XKV A;  4NK6 A;  2NZM A;  3KRG A;  4OJL A;  2UVE A;  3FY3 A;  1NHC A;  2UVF A;  4OJ5 A;  4OZY A;  1DBO A;  2INU A;  1AIR A;  1X0C A;  2QX3 A;  4Z05 A;  2BSP A;  3GQA A;  1IA5 A;  4OJO A;  4OZZ A;  1IB4 A;  4EW9 A;  2NTP A;  1QCX A;  2NTB A;  1RMG A;  1O88 A;  3GQ8 A;  1PLU A;  3VMV A;  2X6X A;  4XOR A;  4XLA A;  3GRH A;  4W8S A;  1HG8 A;  2X3H A;  3ZPP A;  1JRG A;  2Z8G A;  1JTA A;  4YEJ A;  1O8I A;  2O0V A;  1K5C A;  1CZF A;  1QJV A;  1OGO X;  1BN8 A;  4Z03 A;  1O8M A;  2O1D A;  3VST A;  1KCD A;  4OJ6 A;  1RU4 A;  2PYG A;  1O8E A;  4XQF A;  1O8H A;  3VSV A;  2ODL A;  1IDJ A;  3ZSC A;  1O8K A;  2EWE A;  4YZQ A;  1DBG A;  2NST A;  4XLC A;  2O04 A;  3SUC A;  2INV A;  2IQ7 A;  2VJI A;  3B90 A;  4YZX A;  4XR6 A;  4XKW A;  4XN0 A;  1RWR A;  4XMY A;  4W8T A;  4XL9 A;  4MR0 A;  3GQ9 A;  3B8Y A;  1PE9 A;  5C1E A;  1IDK A;  2VBK A;  2X6W A;  4YEL A;  4YZA A;  4U4B A;  4NK8 A;  1BHE A;  1WMR A;  2PYH A;  3B4N A;  2PEC A;  2VBE A;  4PMH A;  2NTQ A;  1KCC A;  1H80 A;  1VBL A;  4XOT A;  2NT9 A;  4Z06 A;  4MXN A;  3WWG A;  4I84 A;  2O17 A;  3GQ7 A;  4W8R A;  2O0W A;  1PXZ A;  1EE6 A;  3EQO A; 
#chains in the Genus database with same CATH topology
 5ILU A;  1VQ8 B;  2PMZ N;  2DU9 A;  2QQ9 A;  1U9O A;  4BDZ A;  1GAQ A;  2XNJ A;  2KLO A;  3QE2 A;  4ZYA A;  1GVH A;  5C1C A;  1VHE A;  2L4A A;  3JX8 A;  3KP3 A;  2ZC2 A;  2HOT A;  3FKI J;  3GUD A;  3OV8 A;  2D2W A;  4JX5 A;  1R1U A;  2HQN A;  2XUB A;  3KP2 A;  4L9V A;  3VYU B;  3N97 A;  4KNY A;  1ETQ A;  2D9R A;  2KDO A;  5EZG A;  2NAZ A;  2XGD A;  3O3K A;  3QRF F;  2GRE A;  2I8D A;  3KFW X;  1YRN A;  3KEW A;  5EMN A;  2QKM B;  3TP0 A;  4ZZD A;  4C2U A;  2WB1 N;  1OFD A;  1R5G A;  1O8L A;  2UUZ A;  1LQ1 A;  2XTY A;  2JVH A;  4FX0 A;  3JUR A;  2XAF A;  1JJ2 B;  3BCD A;  3RKQ A;  3K70 C;  4Z4Z A;  4CYD A;  4Y52 J;  5E17 F;  4XON A;  3OE7 A;  5H20 A;  2O5R A;  3JRA A;  5EYR A;  4KA4 A;  1KU3 A;  3CCY A;  1Y8R B;  4RS8 A;  4PC1 A;  4OZY A;  2DI3 A;  3HEF A;  4KIB A;  1MBJ A;  4M9S A;  3ZN0 A;  4KH3 A;  5J4V A;  4OMY A;  2JJ1 A;  3Q9S A;  3CLO A;  3P9I A;  4OPW A;  4YFX F;  3WQZ A;  4A6E A;  5E3N A;  2BSP A;  1EH7 A;  3GQA A;  2V9V A;  2Z3Y A;  4BGD A;  1EP1 B;  2VBY A;  2BGJ A;  4OZZ A;  1BX0 A;  1T95 A;  5B6I A;  2EB7 A;  2VQL A;  1SD7 A;  2EFQ A;  3GME A;  1QBJ A;  1FT9 A;  3I4P A;  2L9R A;  2OA4 A;  2G7H A;  3EUA A;  1VQ7 I;  1M1E B;  2EQR A;  3MN2 A;  2V1U A;  2FVG A;  4Y7C A;  3QU6 A;  1R58 A;  2X6X A;  3OYK A;  2E1M C;  2L01 A;  3IH2 A;  2E1B A;  3CDH A;  1U8R A;  2PI0 A;  2EIX A;  3S2W A;  1X4P A;  4QPQ A;  1OCR H;  3FHN A;  4BHC A;  5BSY A;  4M3G A;  1OIS A;  3GTJ J;  3GLL A;  4X7D A;  3PSZ A;  2M87 A;  1S72 I;  4CZZ A;  1VND A;  3CCR B;  1O8E A;  2DTZ A;  4CQJ A;  5DNS A;  4BBR J;  5FL7 A;  5M3F J;  4KYW A;  3BWG A;  4EM2 A;  5FLM J;  2KRC A;  1LNW A;  4EJO A;  3HTS B;  1ZK8 A;  1S7E A;  3OYD A;  1T0F A;  3I59 B;  4ESJ A;  3CCU I;  3JQP A;  3R6S A;  5FD6 A;  3A0B C;  1V0E A;  2BM0 A;  4KN4 X;  3DKX A;  3FXO A;  3AKZ A;  3COA C;  3A3G A;  2WY8 Q;  4ENN A;  4WZE A;  1FND A;  1FJL A;  2R7U A;  5CLS A;  2KRH A;  4KMU X;  3V8K A;  3OJX A;  1Q9S A;  1TT0 A;  1LLW A;  2XV4 S;  4KKU A;  4HNV A;  2HCJ B;  5HS8 A;  4DYQ A;  2OBS A;  3MQ0 A;  1Z0X A;  3LQQ A;  5BS6 A;  3WHC A;  1WMR A;  1W5S A;  4N9I A;  4GYG A;  4Z2Y A;  2QTZ A;  3BCF A;  3OOC A;  1V5F A;  5ILS A;  2Y0M A;  1M1K D;  3SZP A;  1UCR A;  2F5C A;  1DDI A;  2Z99 A;  5DCM B;  2CFO A;  2O03 A;  3V42 A;  4C9Y A;  4CDG A;  1K73 D;  1QRC A;  3H35 A;  2EFG A;  2ZTG A;  2R7D A;  1X19 A;  2LBF B;  5B1B H;  3I4M J;  1JE8 A;  2YWG A;  3G6E I;  3KET A;  4PFO A;  1EFR A;  4BQN A;  4C2L A;  3HUG A;  4IRI A;  3HOW J;  1OFM A;  1YIJ B;  4HX8 A;  5IYQ A;  2VXZ A;  1ON2 A;  4XLE A;  1IHM A;  1R5N A;  4JK1 X;  5K5Q A;  1OFC X;  2MAB A;  1I3A A;  3ZZU A;  4XM3 A;  1MMN A;  3BG9 A;  1J5Y A;  2BHY A;  3F23 A;  4H0E A;  2KIQ A;  4BE0 A;  3K4C A;  1FDR A;  2KP6 A;  3V7R A;  1GJR A;  2NT6 A;  3OMY A;  1HF2 A;  1YX2 A;  2DFF A;  2DW4 A;  2QWW A;  3BZC A;  5K7H A;  1WDT A;  4G7O F;  4JP0 A;  3MKY B;  3K4M A;  3U1K A;  2R7V A;  4NC7 A;  4E7Z A;  5LFA A;  2O6W A;  3AG3 H;  2K02 A;  2DPU A;  3U1D A;  4U0V A;  1YHQ I;  3BH7 B;  3B6A A;  3CCL I;  4XKV A;  3PNV A;  4N9H A;  4DQ2 A;  2UXX A;  1XN7 A;  3CMA I;  1UJ8 A;  3ZPL A;  1KZH A;  2DT6 A;  2HDN B;  2PE3 A;  2IGK A;  3GCM A;  3LMM A;  4BXF A;  1ZM3 A;  5EGO B;  5E8I A;  2XGJ A;  3MHP A;  4PC6 A;  3KZI C;  2OU2 A;  3M1E A;  2UXN A;  3IUO A;  4PAA A;  1AMO A;  3P27 A;  1UD5 A;  1X0C A;  2XHK A;  5J6X A;  1E17 A;  4CYC A;  5J1Y A;  1BN5 A;  4ZYD A;  1A04 A;  2DYI A;  1GXQ A;  2XEX A;  4O3M A;  4GO1 A;  5FLX K;  2VAS A;  4B3X A;  1J75 A;  4I99 C;  3ZXS A;  3P5J A;  2JA8 J;  4UVA A;  4HDU A;  2A68 F;  5JVG F;  4DK1 A;  1JXS A;  5FO5 A;  1CF7 B;  3M8F A;  3WHB A;  2WYR A;  4DW6 A;  2FSW A;  4P9S A;  4XOR A;  1DAR A;  1IRZ A;  3GRH A;  1E3H A;  3N05 A;  3QPT A;  3E1S A;  4IPA A;  1YLO A;  3BY1 A;  1QJV A;  3J80 Z;  2BM5 A;  1T6X A;  5L3B A;  1JKO C;  1L0O C;  3SFI A;  5FO1 A;  3K7A J;  4OJ6 A;  2L02 A;  3P7N A;  3CC7 I;  4OIR F;  4OPS A;  4OIO F;  2MSY A;  2YS9 A;  1ZRF A;  1DPU A;  2X3U A;  4UZF A;  1X1P A;  5GAH J;  1CNF A;  1IB0 A;  3WBK A;  1JUS A;  4RDK A;  2RNG A;  4L9J A;  4A3L J;  3FXM A;  2FBH A;  3FXQ A;  4XKC A;  2ETH A;  3HGG A;  4EVI A;  5M5W J;  1PVE A;  4CA0 A;  2R3S A;  1SAX A;  4ZDO A;  3ASR A;  2F5D A;  2O04 A;  1R00 A;  3M8E A;  2VJI A;  3OR2 C;  2Q0O A;  2MA3 A;  4OU0 A;  1RWR A;  2Z2S B;  2CWE A;  3A8I A;  1O3R A;  1MKM A;  2CS3 A;  3K4L A;  4HDV A;  4Y15 A;  1YJ9 I;  3GVK A;  2GQQ A;  2V9P A;  3H5N A;  3S1N J;  3LYC A;  3OYC A;  2ZXH A;  3DU6 A;  3VOD A;  4AU7 A;  2XKO A;  4QTR A;  1NG7 A;  2G7U A;  3IH4 A;  3GVA A;  3RIR A;  5A88 A;  3B4N A;  3CPX A;  1SFE A;  2XTX A;  3R6J A;  5HKK A;  1BA5 A;  4CZC A;  5LHH A;  2ISY A;  2V9K A;  5M5X J;  3WWG A;  1TQM A;  4ACA A;  1WWX A;  2HMA A;  2Z9O A;  3FIS A;  2BW3 A;  3ZMS A;  4RAY A;  4LFU A;  1GAW A;  2X1E A;  1D5V A;  4GRI A;  3C18 A;  4KIC A;  1COW A;  3P26 A;  2QQA A;  5FB2 A;  4XLH A;  2W6I A;  2BVN A;  3EQN A;  1MBG A;  5C4X J;  2FF4 A;  3EYY A;  1WVR A;  2RVC A;  3LFK A;  4II3 A;  1K6O A;  1TC3 C;  3CC2 I;  4TT3 A;  1XCV A;  1G6N A;  2DA1 A;  3TW7 A;  2WAF A;  2M8G X;  4B4C A;  2EZL A;  4QSH A;  4FTH A;  2CH0 A;  4EJV A;  3GLX A;  3A01 B;  4S0H B;  1A5J A;  4WXD A;  3CC2 B;  1MRZ A;  3HSF A;  3RYP A;  4BHB A;  5DD4 A;  1RUO A;  2BM1 A;  2P7C B;  3OOU A;  5IY5 H;  5KVR A;  3ECO A;  5L3C A;  3F21 A;  2YWH A;  1YS6 A;  4FT8 A;  4BQQ A;  3JRE A;  1BJZ A;  1EKE A;  3MD2 A;  4OOI A;  4UUS B;  1DU0 A;  2M4K A;  4A3C J;  1FEX A;  3SLD A;  1DGR M;  2MLK A;  1O8G A;  2Q2E B;  3AVW A;  1D1C A;  2QF7 A;  4PJL A;  1F43 A;  4DNC A;  1SEU A;  5H2F C;  3B8H A;  2BE5 F;  2VT2 A;  1FTT A;  1LUJ B;  1RR8 C;  1FX0 A;  1BR1 A;  4IL6 C;  2EV0 A;  1IXC A;  2WTE A;  4A3E J;  2E7X A;  4XRS G;  1BIB A;  5DD8 A;  1E3X A;  3CW2 A;  3KZZ A;  3ELK A;  1ZG5 A;  4DNT B;  2DK8 A;  5E3L A;  4ZV4 A;  2P6S A;  1B23 P;  2VPR A;  2E1R A;  3DCF A;  1LM1 A;  1IXR C;  1BM9 A;  2PJP A;  2K3P A;  3BTC A;  4NC8 A;  4A0X A;  2Q6I A;  5E6T A;  3IH3 A;  2IOU G;  4L5E A;  4U88 A;  2NVU B;  1L3L A;  4BAY A;  4LG0 B;  1O57 A;  4HLX A;  4EM0 B;  3JRG A;  4M6X A;  3QPL A;  2GJR A;  1A36 A;  4G6I A;  3ZPP A;  2XPV A;  4D1Q A;  3W2F A;  1HG8 A;  2DFE A;  2MG4 A;  2OQG A;  3H1C A;  1V55 H;  4Z4U A;  1O8I A;  1QA1 A;  1MH3 A;  2XC7 A;  1CZF A;  2HZD A;  3LSI A;  4Z03 A;  5CVR A;  5JBQ A;  2NYX A;  1EA3 A;  4DZJ A;  1UEL B;  1I50 J;  3MCZ A;  4CCJ A;  2KVO A;  2D45 A;  2RNJ A;  3B6C A;  3FHZ A;  3A8K A;  4BE1 A;  3HJE A;  2L3D A;  3WNC A;  1JA0 A;  1OHH A;  4A5N A;  4LLL A;  4E7S A;  2P8T A;  3RI4 A;  2PQ8 A;  1VTN C;  3H3Z A;  1VQ5 B;  3GZ5 A;  2I1L A;  3TMO A;  2BY0 A;  3ZMV A;  2NST A;  1Z7L A;  2GAU A;  1N08 A;  2VLA A;  3AG1 H;  3BQY A;  4FIS A;  2ZO4 A;  4XR6 A;  4UUT A;  3RTR A;  4YFK F;  1QFY A;  1I3Q J;  1R1V A;  4LLG F;  5EG0 B;  1FZP B;  3N4M A;  4XL9 A;  1W0U A;  1XG1 A;  1MNM C;  3CES A;  2ME0 A;  4NBQ A;  1JHH A;  3K2Z A;  1KQ9 A;  1GR1 A;  4YZA A;  4NB5 A;  5GTI C;  3C1D A;  2AS5 F;  4RM2 A;  3PO2 J;  4F91 B;  2M3A A;  1QX4 A;  1B6A A;  2EFO A;  1WCM J;  5E1W A;  4X1E A;  5EEG A;  2FBK A;  4YII A;  3H0G J;  2WY7 Q;  2VXD A;  1POG A;  1ZEL A;  2ZNY A;  2BXZ A;  2GPJ A;  5KAI C;  4IOA F;  2NV4 A;  4X05 A;  4B09 A;  3ZQI A;  1H8H A;  1F1Z A;  4F7Z A;  2Q8K A;  1YLF A;  1Z1D A;  3FJO A;  3J80 K;  2VBM A;  3ZC3 A;  2W24 A;  3CDI A;  3PQK A;  1BW5 A;  1QUE A;  5B66 C;  4WX9 A;  2LOO A;  4HSR A;  1E1Q A;  5BPI A;  2E35 A;  2M7A A;  1KTW A;  1TL8 A;  4CCN A;  3CQZ J;  4IHT A;  2OTJ I;  4ASU A;  3SDG A;  4B3A A;  2HTJ A;  5ICC A;  3ABT A;  3LSR A;  1Y1W J;  3PEN A;  2XZL A;  5DM6 F;  4M2L A;  3GTK J;  4HW0 A;  3TO9 A;  4CXF A;  2ACJ A;  1KA8 A;  4YZ0 A;  1IN4 A;  4D7M A;  2O8X A;  2GJP A;  2CW0 F;  1S8N A;  2ECC A;  1R5B A;  2Y2Z A;  2JA2 A;  2JSC A;  3ASN H;  4I0B A;  4II2 A;  4NDL A;  2QA4 B;  4ESF A;  5LBQ A;  3JQQ A;  4HZF A;  1FYL A;  5CJ9 A;  2ZME B;  2P5V A;  1QA3 A;  2XF7 A;  1J2X A;  1MW7 A;  3CCM B;  4FN5 A;  1QO0 D;  3A1Y A;  4LBV A;  1OCZ H;  1VQ5 I;  6PAX A;  4G1B A;  3LA7 A;  4G7Z F;  1ELO A;  2ZCW A;  1X2M A;  3OY9 A;  1FOK A;  4QHY A;  3S8P A;  2DMP A;  2R7O A;  3W5H A;  5FA6 A;  2OTJ B;  3ABL H;  4FQG A;  4MNU A;  2QSF X;  2ZXI A;  2EIK H;  3M8J A;  4FAS D;  1YTY A;  2RN7 A;  4ZYG A;  4BQA A;  4G6T B;  5HOO A;  5FGM A;  5E3O A;  4LB6 B;  4HG2 A;  3OL3 A;  3QP5 A;  1ZG1 A;  4HF1 A;  1BMF A;  3K10 A;  4Z05 A;  2ZJR F;  3GZN B;  1UMQ A;  1XB2 A;  2NNY A;  4G7X A;  3WXM A;  2IAI A;  2BY1 A;  4D9J A;  1HW1 A;  3L1P A;  2VKH A;  4WWV A;  3IAS 2;  1IB4 A;  1U2W A;  3MWM A;  3GVJ A;  4BYY A;  4Q4Z F;  1U9N A;  4E7J A;  1R9T J;  1U3E M;  2CBX A;  2KL4 A;  2L5Q A;  3DEE A;  1FOW A;  1HQC A;  3G1M A;  2DDA A;  1WH5 A;  1EA0 A;  1YIJ I;  2R4G A;  1DP3 A;  2MD5 A;  3G3Z A;  1J9Z A;  4X7F A;  1IGN A;  3L2V A;  1PYV A;  4A3I J;  2DOA A;  1TZL A;  5IP9 J;  2PMD A;  1KCD A;  3F3X A;  3R61 A;  2E1C A;  4V02 C;  4M9X A;  4M4S A;  2XAJ A;  3VPR A;  2JJ2 A;  4TMZ A;  3HSE A;  1JKP C;  1KK1 A;  1V4R A;  2KRF A;  2M8E A;  4UUS A;  1UD2 A;  2BXY A;  5IYB J;  3PIO F;  4IKF A;  2BF4 A;  2ZL6 A;  4JMQ A;  3AL0 B;  1YJW B;  3OR1 C;  2LY2 A;  5AON A;  5EJC A;  1R22 A;  3S1M J;  2LLK A;  1MH4 A;  1Z3X A;  1WJD A;  3K1P A;  1U5T C;  5GP9 A;  2P6T A;  3OYM A;  5HS7 A;  5BPD A;  3I3L A;  4ASN A;  3D5L A;  2WZN A;  3G6E B;  1RIO H;  4WXH A;  5FJ8 J;  3E0J B;  3B8Y A;  4AF6 A;  2YSR A;  1LEA A;  1NRK A;  1IDK A;  3AGQ A;  4YFN F;  4BKX A;  3CO6 C;  2PJR B;  4GFB A;  1KD1 D;  2NVX J;  5LGU A;  1ETW A;  3BJ6 A;  3OW7 A;  2K9S A;  3ABU A;  3R4K A;  1I8D A;  3BPX A;  4CO8 A;  2A61 A;  4P1W A;  2QQB A;  4TSF A;  2NT9 A;  4XOT A;  3EPZ A;  1SVL A;  2O9L A;  3BG6 A;  2JT1 A;  2MFZ A;  3L7W A;  3LSK A;  2ZFU A;  4X07 A;  2QVO A;  2OTL B;  2O17 A;  1K28 D;  3W6K B;  2KPM A;  2XSJ C;  1LE8 A;  3JRC A;  4IHS A;  5J8F A;  2O0W A;  1WU8 A;  4RB3 C;  3ES9 A;  3DEU A;  2W1O A;  1VQ8 I;  1QG0 A;  2F4N A;  1BC8 C;  5HDN A;  3LMW A;  3UW0 A;  2R7Z J;  3T9G A;  5KNL A;  2DPD A;  4YC5 A;  5JMC B;  3H09 A;  1APL C;  1ZQ3 P;  3I56 B;  1MBK A;  2MGQ A;  3GFM A;  4PAB A;  2HQR A;  1CNE A;  1TNS A;  1Z67 A;  1IUF A;  1J59 A;  2FRH A;  4G6Q A;  2M5S A;  2HYJ A;  1G7T A;  2C5H A;  2EFW A;  3L9F A;  3BP8 A;  4ZGN B;  1KQ0 A;  4J19 A;  4E4H A;  2DBB A;  2E5N A;  4UVB A;  2FX3 A;  1YG2 A;  4IHY A;  1QVG B;  5E18 F;  1KYZ A;  1KU2 A;  5GPC A;  1MSF C;  3CP8 A;  1V5E A;  1DP7 P;  2JPB A;  1QPI A;  1FMV A;  3VYR B;  4XD7 A;  3MKW B;  1G59 A;  2BHZ A;  3GF2 A;  1XD7 A;  2NS8 A;  3HXL A;  2YWE A;  2MYS A;  4IRH A;  3DBR B;  1FRQ A;  2XND A;  4ROX A;  2D5V A;  4M3B A;  1FYM A;  2XDV A;  4ON0 A;  1QVT A;  3IRQ A;  4GGG A;  2K86 A;  5CVJ A;  5GAD J;  1KGS A;  5BMZ A;  2E5Z A;  3VDX A;  3L2U A;  1X1B A;  1VLO A;  3A03 A;  1XGS A;  3OL4 A;  1GO2 A;  3H0D A;  2VC1 A;  2DA5 A;  3LSM A;  3Q9V A;  4RD0 A;  3OEE A;  1IA5 A;  1MGT A;  4N4N B;  4IZZ A;  1SM4 A;  5FD5 A;  2R93 J;  2HOS A;  2M34 A;  1FOX A;  2A3S A;  2JA5 J;  5L3D A;  3G05 A;  5GV7 A;  2A6T A;  4E7H A;  4FK8 A;  2ELK A;  5IOY A;  4K1X A;  4P6V F;  4MTE A;  1TQI A;  5HLH A;  2EH3 A;  3OPO A;  3TO6 A;  4TV7 A;  1I5Z A;  1UFM A;  1FBS A;  3BZK A;  4ZZL A;  1OYY A;  1QHG A;  3K4J A;  4EEF G;  1TLH B;  2ZZE A;  1OCT C;  4Y7N J;  1W7P B;  2CUF A;  1WH7 A;  2V4J C;  1HC8 A;  2HPI A;  2XAQ A;  4C0S A;  2IVM A;  3EET A;  1UD8 A;  5F0F A;  5HNF A;  1IXS B;  3ZPN A;  1DBG A;  1W0T A;  3C3W A;  2L7F P;  1I1G A;  2Y0S A;  1W87 A;  1Z91 A;  4UZU A;  2XC1 A;  1YI2 I;  4P25 A;  2CYY A;  2BY2 A;  3RDI A;  3BTL A;  3MMP A;  4BL0 B;  2DDB A;  2KIM A;  4J00 A;  4P2N A;  5F04 A;  3VB2 A;  3GQ9 A;  2Q6K A;  4BY7 J;  4KIS A;  1FBQ A;  1K78 B;  2F4O B;  4Z4R A;  2X6W A;  4LIU A;  5FNZ A;  1E3P A;  4OIN F;  3EDP A;  2MW8 A;  2Z1D A;  4LK1 F;  4PGO A;  3K1M A;  3AGP A;  3H9N A;  5C3E J;  2VBU A;  2KMU A;  3R6K A;  4Z06 A;  1ZKG A;  2HOE A;  1T98 A;  3GTQ J;  5DYM A;  1YIO A;  2ZSI B;  3J7A O;  1WZ2 A;  2XGE A;  1P7J A;  4HST A;  2HDD A;  4B1R A;  3ZGK A;  1NK2 P;  1YIT B;  3F8N A;  2IA2 A;  5E8G A;  1ITY A;  5J35 A;  2BSA A;  2EIM H;  3FXR A;  3G73 A;  1PUE E;  3I1F A;  3CD6 B;  1V5V A;  3VMW A;  2BV6 A;  3C2H A;  3CJR B;  1MIJ A;  5F4J A;  4W8Q A;  1RZ4 A;  2FXA A;  1GQ8 A;  3WGH A;  4MIM A;  1XMX A;  2D3L A;  2DN0 A;  4PFP A;  1K78 A;  1CGP A;  1VF7 A;  3BG3 A;  1TYV A;  2R5Y B;  2XOK A;  3FZV A;  4KT5 C;  1TWH J;  4KIF A;  1QU3 A;  3ASQ A;  4IF4 A;  2H8R A;  5FIU A;  1KQ5 A;  1D0Y A;  4R71 A;  1DUX C;  3Q3S A;  1PP8 F;  2CJJ A;  2LFB A;  1PJR A;  2HS5 A;  4Z4S A;  1R4N B;  3WBJ A;  5AMV A;  1TYW A;  1STZ A;  4XN3 A;  1Y1V J;  4LIV A;  2X4H A;  1O8D A;  4OOV A;  3FM3 A;  4S05 A;  1JTY A;  3VNU A;  3ZQC A;  4IVN A;  4M72 A;  2MH2 A;  2H8W A;  2O7O A;  3E3V A;  1Z9C A;  2J5O A;  2YX4 A;  4G7H F;  2J7K A;  2OBR A;  3RYR A;  2DK5 A;  3H9Q A;  1CF7 A;  2VPL A;  2HEO A;  3FK6 A;  1G7R A;  2LKS A;  2A6H F;  3CC4 I;  5IT3 A;  5DS0 A;  3H3V K;  4G9Y A;  3H94 A;  2F5F A;  1D0Z A;  1VQ9 B;  1XC5 A;  2ZBU A;  3BC8 A;  2LRE A;  1WSU A;  1BOA A;  1IRF A;  3FPK A;  2FE3 A;  2PMZ A;  4MHG A;  1W36 C;  2BM6 A;  1AWC A;  1WOS A;  2X1D A;  1S6L A;  3ML6 A;  2M5W A;  5D5X B;  2D1H A;  4U0Y A;  1XDS A;  3OZW A;  3HM5 A;  4M1K A;  1WSV A;  1YJ9 B;  3A4C A;  2FA5 A;  2W57 A;  4NUB A;  2LZJ A;  4P6Y A;  2Z8G A;  2F1L A;  4DQL A;  2E2J J;  4M73 A;  4HV5 A;  5LHG A;  2WV1 A;  4RD2 A;  1LFP A;  2O6G E;  3Q39 A;  2PYG A;  1HF0 A;  2JA6 J;  5J3L A;  4ABZ A;  2RC6 A;  1VFC A;  1QNT A;  5GAE J;  3DTI A;  2VNK A;  1QQI A;  2BGI A;  3LQ6 A;  1E2X A;  3RKY A;  3RPU D;  4CH7 A;  9ANT A;  2OBT A;  3ZMZ A;  2YPR A;  5M3M J;  1SD6 A;  2PN6 A;  2IS6 A;  3GTL J;  1MBE A;  1KK0 A;  1YS7 A;  4HIZ A;  2KHM A;  2OYN A;  4XLN F;  1OYW A;  4LG3 A;  3CCM I;  2VJ4 A;  1VQ9 I;  5K7Z A;  3QFS A;  2Y31 A;  3CUQ B;  4P26 A;  4HV6 A;  1IN7 A;  3QAH A;  2QBY B;  3S93 A;  5TRD A;  3PQJ A;  2HZT A;  2BW3 B;  2R5Z B;  3EUH A;  4QPO A;  4NQW A;  1N75 A;  2H1L A;  3ZP5 A;  3O8H A;  4LC0 A;  4OOX A;  1ZG3 A;  3OFN A;  2EIJ H;  1HCR A;  4PC7 A;  1P4W A;  5IYC J;  3LNQ A;  4OAY A;  4K2E A;  3GXO A;  1RET A;  1ZRE A;  3ECH A;  2STT A;  3VSK A;  2L9S A;  1FC3 A;  2BPO A;  3OP1 A;  5IYP A;  5GV8 A;  1WFX A;  1MBF A;  2KDZ A;  3CCV I;  3FXU A;  2QLZ A;  2LYC A;  3QU3 A;  4RPB A;  3FIW A;  3W5V A;  2ZZF A;  2QQ8 A;  4ACB A;  4AYB A;  3IWF A;  2PJR A;  2QDX A;  1A6Q A;  4RLZ A;  1VQP I;  2P5L C;  2CW5 A;  2V1X A;  3KIO A;  3BQJ A;  3L2Q A;  4C2T A;  1KJZ A;  4MGR A;  2W7N A;  3U6B A;  3BLY A;  2H09 A;  2FNP A;  3ZZ0 A;  5E3M A;  3U2Q A;  4RDL A;  3TQN A;  4BY1 J;  1ZAO A;  1ZRD A;  3VR6 A;  1O8J A;  3LAJ A;  3GFJ A;  1F4K A;  4OWR B;  1DG1 G;  4Y13 A;  1XG2 A;  1R71 A;  5CVV A;  4A0Y A;  2A07 F;  2H27 A;  1VQO I;  2CF4 A;  5IYD J;  3VNV A;  1Y0N A;  2Z5U A;  1D5Y A;  1G2H A;  1QVU A;  2E1M B;  2COB A;  3WGI A;  1HZE A;  1XSX A;  3OZV A;  2KJB A;  5LRR A;  3TP3 A;  2K9Q A;  3WTV C;  4A69 C;  3K9T A;  1FNM A;  2J5P A;  4PUS A;  4RB0 A;  3F8B A;  4BBS J;  3KZY A;  1TBX A;  5IT9 K;  1HKQ A;  3LL7 A;  4WZT A;  3IRR A;  1Z6R A;  4HOB A;  2V5I A;  2OBP A;  3U2R A;  3O2P E;  3A3B A;  1G4D A;  2DJN A;  3EQL F;  5CKT A;  3CB4 A;  4BU2 A;  2FJ1 A;  3CCS B;  2E2I J;  1HST A;  3H5R A;  1LDD A;  3DF8 A;  3RCO A;  2DMU A;  5BSX A;  3RPU A;  4ENJ A;  2C6Y A;  2W48 A;  1RUN A;  3PSI A;  2XKP A;  2NTP A;  3CCQ B;  3FMQ A;  1J7K A;  3TKY A;  3CF5 F;  3M4O J;  1Q7Y D;  1N25 A;  2B7B A;  3B02 A;  4PCQ A;  1JI8 A;  1O88 A;  1S7O A;  4CUG A;  2E7W A;  1R7J A;  4BH9 A;  1JGS A;  2X3H A;  5LRS A;  2DEU A;  3CJT B;  3LA2 A;  3GTO J;  2GQF A;  4B8X A;  4A6D A;  1EH8 A;  1RQR A;  1QZE A;  2ZIT A;  4B44 A;  4L8J A;  4LK0 F;  3KE2 A;  5H59 A;  5F0H A;  4I09 A;  2YR2 A;  1SFO J;  2Y48 A;  1AKH B;  1R6R A;  2JK3 A;  4Y17 A;  4AIJ A;  2JN6 A;  3DEW A;  5BQT A;  4URR A;  3VO1 A;  4KT6 A;  5IYW A;  1P4X A;  3AST A;  1R1T A;  1EFC A;  3D1N I;  5J3O A;  2HYG D;  4XLC A;  4ZJZ A;  2YU9 J;  3JU4 A;  3QSY A;  3BCA A;  3B90 A;  4EM1 A;  1QUF A;  4XRS A;  2VN2 A;  2W00 A;  3DBH B;  1DDN A;  1YQA A;  4XMY A;  3CCJ I;  3BDD A;  1JTX A;  1FNB A;  1XE1 A;  2K40 A;  3WYA A;  3RIQ A;  2CQ7 A;  1ZUN B;  3J7Z I;  4TMV A;  2LBF A;  3S1Q J;  2HLD A;  2YU3 A;  1N06 A;  4XSZ F;  3V7C A;  4UB8 C;  3CMY A;  1S0U A;  2KKO A;  3TH0 A;  2VC0 A;  5D5V B;  1TW2 A;  2Q6O A;  1Q82 D;  3FMS A;  3BZ6 A;  3RZO J;  4LD5 A;  2WBM A;  1ZGJ A;  3P4G A;  1Z05 A;  3S16 J;  4Z4W A;  2J8K A;  1WI3 A;  1OB5 A;  2DFI A;  3FM5 A;  5CVU A;  4EH1 A;  1NHA A;  5FLV A;  2E71 A;  1F20 A;  4UB6 C;  2VT3 A;  3K70 D;  4BJ5 C;  1IJW C;  3TO7 A;  3OSG A;  1E0E A;  2GLO A;  1N07 A;  3TDU C;  3TOA A;  5L3E A;  3SZG A;  4CCK A;  2ELJ A;  5F4O A;  3W2E A;  1XSV A;  3IWZ A;  1GVD A;  5A89 A;  4RAG A;  1KYW A;  2JZY A;  3AVX A;  1WGX A;  1SVM A;  1OJL A;  2WB1 A;  4MO7 A;  1N0U A;  1H88 C;  1B72 A;  1SAU A;  3SJZ A;  2XRN A;  3L2C A;  1X1A A;  2M0M A;  3SYJ A;  1EP3 B;  1HLV A;  3UR3 C;  1B1B A;  2AO9 A;  3K69 A;  4AD9 A;  3CD6 I;  3VEP A;  1DGW Y;  3U9G A;  1VQM B;  5F08 A;  3DU1 X;  3M7G A;  2R7X A;  4XIC A;  4I2O A;  4ZDP A;  2R5Z A;  1LVK A;  2P3M A;  4IQ4 A;  3FBN B;  2ME6 A;  4YAF A;  4WF2 A;  3ZQF A;  2LF8 A;  1LB2 A;  1BR4 A;  1C0W A;  3OYF A;  4M3E A;  3FWE A;  3ZBU A;  2VJJ A;  1VZ0 A;  3KRG A;  2HYF A;  5HS9 A;  1FPQ A;  2P7V B;  4OJL A;  4LBW A;  2FU4 A;  1KRH A;  3HUG B;  4P96 A;  2LTP A;  4E7I A;  3FPP A;  1NHC A;  2UWM A;  2QE7 A;  1TWF J;  5JFR A;  3KEY A;  4LBY A;  1E3O C;  1ORK A;  4UAJ A;  3SFZ A;  3CMM A;  1UG0 A;  2K85 A;  3T51 B;  4UNO A;  2L9N A;  1VQM I;  5HDK A;  2CQN A;  1W5C C;  1ACI A;  3T8R A;  5J4Y A;  3FBI B;  2L9V A;  4OJO A;  2LKX A;  3A2K A;  3CMA B;  3IP4 B;  1JHF A;  1LEB A;  3BJA A;  2F5V A;  1YI2 B;  3LA3 A;  2NTB A;  2M2E A;  3D5R C;  3C2B A;  2ZZQ A;  1SVO A;  1WJE A;  1OKR A;  2CC2 A;  1TUI A;  1NK3 P;  1MMS A;  1LKX A;  2GZW A;  2ZZG A;  4C43 A;  3G2B A;  3F8F A;  1QGP A;  1BOB A;  3WU2 C;  5B5E C;  5LLQ A;  3N90 A;  2B63 J;  1Q1V A;  3SKB A;  3VST A;  5JI6 A;  1XDU A;  2CUE A;  3AG2 H;  1LJ9 A;  1YW9 A;  2BGC A;  1N0V C;  3CC4 B;  2XT2 A;  2R7S A;  5DTD A;  5CYV A;  2DXI A;  5ICG A;  3E6B A;  1UHM A;  1G7C A;  1O8H A;  3TED A;  3GFL A;  4E0F A;  2ELH A;  3L2W A;  1IDJ A;  5E79 C;  2NVY J;  2HKO A;  1YJW I;  2EIL H;  1OCO H;  2JN9 A;  4EGZ A;  4IO9 F;  5DSZ A;  2A5Y B;  1T6Y A;  4YDT A;  2LF7 A;  3HL2 A;  3CCQ I;  3BR1 A;  3DPU A;  4C2M J;  2F1M A;  3DQV C;  1BX1 A;  3KEO A;  5KK1 A;  4AVP A;  2IQ7 A;  1RNL A;  4XKW A;  4HE5 A;  3I71 A;  1YJN I;  2CW8 A;  1MMD A;  2NNN A;  2XGC A;  3HAG A;  4W8T A;  5DN6 A;  2IT0 A;  3ASO H;  2K5C A;  2VBS A;  2ZSH B;  2DCE A;  2L2O A;  1KU9 A;  3OIP A;  5TGT A;  3MEX A;  3ZMT A;  1BL0 A;  2GXB A;  2VBK A;  4BE2 A;  4DNR B;  3ZQG A;  1A8P A;  3PVD A;  2XB5 A;  3C7J A;  5CQE A;  2QYO A;  4IXA A;  2FD5 A;  3OSF A;  1FOY A;  2E34 A;  4QIW N;  4ZYE A;  1G8X A;  3I64 A;  1PDN C;  2IGM A;  3DU5 A;  2F2E A;  1LFU P;  2LY9 A;  3DTE A;  1AOY A;  1JB9 A;  5LMZ A;  3QFT A;  1VQN B;  1SFU A;  1MBH A;  4OP7 A;  1G3T A;  2R9V A;  3BOQ A;  4CYC B;  5DCM A;  5FKL A;  1FIA A;  1E79 A;  1KK3 A;  2WAQ N;  3E7L A;  2NSP A;  1P4M A;  3LQR A;  1RKW A;  4JX4 A;  2QEN A;  2PEX A;  2WAD A;  5D6E A;  5ICE A;  4HWV A;  2DTR A;  3ONQ A;  3WG7 H;  5JHF A;  1GV5 A;  4OPV A;  1A35 A;  2JSP A;  4A3K J;  4FCY A;  3GWZ A;  2ZKZ A;  3GTG J;  3VOE A;  2IP2 A;  2TRT A;  3U6K A;  1LE8 B;  2XZO A;  2VFP A;  1JGG A;  3CXC B;  1NDH A;  4JRA C;  4PJN A;  1OR7 A;  4GQN A;  4LGW A;  4FX4 A;  2GIV A;  1E62 A;  3JQR A;  2X6O A;  4MFE A;  2WAE A;  2JVG A;  2CQK A;  2HXO A;  1OGM X;  4TN1 A;  2AQF A;  2CG4 A;  2OZ6 A;  1O8F A;  1OOC A;  1T56 A;  3QOP A;  1B9N A;  1K8A D;  2CK3 A;  3E6D A;  1IV6 A;  1MMA A;  1VQ6 I;  3Q0V A;  4XOP A;  4CIC A;  2C4U A;  3G4S I;  1GXP A;  4WWC A;  4XBF A;  5KW9 A;  2PFB A;  3Q6Q A;  5CDF A;  1Z21 A;  4DBR A;  3HYI A;  2BY3 A;  2XF5 A;  3RKX A;  4EGY A;  1DPR A;  1USS A;  2GXA A;  1N77 A;  4G12 A;  4PJJ A;  1XX5 A;  3M3Y J;  1K7A A;  1ULY A;  1WKM A;  2LRD A;  1ETY A;  3MZY A;  1QCX A;  4YAW A;  3LNN A;  1R5I D;  3ABM H;  4IW3 B;  4PK4 A;  4M71 A;  2V7T A;  3PUM A;  3VMV A;  4AIH A;  3JRD A;  4W8S A;  4FHT A;  2B0L A;  3WE3 A;  3CCE B;  2EK5 A;  3HIF A;  5JLX A;  2PLY A;  3KLN A;  1K5C A;  4Y3O A;  3ZBT A;  5DEQ A;  4WK8 F;  1JA1 A;  1UHW A;  2N8G A;  2VBT A;  3NE5 B;  1M90 D;  1O3S A;  2XPU A;  4QVA A;  4DGW B;  2QGU A;  4KMF A;  1Y0Y A;  2XAG A;  1TTY A;  2XT4 A;  3LQE A;  3HOY J;  2STW A;  3I56 I;  2D1V A;  5IPA A;  4AID A;  5C4J J;  1TT5 B;  2HFH A;  4M9Z A;  3W5U A;  1IN8 A;  1W9X A;  2LY1 A;  3QQA A;  5L3G A;  2EZH A;  2EWE A;  2QYU A;  2COM A;  3T1B A;  1ZM9 A;  5KCM A;  4XKB A;  3K4K A;  3OYG A;  1BC7 C;  1TWA J;  3HRM A;  1K6Y A;  3WG9 A;  5JVT A;  3S2D J;  2IS4 A;  5F27 A;  2PBI A;  4L9N A;  5J47 A;  1N05 A;  1BJK A;  3JAM K;  3WTS C;  3T0Y A;  3J81 k;  2WZP P;  1JT0 A;  1P4A A;  2HDW A;  4ZYH A;  2FQ4 A;  2X51 A;  2XVC A;  2L54 A;  2L7Z A;  2KIF A;  3JRF A;  2AHQ A;  1QH0 A;  3ZQH A;  2LDU A;  5J1R A;  2XRL A;  2IS1 A;  3WGG A;  3E6C C;  4Y4R A;  4BS9 A;  5HOD A;  1ETX A;  3A0H C;  1W4M A;  4A3G J;  1NG6 A;  2YUS A;  4CHU A;  1PXZ A;  4YZQ A;  1EE6 A;  4DZP A;  5B1A H;  3BH4 A;  4Q47 A;  2DO7 A;  1E1R A;  1UD6 A;  2X48 A;  1I7P A;  4UZE A;  2LG4 A;  3ZQQ A;  2O0Y A;  2ZJ2 A;  2QA4 I;  4Y33 A;  3JTH A;  2GBY A;  1ZM4 A;  2XF6 A;  4OJP A;  2NPF A;  5CPR B;  4RDU A;  2R92 J;  1RKT A;  5H5J A;  1CQT A;  2QSH X;  3WU0 A;  2V7Q A;  2XSD C;  3CPW B;  2CW7 A;  2CU7 A;  5E1Z B;  1MJ9 A;  3AAF A;  4ZCI A;  1D8K A;  4HRI A;  4YIF A;  3HHG A;  2FEZ A;  1NB9 A;  3V8J A;  1RR7 A;  4U49 A;  2JWT A;  5ERI A;  5F0C A;  3S15 J;  3MVP A;  5TV2 A;  2CQQ A;  2NS0 A;  4UY8 I;  2CUJ A;  2QXZ A;  1KQS B;  1WHU A;  4XID A;  1W0J A;  4MYT A;  4CCM A;  4N0B A;  1REP C;  4OOS A;  3RY8 A;  4CCL A;  3DPT A;  3G71 B;  5HVQ C;  5FKM A;  5FKK A;  5DDG A;  2JUG A;  2MH9 A;  1QGA A;  4N3N A;  4P3I A;  3MZ8 A;  4ZC3 A;  4P12 A;  2VNH A;  5D4R A;  3I55 I;  3HG9 A;  3PFI A;  2B9S A;  4DBQ A;  1GT0 C;  4YHB A;  2G0E A;  1HBX G;  3Q6R A;  1X4O A;  1BLI A;  1Z6T A;  5JLV C;  5DM7 F;  2KT0 A;  3K4B A;  3B82 A;  2Y30 A;  3D26 A;  1KMH A;  2BV3 A;  1MJA A;  3F72 A;  2LK2 A;  1FX7 A;  3X2Q H;  3FXK A;  4EW9 A;  3I0T A;  2JUC A;  1MD0 A;  4OIP F;  1B59 A;  5K5R A;  4X7C A;  4WZL A;  5LD2 C;  2VQC A;  4R79 A;  2GA1 A;  2WJV A;  4G7W A;  4IRG A;  4RJL A;  2I10 A;  1PJ7 A;  3H9G A;  1O7L A;  4Z4V A;  3RQI A;  2VFQ A;  2QUF A;  2OZU A;  3ML3 A;  3BR6 A;  1IDZ A;  1U78 A;  1O8M A;  1CQX A;  1UHS A;  1K4T A;  1RU4 A;  3FKJ A;  4HPQ A;  1W35 A;  2DYR H;  2RC4 A;  3QPS A;  2BM7 A;  3V8L A;  3JRI A;  3PL8 A;  3VSV A;  4WQM A;  3N6Z A;  3OJW A;  1F36 A;  3ERM A;  4U7D A;  2BMW A;  4Y9R A;  4C3H J;  3LO8 A;  3LSG A;  4X0G A;  3HC7 A;  1SD5 A;  2RKH A;  2CGP A;  4X6A J;  3WY9 A;  3T56 B;  4TKO B;  3BQZ A;  1S29 A;  2EFP A;  1ZLK A;  5JLW A;  3KLO A;  4PJM A;  2INV A;  3RQ4 A;  1OGJ A;  4N3G A;  4NBS A;  2OF7 A;  3U21 A;  3ZOB A;  5JR3 A;  4BJ6 C;  2OV7 A;  4HBL A;  5KHD A;  2C4T A;  3F9K A;  1FRN A;  1OB2 A;  1QFJ A;  1XMK A;  1KON A;  3KP7 A;  2WPD A;  1OMI A;  2EZI A;  2KQR A;  1A6I A;  1O3Q A;  3G71 I;  1UZC A;  2V1N A;  3CME I;  4PMH A;  2NTQ A;  2H6B A;  3FXL A;  3F0C A;  2NXN B;  1T6S A;  1U6G A;  4IOC F;  2HNH A;  1P7I A;  2W6J A;  2ID3 A;  1FLI A;  1VQ4 I;  3ZQL A;  1TYU A;  5IYN A;  2O8K A;  1BW6 A;  4A93 J;  1JKR C;  3FMR A;  3HGY A;  1VQP B;  4PC3 A;  3BR5 A;  2O61 A;  3CJQ B;  3HOU J;  4MEY F;  2VFO A;  3I9V 2;  2ZNZ A;  1I18 A;  3PIP F;  1WJC A;  4KKS A;  3LWF A;  4HF0 A;  2BN4 A;  4XK4 A;  1XCB A;  3W6J B;  2MD0 A;  4A3J J;  1TWG J;  5FRO A;  4HNT A;  3IKV A;  2JQ7 A;  3CME B;  2K9M A;  1H0M A;  1EH6 A;  2Y0S N;  1TVC A;  1W0K A;  2DIE A;  1T5E A;  4I01 A;  3KYC B;  5HDG A;  3IV5 A;  2HWV A;  2V1D A;  3NWT A;  1F9N A;  4AM3 A;  4KKT A;  4ZCM A;  1TSP A;  2H94 A;  3VMF A;  3F8C A;  2IRF G;  2Q1Z B;  2KFD A;  2M30 A;  3PA2 A;  1UD4 A;  1OFL A;  3LFU A;  4RM0 A;  3TOB A;  1DDG A;  1XGN A;  2X1C A;  3ISP A;  5J40 A;  4U7B A;  2Z33 A;  4MTD A;  1OYI A;  1B9M A;  4KIT B;  3JTG A;  4WXC A;  3ZMD A;  1T8I A;  2J8I A;  5F6F A;  2GM4 A;  5CQG A;  1IAW A;  1Z7U A;  2VKV A;  1EFU A;  4IX7 A;  1DBO A;  2V7V A;  1EFT A;  1AIR A;  1PKV A;  1YO5 C;  2A05 A;  5CVI A;  1NBM A;  4QV2 A;  2VNI A;  2B0R A;  1H89 C;  3LVB A;  1D1B A;  1ZGA A;  1GUU A;  4C3J J;  3HSR A;  2IGO A;  4RD1 A;  1WJF A;  4AC0 A;  4CCO A;  4RBO A;  4W1U A;  1D8T A;  2DY1 A;  1H8E A;  3OKX A;  3A35 A;  1G3S A;  1O7F A;  4BEH A;  1W34 A;  2B5O A;  1MJB A;  5TIS C;  2LMD A;  4A0Z A;  1ZR2 A;  3KP6 A;  2Y9Z A;  1PLU A;  1Q1H A;  1HDD C;  3QYE A;  4KN7 X;  3CUO A;  1QVF B;  3OWT A;  2A6E F;  3PUF A;  3ABK H;  3GSI A;  3JR9 A;  4HQE A;  3BY2 A;  1K8F A;  2R7W A;  1QGY A;  3OS0 A;  1U0J A;  5H6R A;  3GYH X;  1ODD A;  3QYB A;  4L5J A;  3RKW A;  4M53 A;  2ODL A;  2CQX A;  1X58 A;  2VKE A;  1MDM B;  2MC3 A;  1ON1 A;  3LSP A;  2NVT J;  3Q38 A;  1T0F C;  4LBZ A;  4AF7 A;  3KYD B;  4U0W A;  5FKO A;  4H9G A;  2R0Q C;  3AVT A;  4A3B J;  1R5H A;  4P9U A;  2VYQ A;  3HOZ J;  2Z6B D;  3T8T A;  4YCQ A;  5EGO A;  2KIU A;  5TY0 A;  3SUC A;  4RLQ A;  1QA6 A;  1HW5 A;  2EPF A;  3E5Q A;  3CCS I;  3EUK L;  3K2A A;  4BEH B;  3CC7 B;  2M0C A;  1GDT A;  4V19 K;  4MR0 A;  5B3S H;  3W2I A;  4EAT A;  2W84 A;  3PNY A;  2AXL A;  4DYR A;  1Y0R A;  4U9U A;  3SY2 A;  4NK8 A;  2V6E A;  2PIA A;  3GVL A;  4LB5 A;  4UUV A;  3O6B B;  1V3F A;  1CLW A;  2DOE A;  5FLX Z;  3I55 B;  2OK8 A;  2FMY A;  5F1J A;  2PEC A;  3S3O A;  3PUB A;  2QKL B;  2AXT C;  3SQN A;  4I6Z A;  1B2R A;  3ZQ7 A;  1BIA A;  4F93 B;  4ANJ A;  3AL0 C;  1FSH A;  3HOV J;  4HQM A;  1E3Z A;  1KTV A;  1UD3 A;  1EWY A;  3BC9 A;  2FBI A;  4ZGQ B;  1MZB A;  3DP7 A;  2VUM J;  1EV7 A;  2V79 A;  1SKY B;  4RGR A;  1SMT A;  2IJL A;  4YFO A;  1V5G A;  3BH6 B;  1GLN A;  2DAO A;  1UST A;  1U5T B;  1VQN I;  4Y9U A;  3SJM A;  2GWR A;  3QP6 A;  2XIG A;  5DV5 A;  2E1O A;  4BXU A;  1IUY A;  3G4S B;  1BR2 A;  4ZTJ A;  1D1N A;  5DCF A;  1FNC A;  1J09 A;  5HXB A;  4NHJ A;  1JUP A;  3KPH A;  4MQV A;  3ZMU A;  5D5U B;  2W85 A;  2I5U A;  1XTA A;  4BDY A;  2FX0 A;  3GX4 X;  1Y6I A;  5IOZ A;  2HDC A;  2LNB A;  4YEI A;  4HX7 A;  3MFK A;  2QY1 A;  4OPO A;  2E19 A;  3PJR A;  2VJ5 A;  3GBG A;  1HKS A;  2TDX A;  3OYH A;  2K3F A;  3KCC A;  3O8G A;  2CV0 A;  1HOM A;  2O3F A;  1XSD A;  1QHH D;  3QFC A;  2X85 A;  3CTA A;  2M7B A;  2QEX B;  3LAP A;  1ZGW A;  2HVR A;  1FMW A;  2ECB A;  5FRN A;  4ZDL A;  1ZH5 A;  4OAZ A;  2E1N A;  2DER A;  2ID6 A;  5C44 J;  5E20 A;  1MNE A;  3K1N A;  4P22 A;  2OD5 A;  1VQL B;  4DK0 A;  2LSO A;  3WTZ A;  2INU A;  1QRY A;  1FIP A;  5L3F A;  1O4X A;  3D0S A;  4PGG A;  1NH3 A;  1ZM2 A;  1NJI D;  2VE9 A;  1VQL I;  4OMZ A;  2OAZ A;  4F92 B;  5GPA A;  2IXS A;  4P9F A;  4AYB N;  1F60 A;  2DET A;  2VBX A;  3SLN A;  3GQB A;  2DT7 B;  2RAE A;  1FSE A;  3BG5 A;  4KUM A;  4RAF A;  3RPQ A;  4AWX B;  3CCU B;  5IP7 J;  3CP2 A;  3A01 A;  4F52 A;  3SJP A;  1A31 A;  4LG0 A;  1EZG A;  3DLL F;  1JRG A;  3MMY B;  2ZME C;  4D7N A;  4QFM A;  2K4B A;  2CSO A;  1EF4 A;  2YUH A;  5DUK A;  3J81 K;  1WJA A;  4MEX F;  3JRB A;  3SEQ A;  4ENM A;  2JRT A;  2RQQ A;  2EWN A;  3WTU C;  2PLF A;  4PSX A;  1R4M B;  2JMW A;  3VFZ A;  3B78 A;  2GOX B;  2PX9 A;  1ZN2 A;  3OYI A;  4A12 A;  4M0L A;  4YRV A;  4Q7J B;  3SQV A;  1H9G A;  2H1K A;  2PMU A;  3OYN A;  2R7F A;  1B4A A;  3PFY A;  3DLA A;  4E70 A;  3DWL E;  4UV8 A;  1OR7 C;  1BI2 A;  3DKW A;  5LHI A;  1LPQ A;  1XFO A;  3QFR A;  1KC8 D;  1YOV B;  2IBD A;  1B72 B;  3R0J A;  5EG0 A;  4HNU A;  1XPX A;  1V54 H;  2DLL A;  3W2V A;  2OPT A;  1ZR4 A;  4BAC A;  3K6G A;  5IT9 Z;  3GO5 A;  2G9W A;  2ZJQ F;  3OYA A;  2XAH A;  4HAM A;  4Z4Y A;  1SC7 A;  1K61 A;  1ERD A;  1ONV A;  4NNJ A;  3JSP A;  4YEL A;  4U4B A;  2M45 A;  3R0A A;  4RB2 C;  4XSX F;  3W2A A;  1FWZ A;  4I7H A;  2XPW A;  4M74 A;  3B73 A;  1I27 A;  2P81 A;  3KEQ A;  5K5O A;  3ASS A;  1KCC A;  3L00 A;  1S3J A;  1IDY A;  4KFC A;  1XGO A;  3FDY A;  1KU7 A;  2C78 A;  1RQP A;  3TGN A;  1HSJ A;  4D0P A;  1FYK A;  2OK7 A;  1IJE A;  2MC4 A;  3RJP A;  4W8R A;  3Q3A A;  1JT6 A;  1YE9 A;  5AIP A;  3AVV A;  4UVC A;  1W1W E;  2F43 A;  4V2G A;  1I1S A;  3BPV A;  2F4I A;  1UB9 A;  4KJZ A;  3WTY C;  4OIQ F;  4HE6 A;  1VQO B;  4MYU A;  3H92 A;  4QUZ A;  2FOK A;  1R49 A;  4A3M J;  3NAW A;  4BUP A;  1X2N A;  3M9A A;  3S3M A;  2C2W A;  3J81 Z;  2HPM A;  5HLG A;  2VZL A;  3CRZ A;  2VFN A;  2XGX A;  1Z77 A;  1BI0 A;  3SZE A;  4JOM A;  3JW4 A;  4HEA 2;  2HTS A;  3T53 B;  3J7A Y;  2DA3 A;  4PSW A;  5TR9 A;  1W7P D;  1VI0 A;  4I76 A;  1IO2 A;  1XMA A;  4CSW A;  2JA7 J;  1WP6 A;  4QVJ A;  1BJA A;  1P9Q C;  1TNT A;  1SKQ A;  4AVZ A;  3SHF A;  1P92 A;  4IHX A;  4NK6 A;  2NZM A;  4A3F J;  2P5K A;  3CDL A;  1Z3Y A;  3GTM J;  4YAU A;  3M1C A;  4EMS A;  5L46 A;  5BOX A;  3HRS A;  1MND A;  3W2G A;  4A5M A;  2IA0 A;  2QZA A;  2UVF A;  5KAF C;  3CCR I;  1S72 B;  5K1Y A;  4Z6Y A;  2LKP A;  2WC2 A;  4O6J A;  5FFZ A;  2QBY A;  2V7F A;  1H9T A;  4Z1M A;  2QX3 A;  2ZFW A;  5HZA A;  4LOC A;  2UV1 A;  1N8R D;  2JPC A;  2ZB9 A;  3DPL C;  4U87 A;  3J7Y J;  4YAL A;  1JJ8 C;  3NRV A;  4NCN A;  1VQ7 B;  3K4N A;  5F4M A;  3FF5 A;  2ESN A;  4H4K C;  3P9K A;  5DUI A;  2JDI A;  1AA7 A;  2BVL A;  1TYX A;  2E36 A;  2C77 A;  2LR8 A;  4A2U A;  1IV8 A;  3HRT A;  4R8H A;  2X53 S;  3A1P A;  1E43 A;  1OGO X;  3DV8 A;  4BXX J;  4RDJ A;  3OIQ A;  1QFZ A;  3F6O A;  3BCB A;  1Y39 A;  2JJ7 A;  2HKX A;  4Q48 A;  4TMT A;  1T08 B;  4UV9 A;  3MKZ A;  3HB9 A;  4MLO A;  5GAG J;  4ITV A;  3CCV B;  2WJY A;  4PGH A;  5IK2 A;  4F3Q A;  3WU1 B;  3DDY A;  2VIX A;  3H36 A;  2P4W A;  1P6R A;  1ZAR A;  5TJJ A;  2R7R A;  2GK6 A;  4XLP F;  3LSH A;  3PNT A;  2V7U A;  3L09 A;  4BJT A;  1K79 A;  2FNA A;  1LDK B;  2EV5 A;  3Q0W A;  5HNH A;  1YYV A;  3HKZ A;  5HLT A;  3SEZ A;  3HOS A;  1B8I B;  1BQE A;  5HLI A;  3ONY A;  3FXJ A;  1EP2 B;  2RC5 A;  3A8J A;  3IL2 A;  2EA4 A;  3CF2 A;  3HBL A;  1YW8 A;  3HPG A;  5BNG A;  1S7A A;  1HVX A;  4RCY A;  2G0Y A;  1YW7 A;  1KQ8 A;  3NQO A;  1MAB A;  2V7W A;  4UXN A;  3PET A;  3ULQ B;  3TDZ C;  1OPC A;  4J01 A;  3S14 J;  3R60 A;  3MZH A;  2PYH A;  3SYT A;  3W2W A;  3OS2 A;  2WV0 A;  2ZME A;  2VON A;  3BNW A;  3SZT A;  3OW2 B;  1IC8 A;  1PJ5 A;  3TW6 A;  1Y8Q B;  4I84 A;  1WJB A;  3V7A A;  4G6D A;  4M6V A;  1W7P A;  3GQ7 A;  1RRJ A;  1GHC A;  2K27 A;  1IN6 A;  1F5T A;  1VJS A;  2DQL A;  2HXI A;  2F3L A;  3OOP A;  1NTC A;  1TLL A;  1YJN B;  4GXO A;  1RC9 A;  2FQ3 A;  2HGC A;  4DOZ A;  1D1A A;  2LC2 A;  2M9H A;  2XRO A;  1T38 A;  3W3C A;  2QN6 A;  1QZZ A;  1BI3 A;  3LST A;  4AIK A;  1OQY A;  1TTT A;  1OB0 A;  1QPM A;  2EJR A;  4M3F A;  3VYT B;  5THX A;  1RPW A;  1I6H J;  2ZBK A;  1WOO A;  2QMU A;  2RQP A;  1PUF A;  3V7S A;  1O3T A;  4XNF A;  3S32 A;  3JSO A;  1EXM A;  5F1R A;  3IC7 A;  3HOT A;  3GZ6 A;  2X0K A;  4P55 A;  1XGM A;  4JBA A;  2X6Y A;  4XRF A;  2OJE D;  4BHP A;  2MBF A;  2CRV A;  5KSW B;  1Y56 A;  3T5X A;  4DJA A;  5LEK A;  3QWL A;  3S3N A;  3BY6 A;  5LGN A;  3PM1 A;  3BJO A;  4WZK A;  2ADU A;  3NEU A;  2F48 A;  1DQU A;  2NOG A;  3I59 A;  1FBU A;  2UVE A;  3V4G A;  2RRE A;  3WTW C;  3QPH A;  1S5L C;  1T33 A;  3RSN A;  3QYF A;  3KL9 A;  3G1O A;  2V6C A;  4RCZ A;  3WTX C;  4TMX A;  2XTW A;  3DXJ F;  4HA8 A;  2WR8 A;  2W7Z A;  1K83 J;  2TCT A;  2DOG A;  5IYR A;  4KIG A;  1ZYR F;  1K9M D;  4B3F X;  1UG2 A;  2VFM A;  2DYS H;  1PUF B;  1XS9 A;  2L0K A;  4L0Y B;  1HA3 A;  5A2Q Z;  3ASP A;  1WI9 A;  5FKN A;  4L0Z B;  4F7D A;  1ETO A;  2IA1 A;  2A69 F;  1X1D A;  2YX7 A;  2RGV A;  4RLF A;  4G8X A;  4XLA A;  4I02 A;  1WOR A;  5LEJ A;  2DOF A;  2K7L A;  2DT5 A;  1SFK A;  1WTH D;  2XNC A;  1JTA A;  3P9C A;  4B43 A;  4DYC A;  4HF2 A;  4GDF A;  4JQF A;  1ETK A;  1FP1 D;  2LH9 A;  3F8M A;  3ERE D;  1H8A C;  3CJN A;  1DAB A;  3LOC A;  2VE8 A;  1I6X A;  3A02 A;  1XQB A;  2ZBV A;  4EJW A;  3S2H J;  5F64 A;  1DU6 A;  2CND A;  2WSS A;  2L7K A;  3JRH A;  2F4M B;  3HDD A;  4I98 B;  2VBV A;  1Q86 D;  4C30 A;  1FTZ A;  1G7S A;  4DQK A;  1O8K A;  1OFE A;  3ZSC A;  2EBI A;  4IHW A;  3L2R A;  4MQ9 F;  4ZCL A;  2JRM A;  3E5U A;  2X8K A;  3W2H A;  4JX6 A;  3OYB A;  2KIS A;  2QZ8 A;  1N78 A;  2HQA A;  3S17 J;  3FK7 A;  2D74 A;  1D0X A;  2EIN H;  2X9D A;  3H9J A;  2FOW A;  3SXY A;  1T39 A;  4Q5S F;  1HA8 A;  2HU9 A;  1VQ6 B;  2BOL A;  2IGN A;  4QWQ A;  3OEH A;  2F6C A;  2PMH A;  4PDK A;  4GCV A;  3I58 A;  1TWC J;  1WRJ A;  1HXD A;  1PE9 A;  3NWS A;  1KK2 A;  3MAJ A;  3KYL A;  2EA2 A;  1KZL A;  3I54 A;  1X1C A;  3NB2 A;  1UAA A;  2CV2 A;  1IRG A;  1QGZ A;  2CUZ A;  4EJT A;  4RGS A;  2HVS A;  2ISZ A;  3PO3 J;  1GV2 A;  1JKQ C;  4EV0 A;  2A5W A;  4GYI A;  4L9T A;  1AU7 A;  4D5F A;  4NC6 A;  3REO A;  5EEA A;  2M1B A;  4YIR X;  5ICF A;  2GK7 A;  4F55 A;  3BG7 A;  4XRM A;  4Z4T A;  3WE2 A;  4FE4 A;  1IF1 A;  5K7F A;  5D5W B;  4BNC A;  1IW7 F;  4FE7 A;  4X0C A;  1IN5 A;  5AIQ A;  1HKT A;  2VBZ A;  4C3I J;  5DS9 A;  2OTL I;  4XLF A;  1YFH A;  4OM9 A;  1HDP A;  2P0W A;  2VQG A;  3I5U A;  2R5Y A;  2BVM A;  1T6Z A;  1R5O A;  2EZK A;  1JJ6 C;  2ICW G;  3HZJ A;  1TW3 A;  1I39 A;  1FNN A;  1B8I A;  1YX5 A;  2ZXJ A;  3QOE A;  1YIT I;  1K4S A;  2V4D A;  2DJI A;  2DA7 A;  1U8B A;  3NAR A;  3OYL A;  1IRX A;  2OCE A;  4R1H A;  3ROU A;  1OCP A;  2HI3 A;  2DA6 A;  3OYJ A;  3UKG A;  3VSL A;  3GEZ A;  2E2H J;  3TBI A;  5IP6 A;  2CV1 A;  3ISX A;  5AN9 A;  3JAM Z;  3AVY A;  4E7K A;  3AVU A;  1QA2 A;  3CZ6 A;  5J8C A;  1VHO A;  3K0L A;  1SD4 A;  3FY3 A;  2EV6 A;  1W5T A;  2K9N A;  3BRO A;  1K4Z A;  2GXG A;  2OQR A;  2Y9Y A;  4OJ5 A;  4RGU A;  3DFG A;  3M07 A;  3UNG C;  4ZH4 F;  3ZR8 X;  3CLQ A;  3Q0U A;  4RPD A;  2GA2 A;  4RMN A;  4AUX A;  1IJF A;  1U5T A;  1P2F A;  2Q6L A;  4ETS A;  3WTT C;  1TQP A;  4KDP A;  4E6K G;  2Q2E A;  3ZCO A;  2DA4 A;  2EFN A;  1YRN B;  1RES A;  2XAU A;  3FX3 A;  4E7L A;  4MFD A;  1SMY F;  3BR2 A;  1RMG A;  4HYE A;  1J0R A;  3GQ8 A;  1S9H A;  3E20 A;  1QRB A;  3S1R J;  5EZH A;  3OZU A;  3HKZ N;  1LFB A;  2FUG 2;  1BN8 A;  2BEO A;  3DBL B;  1MMG A;  1QZY A;  5J1U A;  2BZT A;  2NVQ J;  4X06 A;  4LIT A;  3RZD J;  4RB1 A;  3VWB A;  3D5S C;  2VOO A;  2ZXW H;  4XQF A;  4RM3 A;  3E5X A;  4ESB A;  2F5E A;  2XZP A;  4G5G A;  4ENK A;  1R36 A;  2DMQ A;  2GJK A;  1S4M A;  1WOP A;  1VF9 A;  4P1V A;  2BX6 A;  2CRG A;  2LD5 A;  4RD6 A;  1ZTR A;  1G3Y A;  1OLT A;  5HZB A;  1E64 A;  2HOA A;  1W36 D;  4P5O A;  5M5Y J;  4D5C A;  1WPC A;  1NB0 A;  2DCU A;  5D8K B;  3BTI A;  4TMW A;  2KZG A;  2OCC H;  4IHV A;  2VOP A;  2XB0 X;  2OC6 A;  3IAM 2;  3Q5F A;  1VQ4 B;  4N4O B;  1E63 A;  3C2G A;  2YWF A;  4L18 B;  1IZ1 A;  5C1E A;  2BBY A;  2LP0 A;  4IJA A;  1IG7 A;  2R7T A;  3HHH A;  4EQQ A;  1GVJ A;  4YG2 F;  2RDP A;  4NQW B;  4ZTF A;  2VBE A;  3SEJ A;  1H80 A;  1H85 A;  3MKL A;  1LLZ A;  4B4D A;  3DTK A;  4G1V A;  3OYE A;  3ZN1 A;  2JIZ A;  2VNJ A;  2WAQ A;  3H5A A;  2HVQ A;  2IEK A;  3I53 A;  2X0L A;  4FXU A;  5FO0 A;  2C5B A;  3IKT A;  2QTL A;  5JHU A;  4QLC U;  3EQO A;  5D4S A;  3BTJ A;  1HW2 A;  4B3G A;  1PP7 U;  2KZV A;  2VKD A;  2IS2 A;  1D8J A;  3HTU A;  5FRM A;  1BI1 A;  2Z16 A;  2V7X A;  4HX4 A;  1RI7 A;  2UZK A;  3EYI A;  3ZIA A;  1D3Y A;  2L7M P;  3PSF A;  4V2F A;  3BR3 A;  2WWY A;  2IW5 A;  2Y69 H;  3GFI A;  3KP4 A;  2WA0 A;  4M3D A;  1ENH A;  1SFX A;  1G3W A;  3LSJ A;  2B7E A;  1SAN A;  4J0Q A;  1YHQ B;  4PZJ A;  2K9L A;  4L5I A;  2D3N A;  2VB6 A;  2W4S A;  4X8I A;  2XAS A;  1VLY A;  3BT9 A;  2R6H A;  4S04 A;  3VSU A;  1MSE C;  4O5V A;  3PSS A;  3JCU C;  1V0F A;  5EDN A;  3E97 A;  1ZLJ A;  4I0A A;  1MDM A;  1UMK A;  2DOD A;  2KJC A;  3F6V A;  1VQK B;  3CO7 C;  2QSG X;  1X3W B;  3ESW B;  1T2K A;  2K4J A;  2CFX A;  2DMT A;  4P3Y A;  3WNB A;  4X7E A;  1X3U A;  2IPQ X;  5LGT A;  3NAU A;  5D8L B;  1ETV A;  1WJ5 A;  2VQH A;  2Y75 A;  4RA2 A;  2HQ5 A;  2GOM A;  1FY7 A;  5E1X A;  3I4N J;  3H3U A;  3W6V A;  4M6Y A;  4BQO A;  4EJU A;  2AHO A;  1ZRC A;  3CCJ B;  2V31 A;  4IQJ A;  4BPR A;  3LJY A;  4W97 A;  3WND A;  2NRA C;  4FWT A;  3E6M A;  3CUQ A;  2ESH A;  1ZHF A;  2PG4 A;  3ZZT A;  2BM4 A;  3HRU A;  3AG4 H;  1D2E A;  1Q81 D;  5EF6 A;  2VL8 A;  2BYV E;  1VQK I;  3AK5 A;  2VI6 A;  2QEX I;  2NS7 A;  1FP2 A;  3HOX J;  3SDB A;  1JUM A;  2ZTN A;  3GW2 A;  3KX2 A;  4FET A;  4YEJ A;  1WPK A;  1X3Z B;  1JNY A;  2HR3 A;  2DFH A;  2O0V A;  2CMP A;  2R7Q A;  3GIR A;  5ED4 A;  2QGG A;  1AKH A;  3G1L A;  2W82 A;  3BR0 A;  1AIP A;  2O1D A;  3OS1 A;  2W25 A;  5ILV A;  3CUQ C;  4B47 A;  4UHT A;  4PJ0 C;  2ZL7 A;  1BPL A;  1LDJ A;  4DIQ A;  1R23 A;  1XB4 A;  3ONU A;  2VBW A;  4AC9 A;  3QOD A;  2NOJ B;  4RAZ A;  3CCE I;  4YAO A;  2OUM A;  4WCG A;  4A3D J;  4LLN A;  1H42 A;  2FML A;  2RV8 A;  2ZJP F;  4IEJ A;  1WSR A;  3OAA A;  4PC2 A;  3CCL B;  5H6Q A;  3PA1 A;  3TL4 X;  2DQR A;  3F22 A;  1WXR A;  2QM3 A;  1AHD P;  2VOD A;  5FFX A;  2V26 A;  3HPH A;  4YZX A;  2CO5 A;  1J9I A;  4XN0 A;  4LJZ F;  5GTH C;  1U2R A;  4RD3 A;  5A8A A;  2M4G A;  4RGX A;  2L4M A;  2E60 A;  3KP5 A;  1BBY A;  2DMN A;  2JTV A;  5EEH A;  5A2Q K;  2GIZ A;  3WOD F;  2AQE A;  1OCC H;  3EUH C;  2MLG A;  3E1Y E;  3ZUG A;  2H6C A;  1EJ9 A;  3ZRG A;  4B48 A;  1BHE A;  3AFH A;  3GTP J;  3MCA A;  2QCO A;  2B7C A;  3VO2 A;  1TP4 A;  4JYK A;  3OIO A;  1QQ1 A;  1VBL A;  4LMY A;  3DKY A;  2ZL5 A;  5D6F A;  4MXN A;  3VYS B;  1L1I A;  1YX3 A;  2LVS A;  3PUN A;  3FKS A;  1Y0U A;  1W2B B;  4HLY A;  4RD4 A;  3IHU A;  2DA2 A;  4G94 A;  1OGI A;  1LVA A;  1PJ6 A;  1WQ2 A;  4YXW A;  4CGZ A;  3V76 A; 
#chains in the Genus database with same CATH homology
 1E79 A;  4BDZ A;  2W1O A;  2F43 A;  5C1C A;  2KLO A;  4ZYA A;  2F4I A;  4KJZ A;  2NSP A;  3LMW A;  3UW0 A;  3T9G A;  2WAD A;  5KNL A;  4HWV A;  3ONQ A;  5JHF A;  3VYU B;  4URR A;  2JSP A;  4BUP A;  2XZO A;  2KDO A;  3S3M A;  2HPM A;  4PJN A;  2I8D A;  2M5S A;  3KEW A;  4GQN A;  2QKM B;  4JOM A;  4C2U A;  4HEA 2;  3T53 B;  3J7A Y;  1O8L A;  2UUZ A;  4E4H A;  4PSW A;  2E5N A;  2JVH A;  2WAE A;  3JUR A;  2JVG A;  4CSW A;  1OGM X;  2AQF A;  1WP6 A;  1O8F A;  1OOC A;  1P9Q C;  2CK3 A;  4AVZ A;  1MMA A;  3CP8 A;  1V5E A;  4XOP A;  3BCD A;  3K70 C;  3OE7 A;  4NK6 A;  4XON A;  1FMV A;  3VYR B;  4XD7 A;  2NZM A;  3MKW B;  2O5R A;  1G59 A;  1Z3Y A;  3HXL A;  3M1C A;  2MYS A;  5CDF A;  1MND A;  2XND A;  2UVF A;  1Z21 A;  2XDV A;  4DBR A;  4OZY A;  2XF5 A;  1N77 A;  4PJJ A;  2E5Z A;  2V7F A;  3VDX A;  1X1B A;  3L2U A;  2JJ1 A;  4Z1M A;  2QX3 A;  3OL4 A;  3WQZ A;  2UV1 A;  2BSP A;  3H0D A;  3LSM A;  3GQA A;  4BGD A;  3OEE A;  1IA5 A;  4IZZ A;  4N4N B;  4U87 A;  3DPL C;  4OZZ A;  1T95 A;  2LRD A;  2VQL A;  3K4N A;  1QCX A;  3LNN A;  3EUA A;  4H4K C;  3G05 A;  4PK4 A;  2JDI A;  2A6T A;  3VMV A;  3OYK A;  1AA7 A;  2X6X A;  2E1B A;  2E1M C;  2BVL A;  4E7H A;  4W8S A;  1K5C A;  2X53 S;  1X4P A;  4QPQ A;  1E43 A;  3FHN A;  4Y3O A;  1OGO X;  3OPO A;  3OIQ A;  3NE5 B;  3BCB A;  4DGW B;  1O8E A;  3K4J A;  1QHG A;  2ZZE A;  3MKZ A;  5FL7 A;  4MLO A;  2V4J C;  4ITV A;  2HPI A;  2WJY A;  5IK2 A;  2KRC A;  4F3Q A;  1UD8 A;  5HNF A;  3DDY A;  2VIX A;  3ZPN A;  2Y0S A;  3OYD A;  1W9X A;  2LY1 A;  2R7R A;  2GK6 A;  4UZU A;  2EWE A;  3LSH A;  1V0E A;  3PNT A;  3DKX A;  3AKZ A;  3A3G A;  5KCM A;  2WY8 Q;  4XKB A;  3K4K A;  1LDK B;  4BJT A;  5HNH A;  5HLT A;  3HKZ A;  1K6Y A;  3OYG A;  3SEZ A;  3HOS A;  2IS4 A;  2R7U A;  2KRH A;  4BL0 B;  4J00 A;  1TT0 A;  4KKU A;  3GQ9 A;  4KIS A;  3CF2 A;  3HPG A;  1HVX A;  2X6W A;  4LIU A;  2WZP P;  1MAB A;  2HDW A;  2Z1D A;  1WMR A;  2X51 A;  4J01 A;  2PYH A;  3SYT A;  3W2W A;  3OS2 A;  3BCF A;  3OOC A;  1V5F A;  2KMU A;  4Z06 A;  2IS1 A;  4I84 A;  1WJB A;  2ZSI B;  4Y4R A;  4BS9 A;  2CFO A;  3V42 A;  4C9Y A;  3GQ7 A;  3H35 A;  4HST A;  1VJS A;  1NG6 A;  2ZTG A;  3ZGK A;  2LBF B;  1X19 A;  1PXZ A;  1EE6 A;  4YZQ A;  3BH4 A;  1EFR A;  4PFO A;  1E1R A;  4BQN A;  1UD6 A;  4C2L A;  4DOZ A;  1D1A A;  2LC2 A;  2LG4 A;  3W3C A;  3ZQQ A;  1OFM A;  2VXZ A;  4Y33 A;  4OJP A;  2XF6 A;  4XLE A;  3VMW A;  3C2H A;  5CPR B;  3CJR B;  4W8Q A;  2MAB A;  1OB0 A;  4XM3 A;  2V7Q A;  1MMN A;  1GQ8 A;  2CW7 A;  3VYT B;  2D3L A;  4PFP A;  3K4C A;  4BE0 A;  2KP6 A;  1VF7 A;  4HRI A;  3OMY A;  2XOK A;  2NT6 A;  1QU3 A;  4XNF A;  3S32 A;  4U49 A;  1D0Y A;  3MKY B;  3K4M A;  3HOT A;  4NC7 A;  2R7V A;  2CUJ A;  4E7Z A;  5LFA A;  2QXZ A;  1PJR A;  2X6Y A;  1W0J A;  5AMV A;  4CCM A;  4XN3 A;  4LIV A;  1Y56 A;  4DJA A;  1O8D A;  4CCL A;  3DPT A;  3S3N A;  5HVQ C;  4XKV A;  3PNV A;  1DQU A;  2JUG A;  2UVE A;  2DT6 A;  2IGK A;  2RRE A;  3LMM A;  4ZC3 A;  4BXF A;  3HG9 A;  3RSN A;  3H9Q A;  3QYF A;  4DBQ A;  2VPL A;  2XGJ A;  3IUO A;  1X4O A;  1BLI A;  1UD5 A;  1X0C A;  3K4B A;  3H94 A;  1D0Z A;  1KMH A;  3BC8 A;  2LRE A;  2VAS A;  4B3X A;  4B3F X;  3ZXS A;  2PMZ A;  1W36 C;  4EW9 A;  2X1D A;  4DK1 A;  5LD2 C;  2VQC A;  4R79 A;  2WJV A;  1X1D A;  4G7W A;  4RLF A;  4XOR A;  4XLA A;  3A4C A;  3H9G A;  3GRH A;  2LZJ A;  4NUB A;  3N05 A;  1WTH D;  1SFK A;  2Z8G A;  1JTA A;  3E1S A;  4B43 A;  1IDJ A;  1QJV A;  4JQF A;  2LH9 A;  1O8M A;  1LFP A;  4OJ6 A;  1RU4 A;  3FKJ A;  2PYG A;  4HPQ A;  2WSS A;  3PL8 A;  2L7K A;  3VSV A;  3DTI A;  4C30 A;  3ZSC A;  1O8K A;  3RPU D;  3L2R A;  4CH7 A;  3LSG A;  2RNG A;  3HC7 A;  4X0G A;  2IS6 A;  4HIZ A;  2X8K A;  2KHM A;  4XKC A;  4TKO B;  1DBG A;  3OYB A;  4LG3 A;  4CA0 A;  2VJ4 A;  4ZDO A;  2O04 A;  1N78 A;  2HQA A;  4PJM A;  2INV A;  1D0X A;  2VJI A;  3OR2 C;  3H9J A;  3RQ4 A;  3U21 A;  2HU9 A;  1HA8 A;  1RWR A;  2BOL A;  3S93 A;  2IGN A;  2OV7 A;  2Z2S B;  4BJ6 C;  5KHD A;  3OEH A;  2BW3 B;  2F6C A;  3K4L A;  3F9K A;  2CS3 A;  4QPO A;  3GVK A;  3H5N A;  1PE9 A;  3NWS A;  1N75 A;  3OYC A;  2ZXH A;  1KON A;  3DU6 A;  4AU7 A;  3KYL A;  1KZL A;  2WPD A;  2KQR A;  3OFN A;  1NG7 A;  1X1C A;  3B4N A;  1UAA A;  4OAY A;  2CV2 A;  2CUZ A;  2V1N A;  4PMH A;  2NTQ A;  3VSK A;  2L9S A;  5HKK A;  4CZC A;  2HVS A;  2V9K A;  1WFX A;  3WWG A;  2HNH A;  2A5W A;  2W6J A;  2BW3 A;  2LYC A;  2GK7 A;  3T56 B;  2ZZF A;  2X1E A;  4GRI A;  4F55 A;  3BG7 A;  4AYB A;  2PJR A;  1COW A;  4XLH A;  2W6I A;  3EQN A;  3CJQ B;  3L2Q A;  4C2T A;  3I9V 2;  2W7N A;  1I18 A;  3BLY A;  1WJC A;  4II3 A;  4KKS A;  4XLF A;  4TT3 A;  2P0W A;  2VQG A;  2WAF A;  2BVM A;  2MD0 A;  3VR6 A;  1O8J A;  5FRO A;  4OWR B;  4HNT A;  2CH0 A;  2K9M A;  1XG2 A;  1W0K A;  2DIE A;  1YX5 A;  3QOE A;  1T5E A;  2V4D A;  2DJI A;  3OOU A;  3OYL A;  1IRX A;  3NWT A;  3OYJ A;  4KKT A;  3VSL A;  2E1M B;  4BQQ A;  1HZE A;  3TBI A;  2Q1Z B;  2CV1 A;  3MD2 A;  2M4K A;  1UD4 A;  3LFU A;  4E7K A;  1OFL A;  1DGR M;  1O8G A;  2Q2E B;  2X1C A;  3CZ6 A;  4PUS A;  1D1C A;  4PJL A;  4U7B A;  4KIT B;  3FY3 A;  1FX0 A;  3LL7 A;  1BR1 A;  5CQG A;  4OJ5 A;  4IX7 A;  3UNG C;  3A3B A;  3ZR8 X;  1DBO A;  5CKT A;  1AIR A;  1E3X A;  4BU2 A;  1PKV A;  4DNT B;  4RMN A;  3H5R A;  3RCO A;  1NBM A;  1D1B A;  2IGO A;  1WJF A;  4E6K G;  3ZCO A;  4CCO A;  2K3P A;  4NC8 A;  3PSI A;  1H8E A;  2XAU A;  4E7L A;  3A35 A;  2NTP A;  4BEH A;  1RMG A;  1JI8 A;  1O88 A;  1PLU A;  4CUG A;  2GJR A;  3GQ8 A;  1S9H A;  3QYE A;  4G6I A;  3ZPP A;  4D1Q A;  1HG8 A;  2X3H A;  3OWT A;  1O8I A;  2XC7 A;  1CZF A;  2HZD A;  2FUG 2;  3LSI A;  1BN8 A;  4Z03 A;  1EA3 A;  1MMG A;  1UEL B;  4B44 A;  4L8J A;  4CCJ A;  2R7W A;  2KVO A;  3OS0 A;  4LIT A;  1U0J A;  3VWB A;  3D5S C;  3QYB A;  4BE1 A;  4XQF A;  1R6R A;  2ODL A;  4RM3 A;  1OHH A;  2XZP A;  1T0F C;  4E7S A;  4KT6 A;  2GJK A;  1OLT A;  2Z6B D;  3TMO A;  2NST A;  1Z7L A;  1W36 D;  4XLC A;  4ZJZ A;  4P5O A;  4RLQ A;  3JU4 A;  3SUC A;  3BCA A;  2VLA A;  1WPC A;  3B90 A;  3RTR A;  4XR6 A;  3EUK L;  2W00 A;  4BEH B;  4XMY A;  4XL9 A;  4MR0 A;  2OC6 A;  3IAM 2;  3CES A;  4N4O B;  3C2G A;  4EAT A;  3PNY A;  5C1E A;  2LBF A;  2HLD A;  4YZA A;  4NK8 A;  2V6E A;  2R7T A;  4RM2 A;  3GVL A;  4F91 B;  2M3A A;  4NQW B;  4ZTF A;  2PEC A;  2VBE A;  3S3O A;  3PUB A;  2QKL B;  1H80 A;  4TSF A;  2WBM A;  3DTK A;  4F93 B;  1UD3 A;  4ANJ A;  3OYE A;  3AL0 C;  1E3Z A;  3BC9 A;  2JIZ A;  2WY7 Q;  2VXD A;  1ZEL A;  2WAQ A;  3H5A A;  2HVQ A;  4FXU A;  1SKY B;  3K70 D;  1V5G A;  4BJ5 C;  1H8H A;  1GLN A;  3EQO A;  4B3G A;  2KZV A;  2VKD A;  1E0E A;  2VBM A;  2IS2 A;  5FRM A;  2LOO A;  1BR2 A;  2Z16 A;  4HSR A;  3SZG A;  4CCK A;  4ZTJ A;  1E1Q A;  2ELJ A;  2M7A A;  3ZIA A;  1J09 A;  1KTW A;  4CCN A;  4ASU A;  3PSF A;  2XZL A;  2WA0 A;  2WB1 A;  4BDY A;  1SAU A;  1X1A A;  2M0M A;  4YZ0 A;  2GJP A;  3UR3 C;  2JA2 A;  2K9L A;  1Y6I A;  1DGW Y;  4II2 A;  2D3N A;  2VB6 A;  2QY1 A;  2W4S A;  3VSU A;  3PJR A;  2R7X A;  1VLY A;  2VJ5 A;  2XF7 A;  1LVK A;  4ZDP A;  3GBG A;  3FBN B;  1MW7 A;  4IQ4 A;  3OYH A;  2CV0 A;  1V0F A;  3A1Y A;  1QHH D;  1BR4 A;  2X85 A;  2M7B A;  3OYF A;  2HVR A;  1FMW A;  2VJJ A;  5FRN A;  3OY9 A;  1VZ0 A;  4ZDL A;  3KRG A;  4OJL A;  4OAZ A;  3S8P A;  2R7O A;  3HUG B;  1MNE A;  4E7I A;  3FPP A;  1NHC A;  2ZXI A;  2UWM A;  4P22 A;  2QE7 A;  3KEY A;  3M8J A;  1WJ5 A;  4FAS D;  2VQH A;  4DK0 A;  4G6T B;  3CMM A;  1UG0 A;  5HOO A;  3T51 B;  2GOM A;  2INU A;  2L9N A;  4HG2 A;  3OL3 A;  1BMF A;  3K10 A;  4BQO A;  4Z05 A;  2V31 A;  4F92 B;  4IQJ A;  2IXS A;  4G7X A;  3FBI B;  4OJO A;  3GQB A;  4D9J A;  2DT7 B;  2VKH A;  3IAS 2;  3A2K A;  1IB4 A;  3IP4 B;  3GVJ A;  2F5V A;  2NTB A;  3D5R C;  2VL8 A;  4E7J A;  2ZZQ A;  3CP2 A;  2KL4 A;  1WJE A;  2L5Q A;  3DEE A;  4F52 A;  2ZTN A;  3SDB A;  1JRG A;  3KX2 A;  3MMY B;  2R4G A;  4FET A;  1LKX A;  4YEJ A;  1DP3 A;  2ZZG A;  3G2B A;  2CMP A;  1BOB A;  2O0V A;  3L2V A;  1PYV A;  2R7Q A;  2DOA A;  1TZL A;  1WJA A;  2O1D A;  2W82 A;  3VST A;  1KCD A;  3OS1 A;  3SEQ A;  2RQQ A;  2R7S A;  2DXI A;  4PSX A;  2JJ2 A;  4B47 A;  2GOX B;  1BPL A;  1O8H A;  3OYI A;  4DIQ A;  4YRV A;  4E0F A;  3L2W A;  3QOD A;  2NOJ B;  3OYN A;  1UD2 A;  3PFY A;  2OUM A;  3DLA A;  4IKF A;  4JMQ A;  3AL0 B;  3DWL E;  3OR1 C;  1OR7 C;  2LY2 A;  3OAA A;  3TL4 X;  4HNU A;  3HL2 A;  1Z3X A;  3DPU A;  1WJD A;  3OYM A;  3DQV C;  2F1M A;  3W2V A;  2IQ7 A;  2V26 A;  3HPH A;  3I3L A;  3D5L A;  3K6G A;  4XKW A;  4BAC A;  4XN0 A;  2CW8 A;  4YZX A;  1MMD A;  3HAG A;  3OYA A;  4W8T A;  3E0J B;  5DN6 A;  2M4G A;  3B8Y A;  2K5C A;  2E60 A;  2ZSH B;  2DCE A;  2L2O A;  3OIP A;  1ERD A;  4NNJ A;  5TGT A;  1NRK A;  1IDK A;  2VBK A;  4YEL A;  4BE2 A;  4DNR B;  4U4B A;  2PJR B;  2AQE A;  3EUH C;  1BHE A;  5CQE A;  3ZRG A;  4B48 A;  3AFH A;  3W2A A;  3OW7 A;  1I8D A;  1G8X A;  4P1W A;  1KCC A;  2IGM A;  3DU5 A;  4XOT A;  1VBL A;  3EPZ A;  3DKY A;  2NT9 A;  4MXN A;  3BG6 A;  3VYS B;  2MFZ A;  3LSK A;  2ZFU A;  3DTE A;  1YX3 A;  3FDY A;  3FKS A;  2O17 A;  1K28 D;  2KPM A;  2XSJ C;  2MC4 A;  4W8R A;  2O0W A;  4YXW A;  2R9V A;  1YE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...