2VJJA

Tailspike protein of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
molecule keywords TAILSPIKE PROTEIN
molecule tags Viral protein
source organism Salmonella phage hk620
total genus 232
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjjA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjjA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjjA02
3ZPPA 1BN8A 1H80A 1O8HA 1AIRA 3JURA 2VBEA 2INVA 1RMGA 4W8RA 1JRGA 4Z05A 1O88A 1PXZA 1IDJA 2NT9A 2NSTA 2QY1A 4W8TA 4W8SA 3KRGA 1KCCA 3EQNA 4NK6A 2PECA 1PE9A 2QXZA 4MR0A 2PYHA 3ZSCA 1PLUA 4XM3A 2VBMA 4XN0A 2IQ7A 2BSPA 2O17A 3UW0A 4XKVA 4XLEA 4NK8A 4HWVA 4YZQA 2O1DA 3VSUA 4AVZA 2O04A 2NTQA 2UVEA 3EQOA 1DBOA 1KTWA 1VBLA 3B90A 1IB4A 3FY3A 1O8JA 3GQ8A 4OJ6A 3VSVA 4OZZA 1X0CA 1IDKA 2VJJA 1O8KA 4YEJA 1XG2A 4U49A 2PYGA 3GQ9A 4W8QA 2Z8GA 1EE6A 2EWEA 1O8FA 3GRHA 2NTPA 2NT6A 3WWGA 2O0WA 1O8EA 1IA5A 4XQFA 1O8MA 4XOPA 4YZAA 1DBGA 4PMHA 4XNFA 4XORA 1O8IA 4XLHA 4XOTA 1O8GA 4OZYA 4OJ5A 4Z03A 4C2LA 1KCDA 3VMVA 2X3HA 4XLAA 1OFLA 1GQ8A 2O0VA 1OGMX 5AMVA 3LMWA 2X85A 2NZMA 2VJIA 1CZFA 2ODLA 1HG8A 3GQ7A 1NHCA 1QCXA 2INUA 5C1CA 4MXNA 4YZ0A 4XLCA 2QX3A 4EW9A 1BHEA 4URRA 4XN3A 3VMWA 4YELA 3VSTA 2X6WA 1JTAA 1RU4A 1RWRA 4OJLA 4I84A 2X6XA 4OJPA 2NSPA 2X6YA 1QJVA 4XKWA 4XLFA 3B4NA 3GQAA 1O8LA 4U4BA 2NTBA 2VBKA 5C1EA 3SUCA 3T9GA 2UVFA 1K5CA 1O8DA 4XR6A 4Z06A 1OOCA 1WMRA 4OJOA 4XL9A 4XMYA 1OGOX 4YZXA 3B8YA 4XONA 1OFMA
chains in the Genus database with same CATH superfamily
1GJRA 1HLVA 2FX0A 5DUKA 1JUSA 3DKYA 1B1BA 1YTYA 4KJZA 2K9MA 1AIPA 1WJCA 2A61A 3F8CA 4MIMA 2W84A 3GF2A 2VN2A 3K4BA 4LLNA 4PGGA 2OK8A 2VBEA 1FOWA 5BNGA 3AVTA 1O88A 1JXSA 1UMQA 3R0AA 2DFIA 3CCLI 1CGPA 3MCZA 3ISXA 3HPGA 2QQ8A 5D6EA 5JR3A 1SANA 4LG0A 3I55B 3TP0A 5FGMA 4R1HA 3SFZA 1XX5A 2VONA 2ZB9A 4N3GA 2GQFA 1QHGA 5IT3A 1P92A 5K5RA 4LLLA 4F3QA 4E4HA 4C0SA 3LWFA 2XPWA 5LEKA 2ZJ2A 3DTKA 1YITB 1R6RA 2XF7A 3U21A 2K4JA 4UV8A 4NBQA 4BY1J 3OAAA 4YC5A 3FXLA 3GWZA 1QGZA 2MBFA 1PKVA 1HSJA 1POGA 5GADJ 3IWFA 1DDNA 1SMYF 2NOJB 2IEKA 3Q0VA 3GFIA 1DP7P 3HDDA 4PABA 3TH0A 1RZ4A 1X0CA 1TT5B 2R5ZA 5HLTA 2AO9A 4U7BA 1OB5A 2HDWA 2BW3A 5IOZA 5C4JJ 1V5FA 2EILH 3ES9A 4ITVA 2BM1A 2VBTA 4G6QA 4PGOA 1VQ4B 2YWHA 1FBSA 1HW1A 1OLTA 2G0EA 1UAAA 1XN7A 1MNEA 1XMKA 1ACIA 2KVOA 2DN0A 3GTGJ 2A6HF 3WWGA 1PP7U 2GA1A 3WHBA 1RIOH 2B0LA 1CLWA 3WNDA 2PQ8A 2XAHA 2KDZA 1A5JA 1W9XA 1HDPA 1ZGAA 4XOPA 1CNEA 5DCFA 1DPUA 2W25A 4TMVA 1Q1VA 4OPWA 5CYVA 1QRBA 2ZZEA 3WTSC 5CVIA 2VFNA 2WJVA 2LREA 1F36A 1JT6A 1XC5A 4HDUA 5BPIA 3RQ4A 1ZQ3P 4RLQA 2PMHA 2W7NA 2O6GE 3BR0A 4M2LA 1KTVA 4WQMA 4DQLA 3KZZA 2Y69H 5K7HA 2BY0A 2WR8A 4DYQA 3IH3A 5J8FA 1T6ZA 3HAGA 1T33A 1TLHB 3CMEI 2GK7A 4M9SA 3G2BA 3S15J 2Y9YA 1DQUA 2HLDA 5AIPA 3OY9A 1VF9A 3OMYA 4QLCU 4ZGNB 3G71B 2Z99A 1TUIA 3T8RA 1M1EB 4HF1A 4ZYHA 3DPLC 4JP0A 4N4OB 4DNTB 4ON0A 2QBYA 4I84A 3A3BA 1K28D 4YXWA 4Y13A 4B3XA 2O5RA 3CCUB 3BQYA 5AIQA 2DOEA 3AAFA 1O4XA 4BQNA 3FXUA 2JDIA 4WWCA 3SY2A 1T2KA 3H92A 4XR6A 3CLOA 3GBGA 2CRVA 3U6KA 2CC2A 1YJ9I 1Q86D 2Q0OA 5J3LA 1BR4A 2VQLA 3AVUA 1TC3C 2A3SA 4LOCA 1I6XA 4MNUA 3PUNA 1OFDA 3ZMUA 4FN5A 1J9ZA 4YFNF 1YE9A 3A2KA 2CW7A 1VHEA 3C7JA 1MBJA 4HZFA 3U9GA 3ZCOA 5JI6A 3JRCA 3HM5A 1R9TJ 3OJXA 1G2HA 1DGRM 1FNDA 1XGMA 4IQ4A 4YFOA 2NPFA 3M8EA 1O3TA 2RQQA 4KISA 2XC1A 3CC2B 2BGJA 2XKOA 2NSTA 3TO6A 1AU7A 1TW2A 1X1AA 4RGRA 2XPUA 3VWBA 2IS1A 1XE1A 2QE7A 1GAWA 3KRGA 3KPHA 3VB2A 3IV5A 1TWGJ 5DUIA 2PECA 3A1YA 1QZEA 2PBIA 4BUPA 4Y52J 3BG9A 2E60A 2F4MB 2BM7A 3MKZA 4QVAA 5J35A 1TZLA 4C43A 1K78A 1FP2A 1YJNB 5E1XA 2WAFA 4CH7A 1ODDA 4LBZA 1N05A 4P1VA 2LMDA 1MH3A 5HODA 3WGIA 3WG7H 1TVCA 2DOGA 1GHCA 3PUBA 3ASSA 4U0VA 2Z6BD 2K9QA 3AG4H 1PYVA 2V7FA 1WH7A 1PJ7A 3KEYA 2HZDA 3OV8A 2O6WA 3TQNA 4HYEA 2BHYA 2DMQA 3IAS2 4OU0A 4B1RA 4S04A 3BOQA 4M53A 4P2NA 1I7PA 4WK8F 2JSCA 1T95A 3LNNA 2CGPA 1YI2I 5FO0A 3W2HA 4R71A 3BCAA 1SFOJ 1YW8A 3HZJA 3IC7A 2LSOA 1XCBA 2HVRA 2PX9A 1FRQA 1WDTA 4HNVA 3V76A 2DA7A 3D0SA 4JOMA 1K8FA 2BX6A 1DDIA 3QE2A 4DYRA 4PMHA 3TOBA 3DKXA 4LJZF 3SDGA 3LQEA 4XLHA 4XOTA 1KRHA 3BNWA 4ZTFA 4X0GA 1O8IA 2G0YA 2C6YA 5BSXA 2HQNA 2QZ8A 1BI1A 3F3XA 2ZZFA 4EJTA 1HZEA 3N6ZA 4HDVA 1OFLA 2ZMEB 3JRDA 2EH3A 4AUXA 4P12A 3GZ5A 1FIPA 3FM3A 3PNYA 1XGSA 2IS4A 1UMKA 1ETWA 4MQVA 2Q1ZB 3BG7A 3ZQQA 1HG8A 3LMMA 2HFHA 1HKTA 3TEDA 3FX3A 3CC7I 2XZPA 1W36D 2IJLA 5LFAA 1IV8A 2BV6A 2WB1N 3HYIA 1H85A 5B6IA 3I58A 4AIJA 1XTAA 3I3LA 4XN3A 3LSJA 3PIOF 5TR9A 3BLYA 4GYGA 1PUFA 2NYXA 1S9HA 2MD5A 5J4YA 3Q5FA 1VQKI 4OJLA 2OZUA 1BBYA 2P6TA 5FKLA 3CD6I 4Q5SF 2HOEA 4IHYA 4A6DA 4G7WA 4OJPA 2EIKH 1Z9CA 4RDUA 3A8JA 4UV9A 1GV5A 1JT0A 2B7BA 1NG7A 3BG3A 3D1NI 1HF0A 5D4RA 5HS9A 3GTMJ 3I56B 3AVXA 3PSIA 1U5TB 2VFPA 3ZMZA 2QYUA 3DTIA 2P8TA 2VC1A 2AXLA 1X1BA 1FOYA 3D5LA 3HSFA 4GRIA 3VSLA 1GXPA 2O9LA 4G7XA 1WMRA 4OJOA 3CMAI 4XIDA 4YDTA 3KP2A 5CJ9A 3BG5A 1L3LA 2P0WA 1WRJA 3HTUA 4PUSA 4EJOA 4ZCIA 1FNCA 5L3EA 3OOUA 3HRSA 1QVGB 3R4KA 3JSPA 1AWCA 1BX1A 2KMUA 1FSEA 2M5WA 2M8EA 3QYBA 4AYBA 2H1LA 2WAEA 1LDKB 3S17J 4NK6A 4C2UA 3HKZN 1BIBA 2F2EA 4FE7A 2Q8KA 2HKOA 4G6TB 1Z91A 2L7ZA 3ZOBA 2VBMA 1H88C 3GTLJ 1OFCX 1X3WB 2M7BA 3S1RJ 1VQ7B 2RC6A 1EH7A 3NEUA 1OB0A 1E2XA 3A01A 1P6RA 4HPQA 4OWRB 4WF2A 1BLIA 1OPCA 1IB4A 2KRFA 3V7SA 3CCEB 1W7PA 2L9NA 3MQ0A 3OYEA 3S2WA 3F21A 2CV2A 3BWGA 2VKHA 2X53S 2MH2A 4BXFA 2EZHA 3NWSA 1GO2A 3RKQA 3CC4I 3QAHA 4N4NB 3QPSA 4C9YA 1B23P 3K4LA 2J5PA 3CF2A 2L9RA 1JKOC 2QA4B 4A3IJ 2R0QC 4WZLA 5DCMB 1KU3A 1UHSA 4PSWA 5GPAA 1JKPC 3DU6A 2CO5A 5LEJA 3AL0B 2DJIA 1B59A 4IW3B 2ISZA 4Z4UA 4DBQA 4M3EA 3NARA 4HW0A 4XQFA 5E3OA 2EFNA 4YIFA 1KK0A 2BSAA 2XKPA 3QPHA 1IZ1A 4AIHA 4BBSJ 2B5OA 2P4WA 2EIXA 4XORA 1SFXA 5LHHA 1KQ5A 2EA2A 3DEUA 5ICCA 4Z03A 1JGGA 1P2FA 1BI0A 3OOCA 2GPJA 1ZK8A 5HDNA 3N90A 3EYIA 3DEEA 2ELHA 3WXMA 4Y17A 1LE8B 1RPWA 3CJNA 1V55H 1BJKA 2X4HA 4LGWA 1CF7B 1ZM2A 2F1MA 3B6CA 1IG7A 2NOGA 3GVAA 2LDUA 3ZGKA 2QN6A 1OFEA 2M1BA 4OM9A 4URRA 4BHCA 4Q4ZF 4M3BA 1YHQI 1A36A 4G8XA 4L9NA 5FIUA 4KICA 2HQAA 4DW6A 3BY2A 2AHQA 2Y48A 4PK4A 1WFXA 1BQEA 1FLIA 3ZZTA 1REPC 5EEHA 1QQ1A 4FCYA 3HOZJ 4EQQA 2QGGA 4I99C 3ZR8X 2L5QA 3CDHA 5JFRA 3OW2B 4TV7A 5THXA 3OYAA 3CLQA 5H6RA 1TW3A 4Y15A 1MBKA 2BHZA 1XB2A 3E6DA 3N05A 1LDDA 2VQGA 1R1UA 2DA2A 1Z21A 1PJ5A 3F0CA 1K6YA 2G9WA 5J6XA 2ZBVA 2HPMA 3RY8A 5C1EA 2O61A 2EV5A 1YS6A 4BXUA 4CYDA 3BTJA 3CTAA 3Q9SA 3RJPA 1QPIA 1ZHFA 2WY7Q 3VPRA 2ICWG 4HE6A 1MBFA 5HZBA 4GCVA 3H3VK 4OOXA 1E3HA 3HL2A 3ONUA 4R8HA 1OFMA 1ORKA 2DDAA 3QU6A 2XSDC 2R9VA 1OQYA 1BN8A 3A3GA 4RAYA 3CO6C 1O8HA 5ERIA 4XSZF 1FYLA 2INVA 1VQ9B 2F43A 1PJRA 2VKDA 3I9V2 3L2QA 2LRDA 4A3KJ 5BOXA 2OTJI 2QEXB 3LNQA 1NRKA 2Q6OA 2HDNB 2E1MC 4AF6A 4CYCB 4I76A 2JQ7A 3R6SA 1OB2A 5D8LB 2HYGD 2QXZA 5D5VB 2VBSA 3LA2A 5F64A 3K2AA 1X2NA 1VQ5I 4KT6A 9ANTA 3FPKA 1YS7A 4RM0A 2FNPA 1R4MB 3KZIC 3M4OJ 1T56A 2V7VA 1LLZA 1WGXA 3IL2A 3HGGA 4L9TA 3WTYC 1Q7YD 2OJED 2QSFX 3OOPA 3M9AA 1XB4A 2R7UA 5FRMA 2H6BA 2M87A 3EUKL 1Q81D 4OIPF 1Z67A 1LNWA 3HSEA 4BQAA 3CDLA 2EV0A 2VXDA 1I3AA 1YLFA 2UXNA 3OIOA 2F5DA 2ME0A 5LRRA 5KHDA 2QTZA 1Z7LA 2C4UA 2GIZA 3DPTA 2MC3A 3M7GA 5E1ZB 4BPRA 1EZGA 2QWWA 4IQJA 2X1DA 5GTHC 1XD7A 3N97A 2PE3A 2CQQA 3SZGA 4HNTA 3VMFA 5LGNA 3OZWA 4D5CA 2STTA 3H3UA 1BOBA 1QPMA 3GRHA 5TY0A 2EB7A 2Z2SB 4IHVA 3K4NA 4KN4X 4RB1A 3FHZA 3GW2A 1TQPA 2R7QA 5IT9Z 4KH3A 3K2ZA 2WAQA 1QFZA 3EUAA 2Z1DA 3AK5A 1ZN2A 3OR2C 3E5QA 2TDXA 2DU9A 3WTVC 1FWZA 3I71A 1D1NA 3VOEA 4F7DA 1D5YA 2L9VA 3ZQCA 2BMWA 1H89C 1BW5A 6PAXA 4B43A 1XG1A 2D1VA 2WADA 3HXLA 4L5IA 4KKTA 3WQZA 3LMWA 3ISPA 3KP6A 1YX5A 2L2OA 1ELOA 2INUA 3H94A 1RUOA 1R5OA 1SKYB 2ZSIB 2V7QA 5GP9A 4NB5A 2X0LA 4TN1A 2B7EA 3HPHA 2B63J 4L9JA 1NBMA 3ASTA 1RKWA 2X6WA 3WE2A 1FZPB 1OCRH 5JHFA 2HDDA 1RWRA 2YPRA 4JX6A 3TDZC 3GO5A 3LSHA 2LYCA 4PGHA 4DK1A 1VQMI 2FXAA 2ID6A 5HKKA 3ZP5A 2EWNA 5B1AH 4EV0A 4KNYA 3B4NA 3DFGA 4UZEA 3MFKA 2OYNA 2BN4A 2KISA 2VBYA 4FETA 5DD8A 4BHBA 3SDBA 4YFKF 3CQZJ 3KE2A 4M74A 2I10A 5EDNA 4ZH4F 3H1CA 3LSGA 1R22A 4IEJA 4Z06A 4BYYA 1SM4A 1T38A 5B1BH 2ZITA 4FTHA 2YU9J 3W5VA 2GIVA 3QWLA 4R79A 5LRSA 4JX5A 2DYSH 1XSDA 4WZKA 3FBNB 2NVUB 1T5EA 1BJAA 2O7OA 4W97A 2RREA 5LBQA 1TNSA 3BH4A 3OYHA 3PO2J 3ONYA 1I18A 3I64A 2JA5J 2KP6A 5JLWA 4E7JA 2CQ7A 4TMTA 4LG3A 3WBJA 2F48A 3G1OA 3AVYA 1CQXA 4YAUA 2FRHA 2NT9A 1K61A 4RM3A 2ZNZA 4PJNA 2K4BA 1EJ9A 1Z3XA 2GZWA 4EEFG 1ZM4A 4YAWA 3PA1A 2G7HA 3BROA 3TBIA 1G3TA 4C3IJ 3VYUB 3S1NJ 3LSMA 4Y9UA 4XM3A 1I8DA 3ASPA 3GTOJ 1PDNC 1K4SA 2LY1A 5K7ZA 4L9VA 5JBQA 2NVQJ 1F20A 2EFPA 5FFXA 3MCAA 2VB6A 2E36A 1D3YA 1UD6A 2JK3A 3MMPA 2R7SA 5KAFC 1V4RA 3BZCA 1O8JA 5CVVA 1F60A 1ETYA 1IN6A 3MKWB 2H94A 1TP4A 2W48A 2DFFA 3SEZA 4P9UA 1O8KA 1U9NA 3M3YJ 1FDRA 2F5VA 1O3QA 3V7AA 3OFNA 4FX4A 2WBMA 4RAGA 1MMDA 2Q2EA 2V9PA 4XKBA 1F5TA 1COWA 3CCVB 1QUFA 3LFKA 1DUXC 1B72A 3QFCA 5FNZA 4UUTA 1YIJI 3KEOA 3GIRA 3OJWA 2LP0A 2CUZA 5J1YA 2IGOA 4FXUA 4WXDA 3P7NA 2CS3A 2ESHA 1WCMJ 4IPAA 1YJWI 1MRZA 3PM1A 1JKQC 3KETA 3KP4A 2JJ1A 4AYBN 5M5YJ 4OZYA 2BZTA 4OPOA 3T53B 2DMPA 1IN5A 2FD5A 4QWQA 4UVAA 2ELJA 1GLNA 3LSKA 3HUGA 2KZGA 3HOSA 1X1DA 4NQWB 3FHNA 4UZUA 5IP6A 3K70D 1ETKA 4A3LJ 1MMGA 1YLOA 2WV1A 1RRJA 3J7YJ 1NHCA 2JA8J 2OZ6A 4TMXA 1ENHA 1QUEA 3GZNB 2CNDA 3SZEA 1TQIA 2VJ4A 1OMIA 3RKYA 4YAOA 3K1MA 1Y0UA 1U0JA 3HTSB 1TTYA 3FMQA 2VL8A 1UD4A 1FOKA 2P5VA 5ICGA 2E2IJ 1I1GA 2L7MP 3RSNA 5IT9K 2QLZA 3FPPA 2DCUA 1LVKA 1G59A 3V8JA 2M0CA 4ZZDA 5CDFA 1KU2A 1I27A 1XFOA 2VFQA 1LFUP 4CCJA 1RQRA 1SVLA 1WJFA 2X6YA 1WJAA 4KIBA 2LZJA 3IAM2 4RD2A 4BQOA 2WV0A 2BM5A 1ZRDA 1WPCA 3SQNA 2VI6A 3IH4A 2A05A 1SMTA 2BXYA 2OC6A 3SXYA 3WNCA 3VMVA 1K5CA 2DERA 1EFCA 1FPQA 4KKSA 2W00A 1JHFA 3JQPA 3S3NA 1VLOA 1QNTA 4DOZA 1S6LA 3RTRA 3U1KA 3H9QA 3GVKA 2Z9OA 1IJFA 2CH0A 2DPDA 1FNBA 4AF7A 3JRHA 4I6ZA 3AGPA 2VBUA 1FTZA 2BGIA 3GVJA 3V8LA 1B8IA 1R00A 3FK6A 4KFCA 2R4GA 1Q82D 4YEIA 4TSFA 2XGCA 2A6EF 1FX7A 4O6JA 2Z16A 2WWYA 5H5JA 2J8IA 2BY3A 4DJAA 5HVQC 3W2FA 1FYMA 4P55A 2ZSHB 4ZDPA 1E3PA 3WHCA 2ZL7A 2O8XA 1QU3A 4PC2A 2V1NA 2KJBA 2XC7A 2VKVA 2E5NA 3CCMI 1VLYA 4TMZA 1APLC 1UB9A 1Z1DA 3W6KB 3P26A 2HQRA 3CP2A 2VNIA 2DETA 4HAMA 2Q6LA 1VQNB 3T0YA 2PJRA 1R5GA 4BJ5C 3DWLE 4OOIA 4HRIA 4RPBA 3AFHA 2OU2A 4BBRJ 3CUQB 3VSVA 2R92J 1GDTA 2JPCA 3FWEA 2K9NA 1FJLA 3JQRA 1OJLA 3T51B 4ACAA 3HOTA 1D5VA 1P7JA 5IP7J 3BT9A 2AXTC 1LKXA 3A4CA 5H20A 5BQTA 2B9SA 1UD8A 2XEXA 3I1FA 2ZJQF 1AKHA 4LBYA 3DBHB 3VODA 1E17A 2EWEA 4XLNF 3F8BA 2EIMH 1YRNA 2FE3A 1DGWY 2LD5A 2CFXA 2QQBA 3QFTA 1VNDA 2RVCA 4XNFA 1NTCA 1U8RA 3KZYA 3U6BA 5DDGA 2P5LC 2XOKA 3GMEA 4E7ZA 2E1OA 2XGXA 3IUOA 4Z6YA 1VQOI 1D8JA 2E1CA 1ZAOA 4GXOA 1KYZA 3BR3A 1KK2A 1KCDA 4RM2A 4M9XA 1YW7A 2JRTA 4M71A 4CCNA 4CGZA 4L8JA 1GQ8A 4HOBA 1NH3A 2V1UA 4KMFA 1W36C 5C4XJ 4JMQA 1H9GA 2X85A 3R61A 1KK1A 3GTPJ 2K3FA 4V19K 3B02A 2R5YB 3ZQ7A 4CXFA 1P4MA 2EFWA 3Q38A 3G6EB 2DK8A 1RC9A 1EP2B 4A3EJ 3VMWA 3WODF 2WZPP 3HSRA 4RBOA 2VIXA 4RB3C 1JTYA 3HRMA 2X6XA 2DA5A 4PC7A 1S29A 4BGDA 2BF4A 2I5UA 1VQ8I 2L02A 1O8LA 1UD2A 5TISC 4P22A 4GDFA 2NS8A 3G1LA 3HOXJ 2OPTA 3TGNA 4CZZA 3Q6RA 2XTYA 4RB0A 3JW4A 4MTDA 4MEXF 3Q0WA 1UD3A 1H8AC 2DCEA 3OSFA 4E7KA 4XRFA 3W2IA 5FD5A 1GR1A 1WP6A 2FQ4A 3V8KA 3F8NA 1HDDC 1VQPI 2XAJA 2DPUA 4FT8A 2WAQN 4XICA 1H42A 2HQ5A 3BR5A 3DEWA 4LBWA 2Y9ZA 4F93B 1QA2A 4UVBA 4RD3A 2TCTA 1WXRA 2NXNB 4ZDLA 4ZYAA 2IAIA 1KQ8A 1JB9A 1A35A 2VT3A 4P26A 1AIRA 4E70A 1Z7UA 3MZYA 1G3WA 4MYUA 1GV2A 2R7FA 3REOA 1JA0A 4NBSA 4UAJA 4BHPA 2XRLA 1E1QA 1XDUA 4B48A 4RD4A 1Z6TA 2ZL5A 2PMZA 1R23A 1O3RA 1KC8D 4CZCA 4N9HA 3LQ6A 2LVSA 3CPXA 2XGJA 5KCMA 1QHHD 1HA8A 1T98A 4MQ9F 2DFHA 1J5YA 4AVPA 3DDYA 2W57A 1D8KA 4Q48A 2OCCH 2EBIA 5FKKA 1IN8A 2KRHA 2CYYA 2ZXHA 4AIKA 2PYHA 4MR0A 2HXIA 2QUFA 4AC9A 4B47A 3C2BA 4N9IA 2PG4A 2L4MA 4U88A 3PENA 1Z77A 2CWEA 1IRGA 4XKVA 4Q47A 1ZG5A 1IF1A 1IRZA 2KDOA 3CW2A 4B09A 1ZGWA 4ROXA 4HF2A 4RD0A 1WSVA 1ETVA 4RAZA 3IRQA 1TNTA 3H5AA 1BMFA 3SJZA 3E5XA 4M6VA 5EGOB 2WTEA 4HBLA 1ON1A 1RKTA 4AWXB 4QFMA 4I09A 5E3LA 3G1MA 4UUSA 2CU7A 2O0YA 1S72I 2H8WA 3PSSA 1AOYA 2ISYA 2GJKA 2IGNA 2Z8GA 1IC8A 4G1BA 2K27A 1IRXA 1FX0A 2HZTA 5EG0B 3KIOA 4M3FA 3PIPF 2W1OA 1CF7A 4C3JJ 1QRCA 2M9HA 5IYCJ 1JJ2B 1IA5A 2LLKA 3GZ6A 4P96A 1X4OA 2L7KA 3I54A 1N06A 1ZH5A 1LFPA 4UUVA 2X8KA 3HHHA 4HSRA 2R7VA 1W35A 2M4KA 3T5XA 3CCRI 3H9NA 1DARA 4WXCA 1LPQA 2D2WA 2DMNA 5F04A 4FASD 5C3EJ 1AHDP 3ZC3A 4X1EA 5D5WB 1KQSB 1K9MD 2VBXA 1XQBA 4BL0B 2HU9A 4MHGA 2HVQA 4EJWA 2K40A 3F8FA 3K1PA 2LBFA 4ZJZA 5M5XJ 4BNCA 2BOLA 4U0WA 3R6KA 3VYSB 2PLFA 1I5ZA 2ETHA 3EETA 3C1DA 4FWTA 3OYMA 1MNDA 4X7DA 4X8IA 3WNBA 1W5SA 1X19A 2RKHA 3LYCA 4A2UA 4UZFA 1RU4A 1J09A 2IS2A 4Z1MA 4OAYA 1RESA 3KFWX 2PJPA 2IGKA 2IVMA 1NB0A 3Q6QA 3Q3AA 3GTKJ 1HW5A 4EH1A 1DU0A 1IXCA 3PQKA 2EJRA 3WTWC 4RB2C 3LQQA 4RGUA 2YWEA 1VI0A 2B0RA 1K73D 2HVSA 2ZTGA 2RV8A 2A69F 1W5TA 4OOSA 3NE5B 5GTIC 2D1HA 2LG4A 1O8DA 1W0TA 3OYBA 3WTZA 1UELB 1D0YA 1UHWA 4ETSA 1OGOX 1ZTRA 2WA0A 1IB0A 1QGPA 3B73A 2X1CA 3VEPA 1ETOA 5E3MA 5HNHA 1N0VC 5LHGA 1W34A 2VJ5A 3CB4A 4ZV4A 1QQIA 1Y8QB 4A0XA 1MDMA 2F6CA 5J1RA 1J59A 3BTCA 3WU1B 5DS0A 3SEJA 5TJJA 4ENNA 3QFRA 4LG0B 3L7WA 3CRZA 2A07F 5K1YA 3ZBTA 4OAZA 2BGCA 3CJQB 4YFXF 2ZZQA 2QY1A 1EXMA 2HOAA 1HXDA 2RN7A 2QQAA 1YX3A 2LH9A 3ECHA 3WU2C 3FXQA 1QBJA 2DIEA 1YO5C 3PFYA 1KJZA 4M6YA 1J0RA 1G7RA 3F6VA 1TTTA 1GT0C 1OKRA 1G3SA 1O3SA 3P4GA 4A69C 3ZUGA 3CCJB 4A3DJ 2HEOA 4QIWN 2R93J 3FXRA 2R5ZB 2XAGA 2V6EA 3CO7C 5JLVC 2BW3B 1ZM9A 4DGWB 1T39A 4C30A 2V7WA 3S1QJ 3GQ8A 4K2EA 3KLOA 3L00A 2NVTJ 4UXNA 4FX0A 2BVLA 4LB5A 1UCRA 2E5ZA 1IUYA 5HXBA 1A04A 3H9GA 1HW2A 3BH6B 2RNGA 2ME6A 2XNDA 2O3FA 3Q3SA 4XRSA 5ICEA 2P7CB 2UXXA 2K02A 3HRTA 3MKLA 2VZLA 4HV5A 1O8EA 3Q9VA 1KQ9A 5HOOA 1MMSA 1ZGJA 4IHWA 4JBAA 4V2GA 5J47A 2DDBA 1T8IA 2ZXWH 1J9IA 4G12A 4HQMA 3GFLA 4G6DA 5FO5A 5GAHJ 3LL7A 1QH0A 4OJ5A 3IWZA 4RAFA 4U0YA 3MN2A 5F0HA 2MG4A 1DPRA 3W2VA 2GOXB 4NC7A 4XK4A 2DA3A 2QM3A 5B66C 3F6OA 1Y1VJ 1CZFA 4IF4A 3CCQB 1IDYA 3R60A 2VPLA 3RIRA 4LMYA 2DOAA 2PI0A 5FA6A 4BXXJ 1YOVB 3KEWA 3FBIB 1WOOA 2KJCA 2P3MA 1ZLKA 3TW7A 4H0EA 4PJLA 2I1LA 2OBTA 2F3LA 2QBYB 1QGYA 1HSTA 3IP4B 3QU3A 1Y6IA 4S05A 5GV7A 2OTLI 4N0BA 2LY9A 2ZL6A 1VJSA 4TMWA 4AC0A 2FVGA 3FXKA 4IO9F 4BS9A 2DODA 1GVDA 2E7WA 4E6KG 4BY7J 3J81Z 2DYIA 1TT0A 1STZA 4GGGA 2BVNA 2VBKA 1QVUA 1MBEA 1TSPA 1EKEA 3A35A 3BG6A 1BM9A 1W0UA 2DXIA 4WZTA 4Y9RA 5F08A 4EMSA 5J4VA 2K86A 2L9SA 4L5EA 5FB2A 1BR1A 1B9NA 2FBHA 4LIUA 2FNAA 1QA6A 2E2JJ 1MJAA 2EFOA 1JJ6C 4M1KA 3I55I 3X2QH 1KQ0A 1KONA 4HNUA 5A2QZ 1IJWC 1IJEA 5F1RA 1WJ5A 2JN9A 4Z05A 3DBRB 2GXGA 2CW5A 3LA7A 1GAQA 2IXSA 4HLXA 1JTXA 1A6IA 4CDGA 1YITI 4W8TA 2A5YB 5HDGA 2HOTA 1WPKA 2KRCA 4II3A 2XRNA 1K78B 1YQAA 3JAMZ 4PJMA 2HS5A 3VYRB 1HVXA 1IXSB 3OL3A 4G7OF 1K8AD 3VSKA 2DQRA 5EJCA 1ETQA 1MD0A 5H6QA 1AMOA 4A3GJ 2E71A 1Y39A 1WOPA 1G7SA 3FMRA 2CQNA 3BY1A 3CCLB 2EIJH 1HBXG 1LEBA 4QVJA 2FU4A 2FOWA 3DCFA 1VQ4I 2CUFA 3B8HA 2O04A 3QP6A 1WI3A 2M2EA 1VBLA 4Y33A 1U8BA 3ABTA 4EJVA 4WXHA 1L0OC 1HC8A 2YX7A 1BX0A 3OYFA 2C77A 4BEHA 2GM4A 1FSHA 3I59B 3ZQGA 3CMMA 2H27A 4Y7CA 3H5RA 3OSGA 3GTJJ 2F1LA 3RZDJ 4NQWA 2C5BA 2K9LA 5FKMA 4M3GA 1F4KA 3AGQA 1ZKGA 3CF5F 3SLDA 4W8QA 2A6TA 3OS2A 3S16J 2BY1A 2H1KA 2FMLA 1SFUA 3V7CA 1VHOA 2L0KA 4Z4SA 4P1WA 1D1BA 2KIUA 5FJ8J 2BM6A 5M3MJ 4F55A 3I4MJ 1DBGA 3CJTB 3FJOA 2XIGA 2H6CA 2PMZN 2RNJA 2WY8Q 4G1VA 4YCQA 3V42A 1VZ0A 2QKLB 1OYIA 3K70C 4ZTJA 2LKPA 1S4MA 3G05A 1EH8A 2XAUA 3G71I 3KLNA 5FLVA 1LQ1A 5DD4A 2O0VA 3R0JA 4BQQA 3S3OA 1VFCA 4LFUA 1WVRA 1VQ6I 2HWVA 3KYDB 1BW6A 5HLHA 2D3LA 3O8HA 1MMAA 1PUFB 4AM3A 1Q9SA 1LB2A 3CCUI 2MLKA 5L3CA 4JYKA 2F5FA 4A5MA 3OE7A 2GJRA 3VSTA 2N8GA 2MGQA 2ZJPF 3ML6A 2XV4S 1JJ8C 3MHPA 3BTIA 1NG6A 2PEXA 1X4PA 1D2EA 5K7FA 4PDKA 2IS6A 1R1VA 4XLFA 3CMEB 1TBXA 2MD0A 1TWAJ 4NUBA 2D74A 1YIOA 5D6FA 3TKYA 4YIRX 1TYXA 5ILVA 3B82A 2XGDA 5F0FA 2ZBUA 2CV0A 5KSWB 2Y30A 2UVFA 2C5HA 3LSIA 3W2WA 2EZLA 4EVIA 1USTA 4I2OA 3BJ6A 3O8GA 3RYRA 1OOCA 2XGEA 3CC2I 1KU7A 4DNCA 4TT3A 5F4JA 2DA1A 3A8IA 2OBRA 2NVYJ 4RLFA 3NWTA 3S1MJ 2Y0SA 1T6YA 2HKXA 4IRGA 3OZVA 4P3YA 3T56B 1OYYA 3RIQA 4A0YA 1HKQA 3DF8A 4D9JA 4A6EA 1K4ZA 1FC3A 1FMVA 2BE5F 3C2GA 2QF7A 4O5VA 2MYSA 1YJ9B 1QRYA 5EZGA 4OIOF 2L01A 1TL8A 3LA3A 1XGNA 3J81K 3CCSI 3PJRA 3A1PA 4W8SA 3RZOJ 2ZJRF 2OBSA 2QTLA 5LHIA 1KD1D 1NJID 1QFYA 4C2TA 1H8EA 4IXAA 2XROA 2DT6A 3OIQA 3ZSCA 2YUSA 5GAGJ 1M1KD 2KIQA 2ZFWA 3AG3H 3A01B 2BVMA 4XN0A 2IQ7A 2LF7A 2P7VB 2V1XA 3W2EA 1WKMA 3CPWB 4WCGA 2O17A 1W7PB 1OCZH 4LD5A 1KZLA 1DABA 4QPQA 3OYLA 5A8AA 5B3SH 5FKOA 3UNGC 1KGSA 5A2QK 3OYIA 1RUNA 3BTLA 2BBYA 3FY3A 1WQ2A 1ZUNB 3P27A 3BP8A 5FRNA 1GUUA 3BZKA 3NRVA 3BC9A 2FUG2 3OYJA 4L18B 1IDKA 2M0MA 4HF0A 4QPOA 1XG2A 3RCOA 2RQPA 2DJNA 4MEYF 2R3SA 3ZMSA 2QKMB 4HLYA 2K7LA 3SKBA 3JAMK 3ERED 3R6JA 2IW5A 4DIQA 2QZAA 3AKZA 2RGVA 2R5YA 4M72A 3PUMA 1R7JA 3LO8A 2NS0A 3E1YE 1O8MA 3B6AA 4LK1F 4E7SA 4E0FA 4RMNA 1SFKA 3CCYA 1YI2B 2ZTNA 3M8FA 4LBVA 2HGCA 2HYJA 3CUOA 3OR1C 4M3DA 2X3HA 5KNLA 5E6TA 2YWFA 4W1UA 2VOPA 1A31A 2JRMA 4L0ZB 4KDPA 3S2DJ 2M3AA 3CESA 3DLAA 2GLOA 3LSTA 2X9DA 5IYNA 2XZOA 1U9OA 1V5GA 2GAUA 2QGUA 3J7ZI 1E79A 1JNYA 1B9MA 2E35A 1RNLA 2YU3A 3MAJA 4LITA 5L3FA 4E7HA 3I56I 4ENMA 1T6XA 1LJ9A 5FO1A 1SD4A 3OYKA 3FXJA 3W2GA 4MO7A 1IRFA 2ZMEC 3A02A 3W5UA 2LY2A 2CJJA 2DFEA 4RDJA 3B78A 2PFBA 1QX4A 1FBQA 3BJAA 3LQRA 5DS9A 3SYTA 5FD6A 1LM1A 3IKTA 3G4SI 3CC7B 1PP8F 1GXQA 4FK8A 3ZMDA 1K7AA 5FFZA 1LUJB 1Y1WJ 2D3NA 1Y0NA 4HX8A 2M30A 2XAQA 2LK2A 4ESFA 4B3GA 2C78A 1W1WE 3H9JA 3H0GJ 1VQKB 1I50J 1Y56A 3CD6B 1YYVA 4G9YA 1QA1A 4PFPA 4FQGA 2STWA 3W5HA 2GREA 3B8YA 1W0KA 4II2A 4RJLA 3DBLB 1G7CA 3ZPPA 1GVHA 1KA8A 1OR7C 1U5TC 2MABA 1HKSA 2EZIA 1TWFJ 2K9SA 2E1BA 3BQZA 4BH9A 2DLLA 1S7EA 4DBRA 2BM4A 4HA8A 1ZLJA 1VQ7I 3CMAB 1Q1HA 1ON2A 1RR7A 3S8PA 4ZGQB 1FTTA 3L2RA 5FLMJ 3JU4A 3FKSA 2OQGA 3OEHA 1VQLI 2ECCA 5L3DA 5A88A 1RQPA 1Y8RB 2JPBA 3K6GA 5AN9A 5F27A 2VFMA 1WJBA 1HQCA 2CF4A 4XD7A 3H36A 3DPUA 2XF6A 4CUGA 1K83J 3FKIJ 3AG1H 4XLEA 5EG0A 1ULYA 1MKMA 3I4PA 3FM5A 1EH6A 4KITB 2QA4I 3PNTA 2NNNA 1QZYA 2RAEA 2V7UA 2V7XA 1KTWA 2XT4A 5E3NA 2K3PA 3OS0A 3HC7A 4PJ0C 1OCPA 2DMUA 5E8GA 3RKWA 4ABZA 2BV3A 2WYRA 2EINH 2W6IA 3K1NA 2VBVA 3T8TA 5DN6A 4NC6A 3G73A 4CCLA 4HEA2 2FF4A 2L54A 3TL4X 4BDYA 2DMTA 5DNSA 1A6QA 4IRHA 4IVNA 5IYQA 2KT0A 4KUMA 3JTHA 3V7RA 2W82A 2VE9A 2OD5A 5FKNA 2PN6A 2JUGA 1QA3A 1S0UA 1TYVA 3GQBA 4ZYDA 3O3KA 3C2HA 1OISA 5TV2A 2ADUA 2R7XA 2LC2A 3CC4B 1EF4A 2XTWA 1F1ZA 3S93A 3TDUC 1ZG1A 2YUHA 3SJPA 1SAUA 4PSXA 4RLZA 2COBA 4U7DA 3AL0C 2X0KA 5DSZA 3F9KA 2M4GA 5D5XB 5HS7A 3M1CA 4XLAA 1XPXA 3I4NJ 2H09A 4KIFA 3GYHX 4KKUA 2G7UA 2ODLA 1OHHA 3RDIA 3BDDA 3RYPA 2ZMEA 1IV6A 3LJYA 3HHGA 1RI7A 2XT2A 3D26A 2R7ZJ 4EW9A 1V54H 3DKWA 5IYBJ 2AS5F 2DTRA 1BA5A 1MBHA 3JCUC 4BKXA 1ITYA 3ECOA 3BR2A 2VKEA 3E1SA 4YRVA 4IOAF 1B4AA 2PLYA 2OV7A 2YR2A 1V5VA 4WX9A 1QJVA 3K4CA 2KFDA 2RDPA 3GQAA 4M73A 3P9IA 3MWMA 1X1CA 1J2XA 1YHQB 1TWHJ 4J19A 2WC2A 2DYRH 5IK2A 2LF8A 3TO9A 2WJYA 1VQ9I 2DI3A 3K9TA 5DYMA 2QEXI 3GSIA 5IYRA 2OUMA 5KW9A 5EYRA 2KZVA 1OR7A 1U5TA 3GTQJ 3U2QA 1F43A 2E1MB 3OW7A 1Z6RA 2GOMA 1W2BB 1E3OC 2ZKZA 2ZFUA 3D5RC 5F0CA 4JX4A 4OINF 3H3ZA 4CA0A 3HOYJ 4UNOA 2ELKA 5LGUA 4KT5C 1ZELA 2X6OA 1DU6A 4J01A 3QPLA 2FEZA 1MGTA 1WU8A 3I53A 4GYIA 2D9RA 3PSZA 3OYCA 2V31A 5D8KB 1YW9A 1QVFB 5CVRA 3OEEA 3FDYA 2AQFA 3KCCA 5L3BA 4HIZA 3SYJA 1EFRA 1ERDA 1R4NB 3OL4A 1IHMA 2M5SA 2IA1A 2E34A 4I0BA 4IJAA 3ROUA 2NNYA 4NNJA 3J7AO 5D4SA 3I0TA 2MC4A 4ESJA 4Q7JB 4X06A 2OTJB 1IGNA 1EWYA 4O3MA 1EP1B 3FK7A 1BPLA 1G8XA 3HOVJ 4IHXA 2Y2ZA 4JQFA 5CVJA 4Z4YA 5H59A 3UW0A 4M9ZA 4QV2A 1N0UA 3ASOH 5E18F 5FLXZ 3KYCB 4YZQA 3VSUA 1OGJA 3TP3A 2V26A 3ZN0A 2BPOA 4Z4ZA 4AIDA 4BJ6C 5EEGA 5DTDA 4X07A 1BR2A 3GQ9A 2M8GX 3F72A 2HCJB 2ZC2A 1VQ5B 2Q2EB 4QUZA 3A03A 1B72B 1HOMA 1SD5A 1X3UA 5KAIC 3RKXA 2H8RA 3S14J 2W24A 1OYWA 4ESBA 2PYGA 2KIFA 2Y0SN 1E3ZA 3WGHA 3K4KA 1E0EA 4P3IA 5BS6A 2BM0A 2V9VA 2KIMA 3FF5A 3OYGA 3COAC 2NVXJ 2CQXA 4YZAA 1UZCA 5DCMA 4D7NA 3MEXA 3HUGB 2JZYA 3KEQA 3QPTA 1SFEA 3WGGA 3JR9A 4M4SA 1VQ6B 2V1DA 1NHAA 3DP7A 2JT1A 4YG2F 5LLQA 3ZPNA 4F91B 2MH9A 3QOEA 5H2FC 5C44J 3F22A 4KYWA 1UD5A 3VO2A 2JA6J 3WY9A 3HRUA 4OPSA 3CZ6A 4P25A 3MMYB 3K0LA 4KMUX 1ZREA 1FEXA 2KHMA 3CJRB 3BC8A 5C1CA 4CICA 2BY2A 4X0CA 1LE8A 4ZCLA 2Z33A 1W87A 5F4MA 4PZJA 4MLOA 1B6AA 3VO1A 2QX3A 5JMCB 2E1RA 1ZR2A 2V5IA 1F9NA 1WSUA 1KZHA 1WHUA 3F8MA 1J7KA 1LVAA 3PO3J 5IYWA 1XMAA 3O2PE 4V2FA 2CUEA 1XS9A 3Q39A 1OCTC 3M8JA 2V79A 4G6IA 3JSOA 5J3OA 1Z3YA 2PIAA 3K10A 1X3ZB 4U4BA 3HB9A 4G7HF 2NTBA 3KP5A 1SVOA 3HJEA 3OPOA 5DV5A 3K7AJ 2ZXJA 1O7LA 3AVWA 1D0XA 1N77A 2IT0A 3IH2A 4HSTA 3SJMA 3MZHA 1DP3A 4DQ2A 4IZZA 1VQMB 1TYUA 3SZPA 2QMUA 2F4OB 2CW0F 5L3GA 2XSJC 1B8IB 2DO7A 5J8CA 2XHKA 2J5OA 2M7AA 3CCSB 1D8TA 1H80A 2VUMJ 5HNFA 1O7FA 1FP1D 3JURA 5IYDJ 1IN7A 1LEAA 2EQRA 3QP5A 3MKYB 2Q6KA 3RI4A 3VR6A 2KLOA 4I0AA 2A68F 4PJJA 2LFBA 4S0HB 4A3CJ 2JMWA 2R6HA 2DA6A 2KKOA 3A8KA 1S7AA 3ZMTA 5DM7F 4Z4TA 2JA7J 4IL6C 2CBXA 4XLPF 1W0JA 3I59A 4CYCA 4Z4RA 1XSVA 1BL0A 5KK1A 1ZM3A 5F1JA 1H0MA 4P6VF 2HXOA 3JREA 2X1EA 3JX8A 2AQEA 5J1UA 2PJRB 4UY8I 1DG1G 2FBKA 2VASA 2LTPA 3ASNH 1MABA 3PVDA 5GAEJ 3DLLF 3CXCB 2BSPA 2OQRA 1L1IA 2UUZA 3BPVA 3GUDA 3CCVI 4HWVA 1WJEA 4Y7NJ 5L46A 1ZRCA 3ZIAA 4U9UA 1LLWA 1MBGA 2V6CA 3WBKA 3EQOA 4B4DA 3L2WA 3BPXA 1YFHA 3OZUA 4BE1A 1FNNA 2FA5A 3ONQA 2YS9A 1BC8C 1AKHB 2GJPA 2ZZGA 3LAPA 4IRIA 1I3QJ 3OYNA 4OOVA 3BH7B 4I01A 1KYWA 3HG9A 1YRNB 5IYPA 3JRGA 1EE6A 1IW7F 4NC8A 4UB6C 3J81k 1O8FA 5EEAA 1IUFA 4GQNA 1P4WA 1SVMA 2ZNYA 2VLAA 1V0EA 1SD6A 3ESWB 1DDGA 4YAFA 3U1DA 2QDXA 5FLXK 1FRNA 3ZQFA 1S3JA 1QZZA 3LOCA 3C3WA 1UG0A 3F23A 3WYAA 3SEQA 3FZVA 2UWMA 3OP1A 2QVOA 1TQMA 4C2LA 4RD1A 2BXZA 4HV6A 1FYKA 3PFIA 1YIJB 1VTNC 1JKRC 1S5LC 4RD6A 1OGMX 4H4KC 4XSXF 1MW7A 4LC0A 1XSXA 2WSSA 3EQLF 1QCXA 2O8KA 2VYQA 1YJWB 4ZZLA 4MXNA 2K85A 1P7IA 4XLCA 4A3FJ 1NK2P 3G4SB 1BIAA 3W2AA 2XB0X 3ZZ0A 4X05A 1BHEA 3EDPA 1V3FA 2GA2A 1WOSA 3UKGA 2DT5A 4PAAA 3ZBUA 2FOKA 4AD9A 1JTAA 5IPAA 2EA4A 1T0FC 1R5BA 1XDSA 3E20A 2CW8A 2J7KA 3SFIA 1S8NA 2A5WA 2DA4A 3RQIA 1FNMA 3GCMA 2E19A 3FXOA 2DBBA 5HDKA 2JA2A 4NDLA 4BE2A 2ZBKA 2VT2A 3L1PA 3WTXC 2DY1A 4QSHA 5CQGA 2MLGA 3H09A 4IOCF 4RA2A 3ZPLA 4A0ZA 1N25A 3E6BA 4XL9A 1V5EA 4PC1A 4EATA 1K79A 3ZN1A 1WSRA 1HCRA 3OS1A 2X51A 4A3MJ 1Z0XA 1N08A 2ID3A 2K5CA 4DYCA 3AVVA 3T1BA 5CKTA 3H35A 2JSPA 3LVBA 2GK6A 2BYVE 3BJOA 1BN5A 1JHHA 3W6VA 1VQLB 1MJBA 1RMGA 4W8RA 1E64A 2XVCA 4L0YB 2LOOA 2YSRA 3PSFA 1PXZA 4C3HJ 1AA7A 2W6JA 1IDJA 3H5NA 1N07A 3IHUA 4E7IA 3C18A 1G7TA 1WTHD 2ESNA 3S32A 2VQCA 2FMYA 1VQNI 5JHUA 3FISA 3QYFA 1KCCA 1EFUA 5HS8A 1PE9A 3GXOA 2P5KA 1FOXA 4M6XA 1D1CA 3GLXA 2XB5A 1I39A 3ABUA 1EA3A 3ASQA 5A89A 2CV1A 1LDJA 4Z4WA 2LNBA 3LFUA 2Z5UA 2KQRA 1OCCH 4KIGA 4CSWA 1Z05A 1V0FA 1M90D 4K1XA 1R5HA 2XASA 3A0HC 3L2CA 2QCOA 3KP3A 1YG2A 2EFQA 3LSRA 2R7RA 2UVEA 1DBOA 1FT9A 3ZXSA 2GXBA 1PJ6A 2BEOA 3CP8A 2FQ3A 4UUSB 1ETXA 3K69A 4HQEA 4LLGF 4OJ6A 3OKXA 3CCMB 3CDIA 1BI3A 4OZZA 1TLLA 4DNRB 2JN6A 1NK3P 4HG2A 4D5FA 2QSHX 2JWTA 4U49A 2F5EA 1JGSA 1QO0D 4ZCMA 1ONVA 2HPIA 1R5ID 2JVHA 1R49A 3HOWJ 4IHTA 4D7MA 5AONA 2RC4A 4BACA 1W7PD 2VNHA 2JJ7A 2OCEA 4OIQF 3VFZA 3JTGA 4L5JA 3CUQC 4YHBA 4LIVA 4C2MJ 1R36A 2L7FP 4F52A 5GPCA 4XKCA 3BCFA 3LAJA 5IOYA 3S2HJ 3DV8A 5GV8A 5E20A 4ENKA 4B3FX 1JI8A 1I1SA 1ZR4A 3G6EI 4B44A 3JRFA 2XNJA 2Z3YA 2I8DA 1WWXA 3PA2A 5F6FA 2VNKA 3V4GA 1U6GA 4MFEA 3W6JB 2D45A 4UHTA 5LGTA 5CQEA 3GFMA 3DU5A 4A12A 3S3MA 4A5NA 3WU0A 2LBFB 4IHSA 4HX7A 5AMVA 4ZYEA 2NZMA 5K5QA 4ZDOA 2CMPA 3WG9A 3QOPA 4D1QA 5IY5H 4J0QA 5DEQA 3K4MA 2MFZA 1IAWA 1GVJA 3EPZA 2XF5A 5BMZA 2UV1A 4NCNA 1VQOB 3JRAA 1P9QC 1T0FA 2VBZA 1X58A 3QSYA 3VNVA 1E43A 2EK5A 2VNJA 3DQVC 3UR3C 5FROA 4RCYA 4FE4A 4RDLA 3SHFA 3PL8A 3PNVA 3JRIA 2FX3A 4FHTA 5DM6F 5IP9J 1BC7C 1WZ2A 3BY6A 1SEUA 3ASRA 4UB8C 5EZHA 3OWTA 2IGMA 2NAZA 3W3CA 3WTUC 4OMYA 3BZ6A 2XPVA 3TO7A 1Y0RA 3RPQA 3GLLA 1H9TA 2DT7B 2VE8A 4U87A 2FBIA 2CSOA 1EV7A 2IA2A 4EM1A 1K4TA 3FMSA 3QFSA 3T9GA 3G3ZA 3KP7A 1MIJA 4ANJA 3BR6A 4I98B 1RR8C 1KU9A 1MSEC 4XMYA 3ZQLA 2NS7A 3QODA 4F7ZA 1MDMB 2E1NA 4G94A 2YX4A 2WPDA 1TYWA 4MGRA 1VQ8B 2QYOA 2CRGA 4V02C 1XCVA 1G6NA 1SC7A 4E7LA 2R7OA 3E6CC 2DK5A 2UZKA 5E17F 3EYYA 1JUPA 2GXAA 3AG2H 5KVRA 1E63A 1JRGA 2HR3A 3WE3A 3LSPA 1EP3B 4JRAC 2RC5A 1ZARA 2VXZA 2KL4A 4RGSA 4OIRF 2X3UA 1U2RA 1VQPB 1PUEE 1JE8A 4JK1X 1VF7A 1WH5A 3ZZUA 1O57A 4P9FA 3TOAA 3A0BC 2O03A 3ERMA 1W4MA 3PQJA 1ZG3A 2R7TA 1MNMC 1U2WA 2ACJA 1KMHA 4ZC3A 4I02A 4DK0A 2HDCA 2QQ9A 4FISA 4M0LA 4HX4A 5JVTA 3J80Z 2C4TA 4NK8A 2OF7A 3VNUA 3EUHC 1QGAA 4MYTA 2HTSA 3QYEA 5HLIA 4NHJA 2JUCA 1E1RA 2O1DA 2D5VA 3FKJA 5JLXA 2NTQA 5ICFA 2LR8A 3B90A 4BE0A 1C0WA 1TWCJ 2Y0MA 3J7AY 1EFTA 1YJNI 2WZNA 2L3DA 3P5JA 5J40A 2VJJA 3OIPA 4Y3OA 1R5NA 4GO1A 4OMZA 1XMXA 3CUQA 4BAYA 1LFBA 3HGYA 1QFJA 2XNCA 3ABMH 4BU2A 4IX7A 1HA3A 2C2WA 3ELKA 2Y75A 3I5UA 3M07A 3ZMVA 1FIAA 2NTPA 2MA3A 2O0WA 2VQHA 3MVPA 4B4CA 4EM2A 3CMYA 4WZEA 2W4SA 3FXMA 1N8RD 3K4JA 2GBYA 1MZBA 1PVEA 2CG4A 4KA4A 4ENJA 1S72B 1O8GA 2Q6IA 4ASUA 1P4AA 2XAFA 4DZPA 1IN4A 1H8HA 3E5UA 1HF2A 1MJ9A 1BI2A 2IPQX 1S7OA 4I7HA 3HBLA 2YWGA 4CHUA 5TRDA 2VJIA 3PUFA 2E2HJ 2MW8A 2V7TA 2DOFA 3KYLA 2J8KA 4XBFA 1N75A 3CCRB 4RDKA 2XDVA 5ILUA 3HEFA 1D1AA 4QTRA 1BJZA 2HOSA 1B2RA 1E62A 3D5SC 2EV6A 2ZXIA 4D0PA 4YELA 5FL7A 1KK3A 3ULQB 2IRFG 3P9KA 2HMAA 5CLSA 3GVLA 1T08B 2HTJA 2V4JC 4N3NA 4MTEA 4EJUA 2NSPA 3DTEA 4CCMA 3N4MA 2V9KA 3E97A 4DZJA 2F4NA 3L2VA 5F4OA 2IP2A 4YIIA 5TGTA 2ZO4A 3SUCA 1A8PA 3SLNA 4HE5A 2XUBA 4UVCA 2MSYA 4F92B 2COMA 5M5WJ 1Y0YA 2KPMA 4XRSG 5HLGA 3WTTC 3FIWA 2LKSA 1SAXA 1R1TA 2PMDA 4EM0B 3RPUA 3OYDA 3JRBA 1ZRFA 4XONA 1K6OA 3ZQIA 4YZXA 3L09A 1MMNA 3ML3A 1FMWA 1U3EM 1QG0A 1OCOH 5EF6A 1U78A 2R7WA 2GQQA 3NAUA 3BCBA 3IKVA 5CPRB 4RS8A 4P5OA 4PC6A 2CFOA 1SKQA 1NDHA 1R58A 2E7XA 2HI3A 3E6MA 3KX2A 3CCJI 2M34A 3Q0UA 3PETA 2DQLA 2OA4A 4ACBA 1QVTA 2OK7A 2GWRA 3SZTA 5E8IA 4CCOA 4CO8A 1ZYRF 4BDZA 2VOOA 4J00A 2V4DA 3EQNA 3L9FA 4XRMA 4PFOA 5K5OA 1UFMA 5ED4A 5EMNA 2AHOA 4H9GA 3ZQHA 1D0ZA 1N78A 5JVGF 1PLUA 3EUHA 3U2RA 2DW4A 2QENA 1T6SA 2F5CA 4RGXA 4QHYA 4G7ZF 1UG2A 2CUJA 4AVZA 4EGZA 2WB1A 5LD2C 2EPFA 1X1PA 4X7FA 4BEHB 2EFGA 1NB9A 4X6AJ 4OP7A 2ZCWA 1WJDA 3E7LA 2B7CA 4OPVA 3NAWA 2DTZA 1P4XA 4Z2YA 2M45A 3HOUJ 1JUMA 3RPUD 1FY7A 4PC3A 4MFDA 3BR1A 4CCKA 4RPDA 4YEJA 1WI9A 1WORA 3BCDA 2W85A 2VPRA 2CQKA 4KN7X 5EGOA 2W7ZA 2OBPA 3CCEI 2XTXA 1JA1A 5E1WA 4P9SA 2IBDA 2NT6A 4DQKA 3QQAA 2EZKA 4A93J 1FBUA 3MD2A 4X7CA 5M3FJ 3GFJA 3J80K 1W5CC 4YALA 3CCQI 2L4AA 3DXJF 3GEZA 2DEUA 1BOAA 3P9CA 3ABKH 4P6YA 4WWVA 3NB2A 4A3JJ 1SD7A 3QRFF 3M1EA 4B8XA 4BJTA 4X7EA 1G3YA 2P81A 2ECBA 3HIFA 1MSFC 4AU7A 3KL9A 3O6BB 4B3AA 1IXRC 3IRRA 4Z4VA 4Y4RA 2JVGA 1X2MA 3TMOA 4GFBA 1I6HJ 4IKFA 2X48A 3E3VA 4EGYA 2VODA 1OGIA 5E79C 2CK3A 3GQ7A 2TRTA 2QSGX 3VDXA 5ILSA 1IO2A 3ABLH 5CVUA 2HYFA 2P6SA 1R71A 4YZ0A 3NQOA 2OAZA 3L2UA 1RETA 3HKZA 2VC0A 1YX2A 3ZRGA 2IOUG 1E3XA 2LKXA 4TKOB 2VBWA 5BSYA 3SQVA 1CNFA 3H0DA 1MH4A 1IDZA 2PMUA 1G4DA 5B5EC 4PCQA 5LMZA 5HZAA 1EA0A 4A3BJ 4XKWA 4RCZA 2HNHA 1UHMA 2FJ1A 2JTVA 4CQJA 5BPDA 2NV4A 2JJ2A 3VYTB 4LB6B 5D5UB 1XGOA 2R7DA 3MZ8A 2NRAC 2JIZA 2FSWA 1UJ8A 2DAOA 2OTLB 2IA0A 4LK0F 1USSA 3BQJA 4G5GA 3DU1X 4ZYGA 3GX4X 3TW6A 3E0JB 3JQQA 2XZLA 2F4IA 1CQTA 4ASNA 2Y31A 2VFOA 1J75A
chains in the Genus database with same CATH topology
1T5EA 2XSJC 3DKYA 2M7AA 1H80A 4KJZA 2K9MA 2RREA 1WJCA 3BH4A 5HNFA 3OYHA 1I18A 3JURA 3K4BA 3MKYB 2KP6A 4HNUA 1KONA 3VR6A 2VBEA 4E7JA 2KLOA 4LG3A 4PJJA 4Z05A 1WJ5A 1O88A 2IXSA 2NT9A 3HPGA 4RM3A 4W8TA 4PJNA 2KRCA 1Z3XA 4II3A 1W0JA 4PJMA 3VYRB 1HVXA 3TBIA 3OL3A 3VYUB 1QHGA 2X1EA 3LSMA 3VSKA 4XM3A 2AQEA 1I8DA 4F3QA 2PJRB 1MABA 2LY1A 2VASA 4E4HA 2BSPA 3DTKA 2UUZA 1R6RA 2XF7A 3U21A 4HWVA 1WJEA 3ZIAA 2O04A 3OAAA 2VB6A 1PKVA 1UD6A 3EQOA 1VBLA 2R7SA 4Y33A 3L2WA 1O8JA 2NOJB 4BE1A 3MKWB 3OYFA 1X0CA 4BEHA 3ONQA 5HLTA 3SEZA 1O8KA 4U7BA 3CMMA 2F5VA 2BW3A 2HDWA 3H5RA 2GJPA 2ZZGA 3OFNA 3OYNA 2WBMA 4XKBA 1MMDA 1COWA 1V5FA 4ITVA 3HG9A 2K9LA 4W8QA 1OLTA 2A6TA 3OS2A 1EE6A 1UAAA 4NC8A 1MNEA 1O8FA 2KVOA 3WWGA 4GQNA 1V0EA 2VLAA 1W9XA 4P1WA 2CUZA 4FXUA 1D1BA 2IGOA 4XOPA 2CS3A 4F55A 1DBGA 2WY8Q 2JJ1A 2ZZEA 3V42A 1UG0A 1VZ0A 2QKLB 3K70C 3SEQA 4ZTJA 2WJVA 4OZYA 2LREA 2UWMA 3T53B 4C2LA 2ELJA 1GLNA 2XAUA 3LSKA 3RQ4A 3HOSA 1X1DA 4NQWB 4RLQA 3FHNA 2W7NA 4UZUA 2O0VA 3K70D 1MMGA 4BQQA 1OGMX 4H4KC 3S3OA 1MW7A 2WSSA 1NHCA 1QCXA 4MXNA 2D3LA 3HAGA 1MMAA 2VJ4A 4XLCA 2GK7A 3W2AA 3G2BA 1U0JA 1DQUA 1BHEA 2VL8A 3OY9A 1UD4A 3OMYA 2HLDA 3OE7A 2GJRA 3VSTA 3RSNA 1JTAA 3FPPA 1LVKA 1T0FC 1G59A 5CDFA 2CW8A 3DPLC 1NG6A 2A5WA 4N4OB 4DNTB 1X4PA 4I84A 3A3BA 4CCJA 1K28D 2IS6A 1WJFA 2X6YA 1WJAA 4XLFA 2JA2A 4YXWA 4B3XA 2O5RA 4BE2A 2LZJA 3IAM2 2MD0A 4NUBA 4BQOA 4BQNA 2JDIA 1WPCA 2CV0A 5CQGA 2OC6A 2UVFA 1K5CA 4XR6A 3LSIA 3W2WA 3GBGA 1OOCA 4KKSA 4XL9A 1BR4A 1V5EA 2VQLA 2W00A 4EATA 4TT3A 3S3NA 3OS1A 2X51A 4RLFA 3RTRA 4DOZA 3NWTA 3H9QA 2Y0SA 2K5CA 3GVKA 5CKTA 2CH0A 1YE9A 3H35A 3T56B 3A2KA 2CW7A 2JSPA 2GK6A 3ZCOA 4D9JA 3GVJA 1RMGA 1DGRM 4W8RA 1FMVA 4IQ4A 3C2GA 2RQQA 2MYSA 4KISA 2R4GA 2LOOA 3PSFA 1PXZA 1AA7A 2W6JA 4TSFA 3H5NA 1IDJA 2NSTA 4E7IA 2Z16A 1X1AA 3VWBA 3PJRA 2IS1A 1WTHD 4DJAA 3S32A 5HVQC 2QE7A 2VQCA 3KRGA 4W8SA 1KCCA 3QYFA 2ZSHB 4ZDPA 1PE9A 4C2TA 3A1YA 1H8EA 2PECA 2DT6A 3OIQA 2E60A 4BUPA 1QU3A 1D1CA 2V1NA 2XC7A 1VLYA 2E5NA 3ZSCA 3MKZA 1EA3A 2NZMA 1TZLA 2BVMA 4XN0A 2CV1A 2IQ7A 1KCDA 3LFUA 2KQRA 2WAFA 4CH7A 4CSWA 3CP2A 1V0FA 2O17A 1KZLA 4QPQA 3OYLA 2PJRA 2UVEA 3PUBA 3UNGC 4BJ5C 2R7RA 3DWLE 3ZXSA 3OYIA 2Z6BD 1DBOA 1PYVA 3CP8A 4HRIA 3FY3A 3AFHA 2V7FA 4OJ6A 5FRNA 3KEYA 3VSVA 2HZDA 4OZZA 3BC9A 4DNRB 2FUG2 3OYJA 3T51B 4HG2A 3IAS2 1IDKA 2M0MA 3HOTA 4QPOA 1XG2A 3RCOA 4U49A 1T95A 2QKMB 2HPIA 2JVHA 3LNNA 1LKXA 3A4CA 1UD8A 3GQ9A 4BACA 3BCAA 4DIQA 2EWEA 3AKZA 2HVRA 4LIVA 4F52A 1DGWY 4JOMA 4XKCA 3BCFA 1O8MA 4PMHA 4XNFA 4B3FX 3DKXA 1JI8A 4E7SA 4E0FA 4RMNA 4XLHA 4XOTA 4B44A 1SFKA 4ZTFA 4X0GA 2I8DA 1O8IA 2XOKA 4E7ZA 2ZTNA 3IUOA 3OR1C 5CQEA 3S3MA 3DU5A 4RM2A 2ZZFA 1HZEA 4CCNA 2LBFB 5KNLA 4L8JA 1GQ8A 1OFLA 2X3HA 1W36C 5AMVA 4JMQA 2X85A 2M3AA 3PNYA 3CESA 3DLAA 2IS4A 1HG8A 3ZQQA 2Q1ZB 3BG7A 4ZDOA 2CMPA 3LMMA 4D1QA 1V5GA 1E79A 2XZOA 2XZPA 3K4MA 2MFZA 3EPZA 4E7HA 1W36D 4LITA 2XF5A 5LFAA 2UV1A 1P9QC 3OYKA 3I3LA 1E43A 4XN3A 3VMWA 3DQVC 3UR3C 2WZPP 5FROA 3BLYA 2VIXA 2LY2A 3PL8A 3PNVA 1S9HA 4OJLA 4G7WA 2X6XA 4OJPA 3SYTA 4BGDA 3OWTA 1NG7A 2IGMA 3W3CA 1O8LA 1UD2A 3PSIA 2DT7B 4U87A 2D3NA 4P22A 4B3GA 3T9GA 3DTIA 3H9JA 1UD3A 2DCEA 1X1BA 3D5LA 4GRIA 3VSLA 4ANJA 4E7KA 1Y56A 4G7XA 1WMRA 4OJOA 1WP6A 4PFPA 4XMYA 3QODA 3B8YA 2WPDA 1W0KA 4II2A 4F93B 3ZPPA 4ZDLA 1OR7C 2MABA 2P0WA 4ZYAA 4E7LA 1AIRA 2R7OA 4PUSA 2E1BA 3OOUA 1JRGA 4DBRA 1E1QA 4B48A 2KMUA 2VXZA 2KL4A 2PMZA 3QYBA 4CZCA 4AYBA 1VF7A 3S8PA 2XGJA 5KCMA 3L2RA 1QHHD 2WAEA 1LDKB 1HA8A 3JU4A 4NK6A 4C2UA 3FKSA 3OEHA 3DDYA 4MR0A 2KRHA 4G6TB 2ZXHA 2R7TA 2PYHA 1KMHA 3K6GA 4ZC3A 1WJBA 4B47A 2VBMA 4DK0A 2M7BA 4XD7A 3DPUA 2XF6A 4CUGA 4XKVA 4XLEA 1OB0A 4NK8A 3EUHC 3QYEA 2O1DA 4KITB 1E1RA 3PNTA 2KDOA 3FKJA 4HPQA 3G05A 2NTQA 4OWRB 1BLIA 1KTWA 3B90A 1IB4A 4BE0A 2L9NA 3OS0A 2K3PA 3OYEA 2CV2A 3HC7A 3J7AY 2VKHA 3H5AA 1BMFA 2X53S 4BXFA 2W6IA 3NWSA 2VJJA 5DN6A 3OIPA 4N4NB 4Y3OA 4CCLA 4C9YA 4HEA2 3K4LA 3TL4X 3CF2A 4BDYA 2GJKA 2IGNA 2Z8GA 4BU2A 4IX7A 1IRXA 1FX0A 2NTPA 2W82A 4PSWA 2JUGA 2W1OA 3DU6A 3AL0B 2DJIA 2O0WA 2VQHA 1IA5A 3GQBA 4DBQA 4XQFA 2W4SA 3C2HA 1X4OA 2L7KA 3K4JA 1LFPA 2LC2A 2R7XA 2X8KA 3S93A 4XORA 4HSRA 2R7VA 2M4KA 1O8GA 1SAUA 4PSXA 4ASUA 4Z03A 4FASD 1H8HA 3OOCA 3AL0C 3F9KA 2M4GA 3M1CA 4XLAA 3DEEA 4BL0B 4KKUA 2HU9A 2ODLA 2VJIA 1OHHA 2HVQA 2F1MA 3KYLA 2LBFA 4ZJZA 2BOLA 3ZGKA 1N75A 3VYSB 2XDVA 4EW9A 1D1AA 4URRA 3OYMA 1MNDA 3D5SC 2ZXIA 1X19A 4YELA 2HQAA 5FL7A 4PK4A 1RU4A 1J09A 2IS2A 4Z1MA 1WFXA 4OAYA 3E1SA 3GVLA 2V4JC 4YRVA 2IGKA 2L5QA 3ZR8X 2OV7A 2NSPA 3OYAA 3DTEA 4CCMA 1QJVA 3K4CA 2V9KA 3GQAA 2HVSA 2ZTGA 3N05A 2VQGA 3L2VA 1X1CA 1Z21A 5TGTA 1K6YA 3NE5B 5IK2A 2HPMA 5C1EA 3SUCA 2WJYA 2LG4A 4F92B 1O8DA 3OYBA 2OUMA 1UELB 1D0YA 2KPMA 2WY7Q 2KZVA 1OGOX 2WA0A 3OYDA 3HL2A 2X1CA 2E1MB 4XONA 3OW7A 4YZXA 1OFMA 1MMNA 2GOMA 5HNHA 1FMWA 2VJ5A 2R9VA 1BN8A 2ZFUA 3A3GA 3D5RC 2R7WA 1O8HA 3BCBA 4CA0A 2F6CA 5CPRB 1ZELA 4P5OA 2INVA 2F43A 1PJRA 2VKDA 3I9V2 3L2QA 2CFOA 2LRDA 4J01A 1NRKA 3OYCA 3KX2A 2V31A 2E1MC 4OAZA 3CJQB 2ZZQA 2QY1A 3OEEA 3FDYA 2AQFA 4HIZA 4BDZA 1EFRA 4CCOA 1ERDA 3OL4A 2V4DA 4J00A 2M5SA 3EQNA 2QXZA 1YX3A 2LH9A 4PFOA 2DIEA 4NNJA 2MC4A 3PFYA 4KT6A 1D0ZA 1N78A 1PLUA 1BPLA 1G8XA 4JQFA 3UW0A 4YZQA 3VSUA 2CUJA 4AVZA 2R7UA 2WB1A 2V26A 5LD2C 5FRMA 3EUKL 4BEHB 2V6EA 1WJDA 4BJ6C 2BW3B 1BR2A 4DGWB 4C30A 2VXDA 5KHDA 3GQ8A 2Q2EB 3RPUD 1Z7LA 2BVLA 2E5ZA 4CCKA 4YEJA 3DPTA 3BCDA 4IQJA 2X1DA 3H9GA 2RNGA 3SZGA 4HNTA 2XNDA 2PYGA 1E3ZA 3K4KA 1E0EA 1BOBA 3GRHA 2NT6A 2Z2SB 3OYGA 3K4NA 1O8EA 5HOOA 3MD2A 2R7QA 4YZAA 2WAQA 3EUAA 2Z1DA 3HUGB 3OR2C 3LL7A 4OJ5A 4BJTA 3ZPNA 3W2VA 4F91B 4B43A 3QOEA 2GOXB 3VMVA 4NC7A 4AU7A 1UD5A 2WADA 3HXLA 3CZ6A 4KKTA 4Y4RA 2JVGA 3TMOA 3WQZA 3LMWA 3MMYB 4IKFA 1CZFA 3GQ7A 1YX5A 2L2OA 2CK3A 2KHMA 2VPLA 3CJRB 3BC8A 3H94A 2INUA 3VDXA 2DOAA 2ZSIB 1SKYB 2V7QA 5C1CA 4YZ0A 3KEWA 3FBIB 3HPHA 3L2UA 4MLOA 3HKZA 4PJLA 1NBMA 3ZRGA 2QX3A 1E3XA 3IP4B 4TKOB 1Y6IA 2X6WA 5JHFA 1RWRA 3H0DA 1VJSA 3LSHA 2LYCA 3M8JA 4DK1A 4G6IA 5HKKA 1Z3YA 4BS9A 4XKWA 3K10A 2HNHA 3B4NA 4E6KG 4FETA 2JJ2A 4U4BA 1TT0A 3VYTB 2NTBA 3SDBA 3OPOA 2VBKA 3A35A 3BG6A 2DXIA 2JIZA 3LSGA 1D0XA 1N77A 4Z06A 4HSTA 1DP3A 2L9SA 4IZZA 1BR1A 3E0JB 4R79A 2XZLA 2F4IA 4LIUA 3FBNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZPP A;  1BN8 A;  1H80 A;  1O8H A;  1AIR A;  3JUR A;  2VBE A;  2INV A;  1RMG A;  4W8R A;  1JRG A;  4Z05 A;  1O88 A;  1PXZ A;  1IDJ A;  2NT9 A;  2NST A;  2QY1 A;  4W8T A;  4W8S A;  3KRG A;  1KCC A;  3EQN A;  4NK6 A;  2PEC A;  1PE9 A;  2QXZ A;  4MR0 A;  2PYH A;  3ZSC A;  1PLU A;  4XM3 A;  2VBM A;  4XN0 A;  2IQ7 A;  2BSP A;  2O17 A;  3UW0 A;  4XKV A;  4XLE A;  4NK8 A;  4HWV A;  4YZQ A;  2O1D A;  3VSU A;  4AVZ A;  2O04 A;  2NTQ A;  2UVE A;  3EQO A;  1DBO A;  1KTW A;  1VBL A;  3B90 A;  1IB4 A;  3FY3 A;  1O8J A;  3GQ8 A;  4OJ6 A;  3VSV A;  4OZZ A;  1X0C A;  1IDK A;  2VJJ A;  1O8K A;  4YEJ A;  1XG2 A;  4U49 A;  2PYG A;  3GQ9 A;  4W8Q A;  2Z8G A;  1EE6 A;  2EWE A;  1O8F A;  3GRH A;  2NTP A;  2NT6 A;  3WWG A;  2O0W A;  1O8E A;  1IA5 A;  4XQF A;  1O8M A;  4XOP A;  4YZA A;  1DBG A;  4PMH A;  4XNF A;  4XOR A;  1O8I A;  4XLH A;  4XOT A;  1O8G A;  4OZY A;  4OJ5 A;  4Z03 A;  4C2L A;  1KCD A;  3VMV A;  2X3H A;  4XLA A;  1OFL A;  1GQ8 A;  2O0V A;  1OGM X;  5AMV A;  3LMW A;  2X85 A;  2NZM A;  2VJI A;  1CZF A;  2ODL A;  1HG8 A;  3GQ7 A;  1NHC A;  1QCX A;  2INU A;  5C1C A;  4MXN A;  4YZ0 A;  4XLC A;  2QX3 A;  4EW9 A;  1BHE A;  4URR A;  4XN3 A;  3VMW A;  4YEL A;  3VST A;  2X6W A;  1JTA A;  1RU4 A;  1RWR A;  4OJL A;  4I84 A;  2X6X A;  4OJP A;  2NSP A;  2X6Y A;  1QJV A;  4XKW A;  4XLF A;  3B4N A;  3GQA A;  1O8L A;  4U4B A;  2NTB A;  2VBK A;  5C1E A;  3SUC A;  3T9G A;  2UVF A;  1K5C A;  1O8D A;  4XR6 A;  4Z06 A;  1OOC A;  1WMR A;  4OJO A;  4XL9 A;  4XMY A;  1OGO X;  4YZX A;  3B8Y A;  4XON A;  1OFM A; 
#chains in the Genus database with same CATH topology
 1GJR A;  1HLV A;  2FX0 A;  5DUK A;  1JUS A;  3DKY A;  1B1B A;  1YTY A;  4KJZ A;  2K9M A;  1AIP A;  1WJC A;  2A61 A;  3F8C A;  4MIM A;  2W84 A;  3GF2 A;  2VN2 A;  3K4B A;  4LLN A;  4PGG A;  2OK8 A;  2VBE A;  1FOW A;  5BNG A;  3AVT A;  1O88 A;  1JXS A;  1UMQ A;  3R0A A;  2DFI A;  3CCL I;  1CGP A;  3MCZ A;  3ISX A;  3HPG A;  2QQ8 A;  5D6E A;  5JR3 A;  1SAN A;  4LG0 A;  3I55 B;  3TP0 A;  5FGM A;  4R1H A;  3SFZ A;  1XX5 A;  2VON A;  2ZB9 A;  4N3G A;  2GQF A;  1QHG A;  5IT3 A;  1P92 A;  5K5R A;  4LLL A;  4F3Q A;  4E4H A;  4C0S A;  3LWF A;  2XPW A;  5LEK A;  2ZJ2 A;  3DTK A;  1YIT B;  1R6R A;  2XF7 A;  3U21 A;  2K4J A;  4UV8 A;  4NBQ A;  4BY1 J;  3OAA A;  4YC5 A;  3FXL A;  3GWZ A;  1QGZ A;  2MBF A;  1PKV A;  1HSJ A;  1POG A;  5GAD J;  3IWF A;  1DDN A;  1SMY F;  2NOJ B;  2IEK A;  3Q0V A;  3GFI A;  1DP7 P;  3HDD A;  4PAB A;  3TH0 A;  1RZ4 A;  1X0C A;  1TT5 B;  2R5Z A;  5HLT A;  2AO9 A;  4U7B A;  1OB5 A;  2HDW A;  2BW3 A;  5IOZ A;  5C4J J;  1V5F A;  2EIL H;  3ES9 A;  4ITV A;  2BM1 A;  2VBT A;  4G6Q A;  4PGO A;  1VQ4 B;  2YWH A;  1FBS A;  1HW1 A;  1OLT A;  2G0E A;  1UAA A;  1XN7 A;  1MNE A;  1XMK A;  1ACI A;  2KVO A;  2DN0 A;  3GTG J;  2A6H F;  3WWG A;  1PP7 U;  2GA1 A;  3WHB A;  1RIO H;  2B0L A;  1CLW A;  3WND A;  2PQ8 A;  2XAH A;  2KDZ A;  1A5J A;  1W9X A;  1HDP A;  1ZGA A;  4XOP A;  1CNE A;  5DCF A;  1DPU A;  2W25 A;  4TMV A;  1Q1V A;  4OPW A;  5CYV A;  1QRB A;  2ZZE A;  3WTS C;  5CVI A;  2VFN A;  2WJV A;  2LRE A;  1F36 A;  1JT6 A;  1XC5 A;  4HDU A;  5BPI A;  3RQ4 A;  1ZQ3 P;  4RLQ A;  2PMH A;  2W7N A;  2O6G E;  3BR0 A;  4M2L A;  1KTV A;  4WQM A;  4DQL A;  3KZZ A;  2Y69 H;  5K7H A;  2BY0 A;  2WR8 A;  4DYQ A;  3IH3 A;  5J8F A;  1T6Z A;  3HAG A;  1T33 A;  1TLH B;  3CME I;  2GK7 A;  4M9S A;  3G2B A;  3S15 J;  2Y9Y A;  1DQU A;  2HLD A;  5AIP A;  3OY9 A;  1VF9 A;  3OMY A;  4QLC U;  4ZGN B;  3G71 B;  2Z99 A;  1TUI A;  3T8R A;  1M1E B;  4HF1 A;  4ZYH A;  3DPL C;  4JP0 A;  4N4O B;  4DNT B;  4ON0 A;  2QBY A;  4I84 A;  3A3B A;  1K28 D;  4YXW A;  4Y13 A;  4B3X A;  2O5R A;  3CCU B;  3BQY A;  5AIQ A;  2DOE A;  3AAF A;  1O4X A;  4BQN A;  3FXU A;  2JDI A;  4WWC A;  3SY2 A;  1T2K A;  3H92 A;  4XR6 A;  3CLO A;  3GBG A;  2CRV A;  3U6K A;  2CC2 A;  1YJ9 I;  1Q86 D;  2Q0O A;  5J3L A;  1BR4 A;  2VQL A;  3AVU A;  1TC3 C;  2A3S A;  4LOC A;  1I6X A;  4MNU A;  3PUN A;  1OFD A;  3ZMU A;  4FN5 A;  1J9Z A;  4YFN F;  1YE9 A;  3A2K A;  2CW7 A;  1VHE A;  3C7J A;  1MBJ A;  4HZF A;  3U9G A;  3ZCO A;  5JI6 A;  3JRC A;  3HM5 A;  1R9T J;  3OJX A;  1G2H A;  1DGR M;  1FND A;  1XGM A;  4IQ4 A;  4YFO A;  2NPF A;  3M8E A;  1O3T A;  2RQQ A;  4KIS A;  2XC1 A;  3CC2 B;  2BGJ A;  2XKO A;  2NST A;  3TO6 A;  1AU7 A;  1TW2 A;  1X1A A;  4RGR A;  2XPU A;  3VWB A;  2IS1 A;  1XE1 A;  2QE7 A;  1GAW A;  3KRG A;  3KPH A;  3VB2 A;  3IV5 A;  1TWG J;  5DUI A;  2PEC A;  3A1Y A;  1QZE A;  2PBI A;  4BUP A;  4Y52 J;  3BG9 A;  2E60 A;  2F4M B;  2BM7 A;  3MKZ A;  4QVA A;  5J35 A;  1TZL A;  4C43 A;  1K78 A;  1FP2 A;  1YJN B;  5E1X A;  2WAF A;  4CH7 A;  1ODD A;  4LBZ A;  1N05 A;  4P1V A;  2LMD A;  1MH3 A;  5HOD A;  3WGI A;  3WG7 H;  1TVC A;  2DOG A;  1GHC A;  3PUB A;  3ASS A;  4U0V A;  2Z6B D;  2K9Q A;  3AG4 H;  1PYV A;  2V7F A;  1WH7 A;  1PJ7 A;  3KEY A;  2HZD A;  3OV8 A;  2O6W A;  3TQN A;  4HYE A;  2BHY A;  2DMQ A;  3IAS 2;  4OU0 A;  4B1R A;  4S04 A;  3BOQ A;  4M53 A;  4P2N A;  1I7P A;  4WK8 F;  2JSC A;  1T95 A;  3LNN A;  2CGP A;  1YI2 I;  5FO0 A;  3W2H A;  4R71 A;  3BCA A;  1SFO J;  1YW8 A;  3HZJ A;  3IC7 A;  2LSO A;  1XCB A;  2HVR A;  2PX9 A;  1FRQ A;  1WDT A;  4HNV A;  3V76 A;  2DA7 A;  3D0S A;  4JOM A;  1K8F A;  2BX6 A;  1DDI A;  3QE2 A;  4DYR A;  4PMH A;  3TOB A;  3DKX A;  4LJZ F;  3SDG A;  3LQE A;  4XLH A;  4XOT A;  1KRH A;  3BNW A;  4ZTF A;  4X0G A;  1O8I A;  2G0Y A;  2C6Y A;  5BSX A;  2HQN A;  2QZ8 A;  1BI1 A;  3F3X A;  2ZZF A;  4EJT A;  1HZE A;  3N6Z A;  4HDV A;  1OFL A;  2ZME B;  3JRD A;  2EH3 A;  4AUX A;  4P12 A;  3GZ5 A;  1FIP A;  3FM3 A;  3PNY A;  1XGS A;  2IS4 A;  1UMK A;  1ETW A;  4MQV A;  2Q1Z B;  3BG7 A;  3ZQQ A;  1HG8 A;  3LMM A;  2HFH A;  1HKT A;  3TED A;  3FX3 A;  3CC7 I;  2XZP A;  1W36 D;  2IJL A;  5LFA A;  1IV8 A;  2BV6 A;  2WB1 N;  3HYI A;  1H85 A;  5B6I A;  3I58 A;  4AIJ A;  1XTA A;  3I3L A;  4XN3 A;  3LSJ A;  3PIO F;  5TR9 A;  3BLY A;  4GYG A;  1PUF A;  2NYX A;  1S9H A;  2MD5 A;  5J4Y A;  3Q5F A;  1VQK I;  4OJL A;  2OZU A;  1BBY A;  2P6T A;  5FKL A;  3CD6 I;  4Q5S F;  2HOE A;  4IHY A;  4A6D A;  4G7W A;  4OJP A;  2EIK H;  1Z9C A;  4RDU A;  3A8J A;  4UV9 A;  1GV5 A;  1JT0 A;  2B7B A;  1NG7 A;  3BG3 A;  3D1N I;  1HF0 A;  5D4R A;  5HS9 A;  3GTM J;  3I56 B;  3AVX A;  3PSI A;  1U5T B;  2VFP A;  3ZMZ A;  2QYU A;  3DTI A;  2P8T A;  2VC1 A;  2AXL A;  1X1B A;  1FOY A;  3D5L A;  3HSF A;  4GRI A;  3VSL A;  1GXP A;  2O9L A;  4G7X A;  1WMR A;  4OJO A;  3CMA I;  4XID A;  4YDT A;  3KP2 A;  5CJ9 A;  3BG5 A;  1L3L A;  2P0W A;  1WRJ A;  3HTU A;  4PUS A;  4EJO A;  4ZCI A;  1FNC A;  5L3E A;  3OOU A;  3HRS A;  1QVG B;  3R4K A;  3JSP A;  1AWC A;  1BX1 A;  2KMU A;  1FSE A;  2M5W A;  2M8E A;  3QYB A;  4AYB A;  2H1L A;  2WAE A;  1LDK B;  3S17 J;  4NK6 A;  4C2U A;  3HKZ N;  1BIB A;  2F2E A;  4FE7 A;  2Q8K A;  2HKO A;  4G6T B;  1Z91 A;  2L7Z A;  3ZOB A;  2VBM A;  1H88 C;  3GTL J;  1OFC X;  1X3W B;  2M7B A;  3S1R J;  1VQ7 B;  2RC6 A;  1EH7 A;  3NEU A;  1OB0 A;  1E2X A;  3A01 A;  1P6R A;  4HPQ A;  4OWR B;  4WF2 A;  1BLI A;  1OPC A;  1IB4 A;  2KRF A;  3V7S A;  3CCE B;  1W7P A;  2L9N A;  3MQ0 A;  3OYE A;  3S2W A;  3F21 A;  2CV2 A;  3BWG A;  2VKH A;  2X53 S;  2MH2 A;  4BXF A;  2EZH A;  3NWS A;  1GO2 A;  3RKQ A;  3CC4 I;  3QAH A;  4N4N B;  3QPS A;  4C9Y A;  1B23 P;  3K4L A;  2J5P A;  3CF2 A;  2L9R A;  1JKO C;  2QA4 B;  4A3I J;  2R0Q C;  4WZL A;  5DCM B;  1KU3 A;  1UHS A;  4PSW A;  5GPA A;  1JKP C;  3DU6 A;  2CO5 A;  5LEJ A;  3AL0 B;  2DJI A;  1B59 A;  4IW3 B;  2ISZ A;  4Z4U A;  4DBQ A;  4M3E A;  3NAR A;  4HW0 A;  4XQF A;  5E3O A;  2EFN A;  4YIF A;  1KK0 A;  2BSA A;  2XKP A;  3QPH A;  1IZ1 A;  4AIH A;  4BBS J;  2B5O A;  2P4W A;  2EIX A;  4XOR A;  1SFX A;  5LHH A;  1KQ5 A;  2EA2 A;  3DEU A;  5ICC A;  4Z03 A;  1JGG A;  1P2F A;  1BI0 A;  3OOC A;  2GPJ A;  1ZK8 A;  5HDN A;  3N90 A;  3EYI A;  3DEE A;  2ELH A;  3WXM A;  4Y17 A;  1LE8 B;  1RPW A;  3CJN A;  1V55 H;  1BJK A;  2X4H A;  4LGW A;  1CF7 B;  1ZM2 A;  2F1M A;  3B6C A;  1IG7 A;  2NOG A;  3GVA A;  2LDU A;  3ZGK A;  2QN6 A;  1OFE A;  2M1B A;  4OM9 A;  4URR A;  4BHC A;  4Q4Z F;  4M3B A;  1YHQ I;  1A36 A;  4G8X A;  4L9N A;  5FIU A;  4KIC A;  2HQA A;  4DW6 A;  3BY2 A;  2AHQ A;  2Y48 A;  4PK4 A;  1WFX A;  1BQE A;  1FLI A;  3ZZT A;  1REP C;  5EEH A;  1QQ1 A;  4FCY A;  3HOZ J;  4EQQ A;  2QGG A;  4I99 C;  3ZR8 X;  2L5Q A;  3CDH A;  5JFR A;  3OW2 B;  4TV7 A;  5THX A;  3OYA A;  3CLQ A;  5H6R A;  1TW3 A;  4Y15 A;  1MBK A;  2BHZ A;  1XB2 A;  3E6D A;  3N05 A;  1LDD A;  2VQG A;  1R1U A;  2DA2 A;  1Z21 A;  1PJ5 A;  3F0C A;  1K6Y A;  2G9W A;  5J6X A;  2ZBV A;  2HPM A;  3RY8 A;  5C1E A;  2O61 A;  2EV5 A;  1YS6 A;  4BXU A;  4CYD A;  3BTJ A;  3CTA A;  3Q9S A;  3RJP A;  1QPI A;  1ZHF A;  2WY7 Q;  3VPR A;  2ICW G;  4HE6 A;  1MBF A;  5HZB A;  4GCV A;  3H3V K;  4OOX A;  1E3H A;  3HL2 A;  3ONU A;  4R8H A;  1OFM A;  1ORK A;  2DDA A;  3QU6 A;  2XSD C;  2R9V A;  1OQY A;  1BN8 A;  3A3G A;  4RAY A;  3CO6 C;  1O8H A;  5ERI A;  4XSZ F;  1FYL A;  2INV A;  1VQ9 B;  2F43 A;  1PJR A;  2VKD A;  3I9V 2;  3L2Q A;  2LRD A;  4A3K J;  5BOX A;  2OTJ I;  2QEX B;  3LNQ A;  1NRK A;  2Q6O A;  2HDN B;  2E1M C;  4AF6 A;  4CYC B;  4I76 A;  2JQ7 A;  3R6S A;  1OB2 A;  5D8L B;  2HYG D;  2QXZ A;  5D5V B;  2VBS A;  3LA2 A;  5F64 A;  3K2A A;  1X2N A;  1VQ5 I;  4KT6 A;  9ANT A;  3FPK A;  1YS7 A;  4RM0 A;  2FNP A;  1R4M B;  3KZI C;  3M4O J;  1T56 A;  2V7V A;  1LLZ A;  1WGX A;  3IL2 A;  3HGG A;  4L9T A;  3WTY C;  1Q7Y D;  2OJE D;  2QSF X;  3OOP A;  3M9A A;  1XB4 A;  2R7U A;  5FRM A;  2H6B A;  2M87 A;  3EUK L;  1Q81 D;  4OIP F;  1Z67 A;  1LNW A;  3HSE A;  4BQA A;  3CDL A;  2EV0 A;  2VXD A;  1I3A A;  1YLF A;  2UXN A;  3OIO A;  2F5D A;  2ME0 A;  5LRR A;  5KHD A;  2QTZ A;  1Z7L A;  2C4U A;  2GIZ A;  3DPT A;  2MC3 A;  3M7G A;  5E1Z B;  4BPR A;  1EZG A;  2QWW A;  4IQJ A;  2X1D A;  5GTH C;  1XD7 A;  3N97 A;  2PE3 A;  2CQQ A;  3SZG A;  4HNT A;  3VMF A;  5LGN A;  3OZW A;  4D5C A;  2STT A;  3H3U A;  1BOB A;  1QPM A;  3GRH A;  5TY0 A;  2EB7 A;  2Z2S B;  4IHV A;  3K4N A;  4KN4 X;  4RB1 A;  3FHZ A;  3GW2 A;  1TQP A;  2R7Q A;  5IT9 Z;  4KH3 A;  3K2Z A;  2WAQ A;  1QFZ A;  3EUA A;  2Z1D A;  3AK5 A;  1ZN2 A;  3OR2 C;  3E5Q A;  2TDX A;  2DU9 A;  3WTV C;  1FWZ A;  3I71 A;  1D1N A;  3VOE A;  4F7D A;  1D5Y A;  2L9V A;  3ZQC A;  2BMW A;  1H89 C;  1BW5 A;  6PAX A;  4B43 A;  1XG1 A;  2D1V A;  2WAD A;  3HXL A;  4L5I A;  4KKT A;  3WQZ A;  3LMW A;  3ISP A;  3KP6 A;  1YX5 A;  2L2O A;  1ELO A;  2INU A;  3H94 A;  1RUO A;  1R5O A;  1SKY B;  2ZSI B;  2V7Q A;  5GP9 A;  4NB5 A;  2X0L A;  4TN1 A;  2B7E A;  3HPH A;  2B63 J;  4L9J A;  1NBM A;  3AST A;  1RKW A;  2X6W A;  3WE2 A;  1FZP B;  1OCR H;  5JHF A;  2HDD A;  1RWR A;  2YPR A;  4JX6 A;  3TDZ C;  3GO5 A;  3LSH A;  2LYC A;  4PGH A;  4DK1 A;  1VQM I;  2FXA A;  2ID6 A;  5HKK A;  3ZP5 A;  2EWN A;  5B1A H;  4EV0 A;  4KNY A;  3B4N A;  3DFG A;  4UZE A;  3MFK A;  2OYN A;  2BN4 A;  2KIS A;  2VBY A;  4FET A;  5DD8 A;  4BHB A;  3SDB A;  4YFK F;  3CQZ J;  3KE2 A;  4M74 A;  2I10 A;  5EDN A;  4ZH4 F;  3H1C A;  3LSG A;  1R22 A;  4IEJ A;  4Z06 A;  4BYY A;  1SM4 A;  1T38 A;  5B1B H;  2ZIT A;  4FTH A;  2YU9 J;  3W5V A;  2GIV A;  3QWL A;  4R79 A;  5LRS A;  4JX5 A;  2DYS H;  1XSD A;  4WZK A;  3FBN B;  2NVU B;  1T5E A;  1BJA A;  2O7O A;  4W97 A;  2RRE A;  5LBQ A;  1TNS A;  3BH4 A;  3OYH A;  3PO2 J;  3ONY A;  1I18 A;  3I64 A;  2JA5 J;  2KP6 A;  5JLW A;  4E7J A;  2CQ7 A;  4TMT A;  4LG3 A;  3WBJ A;  2F48 A;  3G1O A;  3AVY A;  1CQX A;  4YAU A;  2FRH A;  2NT9 A;  1K61 A;  4RM3 A;  2ZNZ A;  4PJN A;  2K4B A;  1EJ9 A;  1Z3X A;  2GZW A;  4EEF G;  1ZM4 A;  4YAW A;  3PA1 A;  2G7H A;  3BRO A;  3TBI A;  1G3T A;  4C3I J;  3VYU B;  3S1N J;  3LSM A;  4Y9U A;  4XM3 A;  1I8D A;  3ASP A;  3GTO J;  1PDN C;  1K4S A;  2LY1 A;  5K7Z A;  4L9V A;  5JBQ A;  2NVQ J;  1F20 A;  2EFP A;  5FFX A;  3MCA A;  2VB6 A;  2E36 A;  1D3Y A;  1UD6 A;  2JK3 A;  3MMP A;  2R7S A;  5KAF C;  1V4R A;  3BZC A;  1O8J A;  5CVV A;  1F60 A;  1ETY A;  1IN6 A;  3MKW B;  2H94 A;  1TP4 A;  2W48 A;  2DFF A;  3SEZ A;  4P9U A;  1O8K A;  1U9N A;  3M3Y J;  1FDR A;  2F5V A;  1O3Q A;  3V7A A;  3OFN A;  4FX4 A;  2WBM A;  4RAG A;  1MMD A;  2Q2E A;  2V9P A;  4XKB A;  1F5T A;  1COW A;  3CCV B;  1QUF A;  3LFK A;  1DUX C;  1B72 A;  3QFC A;  5FNZ A;  4UUT A;  1YIJ I;  3KEO A;  3GIR A;  3OJW A;  2LP0 A;  2CUZ A;  5J1Y A;  2IGO A;  4FXU A;  4WXD A;  3P7N A;  2CS3 A;  2ESH A;  1WCM J;  4IPA A;  1YJW I;  1MRZ A;  3PM1 A;  1JKQ C;  3KET A;  3KP4 A;  2JJ1 A;  4AYB N;  5M5Y J;  4OZY A;  2BZT A;  4OPO A;  3T53 B;  2DMP A;  1IN5 A;  2FD5 A;  4QWQ A;  4UVA A;  2ELJ A;  1GLN A;  3LSK A;  3HUG A;  2KZG A;  3HOS A;  1X1D A;  4NQW B;  3FHN A;  4UZU A;  5IP6 A;  3K70 D;  1ETK A;  4A3L J;  1MMG A;  1YLO A;  2WV1 A;  1RRJ A;  3J7Y J;  1NHC A;  2JA8 J;  2OZ6 A;  4TMX A;  1ENH A;  1QUE A;  3GZN B;  2CND A;  3SZE A;  1TQI A;  2VJ4 A;  1OMI A;  3RKY A;  4YAO A;  3K1M A;  1Y0U A;  1U0J A;  3HTS B;  1TTY A;  3FMQ A;  2VL8 A;  1UD4 A;  1FOK A;  2P5V A;  5ICG A;  2E2I J;  1I1G A;  2L7M P;  3RSN A;  5IT9 K;  2QLZ A;  3FPP A;  2DCU A;  1LVK A;  1G59 A;  3V8J A;  2M0C A;  4ZZD A;  5CDF A;  1KU2 A;  1I27 A;  1XFO A;  2VFQ A;  1LFU P;  4CCJ A;  1RQR A;  1SVL A;  1WJF A;  2X6Y A;  1WJA A;  4KIB A;  2LZJ A;  3IAM 2;  4RD2 A;  4BQO A;  2WV0 A;  2BM5 A;  1ZRD A;  1WPC A;  3SQN A;  2VI6 A;  3IH4 A;  2A05 A;  1SMT A;  2BXY A;  2OC6 A;  3SXY A;  3WNC A;  3VMV A;  1K5C A;  2DER A;  1EFC A;  1FPQ A;  4KKS A;  2W00 A;  1JHF A;  3JQP A;  3S3N A;  1VLO A;  1QNT A;  4DOZ A;  1S6L A;  3RTR A;  3U1K A;  3H9Q A;  3GVK A;  2Z9O A;  1IJF A;  2CH0 A;  2DPD A;  1FNB A;  4AF7 A;  3JRH A;  4I6Z A;  3AGP A;  2VBU A;  1FTZ A;  2BGI A;  3GVJ A;  3V8L A;  1B8I A;  1R00 A;  3FK6 A;  4KFC A;  2R4G A;  1Q82 D;  4YEI A;  4TSF A;  2XGC A;  2A6E F;  1FX7 A;  4O6J A;  2Z16 A;  2WWY A;  5H5J A;  2J8I A;  2BY3 A;  4DJA A;  5HVQ C;  3W2F A;  1FYM A;  4P55 A;  2ZSH B;  4ZDP A;  1E3P A;  3WHC A;  2ZL7 A;  2O8X A;  1QU3 A;  4PC2 A;  2V1N A;  2KJB A;  2XC7 A;  2VKV A;  2E5N A;  3CCM I;  1VLY A;  4TMZ A;  1APL C;  1UB9 A;  1Z1D A;  3W6K B;  3P26 A;  2HQR A;  3CP2 A;  2VNI A;  2DET A;  4HAM A;  2Q6L A;  1VQN B;  3T0Y A;  2PJR A;  1R5G A;  4BJ5 C;  3DWL E;  4OOI A;  4HRI A;  4RPB A;  3AFH A;  2OU2 A;  4BBR J;  3CUQ B;  3VSV A;  2R92 J;  1GDT A;  2JPC A;  3FWE A;  2K9N A;  1FJL A;  3JQR A;  1OJL A;  3T51 B;  4ACA A;  3HOT A;  1D5V A;  1P7J A;  5IP7 J;  3BT9 A;  2AXT C;  1LKX A;  3A4C A;  5H20 A;  5BQT A;  2B9S A;  1UD8 A;  2XEX A;  3I1F A;  2ZJQ F;  1AKH A;  4LBY A;  3DBH B;  3VOD A;  1E17 A;  2EWE A;  4XLN F;  3F8B A;  2EIM H;  1YRN A;  2FE3 A;  1DGW Y;  2LD5 A;  2CFX A;  2QQB A;  3QFT A;  1VND A;  2RVC A;  4XNF A;  1NTC A;  1U8R A;  3KZY A;  3U6B A;  5DDG A;  2P5L C;  2XOK A;  3GME A;  4E7Z A;  2E1O A;  2XGX A;  3IUO A;  4Z6Y A;  1VQO I;  1D8J A;  2E1C A;  1ZAO A;  4GXO A;  1KYZ A;  3BR3 A;  1KK2 A;  1KCD A;  4RM2 A;  4M9X A;  1YW7 A;  2JRT A;  4M71 A;  4CCN A;  4CGZ A;  4L8J A;  1GQ8 A;  4HOB A;  1NH3 A;  2V1U A;  4KMF A;  1W36 C;  5C4X J;  4JMQ A;  1H9G A;  2X85 A;  3R61 A;  1KK1 A;  3GTP J;  2K3F A;  4V19 K;  3B02 A;  2R5Y B;  3ZQ7 A;  4CXF A;  1P4M A;  2EFW A;  3Q38 A;  3G6E B;  2DK8 A;  1RC9 A;  1EP2 B;  4A3E J;  3VMW A;  3WOD F;  2WZP P;  3HSR A;  4RBO A;  2VIX A;  4RB3 C;  1JTY A;  3HRM A;  2X6X A;  2DA5 A;  4PC7 A;  1S29 A;  4BGD A;  2BF4 A;  2I5U A;  1VQ8 I;  2L02 A;  1O8L A;  1UD2 A;  5TIS C;  4P22 A;  4GDF A;  2NS8 A;  3G1L A;  3HOX J;  2OPT A;  3TGN A;  4CZZ A;  3Q6R A;  2XTY A;  4RB0 A;  3JW4 A;  4MTD A;  4MEX F;  3Q0W A;  1UD3 A;  1H8A C;  2DCE A;  3OSF A;  4E7K A;  4XRF A;  3W2I A;  5FD5 A;  1GR1 A;  1WP6 A;  2FQ4 A;  3V8K A;  3F8N A;  1HDD C;  1VQP I;  2XAJ A;  2DPU A;  4FT8 A;  2WAQ N;  4XIC A;  1H42 A;  2HQ5 A;  3BR5 A;  3DEW A;  4LBW A;  2Y9Z A;  4F93 B;  1QA2 A;  4UVB A;  4RD3 A;  2TCT A;  1WXR A;  2NXN B;  4ZDL A;  4ZYA A;  2IAI A;  1KQ8 A;  1JB9 A;  1A35 A;  2VT3 A;  4P26 A;  1AIR A;  4E70 A;  1Z7U A;  3MZY A;  1G3W A;  4MYU A;  1GV2 A;  2R7F A;  3REO A;  1JA0 A;  4NBS A;  4UAJ A;  4BHP A;  2XRL A;  1E1Q A;  1XDU A;  4B48 A;  4RD4 A;  1Z6T A;  2ZL5 A;  2PMZ A;  1R23 A;  1O3R A;  1KC8 D;  4CZC A;  4N9H A;  3LQ6 A;  2LVS A;  3CPX A;  2XGJ A;  5KCM A;  1QHH D;  1HA8 A;  1T98 A;  4MQ9 F;  2DFH A;  1J5Y A;  4AVP A;  3DDY A;  2W57 A;  1D8K A;  4Q48 A;  2OCC H;  2EBI A;  5FKK A;  1IN8 A;  2KRH A;  2CYY A;  2ZXH A;  4AIK A;  2PYH A;  4MR0 A;  2HXI A;  2QUF A;  4AC9 A;  4B47 A;  3C2B A;  4N9I A;  2PG4 A;  2L4M A;  4U88 A;  3PEN A;  1Z77 A;  2CWE A;  1IRG A;  4XKV A;  4Q47 A;  1ZG5 A;  1IF1 A;  1IRZ A;  2KDO A;  3CW2 A;  4B09 A;  1ZGW A;  4ROX A;  4HF2 A;  4RD0 A;  1WSV A;  1ETV A;  4RAZ A;  3IRQ A;  1TNT A;  3H5A A;  1BMF A;  3SJZ A;  3E5X A;  4M6V A;  5EGO B;  2WTE A;  4HBL A;  1ON1 A;  1RKT A;  4AWX B;  4QFM A;  4I09 A;  5E3L A;  3G1M A;  4UUS A;  2CU7 A;  2O0Y A;  1S72 I;  2H8W A;  3PSS A;  1AOY A;  2ISY A;  2GJK A;  2IGN A;  2Z8G A;  1IC8 A;  4G1B A;  2K27 A;  1IRX A;  1FX0 A;  2HZT A;  5EG0 B;  3KIO A;  4M3F A;  3PIP F;  2W1O A;  1CF7 A;  4C3J J;  1QRC A;  2M9H A;  5IYC J;  1JJ2 B;  1IA5 A;  2LLK A;  3GZ6 A;  4P96 A;  1X4O A;  2L7K A;  3I54 A;  1N06 A;  1ZH5 A;  1LFP A;  4UUV A;  2X8K A;  3HHH A;  4HSR A;  2R7V A;  1W35 A;  2M4K A;  3T5X A;  3CCR I;  3H9N A;  1DAR A;  4WXC A;  1LPQ A;  2D2W A;  2DMN A;  5F04 A;  4FAS D;  5C3E J;  1AHD P;  3ZC3 A;  4X1E A;  5D5W B;  1KQS B;  1K9M D;  2VBX A;  1XQB A;  4BL0 B;  2HU9 A;  4MHG A;  2HVQ A;  4EJW A;  2K40 A;  3F8F A;  3K1P A;  2LBF A;  4ZJZ A;  5M5X J;  4BNC A;  2BOL A;  4U0W A;  3R6K A;  3VYS B;  2PLF A;  1I5Z A;  2ETH A;  3EET A;  3C1D A;  4FWT A;  3OYM A;  1MND A;  4X7D A;  4X8I A;  3WNB A;  1W5S A;  1X19 A;  2RKH A;  3LYC A;  4A2U A;  4UZF A;  1RU4 A;  1J09 A;  2IS2 A;  4Z1M A;  4OAY A;  1RES A;  3KFW X;  2PJP A;  2IGK A;  2IVM A;  1NB0 A;  3Q6Q A;  3Q3A A;  3GTK J;  1HW5 A;  4EH1 A;  1DU0 A;  1IXC A;  3PQK A;  2EJR A;  3WTW C;  4RB2 C;  3LQQ A;  4RGU A;  2YWE A;  1VI0 A;  2B0R A;  1K73 D;  2HVS A;  2ZTG A;  2RV8 A;  2A69 F;  1W5T A;  4OOS A;  3NE5 B;  5GTI C;  2D1H A;  2LG4 A;  1O8D A;  1W0T A;  3OYB A;  3WTZ A;  1UEL B;  1D0Y A;  1UHW A;  4ETS A;  1OGO X;  1ZTR A;  2WA0 A;  1IB0 A;  1QGP A;  3B73 A;  2X1C A;  3VEP A;  1ETO A;  5E3M A;  5HNH A;  1N0V C;  5LHG A;  1W34 A;  2VJ5 A;  3CB4 A;  4ZV4 A;  1QQI A;  1Y8Q B;  4A0X A;  1MDM A;  2F6C A;  5J1R A;  1J59 A;  3BTC A;  3WU1 B;  5DS0 A;  3SEJ A;  5TJJ A;  4ENN A;  3QFR A;  4LG0 B;  3L7W A;  3CRZ A;  2A07 F;  5K1Y A;  3ZBT A;  4OAZ A;  2BGC A;  3CJQ B;  4YFX F;  2ZZQ A;  2QY1 A;  1EXM A;  2HOA A;  1HXD A;  2RN7 A;  2QQA A;  1YX3 A;  2LH9 A;  3ECH A;  3WU2 C;  3FXQ A;  1QBJ A;  2DIE A;  1YO5 C;  3PFY A;  1KJZ A;  4M6Y A;  1J0R A;  1G7R A;  3F6V A;  1TTT A;  1GT0 C;  1OKR A;  1G3S A;  1O3S A;  3P4G A;  4A69 C;  3ZUG A;  3CCJ B;  4A3D J;  2HEO A;  4QIW N;  2R93 J;  3FXR A;  2R5Z B;  2XAG A;  2V6E A;  3CO7 C;  5JLV C;  2BW3 B;  1ZM9 A;  4DGW B;  1T39 A;  4C30 A;  2V7W A;  3S1Q J;  3GQ8 A;  4K2E A;  3KLO A;  3L00 A;  2NVT J;  4UXN A;  4FX0 A;  2BVL A;  4LB5 A;  1UCR A;  2E5Z A;  1IUY A;  5HXB A;  1A04 A;  3H9G A;  1HW2 A;  3BH6 B;  2RNG A;  2ME6 A;  2XND A;  2O3F A;  3Q3S A;  4XRS A;  5ICE A;  2P7C B;  2UXX A;  2K02 A;  3HRT A;  3MKL A;  2VZL A;  4HV5 A;  1O8E A;  3Q9V A;  1KQ9 A;  5HOO A;  1MMS A;  1ZGJ A;  4IHW A;  4JBA A;  4V2G A;  5J47 A;  2DDB A;  1T8I A;  2ZXW H;  1J9I A;  4G12 A;  4HQM A;  3GFL A;  4G6D A;  5FO5 A;  5GAH J;  3LL7 A;  1QH0 A;  4OJ5 A;  3IWZ A;  4RAF A;  4U0Y A;  3MN2 A;  5F0H A;  2MG4 A;  1DPR A;  3W2V A;  2GOX B;  4NC7 A;  4XK4 A;  2DA3 A;  2QM3 A;  5B66 C;  3F6O A;  1Y1V J;  1CZF A;  4IF4 A;  3CCQ B;  1IDY A;  3R60 A;  2VPL A;  3RIR A;  4LMY A;  2DOA A;  2PI0 A;  5FA6 A;  4BXX J;  1YOV B;  3KEW A;  3FBI B;  1WOO A;  2KJC A;  2P3M A;  1ZLK A;  3TW7 A;  4H0E A;  4PJL A;  2I1L A;  2OBT A;  2F3L A;  2QBY B;  1QGY A;  1HST A;  3IP4 B;  3QU3 A;  1Y6I A;  4S05 A;  5GV7 A;  2OTL I;  4N0B A;  2LY9 A;  2ZL6 A;  1VJS A;  4TMW A;  4AC0 A;  2FVG A;  3FXK A;  4IO9 F;  4BS9 A;  2DOD A;  1GVD A;  2E7W A;  4E6K G;  4BY7 J;  3J81 Z;  2DYI A;  1TT0 A;  1STZ A;  4GGG A;  2BVN A;  2VBK A;  1QVU A;  1MBE A;  1TSP A;  1EKE A;  3A35 A;  3BG6 A;  1BM9 A;  1W0U A;  2DXI A;  4WZT A;  4Y9R A;  5F08 A;  4EMS A;  5J4V A;  2K86 A;  2L9S A;  4L5E A;  5FB2 A;  1BR1 A;  1B9N A;  2FBH A;  4LIU A;  2FNA A;  1QA6 A;  2E2J J;  1MJA A;  2EFO A;  1JJ6 C;  4M1K A;  3I55 I;  3X2Q H;  1KQ0 A;  1KON A;  4HNU A;  5A2Q Z;  1IJW C;  1IJE A;  5F1R A;  1WJ5 A;  2JN9 A;  4Z05 A;  3DBR B;  2GXG A;  2CW5 A;  3LA7 A;  1GAQ A;  2IXS A;  4HLX A;  1JTX A;  1A6I A;  4CDG A;  1YIT I;  4W8T A;  2A5Y B;  5HDG A;  2HOT A;  1WPK A;  2KRC A;  4II3 A;  2XRN A;  1K78 B;  1YQA A;  3JAM Z;  4PJM A;  2HS5 A;  3VYR B;  1HVX A;  1IXS B;  3OL3 A;  4G7O F;  1K8A D;  3VSK A;  2DQR A;  5EJC A;  1ETQ A;  1MD0 A;  5H6Q A;  1AMO A;  4A3G J;  2E71 A;  1Y39 A;  1WOP A;  1G7S A;  3FMR A;  2CQN A;  3BY1 A;  3CCL B;  2EIJ H;  1HBX G;  1LEB A;  4QVJ A;  2FU4 A;  2FOW A;  3DCF A;  1VQ4 I;  2CUF A;  3B8H A;  2O04 A;  3QP6 A;  1WI3 A;  2M2E A;  1VBL A;  4Y33 A;  1U8B A;  3ABT A;  4EJV A;  4WXH A;  1L0O C;  1HC8 A;  2YX7 A;  1BX0 A;  3OYF A;  2C77 A;  4BEH A;  2GM4 A;  1FSH A;  3I59 B;  3ZQG A;  3CMM A;  2H27 A;  4Y7C A;  3H5R A;  3OSG A;  3GTJ J;  2F1L A;  3RZD J;  4NQW A;  2C5B A;  2K9L A;  5FKM A;  4M3G A;  1F4K A;  3AGQ A;  1ZKG A;  3CF5 F;  3SLD A;  4W8Q A;  2A6T A;  3OS2 A;  3S16 J;  2BY1 A;  2H1K A;  2FML A;  1SFU A;  3V7C A;  1VHO A;  2L0K A;  4Z4S A;  4P1W A;  1D1B A;  2KIU A;  5FJ8 J;  2BM6 A;  5M3M J;  4F55 A;  3I4M J;  1DBG A;  3CJT B;  3FJO A;  2XIG A;  2H6C A;  2PMZ N;  2RNJ A;  2WY8 Q;  4G1V A;  4YCQ A;  3V42 A;  1VZ0 A;  2QKL B;  1OYI A;  3K70 C;  4ZTJ A;  2LKP A;  1S4M A;  3G05 A;  1EH8 A;  2XAU A;  3G71 I;  3KLN A;  5FLV A;  1LQ1 A;  5DD4 A;  2O0V A;  3R0J A;  4BQQ A;  3S3O A;  1VFC A;  4LFU A;  1WVR A;  1VQ6 I;  2HWV A;  3KYD B;  1BW6 A;  5HLH A;  2D3L A;  3O8H A;  1MMA A;  1PUF B;  4AM3 A;  1Q9S A;  1LB2 A;  3CCU I;  2MLK A;  5L3C A;  4JYK A;  2F5F A;  4A5M A;  3OE7 A;  2GJR A;  3VST A;  2N8G A;  2MGQ A;  2ZJP F;  3ML6 A;  2XV4 S;  1JJ8 C;  3MHP A;  3BTI A;  1NG6 A;  2PEX A;  1X4P A;  1D2E A;  5K7F A;  4PDK A;  2IS6 A;  1R1V A;  4XLF A;  3CME B;  1TBX A;  2MD0 A;  1TWA J;  4NUB A;  2D74 A;  1YIO A;  5D6F A;  3TKY A;  4YIR X;  1TYX A;  5ILV A;  3B82 A;  2XGD A;  5F0F A;  2ZBU A;  2CV0 A;  5KSW B;  2Y30 A;  2UVF A;  2C5H A;  3LSI A;  3W2W A;  2EZL A;  4EVI A;  1UST A;  4I2O A;  3BJ6 A;  3O8G A;  3RYR A;  1OOC A;  2XGE A;  3CC2 I;  1KU7 A;  4DNC A;  4TT3 A;  5F4J A;  2DA1 A;  3A8I A;  2OBR A;  2NVY J;  4RLF A;  3NWT A;  3S1M J;  2Y0S A;  1T6Y A;  2HKX A;  4IRG A;  3OZV A;  4P3Y A;  3T56 B;  1OYY A;  3RIQ A;  4A0Y A;  1HKQ A;  3DF8 A;  4D9J A;  4A6E A;  1K4Z A;  1FC3 A;  1FMV A;  2BE5 F;  3C2G A;  2QF7 A;  4O5V A;  2MYS A;  1YJ9 B;  1QRY A;  5EZG A;  4OIO F;  2L01 A;  1TL8 A;  3LA3 A;  1XGN A;  3J81 K;  3CCS I;  3PJR A;  3A1P A;  4W8S A;  3RZO J;  2ZJR F;  2OBS A;  2QTL A;  5LHI A;  1KD1 D;  1NJI D;  1QFY A;  4C2T A;  1H8E A;  4IXA A;  2XRO A;  2DT6 A;  3OIQ A;  3ZSC A;  2YUS A;  5GAG J;  1M1K D;  2KIQ A;  2ZFW A;  3AG3 H;  3A01 B;  2BVM A;  4XN0 A;  2IQ7 A;  2LF7 A;  2P7V B;  2V1X A;  3W2E A;  1WKM A;  3CPW B;  4WCG A;  2O17 A;  1W7P B;  1OCZ H;  4LD5 A;  1KZL A;  1DAB A;  4QPQ A;  3OYL A;  5A8A A;  5B3S H;  5FKO A;  3UNG C;  1KGS A;  5A2Q K;  3OYI A;  1RUN A;  3BTL A;  2BBY A;  3FY3 A;  1WQ2 A;  1ZUN B;  3P27 A;  3BP8 A;  5FRN A;  1GUU A;  3BZK A;  3NRV A;  3BC9 A;  2FUG 2;  3OYJ A;  4L18 B;  1IDK A;  2M0M A;  4HF0 A;  4QPO A;  1XG2 A;  3RCO A;  2RQP A;  2DJN A;  4MEY F;  2R3S A;  3ZMS A;  2QKM B;  4HLY A;  2K7L A;  3SKB A;  3JAM K;  3ERE D;  3R6J A;  2IW5 A;  4DIQ A;  2QZA A;  3AKZ A;  2RGV A;  2R5Y A;  4M72 A;  3PUM A;  1R7J A;  3LO8 A;  2NS0 A;  3E1Y E;  1O8M A;  3B6A A;  4LK1 F;  4E7S A;  4E0F A;  4RMN A;  1SFK A;  3CCY A;  1YI2 B;  2ZTN A;  3M8F A;  4LBV A;  2HGC A;  2HYJ A;  3CUO A;  3OR1 C;  4M3D A;  2X3H A;  5KNL A;  5E6T A;  2YWF A;  4W1U A;  2VOP A;  1A31 A;  2JRM A;  4L0Z B;  4KDP A;  3S2D J;  2M3A A;  3CES A;  3DLA A;  2GLO A;  3LST A;  2X9D A;  5IYN A;  2XZO A;  1U9O A;  1V5G A;  2GAU A;  2QGU A;  3J7Z I;  1E79 A;  1JNY A;  1B9M A;  2E35 A;  1RNL A;  2YU3 A;  3MAJ A;  4LIT A;  5L3F A;  4E7H A;  3I56 I;  4ENM A;  1T6X A;  1LJ9 A;  5FO1 A;  1SD4 A;  3OYK A;  3FXJ A;  3W2G A;  4MO7 A;  1IRF A;  2ZME C;  3A02 A;  3W5U A;  2LY2 A;  2CJJ A;  2DFE A;  4RDJ A;  3B78 A;  2PFB A;  1QX4 A;  1FBQ A;  3BJA A;  3LQR A;  5DS9 A;  3SYT A;  5FD6 A;  1LM1 A;  3IKT A;  3G4S I;  3CC7 B;  1PP8 F;  1GXQ A;  4FK8 A;  3ZMD A;  1K7A A;  5FFZ A;  1LUJ B;  1Y1W J;  2D3N A;  1Y0N A;  4HX8 A;  2M30 A;  2XAQ A;  2LK2 A;  4ESF A;  4B3G A;  2C78 A;  1W1W E;  3H9J A;  3H0G J;  1VQK B;  1I50 J;  1Y56 A;  3CD6 B;  1YYV A;  4G9Y A;  1QA1 A;  4PFP A;  4FQG A;  2STW A;  3W5H A;  2GRE A;  3B8Y A;  1W0K A;  4II2 A;  4RJL A;  3DBL B;  1G7C A;  3ZPP A;  1GVH A;  1KA8 A;  1OR7 C;  1U5T C;  2MAB A;  1HKS A;  2EZI A;  1TWF J;  2K9S A;  2E1B A;  3BQZ A;  4BH9 A;  2DLL A;  1S7E A;  4DBR A;  2BM4 A;  4HA8 A;  1ZLJ A;  1VQ7 I;  3CMA B;  1Q1H A;  1ON2 A;  1RR7 A;  3S8P A;  4ZGQ B;  1FTT A;  3L2R A;  5FLM J;  3JU4 A;  3FKS A;  2OQG A;  3OEH A;  1VQL I;  2ECC A;  5L3D A;  5A88 A;  1RQP A;  1Y8R B;  2JPB A;  3K6G A;  5AN9 A;  5F27 A;  2VFM A;  1WJB A;  1HQC A;  2CF4 A;  4XD7 A;  3H36 A;  3DPU A;  2XF6 A;  4CUG A;  1K83 J;  3FKI J;  3AG1 H;  4XLE A;  5EG0 A;  1ULY A;  1MKM A;  3I4P A;  3FM5 A;  1EH6 A;  4KIT B;  2QA4 I;  3PNT A;  2NNN A;  1QZY A;  2RAE A;  2V7U A;  2V7X A;  1KTW A;  2XT4 A;  5E3N A;  2K3P A;  3OS0 A;  3HC7 A;  4PJ0 C;  1OCP A;  2DMU A;  5E8G A;  3RKW A;  4ABZ A;  2BV3 A;  2WYR A;  2EIN H;  2W6I A;  3K1N A;  2VBV A;  3T8T A;  5DN6 A;  4NC6 A;  3G73 A;  4CCL A;  4HEA 2;  2FF4 A;  2L54 A;  3TL4 X;  4BDY A;  2DMT A;  5DNS A;  1A6Q A;  4IRH A;  4IVN A;  5IYQ A;  2KT0 A;  4KUM A;  3JTH A;  3V7R A;  2W82 A;  2VE9 A;  2OD5 A;  5FKN A;  2PN6 A;  2JUG A;  1QA3 A;  1S0U A;  1TYV A;  3GQB A;  4ZYD A;  3O3K A;  3C2H A;  1OIS A;  5TV2 A;  2ADU A;  2R7X A;  2LC2 A;  3CC4 B;  1EF4 A;  2XTW A;  1F1Z A;  3S93 A;  3TDU C;  1ZG1 A;  2YUH A;  3SJP A;  1SAU A;  4PSX A;  4RLZ A;  2COB A;  4U7D A;  3AL0 C;  2X0K A;  5DSZ A;  3F9K A;  2M4G A;  5D5X B;  5HS7 A;  3M1C A;  4XLA A;  1XPX A;  3I4N J;  2H09 A;  4KIF A;  3GYH X;  4KKU A;  2G7U A;  2ODL A;  1OHH A;  3RDI A;  3BDD A;  3RYP A;  2ZME A;  1IV6 A;  3LJY A;  3HHG A;  1RI7 A;  2XT2 A;  3D26 A;  2R7Z J;  4EW9 A;  1V54 H;  3DKW A;  5IYB J;  2AS5 F;  2DTR A;  1BA5 A;  1MBH A;  3JCU C;  4BKX A;  1ITY A;  3ECO A;  3BR2 A;  2VKE A;  3E1S A;  4YRV A;  4IOA F;  1B4A A;  2PLY A;  2OV7 A;  2YR2 A;  1V5V A;  4WX9 A;  1QJV A;  3K4C A;  2KFD A;  2RDP A;  3GQA A;  4M73 A;  3P9I A;  3MWM A;  1X1C A;  1J2X A;  1YHQ B;  1TWH J;  4J19 A;  2WC2 A;  2DYR H;  5IK2 A;  2LF8 A;  3TO9 A;  2WJY A;  1VQ9 I;  2DI3 A;  3K9T A;  5DYM A;  2QEX I;  3GSI A;  5IYR A;  2OUM A;  5KW9 A;  5EYR A;  2KZV A;  1OR7 A;  1U5T A;  3GTQ J;  3U2Q A;  1F43 A;  2E1M B;  3OW7 A;  1Z6R A;  2GOM A;  1W2B B;  1E3O C;  2ZKZ A;  2ZFU A;  3D5R C;  5F0C A;  4JX4 A;  4OIN F;  3H3Z A;  4CA0 A;  3HOY J;  4UNO A;  2ELK A;  5LGU A;  4KT5 C;  1ZEL A;  2X6O A;  1DU6 A;  4J01 A;  3QPL A;  2FEZ A;  1MGT A;  1WU8 A;  3I53 A;  4GYI A;  2D9R A;  3PSZ A;  3OYC A;  2V31 A;  5D8K B;  1YW9 A;  1QVF B;  5CVR A;  3OEE A;  3FDY A;  2AQF A;  3KCC A;  5L3B A;  4HIZ A;  3SYJ A;  1EFR A;  1ERD A;  1R4N B;  3OL4 A;  1IHM A;  2M5S A;  2IA1 A;  2E34 A;  4I0B A;  4IJA A;  3ROU A;  2NNY A;  4NNJ A;  3J7A O;  5D4S A;  3I0T A;  2MC4 A;  4ESJ A;  4Q7J B;  4X06 A;  2OTJ B;  1IGN A;  1EWY A;  4O3M A;  1EP1 B;  3FK7 A;  1BPL A;  1G8X A;  3HOV J;  4IHX A;  2Y2Z A;  4JQF A;  5CVJ A;  4Z4Y A;  5H59 A;  3UW0 A;  4M9Z A;  4QV2 A;  1N0U A;  3ASO H;  5E18 F;  5FLX Z;  3KYC B;  4YZQ A;  3VSU A;  1OGJ A;  3TP3 A;  2V26 A;  3ZN0 A;  2BPO A;  4Z4Z A;  4AID A;  4BJ6 C;  5EEG A;  5DTD A;  4X07 A;  1BR2 A;  3GQ9 A;  2M8G X;  3F72 A;  2HCJ B;  2ZC2 A;  1VQ5 B;  2Q2E B;  4QUZ A;  3A03 A;  1B72 B;  1HOM A;  1SD5 A;  1X3U A;  5KAI C;  3RKX A;  2H8R A;  3S14 J;  2W24 A;  1OYW A;  4ESB A;  2PYG A;  2KIF A;  2Y0S N;  1E3Z A;  3WGH A;  3K4K A;  1E0E A;  4P3I A;  5BS6 A;  2BM0 A;  2V9V A;  2KIM A;  3FF5 A;  3OYG A;  3COA C;  2NVX J;  2CQX A;  4YZA A;  1UZC A;  5DCM A;  4D7N A;  3MEX A;  3HUG B;  2JZY A;  3KEQ A;  3QPT A;  1SFE A;  3WGG A;  3JR9 A;  4M4S A;  1VQ6 B;  2V1D A;  1NHA A;  3DP7 A;  2JT1 A;  4YG2 F;  5LLQ A;  3ZPN A;  4F91 B;  2MH9 A;  3QOE A;  5H2F C;  5C44 J;  3F22 A;  4KYW A;  1UD5 A;  3VO2 A;  2JA6 J;  3WY9 A;  3HRU A;  4OPS A;  3CZ6 A;  4P25 A;  3MMY B;  3K0L A;  4KMU X;  1ZRE A;  1FEX A;  2KHM A;  3CJR B;  3BC8 A;  5C1C A;  4CIC A;  2BY2 A;  4X0C A;  1LE8 A;  4ZCL A;  2Z33 A;  1W87 A;  5F4M A;  4PZJ A;  4MLO A;  1B6A A;  3VO1 A;  2QX3 A;  5JMC B;  2E1R A;  1ZR2 A;  2V5I A;  1F9N A;  1WSU A;  1KZH A;  1WHU A;  3F8M A;  1J7K A;  1LVA A;  3PO3 J;  5IYW A;  1XMA A;  3O2P E;  4V2F A;  2CUE A;  1XS9 A;  3Q39 A;  1OCT C;  3M8J A;  2V79 A;  4G6I A;  3JSO A;  5J3O A;  1Z3Y A;  2PIA A;  3K10 A;  1X3Z B;  4U4B A;  3HB9 A;  4G7H F;  2NTB A;  3KP5 A;  1SVO A;  3HJE A;  3OPO A;  5DV5 A;  3K7A J;  2ZXJ A;  1O7L A;  3AVW A;  1D0X A;  1N77 A;  2IT0 A;  3IH2 A;  4HST A;  3SJM A;  3MZH A;  1DP3 A;  4DQ2 A;  4IZZ A;  1VQM B;  1TYU A;  3SZP A;  2QMU A;  2F4O B;  2CW0 F;  5L3G A;  2XSJ C;  1B8I B;  2DO7 A;  5J8C A;  2XHK A;  2J5O A;  2M7A A;  3CCS B;  1D8T A;  1H80 A;  2VUM J;  5HNF A;  1O7F A;  1FP1 D;  3JUR A;  5IYD J;  1IN7 A;  1LEA A;  2EQR A;  3QP5 A;  3MKY B;  2Q6K A;  3RI4 A;  3VR6 A;  2KLO A;  4I0A A;  2A68 F;  4PJJ A;  2LFB A;  4S0H B;  4A3C J;  2JMW A;  2R6H A;  2DA6 A;  2KKO A;  3A8K A;  1S7A A;  3ZMT A;  5DM7 F;  4Z4T A;  2JA7 J;  4IL6 C;  2CBX A;  4XLP F;  1W0J A;  3I59 A;  4CYC A;  4Z4R A;  1XSV A;  1BL0 A;  5KK1 A;  1ZM3 A;  5F1J A;  1H0M A;  4P6V F;  2HXO A;  3JRE A;  2X1E A;  3JX8 A;  2AQE A;  5J1U A;  2PJR B;  4UY8 I;  1DG1 G;  2FBK A;  2VAS A;  2LTP A;  3ASN H;  1MAB A;  3PVD A;  5GAE J;  3DLL F;  3CXC B;  2BSP A;  2OQR A;  1L1I A;  2UUZ A;  3BPV A;  3GUD A;  3CCV I;  4HWV A;  1WJE A;  4Y7N J;  5L46 A;  1ZRC A;  3ZIA A;  4U9U A;  1LLW A;  1MBG A;  2V6C A;  3WBK A;  3EQO A;  4B4D A;  3L2W A;  3BPX A;  1YFH A;  3OZU A;  4BE1 A;  1FNN A;  2FA5 A;  3ONQ A;  2YS9 A;  1BC8 C;  1AKH B;  2GJP A;  2ZZG A;  3LAP A;  4IRI A;  1I3Q J;  3OYN A;  4OOV A;  3BH7 B;  4I01 A;  1KYW A;  3HG9 A;  1YRN B;  5IYP A;  3JRG A;  1EE6 A;  1IW7 F;  4NC8 A;  4UB6 C;  3J81 k;  1O8F A;  5EEA A;  1IUF A;  4GQN A;  1P4W A;  1SVM A;  2ZNY A;  2VLA A;  1V0E A;  1SD6 A;  3ESW B;  1DDG A;  4YAF A;  3U1D A;  2QDX A;  5FLX K;  1FRN A;  3ZQF A;  1S3J A;  1QZZ A;  3LOC A;  3C3W A;  1UG0 A;  3F23 A;  3WYA A;  3SEQ A;  3FZV A;  2UWM A;  3OP1 A;  2QVO A;  1TQM A;  4C2L A;  4RD1 A;  2BXZ A;  4HV6 A;  1FYK A;  3PFI A;  1YIJ B;  1VTN C;  1JKR C;  1S5L C;  4RD6 A;  1OGM X;  4H4K C;  4XSX F;  1MW7 A;  4LC0 A;  1XSX A;  2WSS A;  3EQL F;  1QCX A;  2O8K A;  2VYQ A;  1YJW B;  4ZZL A;  4MXN A;  2K85 A;  1P7I A;  4XLC A;  4A3F J;  1NK2 P;  3G4S B;  1BIA A;  3W2A A;  2XB0 X;  3ZZ0 A;  4X05 A;  1BHE A;  3EDP A;  1V3F A;  2GA2 A;  1WOS A;  3UKG A;  2DT5 A;  4PAA A;  3ZBU A;  2FOK A;  4AD9 A;  1JTA A;  5IPA A;  2EA4 A;  1T0F C;  1R5B A;  1XDS A;  3E20 A;  2CW8 A;  2J7K A;  3SFI A;  1S8N A;  2A5W A;  2DA4 A;  3RQI A;  1FNM A;  3GCM A;  2E19 A;  3FXO A;  2DBB A;  5HDK A;  2JA2 A;  4NDL A;  4BE2 A;  2ZBK A;  2VT2 A;  3L1P A;  3WTX C;  2DY1 A;  4QSH A;  5CQG A;  2MLG A;  3H09 A;  4IOC F;  4RA2 A;  3ZPL A;  4A0Z A;  1N25 A;  3E6B A;  4XL9 A;  1V5E A;  4PC1 A;  4EAT A;  1K79 A;  3ZN1 A;  1WSR A;  1HCR A;  3OS1 A;  2X51 A;  4A3M J;  1Z0X A;  1N08 A;  2ID3 A;  2K5C A;  4DYC A;  3AVV A;  3T1B A;  5CKT A;  3H35 A;  2JSP A;  3LVB A;  2GK6 A;  2BYV E;  3BJO A;  1BN5 A;  1JHH A;  3W6V A;  1VQL B;  1MJB A;  1RMG A;  4W8R A;  1E64 A;  2XVC A;  4L0Y B;  2LOO A;  2YSR A;  3PSF A;  1PXZ A;  4C3H J;  1AA7 A;  2W6J A;  1IDJ A;  3H5N A;  1N07 A;  3IHU A;  4E7I A;  3C18 A;  1G7T A;  1WTH D;  2ESN A;  3S32 A;  2VQC A;  2FMY A;  1VQN I;  5JHU A;  3FIS A;  3QYF A;  1KCC A;  1EFU A;  5HS8 A;  1PE9 A;  3GXO A;  2P5K A;  1FOX A;  4M6X A;  1D1C A;  3GLX A;  2XB5 A;  1I39 A;  3ABU A;  1EA3 A;  3ASQ A;  5A89 A;  2CV1 A;  1LDJ A;  4Z4W A;  2LNB A;  3LFU A;  2Z5U A;  2KQR A;  1OCC H;  4KIG A;  4CSW A;  1Z05 A;  1V0F A;  1M90 D;  4K1X A;  1R5H A;  2XAS A;  3A0H C;  3L2C A;  2QCO A;  3KP3 A;  1YG2 A;  2EFQ A;  3LSR A;  2R7R A;  2UVE A;  1DBO A;  1FT9 A;  3ZXS A;  2GXB A;  1PJ6 A;  2BEO A;  3CP8 A;  2FQ3 A;  4UUS B;  1ETX A;  3K69 A;  4HQE A;  4LLG F;  4OJ6 A;  3OKX A;  3CCM B;  3CDI A;  1BI3 A;  4OZZ A;  1TLL A;  4DNR B;  2JN6 A;  1NK3 P;  4HG2 A;  4D5F A;  2QSH X;  2JWT A;  4U49 A;  2F5E A;  1JGS A;  1QO0 D;  4ZCM A;  1ONV A;  2HPI A;  1R5I D;  2JVH A;  1R49 A;  3HOW J;  4IHT A;  4D7M A;  5AON A;  2RC4 A;  4BAC A;  1W7P D;  2VNH A;  2JJ7 A;  2OCE A;  4OIQ F;  3VFZ A;  3JTG A;  4L5J A;  3CUQ C;  4YHB A;  4LIV A;  4C2M J;  1R36 A;  2L7F P;  4F52 A;  5GPC A;  4XKC A;  3BCF A;  3LAJ A;  5IOY A;  3S2H J;  3DV8 A;  5GV8 A;  5E20 A;  4ENK A;  4B3F X;  1JI8 A;  1I1S A;  1ZR4 A;  3G6E I;  4B44 A;  3JRF A;  2XNJ A;  2Z3Y A;  2I8D A;  1WWX A;  3PA2 A;  5F6F A;  2VNK A;  3V4G A;  1U6G A;  4MFE A;  3W6J B;  2D45 A;  4UHT A;  5LGT A;  5CQE A;  3GFM A;  3DU5 A;  4A12 A;  3S3M A;  4A5N A;  3WU0 A;  2LBF B;  4IHS A;  4HX7 A;  5AMV A;  4ZYE A;  2NZM A;  5K5Q A;  4ZDO A;  2CMP A;  3WG9 A;  3QOP A;  4D1Q A;  5IY5 H;  4J0Q A;  5DEQ A;  3K4M A;  2MFZ A;  1IAW A;  1GVJ A;  3EPZ A;  2XF5 A;  5BMZ A;  2UV1 A;  4NCN A;  1VQO B;  3JRA A;  1P9Q C;  1T0F A;  2VBZ A;  1X58 A;  3QSY A;  3VNV A;  1E43 A;  2EK5 A;  2VNJ A;  3DQV C;  3UR3 C;  5FRO A;  4RCY A;  4FE4 A;  4RDL A;  3SHF A;  3PL8 A;  3PNV A;  3JRI A;  2FX3 A;  4FHT A;  5DM6 F;  5IP9 J;  1BC7 C;  1WZ2 A;  3BY6 A;  1SEU A;  3ASR A;  4UB8 C;  5EZH A;  3OWT A;  2IGM A;  2NAZ A;  3W3C A;  3WTU C;  4OMY A;  3BZ6 A;  2XPV A;  3TO7 A;  1Y0R A;  3RPQ A;  3GLL A;  1H9T A;  2DT7 B;  2VE8 A;  4U87 A;  2FBI A;  2CSO A;  1EV7 A;  2IA2 A;  4EM1 A;  1K4T A;  3FMS A;  3QFS A;  3T9G A;  3G3Z A;  3KP7 A;  1MIJ A;  4ANJ A;  3BR6 A;  4I98 B;  1RR8 C;  1KU9 A;  1MSE C;  4XMY A;  3ZQL A;  2NS7 A;  3QOD A;  4F7Z A;  1MDM B;  2E1N A;  4G94 A;  2YX4 A;  2WPD A;  1TYW A;  4MGR A;  1VQ8 B;  2QYO A;  2CRG A;  4V02 C;  1XCV A;  1G6N A;  1SC7 A;  4E7L A;  2R7O A;  3E6C C;  2DK5 A;  2UZK A;  5E17 F;  3EYY A;  1JUP A;  2GXA A;  3AG2 H;  5KVR A;  1E63 A;  1JRG A;  2HR3 A;  3WE3 A;  3LSP A;  1EP3 B;  4JRA C;  2RC5 A;  1ZAR A;  2VXZ A;  2KL4 A;  4RGS A;  4OIR F;  2X3U A;  1U2R A;  1VQP B;  1PUE E;  1JE8 A;  4JK1 X;  1VF7 A;  1WH5 A;  3ZZU A;  1O57 A;  4P9F A;  3TOA A;  3A0B C;  2O03 A;  3ERM A;  1W4M A;  3PQJ A;  1ZG3 A;  2R7T A;  1MNM C;  1U2W A;  2ACJ A;  1KMH A;  4ZC3 A;  4I02 A;  4DK0 A;  2HDC A;  2QQ9 A;  4FIS A;  4M0L A;  4HX4 A;  5JVT A;  3J80 Z;  2C4T A;  4NK8 A;  2OF7 A;  3VNU A;  3EUH C;  1QGA A;  4MYT A;  2HTS A;  3QYE A;  5HLI A;  4NHJ A;  2JUC A;  1E1R A;  2O1D A;  2D5V A;  3FKJ A;  5JLX A;  2NTQ A;  5ICF A;  2LR8 A;  3B90 A;  4BE0 A;  1C0W A;  1TWC J;  2Y0M A;  3J7A Y;  1EFT A;  1YJN I;  2WZN A;  2L3D A;  3P5J A;  5J40 A;  2VJJ A;  3OIP A;  4Y3O A;  1R5N A;  4GO1 A;  4OMZ A;  1XMX A;  3CUQ A;  4BAY A;  1LFB A;  3HGY A;  1QFJ A;  2XNC A;  3ABM H;  4BU2 A;  4IX7 A;  1HA3 A;  2C2W A;  3ELK A;  2Y75 A;  3I5U A;  3M07 A;  3ZMV A;  1FIA A;  2NTP A;  2MA3 A;  2O0W A;  2VQH A;  3MVP A;  4B4C A;  4EM2 A;  3CMY A;  4WZE A;  2W4S A;  3FXM A;  1N8R D;  3K4J A;  2GBY A;  1MZB A;  1PVE A;  2CG4 A;  4KA4 A;  4ENJ A;  1S72 B;  1O8G A;  2Q6I A;  4ASU A;  1P4A A;  2XAF A;  4DZP A;  1IN4 A;  1H8H A;  3E5U A;  1HF2 A;  1MJ9 A;  1BI2 A;  2IPQ X;  1S7O A;  4I7H A;  3HBL A;  2YWG A;  4CHU A;  5TRD A;  2VJI A;  3PUF A;  2E2H J;  2MW8 A;  2V7T A;  2DOF A;  3KYL A;  2J8K A;  4XBF A;  1N75 A;  3CCR B;  4RDK A;  2XDV A;  5ILU A;  3HEF A;  1D1A A;  4QTR A;  1BJZ A;  2HOS A;  1B2R A;  1E62 A;  3D5S C;  2EV6 A;  2ZXI A;  4D0P A;  4YEL A;  5FL7 A;  1KK3 A;  3ULQ B;  2IRF G;  3P9K A;  2HMA A;  5CLS A;  3GVL A;  1T08 B;  2HTJ A;  2V4J C;  4N3N A;  4MTE A;  4EJU A;  2NSP A;  3DTE A;  4CCM A;  3N4M A;  2V9K A;  3E97 A;  4DZJ A;  2F4N A;  3L2V A;  5F4O A;  2IP2 A;  4YII A;  5TGT A;  2ZO4 A;  3SUC A;  1A8P A;  3SLN A;  4HE5 A;  2XUB A;  4UVC A;  2MSY A;  4F92 B;  2COM A;  5M5W J;  1Y0Y A;  2KPM A;  4XRS G;  5HLG A;  3WTT C;  3FIW A;  2LKS A;  1SAX A;  1R1T A;  2PMD A;  4EM0 B;  3RPU A;  3OYD A;  3JRB A;  1ZRF A;  4XON A;  1K6O A;  3ZQI A;  4YZX A;  3L09 A;  1MMN A;  3ML3 A;  1FMW A;  1U3E M;  1QG0 A;  1OCO H;  5EF6 A;  1U78 A;  2R7W A;  2GQQ A;  3NAU A;  3BCB A;  3IKV A;  5CPR B;  4RS8 A;  4P5O A;  4PC6 A;  2CFO A;  1SKQ A;  1NDH A;  1R58 A;  2E7X A;  2HI3 A;  3E6M A;  3KX2 A;  3CCJ I;  2M34 A;  3Q0U A;  3PET A;  2DQL A;  2OA4 A;  4ACB A;  1QVT A;  2OK7 A;  2GWR A;  3SZT A;  5E8I A;  4CCO A;  4CO8 A;  1ZYR F;  4BDZ A;  2VOO A;  4J00 A;  2V4D A;  3EQN A;  3L9F A;  4XRM A;  4PFO A;  5K5O A;  1UFM A;  5ED4 A;  5EMN A;  2AHO A;  4H9G A;  3ZQH A;  1D0Z A;  1N78 A;  5JVG F;  1PLU A;  3EUH A;  3U2R A;  2DW4 A;  2QEN A;  1T6S A;  2F5C A;  4RGX A;  4QHY A;  4G7Z F;  1UG2 A;  2CUJ A;  4AVZ A;  4EGZ A;  2WB1 A;  5LD2 C;  2EPF A;  1X1P A;  4X7F A;  4BEH B;  2EFG A;  1NB9 A;  4X6A J;  4OP7 A;  2ZCW A;  1WJD A;  3E7L A;  2B7C A;  4OPV A;  3NAW A;  2DTZ A;  1P4X A;  4Z2Y A;  2M45 A;  3HOU J;  1JUM A;  3RPU D;  1FY7 A;  4PC3 A;  4MFD A;  3BR1 A;  4CCK A;  4RPD A;  4YEJ A;  1WI9 A;  1WOR A;  3BCD A;  2W85 A;  2VPR A;  2CQK A;  4KN7 X;  5EGO A;  2W7Z A;  2OBP A;  3CCE I;  2XTX A;  1JA1 A;  5E1W A;  4P9S A;  2IBD A;  2NT6 A;  4DQK A;  3QQA A;  2EZK A;  4A93 J;  1FBU A;  3MD2 A;  4X7C A;  5M3F J;  3GFJ A;  3J80 K;  1W5C C;  4YAL A;  3CCQ I;  2L4A A;  3DXJ F;  3GEZ A;  2DEU A;  1BOA A;  3P9C A;  3ABK H;  4P6Y A;  4WWV A;  3NB2 A;  4A3J J;  1SD7 A;  3QRF F;  3M1E A;  4B8X A;  4BJT A;  4X7E A;  1G3Y A;  2P81 A;  2ECB A;  3HIF A;  1MSF C;  4AU7 A;  3KL9 A;  3O6B B;  4B3A A;  1IXR C;  3IRR A;  4Z4V A;  4Y4R A;  2JVG A;  1X2M A;  3TMO A;  4GFB A;  1I6H J;  4IKF A;  2X48 A;  3E3V A;  4EGY A;  2VOD A;  1OGI A;  5E79 C;  2CK3 A;  3GQ7 A;  2TRT A;  2QSG X;  3VDX A;  5ILS A;  1IO2 A;  3ABL H;  5CVU A;  2HYF A;  2P6S A;  1R71 A;  4YZ0 A;  3NQO A;  2OAZ A;  3L2U A;  1RET A;  3HKZ A;  2VC0 A;  1YX2 A;  3ZRG A;  2IOU G;  1E3X A;  2LKX A;  4TKO B;  2VBW A;  5BSY A;  3SQV A;  1CNF A;  3H0D A;  1MH4 A;  1IDZ A;  2PMU A;  1G4D A;  5B5E C;  4PCQ A;  5LMZ A;  5HZA A;  1EA0 A;  4A3B J;  4XKW A;  4RCZ A;  2HNH A;  1UHM A;  2FJ1 A;  2JTV A;  4CQJ A;  5BPD A;  2NV4 A;  2JJ2 A;  3VYT B;  4LB6 B;  5D5U B;  1XGO A;  2R7D A;  3MZ8 A;  2NRA C;  2JIZ A;  2FSW A;  1UJ8 A;  2DAO A;  2OTL B;  2IA0 A;  4LK0 F;  1USS A;  3BQJ A;  4G5G A;  3DU1 X;  4ZYG A;  3GX4 X;  3TW6 A;  3E0J B;  3JQQ A;  2XZL A;  2F4I A;  1CQT A;  4ASN A;  2Y31 A;  2VFO A;  1J75 A; 
#chains in the Genus database with same CATH homology
 1T5E A;  2XSJ C;  3DKY A;  2M7A A;  1H80 A;  4KJZ A;  2K9M A;  2RRE A;  1WJC A;  3BH4 A;  5HNF A;  3OYH A;  1I18 A;  3JUR A;  3K4B A;  3MKY B;  2KP6 A;  4HNU A;  1KON A;  3VR6 A;  2VBE A;  4E7J A;  2KLO A;  4LG3 A;  4PJJ A;  4Z05 A;  1WJ5 A;  1O88 A;  2IXS A;  2NT9 A;  3HPG A;  4RM3 A;  4W8T A;  4PJN A;  2KRC A;  1Z3X A;  4II3 A;  1W0J A;  4PJM A;  3VYR B;  1HVX A;  3TBI A;  3OL3 A;  3VYU B;  1QHG A;  2X1E A;  3LSM A;  3VSK A;  4XM3 A;  2AQE A;  1I8D A;  4F3Q A;  2PJR B;  1MAB A;  2LY1 A;  2VAS A;  4E4H A;  2BSP A;  3DTK A;  2UUZ A;  1R6R A;  2XF7 A;  3U21 A;  4HWV A;  1WJE A;  3ZIA A;  2O04 A;  3OAA A;  2VB6 A;  1PKV A;  1UD6 A;  3EQO A;  1VBL A;  2R7S A;  4Y33 A;  3L2W A;  1O8J A;  2NOJ B;  4BE1 A;  3MKW B;  3OYF A;  1X0C A;  4BEH A;  3ONQ A;  5HLT A;  3SEZ A;  1O8K A;  4U7B A;  3CMM A;  2F5V A;  2BW3 A;  2HDW A;  3H5R A;  2GJP A;  2ZZG A;  3OFN A;  3OYN A;  2WBM A;  4XKB A;  1MMD A;  1COW A;  1V5F A;  4ITV A;  3HG9 A;  2K9L A;  4W8Q A;  1OLT A;  2A6T A;  3OS2 A;  1EE6 A;  1UAA A;  4NC8 A;  1MNE A;  1O8F A;  2KVO A;  3WWG A;  4GQN A;  1V0E A;  2VLA A;  1W9X A;  4P1W A;  2CUZ A;  4FXU A;  1D1B A;  2IGO A;  4XOP A;  2CS3 A;  4F55 A;  1DBG A;  2WY8 Q;  2JJ1 A;  2ZZE A;  3V42 A;  1UG0 A;  1VZ0 A;  2QKL B;  3K70 C;  3SEQ A;  4ZTJ A;  2WJV A;  4OZY A;  2LRE A;  2UWM A;  3T53 B;  4C2L A;  2ELJ A;  1GLN A;  2XAU A;  3LSK A;  3RQ4 A;  3HOS A;  1X1D A;  4NQW B;  4RLQ A;  3FHN A;  2W7N A;  4UZU A;  2O0V A;  3K70 D;  1MMG A;  4BQQ A;  1OGM X;  4H4K C;  3S3O A;  1MW7 A;  2WSS A;  1NHC A;  1QCX A;  4MXN A;  2D3L A;  3HAG A;  1MMA A;  2VJ4 A;  4XLC A;  2GK7 A;  3W2A A;  3G2B A;  1U0J A;  1DQU A;  1BHE A;  2VL8 A;  3OY9 A;  1UD4 A;  3OMY A;  2HLD A;  3OE7 A;  2GJR A;  3VST A;  3RSN A;  1JTA A;  3FPP A;  1LVK A;  1T0F C;  1G59 A;  5CDF A;  2CW8 A;  3DPL C;  1NG6 A;  2A5W A;  4N4O B;  4DNT B;  1X4P A;  4I84 A;  3A3B A;  4CCJ A;  1K28 D;  2IS6 A;  1WJF A;  2X6Y A;  1WJA A;  4XLF A;  2JA2 A;  4YXW A;  4B3X A;  2O5R A;  4BE2 A;  2LZJ A;  3IAM 2;  2MD0 A;  4NUB A;  4BQO A;  4BQN A;  2JDI A;  1WPC A;  2CV0 A;  5CQG A;  2OC6 A;  2UVF A;  1K5C A;  4XR6 A;  3LSI A;  3W2W A;  3GBG A;  1OOC A;  4KKS A;  4XL9 A;  1BR4 A;  1V5E A;  2VQL A;  2W00 A;  4EAT A;  4TT3 A;  3S3N A;  3OS1 A;  2X51 A;  4RLF A;  3RTR A;  4DOZ A;  3NWT A;  3H9Q A;  2Y0S A;  2K5C A;  3GVK A;  5CKT A;  2CH0 A;  1YE9 A;  3H35 A;  3T56 B;  3A2K A;  2CW7 A;  2JSP A;  2GK6 A;  3ZCO A;  4D9J A;  3GVJ A;  1RMG A;  1DGR M;  4W8R A;  1FMV A;  4IQ4 A;  3C2G A;  2RQQ A;  2MYS A;  4KIS A;  2R4G A;  2LOO A;  3PSF A;  1PXZ A;  1AA7 A;  2W6J A;  4TSF A;  3H5N A;  1IDJ A;  2NST A;  4E7I A;  2Z16 A;  1X1A A;  3VWB A;  3PJR A;  2IS1 A;  1WTH D;  4DJA A;  3S32 A;  5HVQ C;  2QE7 A;  2VQC A;  3KRG A;  4W8S A;  1KCC A;  3QYF A;  2ZSH B;  4ZDP A;  1PE9 A;  4C2T A;  3A1Y A;  1H8E A;  2PEC A;  2DT6 A;  3OIQ A;  2E60 A;  4BUP A;  1QU3 A;  1D1C A;  2V1N A;  2XC7 A;  1VLY A;  2E5N A;  3ZSC A;  3MKZ A;  1EA3 A;  2NZM A;  1TZL A;  2BVM A;  4XN0 A;  2CV1 A;  2IQ7 A;  1KCD A;  3LFU A;  2KQR A;  2WAF A;  4CH7 A;  4CSW A;  3CP2 A;  1V0F A;  2O17 A;  1KZL A;  4QPQ A;  3OYL A;  2PJR A;  2UVE A;  3PUB A;  3UNG C;  4BJ5 C;  2R7R A;  3DWL E;  3ZXS A;  3OYI A;  2Z6B D;  1DBO A;  1PYV A;  3CP8 A;  4HRI A;  3FY3 A;  3AFH A;  2V7F A;  4OJ6 A;  5FRN A;  3KEY A;  3VSV A;  2HZD A;  4OZZ A;  3BC9 A;  4DNR B;  2FUG 2;  3OYJ A;  3T51 B;  4HG2 A;  3IAS 2;  1IDK A;  2M0M A;  3HOT A;  4QPO A;  1XG2 A;  3RCO A;  4U49 A;  1T95 A;  2QKM B;  2HPI A;  2JVH A;  3LNN A;  1LKX A;  3A4C A;  1UD8 A;  3GQ9 A;  4BAC A;  3BCA A;  4DIQ A;  2EWE A;  3AKZ A;  2HVR A;  4LIV A;  4F52 A;  1DGW Y;  4JOM A;  4XKC A;  3BCF A;  1O8M A;  4PMH A;  4XNF A;  4B3F X;  3DKX A;  1JI8 A;  4E7S A;  4E0F A;  4RMN A;  4XLH A;  4XOT A;  4B44 A;  1SFK A;  4ZTF A;  4X0G A;  2I8D A;  1O8I A;  2XOK A;  4E7Z A;  2ZTN A;  3IUO A;  3OR1 C;  5CQE A;  3S3M A;  3DU5 A;  4RM2 A;  2ZZF A;  1HZE A;  4CCN A;  2LBF B;  5KNL A;  4L8J A;  1GQ8 A;  1OFL A;  2X3H A;  1W36 C;  5AMV A;  4JMQ A;  2X85 A;  2M3A A;  3PNY A;  3CES A;  3DLA A;  2IS4 A;  1HG8 A;  3ZQQ A;  2Q1Z B;  3BG7 A;  4ZDO A;  2CMP A;  3LMM A;  4D1Q A;  1V5G A;  1E79 A;  2XZO A;  2XZP A;  3K4M A;  2MFZ A;  3EPZ A;  4E7H A;  1W36 D;  4LIT A;  2XF5 A;  5LFA A;  2UV1 A;  1P9Q C;  3OYK A;  3I3L A;  1E43 A;  4XN3 A;  3VMW A;  3DQV C;  3UR3 C;  2WZP P;  5FRO A;  3BLY A;  2VIX A;  2LY2 A;  3PL8 A;  3PNV A;  1S9H A;  4OJL A;  4G7W A;  2X6X A;  4OJP A;  3SYT A;  4BGD A;  3OWT A;  1NG7 A;  2IGM A;  3W3C A;  1O8L A;  1UD2 A;  3PSI A;  2DT7 B;  4U87 A;  2D3N A;  4P22 A;  4B3G A;  3T9G A;  3DTI A;  3H9J A;  1UD3 A;  2DCE A;  1X1B A;  3D5L A;  4GRI A;  3VSL A;  4ANJ A;  4E7K A;  1Y56 A;  4G7X A;  1WMR A;  4OJO A;  1WP6 A;  4PFP A;  4XMY A;  3QOD A;  3B8Y A;  2WPD A;  1W0K A;  4II2 A;  4F93 B;  3ZPP A;  4ZDL A;  1OR7 C;  2MAB A;  2P0W A;  4ZYA A;  4E7L A;  1AIR A;  2R7O A;  4PUS A;  2E1B A;  3OOU A;  1JRG A;  4DBR A;  1E1Q A;  4B48 A;  2KMU A;  2VXZ A;  2KL4 A;  2PMZ A;  3QYB A;  4CZC A;  4AYB A;  1VF7 A;  3S8P A;  2XGJ A;  5KCM A;  3L2R A;  1QHH D;  2WAE A;  1LDK B;  1HA8 A;  3JU4 A;  4NK6 A;  4C2U A;  3FKS A;  3OEH A;  3DDY A;  4MR0 A;  2KRH A;  4G6T B;  2ZXH A;  2R7T A;  2PYH A;  1KMH A;  3K6G A;  4ZC3 A;  1WJB A;  4B47 A;  2VBM A;  4DK0 A;  2M7B A;  4XD7 A;  3DPU A;  2XF6 A;  4CUG A;  4XKV A;  4XLE A;  1OB0 A;  4NK8 A;  3EUH C;  3QYE A;  2O1D A;  4KIT B;  1E1R A;  3PNT A;  2KDO A;  3FKJ A;  4HPQ A;  3G05 A;  2NTQ A;  4OWR B;  1BLI A;  1KTW A;  3B90 A;  1IB4 A;  4BE0 A;  2L9N A;  3OS0 A;  2K3P A;  3OYE A;  2CV2 A;  3HC7 A;  3J7A Y;  2VKH A;  3H5A A;  1BMF A;  2X53 S;  4BXF A;  2W6I A;  3NWS A;  2VJJ A;  5DN6 A;  3OIP A;  4N4N B;  4Y3O A;  4CCL A;  4C9Y A;  4HEA 2;  3K4L A;  3TL4 X;  3CF2 A;  4BDY A;  2GJK A;  2IGN A;  2Z8G A;  4BU2 A;  4IX7 A;  1IRX A;  1FX0 A;  2NTP A;  2W82 A;  4PSW A;  2JUG A;  2W1O A;  3DU6 A;  3AL0 B;  2DJI A;  2O0W A;  2VQH A;  1IA5 A;  3GQB A;  4DBQ A;  4XQF A;  2W4S A;  3C2H A;  1X4O A;  2L7K A;  3K4J A;  1LFP A;  2LC2 A;  2R7X A;  2X8K A;  3S93 A;  4XOR A;  4HSR A;  2R7V A;  2M4K A;  1O8G A;  1SAU A;  4PSX A;  4ASU A;  4Z03 A;  4FAS D;  1H8H A;  3OOC A;  3AL0 C;  3F9K A;  2M4G A;  3M1C A;  4XLA A;  3DEE A;  4BL0 B;  4KKU A;  2HU9 A;  2ODL A;  2VJI A;  1OHH A;  2HVQ A;  2F1M A;  3KYL A;  2LBF A;  4ZJZ A;  2BOL A;  3ZGK A;  1N75 A;  3VYS B;  2XDV A;  4EW9 A;  1D1A A;  4URR A;  3OYM A;  1MND A;  3D5S C;  2ZXI A;  1X19 A;  4YEL A;  2HQA A;  5FL7 A;  4PK4 A;  1RU4 A;  1J09 A;  2IS2 A;  4Z1M A;  1WFX A;  4OAY A;  3E1S A;  3GVL A;  2V4J C;  4YRV A;  2IGK A;  2L5Q A;  3ZR8 X;  2OV7 A;  2NSP A;  3OYA A;  3DTE A;  4CCM A;  1QJV A;  3K4C A;  2V9K A;  3GQA A;  2HVS A;  2ZTG A;  3N05 A;  2VQG A;  3L2V A;  1X1C A;  1Z21 A;  5TGT A;  1K6Y A;  3NE5 B;  5IK2 A;  2HPM A;  5C1E A;  3SUC A;  2WJY A;  2LG4 A;  4F92 B;  1O8D A;  3OYB A;  2OUM A;  1UEL B;  1D0Y A;  2KPM A;  2WY7 Q;  2KZV A;  1OGO X;  2WA0 A;  3OYD A;  3HL2 A;  2X1C A;  2E1M B;  4XON A;  3OW7 A;  4YZX A;  1OFM A;  1MMN A;  2GOM A;  5HNH A;  1FMW A;  2VJ5 A;  2R9V A;  1BN8 A;  2ZFU A;  3A3G A;  3D5R C;  2R7W A;  1O8H A;  3BCB A;  4CA0 A;  2F6C A;  5CPR B;  1ZEL A;  4P5O A;  2INV A;  2F43 A;  1PJR A;  2VKD A;  3I9V 2;  3L2Q A;  2CFO A;  2LRD A;  4J01 A;  1NRK A;  3OYC A;  3KX2 A;  2V31 A;  2E1M C;  4OAZ A;  3CJQ B;  2ZZQ A;  2QY1 A;  3OEE A;  3FDY A;  2AQF A;  4HIZ A;  4BDZ A;  1EFR A;  4CCO A;  1ERD A;  3OL4 A;  2V4D A;  4J00 A;  2M5S A;  3EQN A;  2QXZ A;  1YX3 A;  2LH9 A;  4PFO A;  2DIE A;  4NNJ A;  2MC4 A;  3PFY A;  4KT6 A;  1D0Z A;  1N78 A;  1PLU A;  1BPL A;  1G8X A;  4JQF A;  3UW0 A;  4YZQ A;  3VSU A;  2CUJ A;  4AVZ A;  2R7U A;  2WB1 A;  2V26 A;  5LD2 C;  5FRM A;  3EUK L;  4BEH B;  2V6E A;  1WJD A;  4BJ6 C;  2BW3 B;  1BR2 A;  4DGW B;  4C30 A;  2VXD A;  5KHD A;  3GQ8 A;  2Q2E B;  3RPU D;  1Z7L A;  2BVL A;  2E5Z A;  4CCK A;  4YEJ A;  3DPT A;  3BCD A;  4IQJ A;  2X1D A;  3H9G A;  2RNG A;  3SZG A;  4HNT A;  2XND A;  2PYG A;  1E3Z A;  3K4K A;  1E0E A;  1BOB A;  3GRH A;  2NT6 A;  2Z2S B;  3OYG A;  3K4N A;  1O8E A;  5HOO A;  3MD2 A;  2R7Q A;  4YZA A;  2WAQ A;  3EUA A;  2Z1D A;  3HUG B;  3OR2 C;  3LL7 A;  4OJ5 A;  4BJT A;  3ZPN A;  3W2V A;  4F91 B;  4B43 A;  3QOE A;  2GOX B;  3VMV A;  4NC7 A;  4AU7 A;  1UD5 A;  2WAD A;  3HXL A;  3CZ6 A;  4KKT A;  4Y4R A;  2JVG A;  3TMO A;  3WQZ A;  3LMW A;  3MMY B;  4IKF A;  1CZF A;  3GQ7 A;  1YX5 A;  2L2O A;  2CK3 A;  2KHM A;  2VPL A;  3CJR B;  3BC8 A;  3H94 A;  2INU A;  3VDX A;  2DOA A;  2ZSI B;  1SKY B;  2V7Q A;  5C1C A;  4YZ0 A;  3KEW A;  3FBI B;  3HPH A;  3L2U A;  4MLO A;  3HKZ A;  4PJL A;  1NBM A;  3ZRG A;  2QX3 A;  1E3X A;  3IP4 B;  4TKO B;  1Y6I A;  2X6W A;  5JHF A;  1RWR A;  3H0D A;  1VJS A;  3LSH A;  2LYC A;  3M8J A;  4DK1 A;  4G6I A;  5HKK A;  1Z3Y A;  4BS9 A;  4XKW A;  3K10 A;  2HNH A;  3B4N A;  4E6K G;  4FET A;  2JJ2 A;  4U4B A;  1TT0 A;  3VYT B;  2NTB A;  3SDB A;  3OPO A;  2VBK A;  3A35 A;  3BG6 A;  2DXI A;  2JIZ A;  3LSG A;  1D0X A;  1N77 A;  4Z06 A;  4HST A;  1DP3 A;  2L9S A;  4IZZ A;  1BR1 A;  3E0J B;  4R79 A;  2XZL A;  2F4I A;  4LIU A;  3FBN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...