2VJJA

Tailspike protein of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
598
structure length
598
Chain Sequence
b'DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE PROTEIN
publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 232
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjjA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjjA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjjA02
4HWVA 5C1CA 4XLHA 2UVEA 2PECA 4U49A 4I84A 1PLUA 4XOTA 1O8HA 5AMVA 3ZPPA 2NZMA 5C1EA 4NK6A 1RWRA 4XORA 1BHEA 1XG2A 2QXZA 4URRA 1OGMX 4PMHA 1O8GA 4W8QA 4OJ5A 1KCCA 2O04A 3GRHA 4XMYA 2NSPA 4XN0A 1IDJA 2IQ7A 2VJJA 4C2LA 4YZXA 3GQ7A 3GQAA 2NTQA 2NSTA 2UVFA 1DBOA 1BN8A 1JTAA 2QX3A 3VMWA 1O8FA 4XNFA 4YELA 1WMRA 3B8YA 4OJLA 1O8LA 2NT6A 1K5CA 4AVZA 1KTWA 2O0WA 4XONA 4XKVA 4U4BA 2O17A 1IA5A 2PYHA 3VMVA 2VBEA 4MR0A 2X6XA 4W8TA 2X6WA 4YZAA 1OFLA 1X0CA 3VSUA 1GQ8A 1O8EA 3VSTA 2NTPA 2INUA 2INVA 4Z05A 3FY3A 2VBKA 2BSPA 3GQ9A 1OGOX 4YEJA 1O8MA 4XL9A 1O8JA 4Z03A 3GQ8A 3LMWA 1O8IA 4MXNA 3ZSCA 3B90A 1AIRA 1H80A 3JURA 1PE9A 2VJIA 1O88A 2NT9A 2NTBA 2VBMA 4W8SA 2X85A 4XLEA 4OJ6A 4XLAA 3KRGA 4XN3A 2QY1A 2X6YA 4W8RA 4XLFA 1VBLA 1O8KA 4EW9A 4XM3A 1DBGA 3WWGA 4Z06A 4OJPA 1QJVA 4XR6A 2Z8GA 1IB4A 1KCDA 1EE6A 3T9GA 1IDKA 1O8DA 4XLCA 2O1DA 2PYGA 4XOPA 3UW0A 3B4NA 1HG8A 1OFMA 1RMGA 4XKWA 1JRGA 4OJOA 4NK8A 1NHCA 4YZQA 4OZYA 3VSVA 1QCXA 2O0VA 2X3HA 1OOCA 3SUCA 3EQNA 4XQFA 3EQOA 2ODLA 1CZFA 1PXZA 1RU4A 4YZ0A 4OZZA 2EWEA
chains in the Genus database with same CATH superfamily
3U2RA 3BG3A 5JFRA 4E7JA 1A31A 2V7UA 4YXWA 3K4BA 4G6IA 3OR2C 1QA6A 1I50J 3RY8A 3J80K 1ON1A 5M5WJ 4AM3A 2ELHA 3E1SA 3ABUA 1XMXA 1QNTA 2A68F 3JREA 2GZWA 4MYUA 3BZ6A 1IN4A 2VBUA 2AXTC 1REPC 2OTJB 1HKSA 4LG0A 4J00A 2E1CA 2C2WA 3HTSB 2VNJA 4MO7A 3M8FA 4YZXA 3ZMVA 3GQ7A 2FF4A 3GZ6A 1VQ8B 1ZAOA 4G5GA 1HKQA 2KDZA 1R5ID 3VMWA 4FHTA 2QUFA 4AVPA 3HOTA 4WZEA 1V55H 2ZXWH 3QP5A 1HQCA 4B1RA 1FNMA 3FM3A 2L02A 2Y48A 1X3ZB 1O8LA 3DKWA 1FNDA 1K5CA 5F4JA 1QA3A 1DABA 1FIAA 2FXAA 1MBHA 2LH9A 2IRFG 2BXZA 2F1LA 2V9PA 3FM5A 1LE8B 4Z4YA 4IVNA 4W97A 4R79A 4DK1A 2QA4B 2O0YA 1K78A 4O6JA 4A69C 3O8HA 4YEIA 2VKHA 1P9QC 1QHGA 3IKVA 3G4SI 5K1YA 4YHBA 4HYEA 4KNYA 4E0FA 2GOMA 3ABMH 3RIRA 3W2AA 3T8RA 4DNTB 3GX4X 4YZAA 3GTQJ 4A93J 2PMDA 2XHKA 3E97A 3GXOA 3WBJA 5HODA 2YR2A 4QFMA 3GTJJ 2RC5A 2A6HF 5L46A 2BSPA 1OGOX 1YLOA 2OF7A 3HKZA 2JA6J 3D5RC 4Q7JB 1RNLA 1O8JA 2CRGA 2CG4A 3LA3A 4RGRA 1NK2P 2HTSA 2ZKZA 4JK1X 1MSFC 1BA5A 2DTZA 2QQBA 3HBLA 1L3LA 2W6JA 4W8SA 3P26A 1D2EA 3OYEA 2J5OA 1A36A 4D0PA 1COWA 1U2WA 5JVTA 1TYWA 3BT9A 3GYHX 1U9NA 1J09A 2EWNA 2ID3A 2QCOA 2X6YA 1XE1A 1Q82D 1S4MA 4JX4A 3A1YA 3Q3SA 3P9KA 3DKYA 3HG9A 1K7AA 4ZCIA 2MYSA 4V2GA 1R1UA 4IHSA 4N3GA 2LNBA 1WJAA 3GTKJ 2WY8Q 4AD9A 3CDHA 3K4LA 3HJEA 3FMSA 4PFOA 4E7ZA 3IH4A 1S72B 1EE6A 2FD5A 1EH7A 4EM2A 1IDKA 2K02A 5KAFC 5B3SH 3R0AA 3PO2J 2DA6A 2VJ5A 3T53B 3I5UA 4XSXF 3OS1A 2H09A 1O3SA 1VQ9B 5FO1A 5EF6A 2PJPA 3MKWB 1QO0D 4YIIA 1W36C 1BLIA 1VHEA 2BGJA 1IXSB 2NPFA 3BG7A 2C5BA 1NBMA 4U0YA 4CH7A 1LB2A 4U0VA 1Y6IA 2FBHA 3CCJI 2K9LA 4OOVA 3MCZA 1RU4A 1GVJA 3G6EI 3WU2C 5BNGA 1E79A 2EWEA 2BVNA 2OBRA 4OIPF 3TMOA 3SQVA 2BXYA 1NG7A 4LD5A 2L9VA 2D45A 1MSEC 2BGCA 1U5TA 3CCEI 3VEPA 3BPXA 4CCMA 5C1EA 3ZBUA 1ZKGA 5J8FA 3DU1X 2L7KA 1S9HA 4OPVA 1GVHA 4N0BA 2GK6A 1P4AA 1MBFA 3L2VA 2NVXJ 4E7SA 4LG0B 1BJKA 3T1BA 5ILSA 2O04A 2L3DA 2R4GA 2VBZA 4KISA 2VKVA 2ISYA 2HNHA 1Q1VA 1IG7A 1OKRA 4F93B 1LNWA 1WJDA 1IV6A 2NTQA 2MD0A 1G7TA 2DODA 4ZGNB 2NSTA 1TT0A 2M4KA 4L9VA 1C0WA 1ZHFA 3WGGA 1TTTA 1STZA 3TO7A 4UZUA 3C2HA 5E18F 1SANA 3GW2A 4P9UA 2FA5A 1K78B 3G1OA 2RNGA 1I27A 2EILH 3TGNA 2B0LA 2XASA 5EMNA 3RSNA 3SXYA 2KJBA 3N6ZA 2KT0A 2OQRA 3ZQFA 5A2QZ 2IPQX 2VC0A 5LHIA 2XGJA 2LBFA 2J8KA 1RESA 5B1AH 1OCZH 3G4SB 5CVJA 1LPQA 1LEAA 1G7SA 2E7WA 4TMZA 4NB5A 2XC1A 2XZLA 2B0RA 3V76A 1KU2A 3CP8A 3TH0A 2Z6BD 2IGKA 5IYDJ 2MLGA 2FOWA 1ZRCA 3IC7A 1MDMA 4FQGA 3ZZUA 4ZCLA 1U5TC 1Z7LA 1KQ8A 4IOCF 3JQPA 3KE2A 2C77A 1EJ9A 2M45A 3FBIB 3VODA 2JA8J 4P9SA 1VQ4B 1TNTA 2A6EF 1F1ZA 3PNVA 3QSYA 3CCMB 5E1XA 2QDXA 2HOTA 4RD1A 2QY1A 2XNJA 3HHHA 3R0JA 4B3AA 3ZP5A 1OYWA 3QODA 1CGPA 1OISA 4B47A 1DDGA 4HF0A 2LVSA 4XM3A 1IN7A 4LC0A 3WWGA 2M0MA 4Q5SF 4G12A 1T98A 4NDLA 1UD3A 2WAEA 3MWMA 4ZYEA 2WAQN 2HKXA 2GIVA 2EV6A 2ZMEB 3ZMUA 1WZ2A 5IT9K 2P5VA 4RAZA 1W1WE 4JX5A 2ECBA 2YS9A 5H6QA 1AOYA 3GTPJ 3E3VA 3S2HJ 3OYMA 1KK2A 1HDDC 4KICA 5LHHA 2LDUA 2HQNA 4DYQA 1QCXA 1N25A 1OLTA 4AIKA 2IS4A 4TT3A 1PUEE 2R7FA 3PSSA 4XRMA 1TWHJ 4LITA 1MNMC 1FYMA 1V54H 5EZHA 4A3MJ 2LKXA 2VQLA 4YAWA 4I2OA 1N0VC 1RZ4A 3A1PA 3K69A 3I55I 3S2DJ 3AFHA 2GQFA 5GAGJ 2W6IA 1WI9A 4IQJA 5IP7J 4I6ZA 2IGMA 4Y9RA 2NVYJ 1O8HA 4UY8I 2HDNB 2NZMA 1ULYA 2LRDA 2EV0A 2WV0A 2HU9A 5TISC 4A3LJ 1I5ZA 3ZIAA 3CCQI 3FIWA 1P2FA 1X3WB 3DTEA 4OIOF 4V19K 1KMHA 5CVVA 2O61A 3TKYA 1TYVA 1VQLI 3I54A 3GRHA 1SD7A 1FP2A 4I09A 3A4CA 4E6KG 4KH3A 3LSKA 5E3LA 1HA8A 1S5LC 3W5HA 3QP6A 3R6KA 2RVCA 2QX3A 2O5RA 1X1AA 2OUMA 3V8JA 2HPIA 3Q5FA 2QKMB 4YFKF 1GXPA 1X3UA 1YIJB 3F3XA 2DK8A 2FQ3A 3C7JA 2QGGA 2NT6A 5DS0A 2GXGA 3LSPA 2O0WA 2UV1A 4I76A 1HCRA 2M5SA 4CA0A 2BM1A 4AIJA 2ICWG 3CDIA 4RGXA 2JRTA 1Z77A 3CUQA 2MGQA 2VFMA 3LSRA 1HKTA 1YX2A 3CCLB 5C44J 1ETKA 3TDZC 2R6HA 2VBEA 2LBFB 5GTIC 1SC7A 4ZCMA 4C3JJ 1J59A 4LB6B 1D0XA 3OW7A 2TRTA 2V7XA 5FGMA 4B3GA 2CUZA 1HW5A 3S1QJ 4TMXA 1PUFA 3K6GA 4BJ5C 3QE2A 1XSVA 1FRNA 1O8EA 2KIFA 2VBWA 4UVCA 3HC7A 4Q48A 3JR9A 4RD0A 1MDMB 3JTHA 1R5NA 2WC2A 3HUGA 3W3CA 3L2CA 2AQFA 1TLLA 3CCVI 3LWFA 2EFPA 2JN6A 2QE7A 2CFOA 5FKLA 2O8XA 4G6TB 3RJPA 3WHCA 1H80A 4AF6A 1RKWA 2NVQJ 3LOCA 5DN6A 2NTBA 1EKEA 5HDKA 4FTHA 3K4MA 2FQ4A 4YCQA 1HSTA 2L7MP 4L0ZB 2OK8A 5HLGA 1EH8A 3C3WA 4D7NA 1GR1A 2K7LA 4PDKA 3CO7C 2XKOA 4GO1A 3WG7H 2WWYA 2VNIA 5DM6F 4RPBA 4X8IA 2R3SA 2ZL6A 3KP6A 3KP7A 4OMYA 1Y0RA 3J81K 1OCTC 1NG6A 4QV2A 4UVAA 1GJRA 1XQBA 2ZXHA 2OC6A 4RDUA 4M6YA 1T39A 1XSXA 1WJ5A 3DBHB 4NNJA 2V4DA 2P4WA 1WH5A 2DMTA 3OYLA 2QVOA 4CICA 3MAJA 4LGWA 3JRGA 3ONYA 2E1MC 2VPRA 3E6BA 1I8DA 2RGVA 2F5DA 3P5JA 3BNWA 2CUEA 1BIAA 3GTGJ 1Y1VJ 3VSVA 1D3YA 2AQEA 3CUQC 3ML3A 2HDWA 1POGA 4Y52J 4XRSG 2J5PA 2YSRA 2LMDA 1MNEA 4HZFA 1YITI 3DV8A 2HVSA 2DY1A 3AGPA 2BW3A 4S04A 2BM7A 3RZOJ 3GWZA 3MHPA 2VPLA 2R9VA 2FVGA 3Q38A 3D5SC 3JTGA 1TLHB 1W7PA 3AL0C 5FLXK 2DCEA 1V5FA 5IYWA 2UXNA 5H20A 3I55B 2VE8A 5KK1A 1D0ZA 3QPHA 4P22A 3LSIA 3PO3J 3I3LA 1MABA 2X8KA 2QXZA 2XV4S 1OB0A 1MMGA 1KD1D 2HLDA 1R1VA 5A88A 3R6SA 3U2QA 2EINH 5B5EC 2GA2A 3BTIA 1T5EA 2HMAA 1G4DA 3BR3A 1KJZA 3A3BA 3CCQB 2IW5A 2CQ7A 3DTKA 1TVCA 4LK0F 5LRRA 1UAAA 2P3MA 2K40A 4I99C 1R00A 4L9JA 1VQLB 1ZARA 2TCTA 1T2KA 3KP4A 5LD2C 1S8NA 5IOZA 1TQIA 1YHQB 3VYTB 1JGSA 5DEQA 2CW5A 4QIWN 2VL8A 3CUQB 3EPZA 3WGHA 2GJPA 4BHBA 2KL4A 4Z6YA 3BH6B 3DDYA 3SJZA 3W2GA 5HLHA 1KQ0A 3AG3H 1KQ5A 1YW9A 3WG9A 3W2IA 2JSCA 1QPIA 1OGIA 4C2MJ 2VXDA 4ON0A 3K4CA 4DBQA 1PUFB 3U6BA 3W2WA 3AL0B 1VHOA 2X6XA 4CCKA 1QPMA 3WTUC 2FBIA 5E1ZB 3PUFA 3ZQGA 2XIGA 1SMYF 2JK3A 3OYGA 1EXMA 3GVJA 4G7HF 1I39A 2DQRA 3HUGB 2NOJB 3HSFA 4OIRF 1R4NB 4M3GA 4L18B 2BSAA 1K9MD 1QFZA 1L0OC 4OPSA 4RLZA 3GZNB 3B6AA 2BHZA 4Z03A 2VB6A 3JRFA 2ECCA 3LQRA 2NS7A 4MXNA 4R1HA 4AYBA 3ISXA 2X85A 4HG2A 1HDPA 3BQZA 3G1LA 1FIPA 3W2FA 2XAQA 2DPUA 3QFSA 3ZPLA 2JA5J 4W8RA 1OYYA 3PA1A 2YWHA 3DTIA 3BQYA 3D1NI 1X2MA 2L9RA 2QBYA 5HLTA 2HVRA 3OJXA 4OWRB 3BC9A 4XD7A 4ZV4A 1K8AD 2UXXA 4C3IJ 3ASNH 3BC8A 4M9SA 3GTOJ 2MC4A 1SFOJ 3CXCB 3WQZA 2MH9A 1BX1A 3ZQLA 4X0GA 1FOXA 2K3PA 4A6EA 5GADJ 3WTTC 3H09A 1UG0A 2XDVA 3IAM2 2ZJ2A 3A02A 2BW3B 3LSTA 3WU1B 1MBEA 1TBXA 5FKMA 4Y13A 4ZYHA 1DU6A 1QGAA 1B4AA 2I5UA 5KAIC 4GYIA 1VQNI 3FJOA 1FNCA 4OMZA 1J0RA 1D8KA 2DYIA 1W7PB 3QPLA 2VFNA 2ODLA 3E5UA 2CW7A 2I1LA 5JLWA 3BLYA 3S32A 4MGRA 2VKEA 3ZN0A 1MH4A 3H36A 4XLHA 2HXOA 3AG1H 4H0EA 1F43A 4XK4A 1VI0A 2VC1A 2V9VA 2ZSHB 3GUDA 4UUTA 3TO9A 2XAFA 2VT3A 2O6WA 5TGTA 3IRQA 3F23A 4HOBA 1BW5A 1IN6A 3BTLA 1IV8A 2DFIA 2MFZA 3S93A 4OJ5A 2EV5A 4LBVA 2M2EA 4BNCA 3HRSA 3AVWA 2Y9ZA 2ZSIB 3ZMDA 4TMWA 3SYTA 4WQMA 4XN0A 2XAJA 3G73A 3OIPA 5FNZA 3H9JA 5FRMA 3ECHA 3IKTA 3SEQA 2F4NA 2YU3A 4D5CA 3W6VA 4ESFA 4DOZA 5EEHA 1GLNA 1IXCA 1ZGAA 4JOMA 4EJWA 2H6BA 3GFMA 4Z2YA 2Z2SB 5CQGA 4PCQA 2PEXA 4A0ZA 4RD2A 4HA8A 1B2RA 3T51B 5IYPA 4DW6A 1YJWI 2R7RA 1PP8F 2CUFA 5F0FA 3ABKH 5ICFA 2OTJI 2DMNA 1W9XA 4U7DA 2QYUA 1H0MA 4BBSJ 3QFTA 3BR0A 1YLFA 3L2WA 4LBYA 2KJCA 4F92B 2QMUA 1W0KA 2ELKA 1LVKA 1DUXC 2FSWA 1AA7A 4Z4TA 2E1NA 2G7HA 3MZHA 3H35A 3V42A 3OL4A 3H0GJ 1SFEA 2KVOA 1FOWA 3HOUJ 5BPDA 2XF7A 1O8IA 2KDOA 1RPWA 3G2BA 3IH2A 3FK6A 1TC3C 2P6SA 2WTEA 3DPLC 2XF5A 3FKIJ 3PENA 3ZBTA 4FK8A 1E3PA 3K4JA 1DU0A 1P7IA 3S3OA 3LSMA 4EJVA 3OS2A 1W0UA 1YIOA 1O3QA 2QBYB 4PC3A 2GJRA 4P9FA 4XLFA 1F20A 4NCNA 3Q0UA 2HOAA 3OYKA 4ROXA 1K8FA 3JRDA 2OZUA 4UB6C 4HDUA 2MA3A 1J9IA 3QQAA 2WBMA 4M0LA 5F4OA 4QUZA 5A89A 1OGJA 2Q1ZB 3DLAA 2BOLA 1WJBA 3PNYA 3MKLA 4B44A 1GAWA 1CNEA 2I10A 1SM4A 3TQNA 3WHBA 2IXSA 4A3EJ 2NOGA 3J7YJ 3ZOBA 4A5MA 1KQSB 4DQKA 3J81k 1YTYA 3C2GA 1CLWA 4A3KJ 5H5JA 3CLQA 2EFWA 4A3BJ 1G7RA 4B4DA 4GQNA 2IOUG 4OZYA 3HSEA 1W35A 1HW2A 3EYYA 2FX0A 3H9GA 4PC7A 4N4NB 2VFOA 3V7AA 1IAWA 2B7CA 3KL9A 5BSXA 3BR1A 1QVFB 1Z6RA 4M2LA 3QPSA 1BW6A 4CQJA 1IRXA 1WFXA 1U3EM 2PECA 2VZLA 1PLUA 3SY2A 1FOKA 3CLOA 3FZVA 1VQ9I 4M72A 1UMQA 2XPUA 1AU7A 1ZRDA 1FC3A 3F8FA 3EUKL 4IKFA 2DLLA 1J75A 1MBKA 1M1EB 3KYLA 4XRFA 2GIZA 1VQ6I 2GQQA 4URRA 5CJ9A 2DOEA 3CCSI 1OGMX 4JRAC 3F9KA 4OJ6A 5E8IA 3M3YJ 1KCCA 1G8XA 2HI3A 4Q47A 4FX4A 4BAYA 1D1NA 1JUMA 5JR3A 4IX7A 3R4KA 3T5XA 4E7LA 1Z67A 2PQ8A 1YJNB 5DCFA 3M1EA 1DG1G 4NC6A 1Z0XA 4X7FA 1WVRA 1VQ5B 2EZHA 2R0QC 2B7BA 2JUGA 3LMMA 4Z4VA 2LFBA 4QWQA 4HPQA 5H6RA 4L8JA 1JJ8C 2R93J 1WJCA 2HOEA 1MJ9A 3CZ6A 4UAJA 2IGNA 3QU3A 3VYUB 1Y1WJ 4IO9F 1T08B 2CC2A 4XKVA 2K3FA 3RKXA 2VODA 3ZN1A 1X1DA 3LSGA 2OQGA 4QPQA 1YJWB 1Q9SA 4NBQA 2BM0A 1XN7A 4IQ4A 3BCFA 2LD5A 2C5HA 4X1EA 2L2OA 3CRZA 4W8TA 1XB4A 1FYLA 2X6WA 1HF0A 2VBVA 2Y0SA 5FD6A 1W0TA 3JRAA 1X1BA 2GLOA 4U88A 3MZYA 1VZ0A 1ETYA 4H9GA 1ETOA 3O8GA 4UV9A 2D3LA 2BM6A 4XL9A 1BQEA 2AS5F 1LFPA 4ETSA 5LMZA 2FU4A 3KETA 4BL0B 2CO5A 4AC0A 3OW2B 1D1BA 4LBWA 1AIRA 4HX7A 1DDIA 3JURA 2VBMA 2VJIA 4RB3C 1JHHA 2GWRA 4WXHA 4ENKA 4ANJA 2NS0A 5THXA 2CS3A 4MQVA 1MJBA 4XLAA 4PC6A 1AWCA 1NJID 3GTLJ 1FP1D 3E5QA 1MMDA 5FKOA 4RM3A 1YQAA 2BV3A 3ECOA 1NDHA 1OJLA 4EATA 3HHGA 4OU0A 1ZG3A 4F55A 4BY1J 2JJ2A 2KMUA 4RLQA 1P7JA 5LEJA 2V4JC 1KCDA 3CESA 3CCVB 5AMVA 3AG2H 2ZC2A 3ZRGA 5GPCA 1VQ4I 3RKYA 3OZVA 2VYQA 2ZBVA 1HG8A 3CCMI 1YG2A 3CDLA 4IOAF 2DA5A 2LF8A 4LLNA 4EH1A 1FT9A 2BVLA 2EZLA 1JA1A 4NK8A 1D8TA 1R1TA 2D2WA 3NWSA 2B63J 2Z1DA 4OAZA 4PABA 5LGTA 2QKLB 2WJVA 4BPRA 2CFXA 4HLYA 5LHGA 4D7MA 3ISPA 2E71A 3DXJF 3CMEI 1FDRA 2VKDA 1V0FA 1U0JA 3K4KA 5D5XB 4BH9A 4QHYA 5A8AA 2JRMA 2IT0A 4ZGQB 2W1OA 4EEFG 3BDDA 1JKPC 2OA4A 3DBRB 2ZJRF 3TO6A 3HTUA 4TMTA 2JT1A 2XF6A 2HZDA 1W36D 1B8IB 1H8EA 3FKJA 3K1PA 2DDBA 4DZPA 5J47A 5M5YJ 2BE5F 2JTVA 1FX0A 2OPTA 2ZMEA 2XAHA 2YWFA 2HKOA 4PMHA 4OAYA 2M34A 3VWBA 4WXCA 3S8PA 1FTTA 2VUMJ 1WU8A 4FXUA 3GVKA 1VQ6B 4D1QA 2DK5A 3FKSA 4L5IA 2RC6A 1EP3B 4OM9A 2LP0A 3H0DA 2LOOA 3WODF 3CCSB 4X07A 3GQAA 4PZJA 1KU7A 5LEKA 1LDKB 3CB4A 1R7JA 1UHMA 1X4PA 4L5JA 5IYBJ 4LG3A 2E7XA 4F7ZA 1IHMA 3EYIA 4OJLA 5HVQC 1HSJA 3QRFF 1HZEA 1ONVA 4ESJA 1UD5A 3CCRB 1WOSA 3ONUA 3WE2A 3S14J 4ZZDA 1MMSA 1AMOA 2R7ZJ 2XZOA 3BR2A 5F64A 5F4MA 2OAZA 1Y0YA 1UZCA 2PN6A 3F72A 5E79C 4LIVA 3J7AO 2VOPA 2JIZA 3S17J 1WORA 2DJNA 1ZTRA 5K7ZA 3BY2A 4HSRA 3AVYA 3JX8A 2HXIA 4RBOA 3W2EA 3JSPA 1W4MA 3FXKA 3MFKA 2FNPA 1GQ8A 3RQ4A 1YIJI 3TW6A 2YX4A 2K4JA 2V6EA 4Z05A 2O7OA 1JI8A 2HYGD 4X0CA 1ETQA 1GV2A 3KYCB 5F1JA 1ZM4A 4B8XA 4KKTA 1RKTA 3BG9A 3CCLI 3CMMA 1O57A 1EFRA 3A03A 3PL8A 4ZZLA 1JT0A 3H3ZA 2OD5A 2F48A 1B59A 2CUJA 3OR1C 1W0JA 2VBSA 1P4MA 1I1GA 1OYIA 3DCFA 3NWTA 2ZMEC 3A8KA 3O2PE 3ZUGA 3AK5A 3SZGA 5EGOA 1CQXA 1USSA 2RNJA 2R5ZA 3L2UA 1MBJA 2Q6LA 3DQVC 3K70C 2R7UA 4BKXA 1E62A 2NYXA 3I64A 4IEJA 4Y3OA 5AIQA 5JLVC 2IS1A 3OYAA 5CYVA 4RJLA 1UJ8A 4K2EA 5HNFA 1IDYA 4HNVA 3A3GA 4NBSA 4XLCA 4BE1A 2O1DA 4Y15A 1Y39A 2IA1A 3ERED 5TRDA 1DGRM 2AO9A 2D74A 3BOQA 3SEJA 4BHCA 5E20A 2GXAA 1T6XA 3T56B 2HEOA 2X3HA 5E17F 3WTYC 3ZXSA 3SUCA 3EQNA 1XMAA 4DNCA 3CD6B 2H94A 4P12A 1PXZA 2ZXIA 2DO7A 3I59A 5DDGA 5DUIA 4YIRX 4J01A 2DAOA 3W5UA 3LFKA 2QGUA 2UVEA 1ON2A 1XTAA 4BS9A 1YI2B 4I84A 3CMEB 2BM5A 4IRIA 3WTSC 4DYRA 4V02C 4YALA 1D1AA 4KMUX 2RQQA 2A05A 3F21A 4HE5A 2VQHA 3FPPA 3CO6C 4B09A 3BG5A 1GT0C 1KYWA 1WWXA 1MBGA 1R23A 2JMWA 1B72A 1SVMA 3ZQCA 1RQPA 3REOA 2VQCA 2LTPA 1Q7YD 2LY1A 2V9KA 3LA2A 1R5GA 1ZM2A 3JRHA 4X6AJ 3FXLA 2ZTNA 3FWEA 3T0YA 4Q4ZF 1UB9A 2K27A 2GXBA 4C2LA 2Q8KA 3L09A 3SFZA 2D5VA 4RM0A 5F08A 3WXMA 2DA4A 3PIOF 3A01A 1BOAA 1O8FA 2FOKA 5KCMA 1BMFA 4O5VA 5D4RA 5F6FA 3WTVC 1F4KA 2H8RA 5JHUA 1USTA 2FE3A 3I56B 3B8YA 2CQQA 4JMQA 1YS6A 4HX8A 3IHUA 4NC8A 3FHZA 2CW0F 1H9TA 2R7TA 5C3EJ 2GJKA 1UD8A 3OOCA 2NNYA 2B5OA 2W82A 4KA4A 2CQKA 2O8KA 1EP2B 3TBIA 5AN9A 1W87A 2Z5UA 1OFEA 2HPMA 3OPOA 2VXZA 2WPDA 2PMZN 4PC1A 5B6IA 3IP4B 4G94A 3OYIA 4AWXB 3QFRA 4MNUA 3FXUA 1Y8QB 4N9HA 4RD3A 2LC2A 5CVUA 4EM1A 4RCZA 2M9HA 4A3GJ 1SAXA 5HXBA 4Z4ZA 3A35A 3BY1A 2OV7A 4XBFA 1OFLA 1X0CA 2HVQA 5K5OA 2QTZA 1YHQI 1T33A 3OL3A 3OYBA 4P3YA 2A07F 3CC4B 1BOBA 2MW8A 2Z16A 3ASRA 3P9IA 2D1HA 3FPKA 3SDGA 2EZIA 4M3FA 2Y31A 4IPAA 3ERMA 1O4XA 4U9UA 3U1KA 1O8MA 2QZAA 2I8DA 2KIMA 4OOIA 1UG2A 3GQ8A 4I02A 5F1RA 1A5JA 3LMWA 3GF2A 3A8JA 3PA2A 1Z9CA 2O03A 2HWVA 4U87A 1ZM9A 4A3DJ 2DFEA 3MKZA 4NC7A 4XLEA 5EGOB 4MFEA 3F8MA 5F0CA 2B9SA 2R5ZB 3BZKA 2Q6KA 2ID6A 3V8LA 1A35A 4A3JJ 1O3TA 3LAJA 2HS5A 1O8KA 4XSZF 2FUG2 4UUVA 3B82A 1AIPA 2BY0A 1IC8A 4OJPA 2WSSA 3DPTA 4BJTA 1MJAA 4BACA 1K4ZA 2ZJQF 2QEXB 1QBJA 2ZJPF 1HLVA 2DQLA 1JKOC 1ZGJA 1QH0A 2ELJA 5IYNA 2VBYA 4ITVA 3OIOA 5ERIA 2B7EA 2OJED 4RDLA 3A0BC 3UW0A 3WTZA 4FX0A 1OFMA 4M71A 1N0UA 1RMGA 4P55A 2ZITA 1FBQA 1GXQA 1OCOH 5L3EA 1IJWC 2ME0A 2FRHA 4XRSA 4ZYAA 5TJJA 2EIXA 3I59B 3V8KA 2RKHA 2XGCA 3QAHA 1K4TA 3Q0VA 2ZZGA 4WZKA 2DOGA 3QFCA 1ZR4A 1MMAA 1SAUA 2EK5A 3SEZA 1FY7A 4PK4A 3GCMA 1IJEA 1YX3A 4NUBA 2BF4A 3U21A 1OB5A 2XTWA 1EV7A 2CK3A 1B72B 2V1UA 1X1PA 2X51A 1B1BA 5EDNA 1H8HA 4XORA 4ZYDA 2DMPA 3NAUA 2NXNB 2D3NA 3CW2A 1TZLA 2MLKA 2JPBA 1O8GA 1UD4A 3ZQQA 1I7PA 4B3FX 1D1CA 3QYBA 4PSWA 1R5OA 4KKSA 3A01B 2VJJA 3ROUA 4CYDA 2R7XA 4CCNA 1SMTA 3BWGA 1EP1B 3KLOA 3Q9VA 4EGYA 3DBLB 2P81A 2OCEA 2PIAA 4XIDA 1CQTA 3M8JA 4RAGA 5GPAA 1JKQC 2QTLA 3VR6A 4IHYA 2V5IA 2DTRA 2LLKA 3ES9A 2W24A 2BY3A 1E1RA 1FMWA 2BVMA 2KP6A 4PFPA 1KTWA 4UZFA 1NK3P 3HGGA 2E5NA 2NVTJ 1BC8C 1ZG1A 3WNDA 4RD6A 2CU7A 2CQNA 1ZG5A 1OPCA 1S7OA 4AU7A 1QZZA 1X4OA 1XG1A 2P5LC 4KDPA 1HC8A 2YUHA 2QM3A 3GLLA 4OINF 5J4VA 1Y56A 1FMVA 3JCUC 1F60A 1V0EA 1TQMA 3DLLF 2F3LA 2COMA 2FNAA 3VSUA 3VSTA 3CJTB 3HKZN 4BBRJ 4E7KA 3FF5A 3SJPA 3IUOA 5B1BH 4LFUA 2KIUA 3ZQ7A 4X7DA 4G7OF 3E6MA 3ZCOA 2V6CA 4AIHA 4BU2A 5FB2A 3WYAA 3CJNA 5TY0A 2X48A 5D4SA 5DSZA 2IVMA 3OYCA 2XGDA 4BE2A 2L4MA 2W25A 1KZHA 3U1DA 4J19A 5LFAA 2PJRA 1E17A 2Y75A 4PJ0C 3E20A 2DCUA 3CMAB 1TWCJ 1W7PD 1EWYA 3RTRA 3PQKA 1R36A 1YE9A 1WOOA 1IZ1A 4AC9A 4I98B 3O6BB 3I4NJ 1A8PA 4XR6A 1RR7A 4QSHA 2VFQA 3C2BA 3HEFA 1EFCA 3A0HC 4IRGA 3OYNA 1J7KA 1G6NA 3MCAA 3CC7I 4FT8A 2ZNZA 4M53A 5K5RA 2K4BA 2R7OA 3LQ6A 2EB7A 3H3UA 2ZFWA 2ZCWA 3K7AJ 5ED4A 3N4MA 2H1KA 1MIJA 1ZH5A 3OZUA 4YFXF 5FKNA 2V7QA 4P96A 1ZLKA 2R7DA 4BYYA 5HS8A 1HXDA 2E1OA 4HAMA 3V4GA 1U8RA 4P5OA 4CO8A 1UFMA 4IZZA 4II3A 3NE5B 1R6RA 2XGXA 3NEUA 4BXXJ 3RQIA 2DT7B 1T95A 1VQMI 1LEBA 3HYIA 4YZ0A 4N9IA 4M6XA 4G7ZF 1VTNC 4XOTA 2F43A 1FWZA 5FA6A 3VO1A 3LJYA 3FMQA 2M87A 1Z1DA 3G1MA 1KA8A 3R61A 2LY9A 4UHTA 2CJJA 5EYRA 2JDIA 2XRNA 1XG2A 1G3YA 2O3FA 1JXSA 2MSYA 5GTHC 2LSOA 4W8QA 2VT2A 1ITYA 3CJRB 1SKYB 2W7ZA 2QQ9A 3Q6QA 2QLZA 3SDBA 1R71A 4RPDA 3QOEA 3D26A 4IHWA 4FCYA 1G3SA 1IRZA 2VN2A 2BZTA 4JYKA 3CMYA 4WCGA 3CJQB 3CPXA 1YW7A 4LJZF 2X53S 1U9OA 4XNFA 4CDGA 5HDGA 2Z33A 5JBQA 1XGOA 2DMUA 3C1DA 1TSPA 2MABA 3NB2A 4KFCA 2OBSA 5DM7F 1KRHA 3WU0A 5DS9A 3ZQIA 2ZL5A 4AVZA 3ASSA 1K83J 3PSZA 4L9NA 3ULQB 1RR8C 2BMWA 2LF7A 3M07A 4L0YB 4P2NA 1V3FA 3PUNA 3ASQA 3VMVA 3TOAA 4A0YA 1MZBA 4PJLA 1BM9A 2RC4A 4GCVA 4M9ZA 4JQFA 4ZC3A 1SKQA 2OYNA 4G1VA 1YJNI 1YO5C 3WNCA 1ZQ3P 1H85A 1XDSA 1VQ5I 2D1VA 1QFYA 2Z3YA 4E4HA 3HM5A 1BR1A 3H1CA 4G7WA 3BH7B 3B78A 5DTDA 1TWGJ 4A3IJ 4MEXF 1KONA 2L5QA 4KYWA 2EIMH 2V31A 2WB1A 3DEEA 5LBQA 5E8GA 4YRVA 2XNDA 3RPUA 4Y9UA 2JJ1A 1YX5A 3P27A 3PSIA 2Y2ZA 3KYDB 3PM1A 1S7EA 1JUSA 4F3QA 2BEOA 4C30A 5KHDA 2PJRB 4M4SA 2E2JJ 1PJ5A 1YS7A 3FDYA 3GZ5A 4RAFA 1FYKA 1ZGWA 1MD0A 1OFCX 4XKBA 1DPUA 1P4WA 3QPTA 2Y0MA 4M6VA 1T6ZA 1U2RA 3Q3AA 3ASOH 2JA2A 3IAS2 2NVUB 4EJTA 2IEKA 4BXFA 4EW9A 4KT6A 5LGNA 1QJVA 1U78A 2XAUA 3OYDA 1Z05A 4YAFA 1HOMA 4RGUA 3DU5A 1IRFA 3IRRA 2J8IA 3R6JA 1KQ9A 1ERDA 1J9ZA 5ICGA 4ZDOA 1E3XA 5TV2A 1ORKA 4AIDA 5FFZA 3E1YE 1I1SA 2ACJA 4RGSA 1CNFA 4YAUA 1AKHA 2DFHA 2WAQA 2W57A 3LSJA 1LUJB 3CQZJ 4MHGA 5IP9J 1JNYA 5IYCJ 2YWGA 3CC7B 2X1CA 3JAMK 1ETWA 1JRGA 5J8CA 4IRHA 1E63A 1TL8A 1EFUA 2ETHA 4O3MA 4OJOA 3G71I 2DN0A 1NTCA 2G0EA 1WRJA 1FBSA 1OOCA 2DBBA 2EQRA 2K9QA 5H59A 2LR8A 4ENJA 1TNSA 1B6AA 2F4MB 1X2NA 1WGXA 3KEOA 1FPQA 4PJNA 5D6FA 1LQ1A 2AXLA 5GV7A 1LDJA 3CCYA 1OCRH 1QHHD 1E43A 1S3JA 2L9SA 2X6OA 1S7AA 4G1BA 3DWLE 4NHJA 2RAEA 4DJAA 2E2HJ 1VLYA 3WY9A 3A2KA 5J6XA 3E5XA 1VQMB 1MH3A 2IJLA 4ENNA 2CV0A 2BN4A 1YW8A 5IOYA 5EEGA 2JSPA 1RIOH 3H5AA 5BPIA 2DMQA 4GGGA 1LDDA 2M1BA 3OZWA 4L5EA 3U9GA 9ANTA 1DQUA 4PGGA 1NB0A 3FISA 1A6QA 1JTYA 2CRVA 3ZZTA 1TUIA 5KNLA 4A5NA 5CLSA 1S0UA 1BI3A 2HOSA 1KZLA 4G9YA 4UB8C 3H3VK 2EFGA 4FWTA 4BXUA 3ZQHA 2F4OB 2KFDA 3MZ8A 2V1NA 3GO5A 5JHFA 1GHCA 1NRKA 3J7ZI 4YFNF 1JTAA 3VDXA 1K61A 1W5CC 3RPQA 3HOZJ 1IRGA 2HR3A 4UZEA 2CSOA 2JVHA 2E19A 2JN9A 2ZZEA 1K4SA 1F5TA 2DT6A 3J7AY 2OBTA 4WZTA 1DARA 2PLYA 5J1UA 3HDDA 4A3CJ 1KK0A 2NNNA 4P26A 2VOOA 2DFFA 3KP2A 2JJ7A 2IP2A 2WA0A 3VOEA 1B8IA 1CF7A 4U4BA 2EH3A 2LREA 3FXQA 3J80Z 1FJLA 4G8XA 1RRJA 1EA0A 2Y9YA 1ZYRF 1E3HA 3OYFA 3DPUA 4WZLA 3GLXA 2IA0A 4IL6C 4B3XA 1UCRA 4H4KC 2KPMA 4IF4A 1S29A 1K6OA 4TKOB 3F8NA 5GV8A 4ESBA 2P7CB 3Q9SA 2NTPA 1BC7C 1E3OC 3D5LA 2CBXA 4MTEA 3CCRI 3HGYA 3PIPF 2UWMA 3TOBA 3IWZA 1FSHA 1TTYA 4U7BA 3PUMA 1WSVA 4IW3B 2ZB9A 2VNKA 1H89C 4C2TA 4OPWA 4XICA 1WOPA 3LAPA 3GVAA 2EA4A 2PE3A 2KISA 3HL2A 4UVBA 2GBYA 3PQJA 5FD5A 2W48A 1OQYA 3L7WA 3HOWJ 3I9V2 2ZBUA 3KRGA 5FFXA 1VBLA 2GM4A 3HRMA 2Z99A 1WSRA 1Y8RB 2L9NA 4X7EA 4Z06A 2OCCH 3BPVA 1XSDA 1YJ9B 2V1DA 3FXJA 3WE3A 1T6YA 3D0SA 1LLWA 3HRTA 1UMKA 1AKHB 1BJZA 2G9WA 1WJFA 1XCBA 3EETA 3M4OJ 1I6HJ 4RB2C 1R22A 2LZJA 3H94A 3NAWA 5J3LA 1PDNC 1BN5A 3IL2A 2WY7Q 2HFHA 3B4NA 3SHFA 3P7NA 5JLXA 5ICCA 4HEA2 3JRBA 1BI2A 4DQ2A 1WPCA 2XUBA 2R7WA 2O0VA 2DDAA 1ETXA 1V4RA 1JJ2B 3IH3A 4P3IA 5IT3A 1OMIA 3K1NA 1TP4A 3V7SA 3OSGA 4FISA 4B48A 2VQGA 3G71B 1QUFA 1QVGB 2K86A 2R5YA 2DA7A 3V7RA 2AHOA 4E7IA 5FIUA 1SD5A 4WK8F 3AKZA 1MMNA 3BJ6A 1Z6TA 4HIZA 3VMFA 4A0XA 4RM2A 4PJJA 3ESWB 3ZC3A 1LM1A 6PAXA 5IK2A 1W5SA 4KIFA 1AHDP 1T0FA 2X4HA 2IBDA 4EQQA 2IA2A 4ZYGA 4EV0A 2XRLA 3N90A 1XC5A 4FASD 1R49A 3OP1A 3RIQA 2F1MA 1BJAA 3IV5A 3CD6I 1SD4A 3W5VA 1VNDA 2YPRA 5GP9A 5EEAA 2DJIA 1J2XA 2E5ZA 1H8AC 1DP3A 1EF4A 1YI2I 1Q86D 1GDTA 1KC8D 1ZRFA 3UKGA 2DYRH 1D5VA 4S0HB 1RI7A 3MVPA 2GPJA 1IW7F 2LG4A 4HNTA 3MMPA 4X7CA 3WTWC 2GREA 1TT5B 3KX2A 1W34A 2VE9A 2JUCA 4G6QA 1TWAJ 3FXMA 1CF7B 1VQOB 5BS6A 2PX9A 1Y0UA 2KRCA 3GVLA 4PUSA 1WXRA 5JI6A 4W1UA 2O17A 2L0KA 2QF7A 3DEWA 3PNTA 3JU4A 2PYHA 3KFWX 4MLOA 1HF2A 3TP0A 4IHVA 3VSKA 3S16J 3CC2B 1YRNA 3GFLA 3I58A 4B4CA 1D5YA 1QRYA 4IHXA 2KIQA 1W5TA 4M3DA 3I56I 2EFOA 3KCCA 1YJ9I 1G3TA 2J7KA 1J5YA 5JMCB 2VBTA 4BDZA 1OB2A 3L2QA 2XROA 4MQ9F 3GSIA 4HX4A 4NQWA 4PGOA 4AYBN 5HS9A 4Y4RA 2R92J 2FX3A 1LVAA 1N06A 1TQPA 2N8GA 3ABLH 4MEYF 4X06A 3JQQA 2A3SA 2F5EA 3NQOA 2E35A 4C9YA 4ZTFA 5LLQA 2O6GE 2NT9A 1T0FC 4HF2A 3JRIA 2BX6A 2A5WA 2KHMA 2QQAA 2VI6A 4Z4UA 2ZTGA 1I6XA 2RN7A 1P6RA 5IY5H 3HZJA 2XPWA 3CC4I 3OJWA 1VF9A 2EIJH 3LL7A 5L3GA 1SVOA 4UUSA 1IJFA 4TSFA 3H9NA 1PYVA 2G0YA 2XT2A 3CCUB 5CVRA 1DBGA 1XX5A 4RB0A 2ME6A 2C4TA 1K28D 1XCVA 1Q81D 4ASUA 1M90D 1BI0A 3OFNA 4YIFA 2DU9A 2MD5A 3B6CA 4ZJZA 2QENA 4RLFA 2HQRA 3VB2A 1ZELA 2JZYA 1DDNA 2CH0A 2GOXB 3K2ZA 4XKWA 1XPXA 5DYMA 4N3NA 1OCCH 3W6JB 5D5UB 1E2XA 4BUPA 3K70D 5AIPA 1QFJA 4GRIA 3HPHA 5C4JJ 1L1IA 2E36A 2EPFA 3DF8A 4JX6A 2R5YB 2E1RA 3S1RJ 1QVUA 5FROA 2QEXI 1PP7U 1UD6A 3L9FA 5J1YA 5FO5A 5AONA 3GMEA 1QVTA 3OMYA 3B73A 3BG6A 3H5NA 3BTJA 1PJ7A 1P92A 2H8WA 2ISZA 3OEHA 3ZPPA 1LFUP 4KN4X 1OCPA 3FXOA 3AGQA 4YFOA 3OE7A 2K9MA 5IT9Z 2W84A 1E0EA 3RYRA 1EZGA 5GAHJ 2HZTA 2IAIA 4LLLA 3E6CC 1K73D 2H27A 4CHUA 1JT6A 3QYFA 1PJ6A 4G7XA 1HVXA 5BSYA 2HCJB 1I3AA 2W85A 5L3DA 2KKOA 2DI3A 3RYPA 3V7CA 5L3CA 1T8IA 2IS6A 1XGNA 3E7LA 1GUUA 2WB1N 1RQRA 5IYQA 2GAUA 3DP7A 4ZDLA 4F91B 4PSXA 2WZNA 2IQ7A 1BL0A 4YC5A 3BP8A 2DW4A 2VLAA 3N05A 3MD2A 3VNVA 1QA2A 2QYOA 4CCOA 2C4UA 2M3AA 2R7QA 3JRCA 1MGTA 4LBZA 4P25A 4EJUA 1JB9A 2KZVA 2HTJA 4HV6A 4C0SA 1WMRA 1WKMA 3LYCA 5D8KB 1LFBA 5DD4A 1Z7UA 5BQTA 3DU6A 2WYRA 2D9RA 2PFBA 3MMYB 3DEUA 1XGSA 2Q0OA 1F36A 4GDFA 1BPLA 4RMNA 4K1XA 4YDTA 3PJRA 3RCOA 2Q2EA 2BY1A 1YRNB 3GQBA 4V2FA 3LQEA 4M1KA 5A2QK 1KGSA 3H5RA 3S1MJ 4P1VA 3VPRA 4LIUA 4ZDPA 2WAFA 4TV7A 1V5EA 2P6TA 2LY2A 1ZLJA 2CW8A 3CUOA 2MBFA 3MQ0A 5HOOA 4BQOA 1JE8A 2CF4A 2V7TA 3A8IA 1PVEA 2PI0A 2INUA 4NQWB 1NHAA 4I0BA 2DA2A 5KW9A 2EA2A 3LVBA 2HDCA 3LFUA 4BY7J 4II2A 4WF2A 4E70A 4HNUA 3F8BA 2XC7A 1RUOA 1RUNA 3ZSCA 3LNQA 1F9NA 5FL7A 1IO2A 4OPOA 3W2HA 3L1PA 2QZ8A 3GEZA 3OYJA 2DA1A 2OBPA 4PAAA 1QRCA 4U0WA 2F5CA 4TN1A 2XSDC 4WWVA 2MC3A 4DNRB 2WADA 3LA7A 5F0HA 3BR6A 5HS7A 2FEZA 5IPAA 4CCLA 4UUSB 3WGIA 2HGCA 1E3ZA 2CWEA 3PUBA 1TW2A 1QGYA 1R5BA 1XB2A 4RDKA 2XTYA 2IGOA 4GYGA 2K9NA 3VYSB 3ELKA 3KEYA 2VBXA 3OS0A 5IYRA 4HRIA 1I3QJ 4M73A 1U5TB 1Z3YA 1KTVA 1ZUNB 1SVLA 5B66C 3RZDJ 3HAGA 3CCJB 2KLOA 3K2AA 4F52A 1GO2A 2E1BA 5J3OA 2YX7A 1FX7A 3G6EB 2DEUA 4QLCU 4MYTA 5DUKA 3KEWA 2QSHX 2DA3A 2EIKH 3E6DA 4RS8A 1O7LA 3CMAI 1UHSA 3CCEB 4WWCA 4HSTA 2NAZA 5TR9A 3P9CA 3ONQA 4C3HJ 1FNBA 4ACAA 4R71A 3KP3A 1GVDA 1N08A 3EQOA 2H6CA 1JTXA 2V1XA 1WP6A 3OY9A 2K85A 1G2HA 4PGHA 4Z4WA 2L4AA 2XGEA 1XDUA 3J81Z 1XD7A 1T56A 3H9QA 4DQLA 4RB1A 2A6TA 1FNNA 2X0LA 3OKXA 4U49A 3IWFA 3T8TA 3UNGC 3LSHA 3S2WA 1IUYA 5CPRB 3RKWA 4DGWB 4DIQA 1Z3XA 1WQ2A 1A04A 3SZTA 4HQMA 2P5KA 4HV5A 4EGZA 4KMFA 1RWRA 1BHEA 5JVGF 2M7BA 3HXLA 1WTHD 2C78A 3S3NA 3G3ZA 3BQJA 4HF1A 4YAOA 2BBYA 2XNCA 3OEEA 3TW7A 3Q39A 4ABZA 3SJMA 2YUSA 4G6DA 1H88C 3FK7A 3I71A 3NARA 2CV1A 4GFBA 3OOUA 3CTAA 3CPWB 3PETA 4UV8A 2PLFA 1UHWA 1O7FA 4MTDA 2P8TA 1ENHA 2DERA 1DBOA 1HBXG 1FLIA 2BM4A 1ZK8A 5H2FC 1Z91A 5FLXZ 3LO8A 5E3NA 1KK1A 5EJCA 3WTXC 3CF2A 2Q2EB 2ZFUA 2JA7J 2P0WA 1U8BA 2FJ1A 3BTCA 3KIOA 3PFIA 2HDDA 4M3BA 5BMZA 1MRZA 4M74A 3F0CA 1ACIA 1FEXA 2QQ8A 4CXFA 5DCMA 3BCBA 2Y0SN 1ZN2A 1RETA 3FXRA 1DGWY 5M3MJ 3OOPA 3RI4A 3PSFA 1D8JA 3QOPA 2ZZFA 4MR0A 3CF5F 2Q6OA 4DK0A 3E0JB 2LKSA 4CZCA 2EFQA 2WR8A 3KZZA 1ZM3A 2KRFA 2M5WA 3JQRA 2MH2A 1KYZA 1P4XA 1O3RA 4X05A 2INVA 1BIBA 3FHNA 4I0AA 1WCMJ 3GQ9A 2OZ6A 2WV1A 4E7HA 4CYCA 1VQPI 2JQ7A 1XMKA 5F04A 4P6VF 3ASTA 2P7VB 3B02A 1MNDA 4M3EA 2X0KA 1VQ7I 3HOYJ 3OAAA 4CUGA 2WZPP 5IP6A 2BY2A 1X1CA 2UUZA 5FKKA 2X9DA 2W4SA 5HDNA 2DXIA 3BH4A 1SEUA 4FE4A 5F27A 1QZEA 1BR2A 4BQQA 5DNSA 3BCDA 2LKPA 1M1KD 2E60A 2BPOA 3I1FA 1TWFJ 1IDZA 2E2IJ 2DOAA 3B8HA 1TW3A 3BZCA 4D5FA 1NH3A 1BBYA 2X1EA 4KT5C 2DOFA 3K1MA 5CQEA 2YU9J 3K0LA 4BGDA 4A3FJ 3S1NJ 2Z8GA 1G59A 1NB9A 2LK2A 4S05A 4KKUA 2MG4A 2XKPA 1JKRC 5BOXA 1HA3A 4RDJA 5CKTA 2RV8A 2BGIA 4CZZA 4UXNA 1O8DA 4KIGA 2QN6A 2F2EA 4XOPA 2V79A 3QU6A 2ESNA 4A2UA 3GTMJ 3OIQA 3JSOA 1HW1A 1VLOA 1H42A 4Z4SA 2F4IA 2F5FA 1EA3A 2V7VA 3F6VA 4N4OB 5J40A 4HW0A 4A6DA 1IGNA 3MKYB 5KVRA 3BCAA 1E1QA 2PBIA 1KU9A 2VJ4A 4IHTA 3FBNB 2NV4A 2HYJA 2M8GX 4Y33A 3HB9A 3MN2A 1JGGA 2K5CA 1VQKI 1T6SA 3OYHA 5EG0A 3HOXJ 1WSUA 1KK3A 3GIRA 4ACBA 2E1MB 4KUMA 4Y7CA 2G7UA 5E1WA 1N07A 2F5VA 2CQXA 4HWVA 1FRQA 2JPCA 2FMLA 1FBUA 3OWTA 3K4NA 1EFTA 3W2VA 3R60A 5HLIA 1N05A 3DKXA 3LQQA 3F8CA 4MFDA 5LGUA 4HE6A 3KEQA 1QGZA 4NK6A 2F6CA 4F7DA 4IXAA 2R7VA 2UZKA 4FETA 2KZGA 1Z21A 3FX3A 3GFJA 3OSFA 4BJ6C 4PC2A 3P4GA 1IN8A 4ASNA 4XKCA 2PG4A 4OOSA 3C18A 3OV8A 1N8RD 3ASPA 1N75A 5HNHA 4BHPA 4EMSA 4XLPF 1IDJA 4LLGF 2RDPA 2KQRA 2R7SA 2TDXA 2AHQA 3TL4X 2ZZQA 1BN8A 2EFNA 3EUHA 4CSWA 5FO0A 5FLMJ 4YELA 3ZMSA 3SQNA 3VYRB 4I7HA 2KRHA 2OU2A 1ODDA 1BR4A 1R4MB 2XB0X 5DCMB 2A69F 2ZXJA 4DBRA 2XOKA 1B9NA 4JBAA 4FN5A 1IUFA 3WBKA 3U6KA 1YYVA 2DIEA 1G3WA 1H9GA 3N97A 1QGPA 2V26A 3X2QH 4IJAA 1T38A 2XAGA 1TYXA 4KJZA 3VFZA 2BV6A 3KPHA 4Y17A 2ZBKA 5EZGA 4HDVA 2M7AA 2A5YB 4DYCA 5GAEJ 3CP2A 5CVIA 2C6YA 5CDFA 4CYCB 2V7WA 1G7CA 5D5VB 1WI3A 5FLVA 1IF1A 1X58A 2L7ZA 1SFUA 4YEJA 1VFCA 1ELOA 4BE0A 2O9LA 3AVVA 2HYFA 1PJRA 1K79A 2STWA 1BX0A 1E64A 1OR7A 1WJEA 1FSEA 2DT5A 4I01A 2WJYA 2ZL7A 1KU3A 1MKMA 1PE9A 1VQPB 2DETA 1IXRC 4CGZA 4XLNF 4LOCA 3HSRA 4HQEA 1B23P 2XZPA 5KSWB 1VQ7B 1WDTA 1OFDA 1B9MA 2VONA 3HRUA 2CV2A 4KN7X 5FJ8J 4BQNA 2OTLI 2XB5A 2XPVA 1YITB 2PMHA 3KLNA 1U6GA 4BEHA 3KZYA 3QWLA 5DV5A 4KITB 3SFIA 4BQAA 2Z9OA 3W6KB 3ZMTA 3T9GA 1XFOA 1W2BB 1ZREA 3EUHC 3HOSA 3HPGA 2E34A 2JWTA 3AVXA 3ML6A 1IN5A 2L7FP 3BROA 4WXDA 3ZR8X 1N78A 2L01A 2GK7A 1SFKA 3JAMZ 1N77A 2STTA 5K5QA 2ESHA 5HZAA 4YZQA 1WPKA 4KIBA 5K7HA 1ZR2A 5EG0B 3RDIA 4PJMA 1XGMA 5J4YA 2HQ5A 3EDPA 2DPDA 2QSFX 3M1CA 5HKKA 2GA1A 3Q0WA 1LJ9A 4XQFA 4M9XA 2LYCA 1CZFA 4RAYA 1Y0NA 1FOYA 1V5GA 2W7NA 4HLXA 2NS8A 4OZZA 5C1CA 2Y30A 3COAC 1JJ6C 4QVJA 1VQKB 2XT4A 3O3KA 1QQ1A 4RD4A 4RCYA 3M8EA 4DZJA 2IS2A 1K6YA 3L00A 1X19A 2Y69H 5J1RA 4EJOA 1FZPB 3I0TA 5L3FA 5D6EA 3BJOA 1OR7C 4P1WA 2CYYA 5ILUA 2PMUA 3BR5A 1JA0A 1VJSA 4OIQF 2ADUA 1MW7A 4AUXA 1VQ8I 2FBKA 1VF7A 3SYJA 4XMYA 2XVCA 1SFXA 2A61A 2NSPA 3DFGA 2X3UA 2ZNYA 2XEXA 1S6LA 4P6YA 3RKQA 2CNDA 3RPUD 4OP7A 4TMVA 1YOVB 3KZIC 3M9AA 1QA1A 3BJAA 1XS9A 2UVFA 1D0YA 5D5WB 1QX4A 2ZO4A 3AVUA 4A12A 2FMYA 2M0CA 3VSLA 2XTXA 3GBGA 3G05A 2QA4I 4C43A 5L3BA 2XSJC 4CCJA 4BDYA 1QUEA 3FMRA 3WNBA 3SKBA 3BY6A 1QG0A 5E3OA 4XONA 3KP5A 4QVAA 5E6TA 4JP0A 2BYVE 3TEDA 4AF7A 1IA5A 2DYSH 3M7GA 4L9TA 1OHHA 4Z1MA 2V7FA 1R5HA 2W00A 2M30A 3AAFA 1I18A 1LE8A 1UELB 2PMZA 4ENMA 2X1DA 3L2RA 4EM0B 3I4PA 1WH7A 2VASA 4UNOA 3SZEA 4HBLA 1TYUA 4Y7NJ 2VFPA 4LK1F 3NRVA 2QSGX 3VO2A 3F22A 1GV5A 1UD2A 2M8EA 1SD6A 1PKVA 2VBKA 3FY3A 2CGPA 1VQOI 3K10A 3EQLF 3JW4A 2RQPA 3HOVJ 4ZTJA 5ILVA 5E3MA 4LMYA 5DD8A 4D9JA 3B90A 4FE7A 2VIXA 4QTRA 5J35A 3I53A 3SLNA 1O88A 3AVTA 3EUAA 1QRBA 1R58A 4RA2A 4EVIA 4ZH4F 3CC2I 2Q6IA 3VNUA 3S3MA 1LKXA 2L54A 4YG2F 2BHYA 2H1LA 3TP3A 4C2UA 4XN3A 5C4XJ 2K9SA 1QZYA 1A6IA 4WX9A 2VNHA 5ICEA 3SLDA 4BEHB 2CMPA 1JUPA 5K7FA 1S72I 1FTZA 5FRNA 1JHFA 2M4GA 3QYEA 3PVDA 4Z4RA 2JVGA 3TDUC 5M3FJ 3Q6RA 3UR3C 1VQNB 1LLZA 3ZMZA 3ZPNA 4R8HA 5D8LB 1IB0A 1IB4A 1Q1HA 3ZGKA 3AG4H 4OOXA 2HQAA 1EH6A 1DP7P 4J0QA 1R9TJ 2OTLB 3PFYA 2COBA 1QQIA 3ZZ0A 2EZKA 2YWEA 2PYGA 4B43A 2NRAC 2QWWA 3I4MJ 1QU3A 3LNNA 4LB5A 3S15J 2RREA 1BI1A 3K9TA 3ABTA 1APLC 1NHCA 1RC9A 1WHUA 1YFHA 5M5XJ 1V5VA 2OK7A 3GFIA 3H92A 3CCUI 2EBIA 3SZPA 3HIFA 1DPRA 5LRSA 5HZBA 1ETVA 2EJRA 4MIMA 4GXOA 1GAQA 3MEXA 3F6OA 4QPOA
chains in the Genus database with same CATH topology
4XLHA 3OMYA 4PK4A 4E7JA 3BG6A 3H5NA 2ZSHB 1YX3A 4NUBA 4YXWA 3U21A 2CK3A 3K4BA 3OEHA 4G6IA 3ZPPA 3OR2C 2X51A 5TGTA 1H8HA 4XORA 3OE7A 2K9MA 1E0EA 2D3NA 3E1SA 1TZLA 2MFZA 3QYFA 3S93A 1HVXA 1UD4A 3ZQQA 4G7XA 1O8GA 4OJ5A 1KCCA 4B3FX 2IS6A 1D1CA 3QYBA 2ZSIB 4PSWA 4KKSA 3SYTA 4XN0A 4J00A 4ZDLA 4F91B 2IQ7A 2VJJA 3OIPA 4PSXA 2R7XA 3H9JA 4YZXA 5FRMA 3GQ7A 4CCNA 3SEQA 2VLAA 3N05A 3MD2A 4CCOA 3VMWA 4DOZA 2M3AA 2R7QA 1GLNA 3HOTA 3M8JA 3VR6A 4JOMA 2KZVA 1WMRA 2Z2SB 5CQGA 1E1RA 3T51B 1FMWA 1O8LA 2BVMA 2KP6A 3DU6A 4PFPA 2R7RA 1K5CA 3MMYB 1KTWA 2LH9A 1BPLA 2E5NA 4RMNA 3PJRA 3RCOA 4DK1A 4R79A 4AU7A 1X4OA 3GQBA 1W9XA 2VKHA 1P9QC 1QHGA 4E0FA 2GOMA 1Y56A 3H5RA 1FMVA 3L2WA 3W2AA 4LIUA 1V0EA 4DNTB 4YZAA 4ZDPA 2WAFA 1V5EA 2LY2A 2CW8A 4F92B 5HOOA 3VSUA 1W0KA 4BQOA 3VSTA 1LVKA 4E7KA 1AA7A 2INUA 4NQWB 3H35A 3V42A 2BSPA 3IUOA 3OL4A 1OGOX 2KVOA 3HKZA 3LFUA 3D5RC 4II2A 4HNUA 1O8JA 2XC7A 2XF7A 1O8IA 2KDOA 3ZSCA 3ZCOA 4BU2A 3G2BA 5FL7A 3DPLC 2XF5A 3OYJA 2W6JA 4W8SA 3K4JA 3OYCA 4DNRB 4BE2A 3OYEA 2WADA 3LSMA 3S3OA 2PJRA 5LFAA 1E3ZA 4OJ6A 4CCLA 3OS2A 1COWA 3PUBA 1J09A 2X6YA 2IGOA 3VYSB 4XLFA 3OS0A 3A1YA 3KEYA 2GJRA 3RTRA 3DKYA 3HG9A 3OYKA 4HRIA 2MYSA 1YE9A 1WJAA 2WY8Q 1Z3YA 2WBMA 3K4LA 4XR6A 2Q1ZB 3DLAA 2BOLA 3HAGA 2KLOA 1WJBA 3PNYA 4PFOA 4F52A 2E1BA 4E7ZA 3OYNA 4B44A 1EE6A 1IDKA 2R7OA 3KEWA 2IXSA 2VJ5A 3T53B 3C2GA 3OS1A 2V7QA 4HSTA 4GQNA 3MKWB 1W36C 3ONQA 1BLIA 4OZYA 3BG7A 1NBMA 4P5OA 3H9GA 4CH7A 4N4NB 1Y6IA 4IZZA 4II3A 3NE5B 3EQOA 1R6RA 2K9LA 1WP6A 2DT7B 1T95A 3OY9A 1RU4A 4YZ0A 2EWEA 1E79A 1IRXA 3TMOA 1WFXA 3H9QA 2PECA 2A6TA 4U49A 1NG7A 1PLUA 3UNGC 3LSHA 4XOTA 2F43A 5CPRB 4DGWB 4DIQA 1Z3XA 5C1EA 4CCMA 3EUKL 4IKFA 1RWRA 2L7KA 1S9HA 3KYLA 1BHEA 2JDIA 2M7BA 3HXLA 1WTHD 1XG2A 2GK6A 3S3NA 4URRA 1OGMX 3L2VA 3F9KA 4E7SA 4W8QA 1SKYB 3CJRB 3OEEA 2O04A 1G8XA 2R4GA 4KISA 3SDBA 2HNHA 1SAUA 3QOEA 2CV1A 3OOUA 4F93B 1WJDA 4IX7A 2NTQA 2MD0A 4E7LA 2NSTA 3CJQB 1DBOA 2X53S 1TT0A 2M4KA 4XNFA 2JUGA 3LMMA 2MABA 4UZUA 4HPQA 3CF2A 3C2HA 4L8JA 1WJCA 2Q2EB 2ZFUA 4AVZA 2P0WA 3CZ6A 2IGNA 3VYUB 2RNGA 4XKVA 3RSNA 1X1DA 3LSGA 3BCBA 4QPQA 3VMVA 4PJLA 1DGWY 4ZC3A 2ZZFA 4IQ4A 3PSFA 4JQFA 3BCFA 4MR0A 2L2OA 4DK0A 4W8TA 3E0JB 2X6WA 2XGJA 2LBFA 2Y0SA 4CZCA 4E4HA 1BR1A 4G7WA 1X1BA 2INVA 1KONA 2L5QA 2V31A 3FHNA 2WB1A 2XZLA 3DEEA 4YRVA 1VZ0A 2XNDA 2JJ1A 3CP8A 1YX5A 4E7HA 2Z6BD 3PSIA 2D3LA 3GQ9A 4XL9A 2IGKA 1LFPA 1MNDA 4F3QA 4BL0B 4C30A 1D1BA 1Z7LA 5KHDA 2PJRB 3OAAA 4CUGA 1AIRA 3JURA 2VBMA 2VJIA 2WZPP 3FDYA 3FBIB 1X1CA 2UUZA 2DXIA 2W4SA 4ANJA 3BH4A 2CS3A 4BQQA 3PNVA 1BR2A 4XKBA 4XLAA 3BCDA 2QY1A 1MMDA 2E60A 4RM3A 3QODA 2JA2A 3IAS2 2DOAA 4B47A 4BXFA 4EATA 4EW9A 4XM3A 2X1EA 4KT6A 2M0MA 4F55A 3WWGA 5CQEA 1QJVA 2JJ2A 2KMUA 4RLQA 1UD3A 4BGDA 2XAUA 2Z8GA 3OYDA 2V4JC 2WAEA 1G59A 1KCDA 3DU5A 3CESA 4KKUA 1ERDA 1E3XA 5CKTA 4ZDOA 1O8DA 3ZRGA 4XOPA 2WAQA 3OIQA 1HG8A 2F4IA 2X1CA 3OYMA 1EA3A 2BVLA 1JRGA 4OJOA 4NK8A 4N4OB 3NWSA 3MKYB 1QCXA 2Z1DA 3BCAA 4OAZA 1OLTA 1E1QA 2VJ4A 3FBNB 2QKLB 2IS4A 4TT3A 1OOCA 4Y33A 2WJVA 4LITA 2K5CA 3OYHA 2VQLA 2VKDA 1V0FA 1U0JA 2E1MB 3K4KA 4PJNA 1QHHD 2F5VA 2W1OA 3AFHA 2L9SA 1E43A 2W6IA 4IQJA 4HWVA 3DWLE 3OWTA 4DJAA 3K4NA 1VLYA 3W2VA 3A2KA 2IGMA 1W36D 2XF6A 2HZDA 2CV0A 1H8EA 3DKXA 3FKJA 1O8HA 5AMVA 2NZMA 2LRDA 2HU9A 4NK6A 2JSPA 2F6CA 3ZIAA 3H5AA 2R7VA 4FETA 1Z21A 1FX0A 1DQUA 4BJ6C 4PMHA 3DTEA 4OAYA 4XKCA 1KMHA 3VWBA 3S8PA 4FXUA 5KNLA 1N75A 3GVKA 3GRHA 4D1QA 4E6KG 3A4CA 5HNHA 3FKSA 3H0DA 2LOOA 3LSKA 1IDJA 1HA8A 1KZLA 2KQRA 3GQAA 2R7SA 5JHFA 2V1NA 3TL4X 1LDKB 1NRKA 2ZZQA 1BN8A 1JTAA 2QX3A 1X4PA 2O5RA 3VDXA 1X1AA 2OUMA 4CSWA 2HPIA 2JVHA 2QKMB 4LG3A 4YELA 2ZZEA 2DT6A 3VYRB 4OJLA 3J7AY 2KRHA 5HVQC 2NT6A 1BR4A 1HZEA 1UD5A 2O0WA 2UV1A 4DBRA 2M5SA 4CA0A 2XOKA 2XZOA 4U4BA 2WA0A 2LREA 2DIEA 4LIVA 2JIZA 3OYFA 2V26A 3DPUA 2LBFB 2VBEA 4B3XA 3OW7A 1D0XA 4H4KC 2KPMA 4B3GA 4HSRA 2CUZA 4KJZA 4TKOB 2M7AA 3CP2A 3K6GA 4BJ5C 3RQ4A 5CDFA 1GQ8A 1O8EA 2NTPA 2V6EA 3HC7A 3D5LA 4Z05A 1JI8A 4YEJA 3W3CA 2UWMA 2AQFA 4BE0A 4KKTA 4U7BA 1PJRA 2QE7A 2CFOA 3CMMA 4G6TB 1WJEA 1EFRA 2WJYA 4C2TA 1H80A 3PL8A 1PE9A 5DN6A 2NTBA 3K4MA 2CUJA 3OR1C 1W0JA 3HL2A 3NWTA 2XZPA 3I9V2 3KRGA 3SZGA 2CV2A 1VBLA 4BQNA 1NG6A 2L9NA 3L2UA 4Z06A 2ZXHA 3DQVC 3K70C 2OC6A 2R7UA 4BEHA 4Y3OA 4KITB 1WJ5A 2IS1A 4NNJA 3OYAA 2V4DA 3T9GA 5HNFA 1WJFA 3OYLA 3H94A 3EUHC 3A3GA 4XLCA 3HPGA 3HOSA 4BE1A 2LZJA 2O1DA 2E1MC 2WY7Q 1I8DA 3B4NA 1DGRM 4HEA2 3ZR8X 1N78A 2GK7A 1SFKA 1N77A 1WPCA 4YZQA 3VSVA 2R7WA 2AQEA 3T56B 2O0VA 2HDWA 2X3HA 4PJMA 1MNEA 2HVSA 3ZXSA 3SUCA 3EQNA 2BW3A 3M1CA 5HKKA 4B48A 4XQFA 2VQGA 2LYCA 2VPLA 1CZFA 2R9VA 2ZXIA 1PXZA 4OZZA 1V5GA 3D5SC 2W7NA 4J01A 4E7IA 5C1CA 3AKZA 3AL0C 1MMNA 2DCEA 2UVEA 4BS9A 1V5FA 4HIZA 4I84A 4RM2A 4PJJA 2IS2A 1D1AA 2RQQA 1K6YA 5IK2A 1X19A 1D0ZA 2VQHA 3FPPA 4P22A 3LSIA 3I3LA 1MABA 2X8KA 2QXZA 1OR7C 4P1WA 1OB0A 1MMGA 1VJSA 2VQCA 4FASD 2HLDA 2LY1A 2V9KA 2F1MA 1MW7A 1T5EA 1VF7A 3A3BA 4XMYA 2NSPA 2ZTNA 3SEZA 2DJIA 2E5ZA 3DTKA 4C2LA 3RPUD 1DP3A 1UAAA 2UVFA 1D0YA 1O8FA 5KCMA 5LD2C 1BMFA 4HNTA 2LG4A 3VSLA 3B8YA 3VYTB 3GBGA 4JMQA 2R7TA 4NC8A 2GJKA 3G05A 3OOCA 2XSJC 3EPZA 2VL8A 3KX2A 1UD8A 4CCJA 4BDYA 2KL4A 2W82A 2GJPA 3TBIA 2KRCA 3DDYA 3GVLA 4PUSA 4XONA 2HPMA 3OPOA 2VXZA 2WPDA 2O17A 1IA5A 1OHHA 3IP4B 3PNTA 3OYIA 3JU4A 4Z1MA 2V7FA 2PYHA 2W00A 2VXDA 4MLOA 3K4CA 1I18A 4DBQA 2LC2A 1UELB 2PMZA 3W2WA 2X1DA 2X6XA 3VSKA 4CCKA 3L2RA 3AL0B 2VASA 3A35A 2OV7A 3OYGA 3GVJA 1OFLA 1X0CA 2HVQA 3OL3A 3OYBA 3HUGB 1BOBA 2NOJB 2Z16A 1UD2A 3FY3A 1PKVA 2VBKA 4BDZA 3L2QA 3K10A 1O8MA 2I8DA 2VB6A 4Z03A 3GQ8A 3LMWA 4ZTJA 4Y4RA 4MXNA 4D9JA 3B90A 2VIXA 4U87A 4AYBA 4C9YA 4ZTFA 1O88A 3EUAA 3MKZA 2NT9A 4NC7A 1T0FC 2X85A 4HG2A 1LKXA 2A5WA 4XLEA 2KHMA 3S3MA 2ZTGA 4C2UA 4XN3A 4TSFA 3LL7A 4W8RA 3DTIA 4BEHB 2CMPA 1PYVA 2M4GA 5FRNA 3QYEA 1O8KA 1DBGA 2FUG2 2JVGA 5HLTA 2HVRA 3UR3C 4OWRB 4OJPA 2WSSA 3ZPNA 3DPTA 4BJTA 3BC9A 4XD7A 1IB4A 4BACA 1K28D 3ZGKA 4ASUA 2HQAA 3BC8A 3OFNA 3PFYA 2ELJA 2MC4A 4ZJZA 4ITVA 4RLFA 3WQZA 2PYGA 3UW0A 4B43A 1QU3A 4X0GA 1ZELA 2K3PA 3LNNA 1OFMA 2RREA 2CH0A 2GOXB 1RMGA 4XKWA 1UG0A 2XDVA 3IAM2 1NHCA 3K70D 4BUPA 2BW3B 4GRIA 3HPHA 4ZYAA 5FROA 2ZZGA 2ODLA 1UD6A 2CW7A 1MMAA 3BLYA 3S32A 4QPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWV A;  5C1C A;  4XLH A;  2UVE A;  2PEC A;  4U49 A;  4I84 A;  1PLU A;  4XOT A;  1O8H A;  5AMV A;  3ZPP A;  2NZM A;  5C1E A;  4NK6 A;  1RWR A;  4XOR A;  1BHE A;  1XG2 A;  2QXZ A;  4URR A;  1OGM X;  4PMH A;  1O8G A;  4W8Q A;  4OJ5 A;  1KCC A;  2O04 A;  3GRH A;  4XMY A;  2NSP A;  4XN0 A;  1IDJ A;  2IQ7 A;  2VJJ A;  4C2L A;  4YZX A;  3GQ7 A;  3GQA A;  2NTQ A;  2NST A;  2UVF A;  1DBO A;  1BN8 A;  1JTA A;  2QX3 A;  3VMW A;  1O8F A;  4XNF A;  4YEL A;  1WMR A;  3B8Y A;  4OJL A;  1O8L A;  2NT6 A;  1K5C A;  4AVZ A;  1KTW A;  2O0W A;  4XON A;  4XKV A;  4U4B A;  2O17 A;  1IA5 A;  2PYH A;  3VMV A;  2VBE A;  4MR0 A;  2X6X A;  4W8T A;  2X6W A;  4YZA A;  1OFL A;  1X0C A;  3VSU A;  1GQ8 A;  1O8E A;  3VST A;  2NTP A;  2INU A;  2INV A;  4Z05 A;  3FY3 A;  2VBK A;  2BSP A;  3GQ9 A;  1OGO X;  4YEJ A;  1O8M A;  4XL9 A;  1O8J A;  4Z03 A;  3GQ8 A;  3LMW A;  1O8I A;  4MXN A;  3ZSC A;  3B90 A;  1AIR A;  1H80 A;  3JUR A;  1PE9 A;  2VJI A;  1O88 A;  2NT9 A;  2NTB A;  2VBM A;  4W8S A;  2X85 A;  4XLE A;  4OJ6 A;  4XLA A;  3KRG A;  4XN3 A;  2QY1 A;  2X6Y A;  4W8R A;  4XLF A;  1VBL A;  1O8K A;  4EW9 A;  4XM3 A;  1DBG A;  3WWG A;  4Z06 A;  4OJP A;  1QJV A;  4XR6 A;  2Z8G A;  1IB4 A;  1KCD A;  1EE6 A;  3T9G A;  1IDK A;  1O8D A;  4XLC A;  2O1D A;  2PYG A;  4XOP A;  3UW0 A;  3B4N A;  1HG8 A;  1OFM A;  1RMG A;  4XKW A;  1JRG A;  4OJO A;  4NK8 A;  1NHC A;  4YZQ A;  4OZY A;  3VSV A;  1QCX A;  2O0V A;  2X3H A;  1OOC A;  3SUC A;  3EQN A;  4XQF A;  3EQO A;  2ODL A;  1CZF A;  1PXZ A;  1RU4 A;  4YZ0 A;  4OZZ A;  2EWE A; 
#chains in the Genus database with same CATH topology
 3U2R A;  3BG3 A;  5JFR A;  4E7J A;  1A31 A;  2V7U A;  4YXW A;  3K4B A;  4G6I A;  3OR2 C;  1QA6 A;  1I50 J;  3RY8 A;  3J80 K;  1ON1 A;  5M5W J;  4AM3 A;  2ELH A;  3E1S A;  3ABU A;  1XMX A;  1QNT A;  2A68 F;  3JRE A;  2GZW A;  4MYU A;  3BZ6 A;  1IN4 A;  2VBU A;  2AXT C;  1REP C;  2OTJ B;  1HKS A;  4LG0 A;  4J00 A;  2E1C A;  2C2W A;  3HTS B;  2VNJ A;  4MO7 A;  3M8F A;  4YZX A;  3ZMV A;  3GQ7 A;  2FF4 A;  3GZ6 A;  1VQ8 B;  1ZAO A;  4G5G A;  1HKQ A;  2KDZ A;  1R5I D;  3VMW A;  4FHT A;  2QUF A;  4AVP A;  3HOT A;  4WZE A;  1V55 H;  2ZXW H;  3QP5 A;  1HQC A;  4B1R A;  1FNM A;  3FM3 A;  2L02 A;  2Y48 A;  1X3Z B;  1O8L A;  3DKW A;  1FND A;  1K5C A;  5F4J A;  1QA3 A;  1DAB A;  1FIA A;  2FXA A;  1MBH A;  2LH9 A;  2IRF G;  2BXZ A;  2F1L A;  2V9P A;  3FM5 A;  1LE8 B;  4Z4Y A;  4IVN A;  4W97 A;  4R79 A;  4DK1 A;  2QA4 B;  2O0Y A;  1K78 A;  4O6J A;  4A69 C;  3O8H A;  4YEI A;  2VKH A;  1P9Q C;  1QHG A;  3IKV A;  3G4S I;  5K1Y A;  4YHB A;  4HYE A;  4KNY A;  4E0F A;  2GOM A;  3ABM H;  3RIR A;  3W2A A;  3T8R A;  4DNT B;  3GX4 X;  4YZA A;  3GTQ J;  4A93 J;  2PMD A;  2XHK A;  3E97 A;  3GXO A;  3WBJ A;  5HOD A;  2YR2 A;  4QFM A;  3GTJ J;  2RC5 A;  2A6H F;  5L46 A;  2BSP A;  1OGO X;  1YLO A;  2OF7 A;  3HKZ A;  2JA6 J;  3D5R C;  4Q7J B;  1RNL A;  1O8J A;  2CRG A;  2CG4 A;  3LA3 A;  4RGR A;  1NK2 P;  2HTS A;  2ZKZ A;  4JK1 X;  1MSF C;  1BA5 A;  2DTZ A;  2QQB A;  3HBL A;  1L3L A;  2W6J A;  4W8S A;  3P26 A;  1D2E A;  3OYE A;  2J5O A;  1A36 A;  4D0P A;  1COW A;  1U2W A;  5JVT A;  1TYW A;  3BT9 A;  3GYH X;  1U9N A;  1J09 A;  2EWN A;  2ID3 A;  2QCO A;  2X6Y A;  1XE1 A;  1Q82 D;  1S4M A;  4JX4 A;  3A1Y A;  3Q3S A;  3P9K A;  3DKY A;  3HG9 A;  1K7A A;  4ZCI A;  2MYS A;  4V2G A;  1R1U A;  4IHS A;  4N3G A;  2LNB A;  1WJA A;  3GTK J;  2WY8 Q;  4AD9 A;  3CDH A;  3K4L A;  3HJE A;  3FMS A;  4PFO A;  4E7Z A;  3IH4 A;  1S72 B;  1EE6 A;  2FD5 A;  1EH7 A;  4EM2 A;  1IDK A;  2K02 A;  5KAF C;  5B3S H;  3R0A A;  3PO2 J;  2DA6 A;  2VJ5 A;  3T53 B;  3I5U A;  4XSX F;  3OS1 A;  2H09 A;  1O3S A;  1VQ9 B;  5FO1 A;  5EF6 A;  2PJP A;  3MKW B;  1QO0 D;  4YII A;  1W36 C;  1BLI A;  1VHE A;  2BGJ A;  1IXS B;  2NPF A;  3BG7 A;  2C5B A;  1NBM A;  4U0Y A;  4CH7 A;  1LB2 A;  4U0V A;  1Y6I A;  2FBH A;  3CCJ I;  2K9L A;  4OOV A;  3MCZ A;  1RU4 A;  1GVJ A;  3G6E I;  3WU2 C;  5BNG A;  1E79 A;  2EWE A;  2BVN A;  2OBR A;  4OIP F;  3TMO A;  3SQV A;  2BXY A;  1NG7 A;  4LD5 A;  2L9V A;  2D45 A;  1MSE C;  2BGC A;  1U5T A;  3CCE I;  3VEP A;  3BPX A;  4CCM A;  5C1E A;  3ZBU A;  1ZKG A;  5J8F A;  3DU1 X;  2L7K A;  1S9H A;  4OPV A;  1GVH A;  4N0B A;  2GK6 A;  1P4A A;  1MBF A;  3L2V A;  2NVX J;  4E7S A;  4LG0 B;  1BJK A;  3T1B A;  5ILS A;  2O04 A;  2L3D A;  2R4G A;  2VBZ A;  4KIS A;  2VKV A;  2ISY A;  2HNH A;  1Q1V A;  1IG7 A;  1OKR A;  4F93 B;  1LNW A;  1WJD A;  1IV6 A;  2NTQ A;  2MD0 A;  1G7T A;  2DOD A;  4ZGN B;  2NST A;  1TT0 A;  2M4K A;  4L9V A;  1C0W A;  1ZHF A;  3WGG A;  1TTT A;  1STZ A;  3TO7 A;  4UZU A;  3C2H A;  5E18 F;  1SAN A;  3GW2 A;  4P9U A;  2FA5 A;  1K78 B;  3G1O A;  2RNG A;  1I27 A;  2EIL H;  3TGN A;  2B0L A;  2XAS A;  5EMN A;  3RSN A;  3SXY A;  2KJB A;  3N6Z A;  2KT0 A;  2OQR A;  3ZQF A;  5A2Q Z;  2IPQ X;  2VC0 A;  5LHI A;  2XGJ A;  2LBF A;  2J8K A;  1RES A;  5B1A H;  1OCZ H;  3G4S B;  5CVJ A;  1LPQ A;  1LEA A;  1G7S A;  2E7W A;  4TMZ A;  4NB5 A;  2XC1 A;  2XZL A;  2B0R A;  3V76 A;  1KU2 A;  3CP8 A;  3TH0 A;  2Z6B D;  2IGK A;  5IYD J;  2MLG A;  2FOW A;  1ZRC A;  3IC7 A;  1MDM A;  4FQG A;  3ZZU A;  4ZCL A;  1U5T C;  1Z7L A;  1KQ8 A;  4IOC F;  3JQP A;  3KE2 A;  2C77 A;  1EJ9 A;  2M45 A;  3FBI B;  3VOD A;  2JA8 J;  4P9S A;  1VQ4 B;  1TNT A;  2A6E F;  1F1Z A;  3PNV A;  3QSY A;  3CCM B;  5E1X A;  2QDX A;  2HOT A;  4RD1 A;  2QY1 A;  2XNJ A;  3HHH A;  3R0J A;  4B3A A;  3ZP5 A;  1OYW A;  3QOD A;  1CGP A;  1OIS A;  4B47 A;  1DDG A;  4HF0 A;  2LVS A;  4XM3 A;  1IN7 A;  4LC0 A;  3WWG A;  2M0M A;  4Q5S F;  4G12 A;  1T98 A;  4NDL A;  1UD3 A;  2WAE A;  3MWM A;  4ZYE A;  2WAQ N;  2HKX A;  2GIV A;  2EV6 A;  2ZME B;  3ZMU A;  1WZ2 A;  5IT9 K;  2P5V A;  4RAZ A;  1W1W E;  4JX5 A;  2ECB A;  2YS9 A;  5H6Q A;  1AOY A;  3GTP J;  3E3V A;  3S2H J;  3OYM A;  1KK2 A;  1HDD C;  4KIC A;  5LHH A;  2LDU A;  2HQN A;  4DYQ A;  1QCX A;  1N25 A;  1OLT A;  4AIK A;  2IS4 A;  4TT3 A;  1PUE E;  2R7F A;  3PSS A;  4XRM A;  1TWH J;  4LIT A;  1MNM C;  1FYM A;  1V54 H;  5EZH A;  4A3M J;  2LKX A;  2VQL A;  4YAW A;  4I2O A;  1N0V C;  1RZ4 A;  3A1P A;  3K69 A;  3I55 I;  3S2D J;  3AFH A;  2GQF A;  5GAG J;  2W6I A;  1WI9 A;  4IQJ A;  5IP7 J;  4I6Z A;  2IGM A;  4Y9R A;  2NVY J;  1O8H A;  4UY8 I;  2HDN B;  2NZM A;  1ULY A;  2LRD A;  2EV0 A;  2WV0 A;  2HU9 A;  5TIS C;  4A3L J;  1I5Z A;  3ZIA A;  3CCQ I;  3FIW A;  1P2F A;  1X3W B;  3DTE A;  4OIO F;  4V19 K;  1KMH A;  5CVV A;  2O61 A;  3TKY A;  1TYV A;  1VQL I;  3I54 A;  3GRH A;  1SD7 A;  1FP2 A;  4I09 A;  3A4C A;  4E6K G;  4KH3 A;  3LSK A;  5E3L A;  1HA8 A;  1S5L C;  3W5H A;  3QP6 A;  3R6K A;  2RVC A;  2QX3 A;  2O5R A;  1X1A A;  2OUM A;  3V8J A;  2HPI A;  3Q5F A;  2QKM B;  4YFK F;  1GXP A;  1X3U A;  1YIJ B;  3F3X A;  2DK8 A;  2FQ3 A;  3C7J A;  2QGG A;  2NT6 A;  5DS0 A;  2GXG A;  3LSP A;  2O0W A;  2UV1 A;  4I76 A;  1HCR A;  2M5S A;  4CA0 A;  2BM1 A;  4AIJ A;  2ICW G;  3CDI A;  4RGX A;  2JRT A;  1Z77 A;  3CUQ A;  2MGQ A;  2VFM A;  3LSR A;  1HKT A;  1YX2 A;  3CCL B;  5C44 J;  1ETK A;  3TDZ C;  2R6H A;  2VBE A;  2LBF B;  5GTI C;  1SC7 A;  4ZCM A;  4C3J J;  1J59 A;  4LB6 B;  1D0X A;  3OW7 A;  2TRT A;  2V7X A;  5FGM A;  4B3G A;  2CUZ A;  1HW5 A;  3S1Q J;  4TMX A;  1PUF A;  3K6G A;  4BJ5 C;  3QE2 A;  1XSV A;  1FRN A;  1O8E A;  2KIF A;  2VBW A;  4UVC A;  3HC7 A;  4Q48 A;  3JR9 A;  4RD0 A;  1MDM B;  3JTH A;  1R5N A;  2WC2 A;  3HUG A;  3W3C A;  3L2C A;  2AQF A;  1TLL A;  3CCV I;  3LWF A;  2EFP A;  2JN6 A;  2QE7 A;  2CFO A;  5FKL A;  2O8X A;  4G6T B;  3RJP A;  3WHC A;  1H80 A;  4AF6 A;  1RKW A;  2NVQ J;  3LOC A;  5DN6 A;  2NTB A;  1EKE A;  5HDK A;  4FTH A;  3K4M A;  2FQ4 A;  4YCQ A;  1HST A;  2L7M P;  4L0Z B;  2OK8 A;  5HLG A;  1EH8 A;  3C3W A;  4D7N A;  1GR1 A;  2K7L A;  4PDK A;  3CO7 C;  2XKO A;  4GO1 A;  3WG7 H;  2WWY A;  2VNI A;  5DM6 F;  4RPB A;  4X8I A;  2R3S A;  2ZL6 A;  3KP6 A;  3KP7 A;  4OMY A;  1Y0R A;  3J81 K;  1OCT C;  1NG6 A;  4QV2 A;  4UVA A;  1GJR A;  1XQB A;  2ZXH A;  2OC6 A;  4RDU A;  4M6Y A;  1T39 A;  1XSX A;  1WJ5 A;  3DBH B;  4NNJ A;  2V4D A;  2P4W A;  1WH5 A;  2DMT A;  3OYL A;  2QVO A;  4CIC A;  3MAJ A;  4LGW A;  3JRG A;  3ONY A;  2E1M C;  2VPR A;  3E6B A;  1I8D A;  2RGV A;  2F5D A;  3P5J A;  3BNW A;  2CUE A;  1BIA A;  3GTG J;  1Y1V J;  3VSV A;  1D3Y A;  2AQE A;  3CUQ C;  3ML3 A;  2HDW A;  1POG A;  4Y52 J;  4XRS G;  2J5P A;  2YSR A;  2LMD A;  1MNE A;  4HZF A;  1YIT I;  3DV8 A;  2HVS A;  2DY1 A;  3AGP A;  2BW3 A;  4S04 A;  2BM7 A;  3RZO J;  3GWZ A;  3MHP A;  2VPL A;  2R9V A;  2FVG A;  3Q38 A;  3D5S C;  3JTG A;  1TLH B;  1W7P A;  3AL0 C;  5FLX K;  2DCE A;  1V5F A;  5IYW A;  2UXN A;  5H20 A;  3I55 B;  2VE8 A;  5KK1 A;  1D0Z A;  3QPH A;  4P22 A;  3LSI A;  3PO3 J;  3I3L A;  1MAB A;  2X8K A;  2QXZ A;  2XV4 S;  1OB0 A;  1MMG A;  1KD1 D;  2HLD A;  1R1V A;  5A88 A;  3R6S A;  3U2Q A;  2EIN H;  5B5E C;  2GA2 A;  3BTI A;  1T5E A;  2HMA A;  1G4D A;  3BR3 A;  1KJZ A;  3A3B A;  3CCQ B;  2IW5 A;  2CQ7 A;  3DTK A;  1TVC A;  4LK0 F;  5LRR A;  1UAA A;  2P3M A;  2K40 A;  4I99 C;  1R00 A;  4L9J A;  1VQL B;  1ZAR A;  2TCT A;  1T2K A;  3KP4 A;  5LD2 C;  1S8N A;  5IOZ A;  1TQI A;  1YHQ B;  3VYT B;  1JGS A;  5DEQ A;  2CW5 A;  4QIW N;  2VL8 A;  3CUQ B;  3EPZ A;  3WGH A;  2GJP A;  4BHB A;  2KL4 A;  4Z6Y A;  3BH6 B;  3DDY A;  3SJZ A;  3W2G A;  5HLH A;  1KQ0 A;  3AG3 H;  1KQ5 A;  1YW9 A;  3WG9 A;  3W2I A;  2JSC A;  1QPI A;  1OGI A;  4C2M J;  2VXD A;  4ON0 A;  3K4C A;  4DBQ A;  1PUF B;  3U6B A;  3W2W A;  3AL0 B;  1VHO A;  2X6X A;  4CCK A;  1QPM A;  3WTU C;  2FBI A;  5E1Z B;  3PUF A;  3ZQG A;  2XIG A;  1SMY F;  2JK3 A;  3OYG A;  1EXM A;  3GVJ A;  4G7H F;  1I39 A;  2DQR A;  3HUG B;  2NOJ B;  3HSF A;  4OIR F;  1R4N B;  4M3G A;  4L18 B;  2BSA A;  1K9M D;  1QFZ A;  1L0O C;  4OPS A;  4RLZ A;  3GZN B;  3B6A A;  2BHZ A;  4Z03 A;  2VB6 A;  3JRF A;  2ECC A;  3LQR A;  2NS7 A;  4MXN A;  4R1H A;  4AYB A;  3ISX A;  2X85 A;  4HG2 A;  1HDP A;  3BQZ A;  3G1L A;  1FIP A;  3W2F A;  2XAQ A;  2DPU A;  3QFS A;  3ZPL A;  2JA5 J;  4W8R A;  1OYY A;  3PA1 A;  2YWH A;  3DTI A;  3BQY A;  3D1N I;  1X2M A;  2L9R A;  2QBY A;  5HLT A;  2HVR A;  3OJX A;  4OWR B;  3BC9 A;  4XD7 A;  4ZV4 A;  1K8A D;  2UXX A;  4C3I J;  3ASN H;  3BC8 A;  4M9S A;  3GTO J;  2MC4 A;  1SFO J;  3CXC B;  3WQZ A;  2MH9 A;  1BX1 A;  3ZQL A;  4X0G A;  1FOX A;  2K3P A;  4A6E A;  5GAD J;  3WTT C;  3H09 A;  1UG0 A;  2XDV A;  3IAM 2;  2ZJ2 A;  3A02 A;  2BW3 B;  3LST A;  3WU1 B;  1MBE A;  1TBX A;  5FKM A;  4Y13 A;  4ZYH A;  1DU6 A;  1QGA A;  1B4A A;  2I5U A;  5KAI C;  4GYI A;  1VQN I;  3FJO A;  1FNC A;  4OMZ A;  1J0R A;  1D8K A;  2DYI A;  1W7P B;  3QPL A;  2VFN A;  2ODL A;  3E5U A;  2CW7 A;  2I1L A;  5JLW A;  3BLY A;  3S32 A;  4MGR A;  2VKE A;  3ZN0 A;  1MH4 A;  3H36 A;  4XLH A;  2HXO A;  3AG1 H;  4H0E A;  1F43 A;  4XK4 A;  1VI0 A;  2VC1 A;  2V9V A;  2ZSH B;  3GUD A;  4UUT A;  3TO9 A;  2XAF A;  2VT3 A;  2O6W A;  5TGT A;  3IRQ A;  3F23 A;  4HOB A;  1BW5 A;  1IN6 A;  3BTL A;  1IV8 A;  2DFI A;  2MFZ A;  3S93 A;  4OJ5 A;  2EV5 A;  4LBV A;  2M2E A;  4BNC A;  3HRS A;  3AVW A;  2Y9Z A;  2ZSI B;  3ZMD A;  4TMW A;  3SYT A;  4WQM A;  4XN0 A;  2XAJ A;  3G73 A;  3OIP A;  5FNZ A;  3H9J A;  5FRM A;  3ECH A;  3IKT A;  3SEQ A;  2F4N A;  2YU3 A;  4D5C A;  3W6V A;  4ESF A;  4DOZ A;  5EEH A;  1GLN A;  1IXC A;  1ZGA A;  4JOM A;  4EJW A;  2H6B A;  3GFM A;  4Z2Y A;  2Z2S B;  5CQG A;  4PCQ A;  2PEX A;  4A0Z A;  4RD2 A;  4HA8 A;  1B2R A;  3T51 B;  5IYP A;  4DW6 A;  1YJW I;  2R7R A;  1PP8 F;  2CUF A;  5F0F A;  3ABK H;  5ICF A;  2OTJ I;  2DMN A;  1W9X A;  4U7D A;  2QYU A;  1H0M A;  4BBS J;  3QFT A;  3BR0 A;  1YLF A;  3L2W A;  4LBY A;  2KJC A;  4F92 B;  2QMU A;  1W0K A;  2ELK A;  1LVK A;  1DUX C;  2FSW A;  1AA7 A;  4Z4T A;  2E1N A;  2G7H A;  3MZH A;  3H35 A;  3V42 A;  3OL4 A;  3H0G J;  1SFE A;  2KVO A;  1FOW A;  3HOU J;  5BPD A;  2XF7 A;  1O8I A;  2KDO A;  1RPW A;  3G2B A;  3IH2 A;  3FK6 A;  1TC3 C;  2P6S A;  2WTE A;  3DPL C;  2XF5 A;  3FKI J;  3PEN A;  3ZBT A;  4FK8 A;  1E3P A;  3K4J A;  1DU0 A;  1P7I A;  3S3O A;  3LSM A;  4EJV A;  3OS2 A;  1W0U A;  1YIO A;  1O3Q A;  2QBY B;  4PC3 A;  2GJR A;  4P9F A;  4XLF A;  1F20 A;  4NCN A;  3Q0U A;  2HOA A;  3OYK A;  4ROX A;  1K8F A;  3JRD A;  2OZU A;  4UB6 C;  4HDU A;  2MA3 A;  1J9I A;  3QQA A;  2WBM A;  4M0L A;  5F4O A;  4QUZ A;  5A89 A;  1OGJ A;  2Q1Z B;  3DLA A;  2BOL A;  1WJB A;  3PNY A;  3MKL A;  4B44 A;  1GAW A;  1CNE A;  2I10 A;  1SM4 A;  3TQN A;  3WHB A;  2IXS A;  4A3E J;  2NOG A;  3J7Y J;  3ZOB A;  4A5M A;  1KQS B;  4DQK A;  3J81 k;  1YTY A;  3C2G A;  1CLW A;  4A3K J;  5H5J A;  3CLQ A;  2EFW A;  4A3B J;  1G7R A;  4B4D A;  4GQN A;  2IOU G;  4OZY A;  3HSE A;  1W35 A;  1HW2 A;  3EYY A;  2FX0 A;  3H9G A;  4PC7 A;  4N4N B;  2VFO A;  3V7A A;  1IAW A;  2B7C A;  3KL9 A;  5BSX A;  3BR1 A;  1QVF B;  1Z6R A;  4M2L A;  3QPS A;  1BW6 A;  4CQJ A;  1IRX A;  1WFX A;  1U3E M;  2PEC A;  2VZL A;  1PLU A;  3SY2 A;  1FOK A;  3CLO A;  3FZV A;  1VQ9 I;  4M72 A;  1UMQ A;  2XPU A;  1AU7 A;  1ZRD A;  1FC3 A;  3F8F A;  3EUK L;  4IKF A;  2DLL A;  1J75 A;  1MBK A;  1M1E B;  3KYL A;  4XRF A;  2GIZ A;  1VQ6 I;  2GQQ A;  4URR A;  5CJ9 A;  2DOE A;  3CCS I;  1OGM X;  4JRA C;  3F9K A;  4OJ6 A;  5E8I A;  3M3Y J;  1KCC A;  1G8X A;  2HI3 A;  4Q47 A;  4FX4 A;  4BAY A;  1D1N A;  1JUM A;  5JR3 A;  4IX7 A;  3R4K A;  3T5X A;  4E7L A;  1Z67 A;  2PQ8 A;  1YJN B;  5DCF A;  3M1E A;  1DG1 G;  4NC6 A;  1Z0X A;  4X7F A;  1WVR A;  1VQ5 B;  2EZH A;  2R0Q C;  2B7B A;  2JUG A;  3LMM A;  4Z4V A;  2LFB A;  4QWQ A;  4HPQ A;  5H6R A;  4L8J A;  1JJ8 C;  2R93 J;  1WJC A;  2HOE A;  1MJ9 A;  3CZ6 A;  4UAJ A;  2IGN A;  3QU3 A;  3VYU B;  1Y1W J;  4IO9 F;  1T08 B;  2CC2 A;  4XKV A;  2K3F A;  3RKX A;  2VOD A;  3ZN1 A;  1X1D A;  3LSG A;  2OQG A;  4QPQ A;  1YJW B;  1Q9S A;  4NBQ A;  2BM0 A;  1XN7 A;  4IQ4 A;  3BCF A;  2LD5 A;  2C5H A;  4X1E A;  2L2O A;  3CRZ A;  4W8T A;  1XB4 A;  1FYL A;  2X6W A;  1HF0 A;  2VBV A;  2Y0S A;  5FD6 A;  1W0T A;  3JRA A;  1X1B A;  2GLO A;  4U88 A;  3MZY A;  1VZ0 A;  1ETY A;  4H9G A;  1ETO A;  3O8G A;  4UV9 A;  2D3L A;  2BM6 A;  4XL9 A;  1BQE A;  2AS5 F;  1LFP A;  4ETS A;  5LMZ A;  2FU4 A;  3KET A;  4BL0 B;  2CO5 A;  4AC0 A;  3OW2 B;  1D1B A;  4LBW A;  1AIR A;  4HX7 A;  1DDI A;  3JUR A;  2VBM A;  2VJI A;  4RB3 C;  1JHH A;  2GWR A;  4WXH A;  4ENK A;  4ANJ A;  2NS0 A;  5THX A;  2CS3 A;  4MQV A;  1MJB A;  4XLA A;  4PC6 A;  1AWC A;  1NJI D;  3GTL J;  1FP1 D;  3E5Q A;  1MMD A;  5FKO A;  4RM3 A;  1YQA A;  2BV3 A;  3ECO A;  1NDH A;  1OJL A;  4EAT A;  3HHG A;  4OU0 A;  1ZG3 A;  4F55 A;  4BY1 J;  2JJ2 A;  2KMU A;  4RLQ A;  1P7J A;  5LEJ A;  2V4J C;  1KCD A;  3CES A;  3CCV B;  5AMV A;  3AG2 H;  2ZC2 A;  3ZRG A;  5GPC A;  1VQ4 I;  3RKY A;  3OZV A;  2VYQ A;  2ZBV A;  1HG8 A;  3CCM I;  1YG2 A;  3CDL A;  4IOA F;  2DA5 A;  2LF8 A;  4LLN A;  4EH1 A;  1FT9 A;  2BVL A;  2EZL A;  1JA1 A;  4NK8 A;  1D8T A;  1R1T A;  2D2W A;  3NWS A;  2B63 J;  2Z1D A;  4OAZ A;  4PAB A;  5LGT A;  2QKL B;  2WJV A;  4BPR A;  2CFX A;  4HLY A;  5LHG A;  4D7M A;  3ISP A;  2E71 A;  3DXJ F;  3CME I;  1FDR A;  2VKD A;  1V0F A;  1U0J A;  3K4K A;  5D5X B;  4BH9 A;  4QHY A;  5A8A A;  2JRM A;  2IT0 A;  4ZGQ B;  2W1O A;  4EEF G;  3BDD A;  1JKP C;  2OA4 A;  3DBR B;  2ZJR F;  3TO6 A;  3HTU A;  4TMT A;  2JT1 A;  2XF6 A;  2HZD A;  1W36 D;  1B8I B;  1H8E A;  3FKJ A;  3K1P A;  2DDB A;  4DZP A;  5J47 A;  5M5Y J;  2BE5 F;  2JTV A;  1FX0 A;  2OPT A;  2ZME A;  2XAH A;  2YWF A;  2HKO A;  4PMH A;  4OAY A;  2M34 A;  3VWB A;  4WXC A;  3S8P A;  1FTT A;  2VUM J;  1WU8 A;  4FXU A;  3GVK A;  1VQ6 B;  4D1Q A;  2DK5 A;  3FKS A;  4L5I A;  2RC6 A;  1EP3 B;  4OM9 A;  2LP0 A;  3H0D A;  2LOO A;  3WOD F;  3CCS B;  4X07 A;  3GQA A;  4PZJ A;  1KU7 A;  5LEK A;  1LDK B;  3CB4 A;  1R7J A;  1UHM A;  1X4P A;  4L5J A;  5IYB J;  4LG3 A;  2E7X A;  4F7Z A;  1IHM A;  3EYI A;  4OJL A;  5HVQ C;  1HSJ A;  3QRF F;  1HZE A;  1ONV A;  4ESJ A;  1UD5 A;  3CCR B;  1WOS A;  3ONU A;  3WE2 A;  3S14 J;  4ZZD A;  1MMS A;  1AMO A;  2R7Z J;  2XZO A;  3BR2 A;  5F64 A;  5F4M A;  2OAZ A;  1Y0Y A;  1UZC A;  2PN6 A;  3F72 A;  5E79 C;  4LIV A;  3J7A O;  2VOP A;  2JIZ A;  3S17 J;  1WOR A;  2DJN A;  1ZTR A;  5K7Z A;  3BY2 A;  4HSR A;  3AVY A;  3JX8 A;  2HXI A;  4RBO A;  3W2E A;  3JSP A;  1W4M A;  3FXK A;  3MFK A;  2FNP A;  1GQ8 A;  3RQ4 A;  1YIJ I;  3TW6 A;  2YX4 A;  2K4J A;  2V6E A;  4Z05 A;  2O7O A;  1JI8 A;  2HYG D;  4X0C A;  1ETQ A;  1GV2 A;  3KYC B;  5F1J A;  1ZM4 A;  4B8X A;  4KKT A;  1RKT A;  3BG9 A;  3CCL I;  3CMM A;  1O57 A;  1EFR A;  3A03 A;  3PL8 A;  4ZZL A;  1JT0 A;  3H3Z A;  2OD5 A;  2F48 A;  1B59 A;  2CUJ A;  3OR1 C;  1W0J A;  2VBS A;  1P4M A;  1I1G A;  1OYI A;  3DCF A;  3NWT A;  2ZME C;  3A8K A;  3O2P E;  3ZUG A;  3AK5 A;  3SZG A;  5EGO A;  1CQX A;  1USS A;  2RNJ A;  2R5Z A;  3L2U A;  1MBJ A;  2Q6L A;  3DQV C;  3K70 C;  2R7U A;  4BKX A;  1E62 A;  2NYX A;  3I64 A;  4IEJ A;  4Y3O A;  5AIQ A;  5JLV C;  2IS1 A;  3OYA A;  5CYV A;  4RJL A;  1UJ8 A;  4K2E A;  5HNF A;  1IDY A;  4HNV A;  3A3G A;  4NBS A;  4XLC A;  4BE1 A;  2O1D A;  4Y15 A;  1Y39 A;  2IA1 A;  3ERE D;  5TRD A;  1DGR M;  2AO9 A;  2D74 A;  3BOQ A;  3SEJ A;  4BHC A;  5E20 A;  2GXA A;  1T6X A;  3T56 B;  2HEO A;  2X3H A;  5E17 F;  3WTY C;  3ZXS A;  3SUC A;  3EQN A;  1XMA A;  4DNC A;  3CD6 B;  2H94 A;  4P12 A;  1PXZ A;  2ZXI A;  2DO7 A;  3I59 A;  5DDG A;  5DUI A;  4YIR X;  4J01 A;  2DAO A;  3W5U A;  3LFK A;  2QGU A;  2UVE A;  1ON2 A;  1XTA A;  4BS9 A;  1YI2 B;  4I84 A;  3CME B;  2BM5 A;  4IRI A;  3WTS C;  4DYR A;  4V02 C;  4YAL A;  1D1A A;  4KMU X;  2RQQ A;  2A05 A;  3F21 A;  4HE5 A;  2VQH A;  3FPP A;  3CO6 C;  4B09 A;  3BG5 A;  1GT0 C;  1KYW A;  1WWX A;  1MBG A;  1R23 A;  2JMW A;  1B72 A;  1SVM A;  3ZQC A;  1RQP A;  3REO A;  2VQC A;  2LTP A;  1Q7Y D;  2LY1 A;  2V9K A;  3LA2 A;  1R5G A;  1ZM2 A;  3JRH A;  4X6A J;  3FXL A;  2ZTN A;  3FWE A;  3T0Y A;  4Q4Z F;  1UB9 A;  2K27 A;  2GXB A;  4C2L A;  2Q8K A;  3L09 A;  3SFZ A;  2D5V A;  4RM0 A;  5F08 A;  3WXM A;  2DA4 A;  3PIO F;  3A01 A;  1BOA A;  1O8F A;  2FOK A;  5KCM A;  1BMF A;  4O5V A;  5D4R A;  5F6F A;  3WTV C;  1F4K A;  2H8R A;  5JHU A;  1UST A;  2FE3 A;  3I56 B;  3B8Y A;  2CQQ A;  4JMQ A;  1YS6 A;  4HX8 A;  3IHU A;  4NC8 A;  3FHZ A;  2CW0 F;  1H9T A;  2R7T A;  5C3E J;  2GJK A;  1UD8 A;  3OOC A;  2NNY A;  2B5O A;  2W82 A;  4KA4 A;  2CQK A;  2O8K A;  1EP2 B;  3TBI A;  5AN9 A;  1W87 A;  2Z5U A;  1OFE A;  2HPM A;  3OPO A;  2VXZ A;  2WPD A;  2PMZ N;  4PC1 A;  5B6I A;  3IP4 B;  4G94 A;  3OYI A;  4AWX B;  3QFR A;  4MNU A;  3FXU A;  1Y8Q B;  4N9H A;  4RD3 A;  2LC2 A;  5CVU A;  4EM1 A;  4RCZ A;  2M9H A;  4A3G J;  1SAX A;  5HXB A;  4Z4Z A;  3A35 A;  3BY1 A;  2OV7 A;  4XBF A;  1OFL A;  1X0C A;  2HVQ A;  5K5O A;  2QTZ A;  1YHQ I;  1T33 A;  3OL3 A;  3OYB A;  4P3Y A;  2A07 F;  3CC4 B;  1BOB A;  2MW8 A;  2Z16 A;  3ASR A;  3P9I A;  2D1H A;  3FPK A;  3SDG A;  2EZI A;  4M3F A;  2Y31 A;  4IPA A;  3ERM A;  1O4X A;  4U9U A;  3U1K A;  1O8M A;  2QZA A;  2I8D A;  2KIM A;  4OOI A;  1UG2 A;  3GQ8 A;  4I02 A;  5F1R A;  1A5J A;  3LMW A;  3GF2 A;  3A8J A;  3PA2 A;  1Z9C A;  2O03 A;  2HWV A;  4U87 A;  1ZM9 A;  4A3D J;  2DFE A;  3MKZ A;  4NC7 A;  4XLE A;  5EGO B;  4MFE A;  3F8M A;  5F0C A;  2B9S A;  2R5Z B;  3BZK A;  2Q6K A;  2ID6 A;  3V8L A;  1A35 A;  4A3J J;  1O3T A;  3LAJ A;  2HS5 A;  1O8K A;  4XSZ F;  2FUG 2;  4UUV A;  3B82 A;  1AIP A;  2BY0 A;  1IC8 A;  4OJP A;  2WSS A;  3DPT A;  4BJT A;  1MJA A;  4BAC A;  1K4Z A;  2ZJQ F;  2QEX B;  1QBJ A;  2ZJP F;  1HLV A;  2DQL A;  1JKO C;  1ZGJ A;  1QH0 A;  2ELJ A;  5IYN A;  2VBY A;  4ITV A;  3OIO A;  5ERI A;  2B7E A;  2OJE D;  4RDL A;  3A0B C;  3UW0 A;  3WTZ A;  4FX0 A;  1OFM A;  4M71 A;  1N0U A;  1RMG A;  4P55 A;  2ZIT A;  1FBQ A;  1GXQ A;  1OCO H;  5L3E A;  1IJW C;  2ME0 A;  2FRH A;  4XRS A;  4ZYA A;  5TJJ A;  2EIX A;  3I59 B;  3V8K A;  2RKH A;  2XGC A;  3QAH A;  1K4T A;  3Q0V A;  2ZZG A;  4WZK A;  2DOG A;  3QFC A;  1ZR4 A;  1MMA A;  1SAU A;  2EK5 A;  3SEZ A;  1FY7 A;  4PK4 A;  3GCM A;  1IJE A;  1YX3 A;  4NUB A;  2BF4 A;  3U21 A;  1OB5 A;  2XTW A;  1EV7 A;  2CK3 A;  1B72 B;  2V1U A;  1X1P A;  2X51 A;  1B1B A;  5EDN A;  1H8H A;  4XOR A;  4ZYD A;  2DMP A;  3NAU A;  2NXN B;  2D3N A;  3CW2 A;  1TZL A;  2MLK A;  2JPB A;  1O8G A;  1UD4 A;  3ZQQ A;  1I7P A;  4B3F X;  1D1C A;  3QYB A;  4PSW A;  1R5O A;  4KKS A;  3A01 B;  2VJJ A;  3ROU A;  4CYD A;  2R7X A;  4CCN A;  1SMT A;  3BWG A;  1EP1 B;  3KLO A;  3Q9V A;  4EGY A;  3DBL B;  2P81 A;  2OCE A;  2PIA A;  4XID A;  1CQT A;  3M8J A;  4RAG A;  5GPA A;  1JKQ C;  2QTL A;  3VR6 A;  4IHY A;  2V5I A;  2DTR A;  2LLK A;  3ES9 A;  2W24 A;  2BY3 A;  1E1R A;  1FMW A;  2BVM A;  2KP6 A;  4PFP A;  1KTW A;  4UZF A;  1NK3 P;  3HGG A;  2E5N A;  2NVT J;  1BC8 C;  1ZG1 A;  3WND A;  4RD6 A;  2CU7 A;  2CQN A;  1ZG5 A;  1OPC A;  1S7O A;  4AU7 A;  1QZZ A;  1X4O A;  1XG1 A;  2P5L C;  4KDP A;  1HC8 A;  2YUH A;  2QM3 A;  3GLL A;  4OIN F;  5J4V A;  1Y56 A;  1FMV A;  3JCU C;  1F60 A;  1V0E A;  1TQM A;  3DLL F;  2F3L A;  2COM A;  2FNA A;  3VSU A;  3VST A;  3CJT B;  3HKZ N;  4BBR J;  4E7K A;  3FF5 A;  3SJP A;  3IUO A;  5B1B H;  4LFU A;  2KIU A;  3ZQ7 A;  4X7D A;  4G7O F;  3E6M A;  3ZCO A;  2V6C A;  4AIH A;  4BU2 A;  5FB2 A;  3WYA A;  3CJN A;  5TY0 A;  2X48 A;  5D4S A;  5DSZ A;  2IVM A;  3OYC A;  2XGD A;  4BE2 A;  2L4M A;  2W25 A;  1KZH A;  3U1D A;  4J19 A;  5LFA A;  2PJR A;  1E17 A;  2Y75 A;  4PJ0 C;  3E20 A;  2DCU A;  3CMA B;  1TWC J;  1W7P D;  1EWY A;  3RTR A;  3PQK A;  1R36 A;  1YE9 A;  1WOO A;  1IZ1 A;  4AC9 A;  4I98 B;  3O6B B;  3I4N J;  1A8P A;  4XR6 A;  1RR7 A;  4QSH A;  2VFQ A;  3C2B A;  3HEF A;  1EFC A;  3A0H C;  4IRG A;  3OYN A;  1J7K A;  1G6N A;  3MCA A;  3CC7 I;  4FT8 A;  2ZNZ A;  4M53 A;  5K5R A;  2K4B A;  2R7O A;  3LQ6 A;  2EB7 A;  3H3U A;  2ZFW A;  2ZCW A;  3K7A J;  5ED4 A;  3N4M A;  2H1K A;  1MIJ A;  1ZH5 A;  3OZU A;  4YFX F;  5FKN A;  2V7Q A;  4P96 A;  1ZLK A;  2R7D A;  4BYY A;  5HS8 A;  1HXD A;  2E1O A;  4HAM A;  3V4G A;  1U8R A;  4P5O A;  4CO8 A;  1UFM A;  4IZZ A;  4II3 A;  3NE5 B;  1R6R A;  2XGX A;  3NEU A;  4BXX J;  3RQI A;  2DT7 B;  1T95 A;  1VQM I;  1LEB A;  3HYI A;  4YZ0 A;  4N9I A;  4M6X A;  4G7Z F;  1VTN C;  4XOT A;  2F43 A;  1FWZ A;  5FA6 A;  3VO1 A;  3LJY A;  3FMQ A;  2M87 A;  1Z1D A;  3G1M A;  1KA8 A;  3R61 A;  2LY9 A;  4UHT A;  2CJJ A;  5EYR A;  2JDI A;  2XRN A;  1XG2 A;  1G3Y A;  2O3F A;  1JXS A;  2MSY A;  5GTH C;  2LSO A;  4W8Q A;  2VT2 A;  1ITY A;  3CJR B;  1SKY B;  2W7Z A;  2QQ9 A;  3Q6Q A;  2QLZ A;  3SDB A;  1R71 A;  4RPD A;  3QOE A;  3D26 A;  4IHW A;  4FCY A;  1G3S A;  1IRZ A;  2VN2 A;  2BZT A;  4JYK A;  3CMY A;  4WCG A;  3CJQ B;  3CPX A;  1YW7 A;  4LJZ F;  2X53 S;  1U9O A;  4XNF A;  4CDG A;  5HDG A;  2Z33 A;  5JBQ A;  1XGO A;  2DMU A;  3C1D A;  1TSP A;  2MAB A;  3NB2 A;  4KFC A;  2OBS A;  5DM7 F;  1KRH A;  3WU0 A;  5DS9 A;  3ZQI A;  2ZL5 A;  4AVZ A;  3ASS A;  1K83 J;  3PSZ A;  4L9N A;  3ULQ B;  1RR8 C;  2BMW A;  2LF7 A;  3M07 A;  4L0Y B;  4P2N A;  1V3F A;  3PUN A;  3ASQ A;  3VMV A;  3TOA A;  4A0Y A;  1MZB A;  4PJL A;  1BM9 A;  2RC4 A;  4GCV A;  4M9Z A;  4JQF A;  4ZC3 A;  1SKQ A;  2OYN A;  4G1V A;  1YJN I;  1YO5 C;  3WNC A;  1ZQ3 P;  1H85 A;  1XDS A;  1VQ5 I;  2D1V A;  1QFY A;  2Z3Y A;  4E4H A;  3HM5 A;  1BR1 A;  3H1C A;  4G7W A;  3BH7 B;  3B78 A;  5DTD A;  1TWG J;  4A3I J;  4MEX F;  1KON A;  2L5Q A;  4KYW A;  2EIM H;  2V31 A;  2WB1 A;  3DEE A;  5LBQ A;  5E8G A;  4YRV A;  2XND A;  3RPU A;  4Y9U A;  2JJ1 A;  1YX5 A;  3P27 A;  3PSI A;  2Y2Z A;  3KYD B;  3PM1 A;  1S7E A;  1JUS A;  4F3Q A;  2BEO A;  4C30 A;  5KHD A;  2PJR B;  4M4S A;  2E2J J;  1PJ5 A;  1YS7 A;  3FDY A;  3GZ5 A;  4RAF A;  1FYK A;  1ZGW A;  1MD0 A;  1OFC X;  4XKB A;  1DPU A;  1P4W A;  3QPT A;  2Y0M A;  4M6V A;  1T6Z A;  1U2R A;  3Q3A A;  3ASO H;  2JA2 A;  3IAS 2;  2NVU B;  4EJT A;  2IEK A;  4BXF A;  4EW9 A;  4KT6 A;  5LGN A;  1QJV A;  1U78 A;  2XAU A;  3OYD A;  1Z05 A;  4YAF A;  1HOM A;  4RGU A;  3DU5 A;  1IRF A;  3IRR A;  2J8I A;  3R6J A;  1KQ9 A;  1ERD A;  1J9Z A;  5ICG A;  4ZDO A;  1E3X A;  5TV2 A;  1ORK A;  4AID A;  5FFZ A;  3E1Y E;  1I1S A;  2ACJ A;  4RGS A;  1CNF A;  4YAU A;  1AKH A;  2DFH A;  2WAQ A;  2W57 A;  3LSJ A;  1LUJ B;  3CQZ J;  4MHG A;  5IP9 J;  1JNY A;  5IYC J;  2YWG A;  3CC7 B;  2X1C A;  3JAM K;  1ETW A;  1JRG A;  5J8C A;  4IRH A;  1E63 A;  1TL8 A;  1EFU A;  2ETH A;  4O3M A;  4OJO A;  3G71 I;  2DN0 A;  1NTC A;  2G0E A;  1WRJ A;  1FBS A;  1OOC A;  2DBB A;  2EQR A;  2K9Q A;  5H59 A;  2LR8 A;  4ENJ A;  1TNS A;  1B6A A;  2F4M B;  1X2N A;  1WGX A;  3KEO A;  1FPQ A;  4PJN A;  5D6F A;  1LQ1 A;  2AXL A;  5GV7 A;  1LDJ A;  3CCY A;  1OCR H;  1QHH D;  1E43 A;  1S3J A;  2L9S A;  2X6O A;  1S7A A;  4G1B A;  3DWL E;  4NHJ A;  2RAE A;  4DJA A;  2E2H J;  1VLY A;  3WY9 A;  3A2K A;  5J6X A;  3E5X A;  1VQM B;  1MH3 A;  2IJL A;  4ENN A;  2CV0 A;  2BN4 A;  1YW8 A;  5IOY A;  5EEG A;  2JSP A;  1RIO H;  3H5A A;  5BPI A;  2DMQ A;  4GGG A;  1LDD A;  2M1B A;  3OZW A;  4L5E A;  3U9G A;  9ANT A;  1DQU A;  4PGG A;  1NB0 A;  3FIS A;  1A6Q A;  1JTY A;  2CRV A;  3ZZT A;  1TUI A;  5KNL A;  4A5N A;  5CLS A;  1S0U A;  1BI3 A;  2HOS A;  1KZL A;  4G9Y A;  4UB8 C;  3H3V K;  2EFG A;  4FWT A;  4BXU A;  3ZQH A;  2F4O B;  2KFD A;  3MZ8 A;  2V1N A;  3GO5 A;  5JHF A;  1GHC A;  1NRK A;  3J7Z I;  4YFN F;  1JTA A;  3VDX A;  1K61 A;  1W5C C;  3RPQ A;  3HOZ J;  1IRG A;  2HR3 A;  4UZE A;  2CSO A;  2JVH A;  2E19 A;  2JN9 A;  2ZZE A;  1K4S A;  1F5T A;  2DT6 A;  3J7A Y;  2OBT A;  4WZT A;  1DAR A;  2PLY A;  5J1U A;  3HDD A;  4A3C J;  1KK0 A;  2NNN A;  4P26 A;  2VOO A;  2DFF A;  3KP2 A;  2JJ7 A;  2IP2 A;  2WA0 A;  3VOE A;  1B8I A;  1CF7 A;  4U4B A;  2EH3 A;  2LRE A;  3FXQ A;  3J80 Z;  1FJL A;  4G8X A;  1RRJ A;  1EA0 A;  2Y9Y A;  1ZYR F;  1E3H A;  3OYF A;  3DPU A;  4WZL A;  3GLX A;  2IA0 A;  4IL6 C;  4B3X A;  1UCR A;  4H4K C;  2KPM A;  4IF4 A;  1S29 A;  1K6O A;  4TKO B;  3F8N A;  5GV8 A;  4ESB A;  2P7C B;  3Q9S A;  2NTP A;  1BC7 C;  1E3O C;  3D5L A;  2CBX A;  4MTE A;  3CCR I;  3HGY A;  3PIP F;  2UWM A;  3TOB A;  3IWZ A;  1FSH A;  1TTY A;  4U7B A;  3PUM A;  1WSV A;  4IW3 B;  2ZB9 A;  2VNK A;  1H89 C;  4C2T A;  4OPW A;  4XIC A;  1WOP A;  3LAP A;  3GVA A;  2EA4 A;  2PE3 A;  2KIS A;  3HL2 A;  4UVB A;  2GBY A;  3PQJ A;  5FD5 A;  2W48 A;  1OQY A;  3L7W A;  3HOW J;  3I9V 2;  2ZBU A;  3KRG A;  5FFX A;  1VBL A;  2GM4 A;  3HRM A;  2Z99 A;  1WSR A;  1Y8R B;  2L9N A;  4X7E A;  4Z06 A;  2OCC H;  3BPV A;  1XSD A;  1YJ9 B;  2V1D A;  3FXJ A;  3WE3 A;  1T6Y A;  3D0S A;  1LLW A;  3HRT A;  1UMK A;  1AKH B;  1BJZ A;  2G9W A;  1WJF A;  1XCB A;  3EET A;  3M4O J;  1I6H J;  4RB2 C;  1R22 A;  2LZJ A;  3H94 A;  3NAW A;  5J3L A;  1PDN C;  1BN5 A;  3IL2 A;  2WY7 Q;  2HFH A;  3B4N A;  3SHF A;  3P7N A;  5JLX A;  5ICC A;  4HEA 2;  3JRB A;  1BI2 A;  4DQ2 A;  1WPC A;  2XUB A;  2R7W A;  2O0V A;  2DDA A;  1ETX A;  1V4R A;  1JJ2 B;  3IH3 A;  4P3I A;  5IT3 A;  1OMI A;  3K1N A;  1TP4 A;  3V7S A;  3OSG A;  4FIS A;  4B48 A;  2VQG A;  3G71 B;  1QUF A;  1QVG B;  2K86 A;  2R5Y A;  2DA7 A;  3V7R A;  2AHO A;  4E7I A;  5FIU A;  1SD5 A;  4WK8 F;  3AKZ A;  1MMN A;  3BJ6 A;  1Z6T A;  4HIZ A;  3VMF A;  4A0X A;  4RM2 A;  4PJJ A;  3ESW B;  3ZC3 A;  1LM1 A;  6PAX A;  5IK2 A;  1W5S A;  4KIF A;  1AHD P;  1T0F A;  2X4H A;  2IBD A;  4EQQ A;  2IA2 A;  4ZYG A;  4EV0 A;  2XRL A;  3N90 A;  1XC5 A;  4FAS D;  1R49 A;  3OP1 A;  3RIQ A;  2F1M A;  1BJA A;  3IV5 A;  3CD6 I;  1SD4 A;  3W5V A;  1VND A;  2YPR A;  5GP9 A;  5EEA A;  2DJI A;  1J2X A;  2E5Z A;  1H8A C;  1DP3 A;  1EF4 A;  1YI2 I;  1Q86 D;  1GDT A;  1KC8 D;  1ZRF A;  3UKG A;  2DYR H;  1D5V A;  4S0H B;  1RI7 A;  3MVP A;  2GPJ A;  1IW7 F;  2LG4 A;  4HNT A;  3MMP A;  4X7C A;  3WTW C;  2GRE A;  1TT5 B;  3KX2 A;  1W34 A;  2VE9 A;  2JUC A;  4G6Q A;  1TWA J;  3FXM A;  1CF7 B;  1VQO B;  5BS6 A;  2PX9 A;  1Y0U A;  2KRC A;  3GVL A;  4PUS A;  1WXR A;  5JI6 A;  4W1U A;  2O17 A;  2L0K A;  2QF7 A;  3DEW A;  3PNT A;  3JU4 A;  2PYH A;  3KFW X;  4MLO A;  1HF2 A;  3TP0 A;  4IHV A;  3VSK A;  3S16 J;  3CC2 B;  1YRN A;  3GFL A;  3I58 A;  4B4C A;  1D5Y A;  1QRY A;  4IHX A;  2KIQ A;  1W5T A;  4M3D A;  3I56 I;  2EFO A;  3KCC A;  1YJ9 I;  1G3T A;  2J7K A;  1J5Y A;  5JMC B;  2VBT A;  4BDZ A;  1OB2 A;  3L2Q A;  2XRO A;  4MQ9 F;  3GSI A;  4HX4 A;  4NQW A;  4PGO A;  4AYB N;  5HS9 A;  4Y4R A;  2R92 J;  2FX3 A;  1LVA A;  1N06 A;  1TQP A;  2N8G A;  3ABL H;  4MEY F;  4X06 A;  3JQQ A;  2A3S A;  2F5E A;  3NQO A;  2E35 A;  4C9Y A;  4ZTF A;  5LLQ A;  2O6G E;  2NT9 A;  1T0F C;  4HF2 A;  3JRI A;  2BX6 A;  2A5W A;  2KHM A;  2QQA A;  2VI6 A;  4Z4U A;  2ZTG A;  1I6X A;  2RN7 A;  1P6R A;  5IY5 H;  3HZJ A;  2XPW A;  3CC4 I;  3OJW A;  1VF9 A;  2EIJ H;  3LL7 A;  5L3G A;  1SVO A;  4UUS A;  1IJF A;  4TSF A;  3H9N A;  1PYV A;  2G0Y A;  2XT2 A;  3CCU B;  5CVR A;  1DBG A;  1XX5 A;  4RB0 A;  2ME6 A;  2C4T A;  1K28 D;  1XCV A;  1Q81 D;  4ASU A;  1M90 D;  1BI0 A;  3OFN A;  4YIF A;  2DU9 A;  2MD5 A;  3B6C A;  4ZJZ A;  2QEN A;  4RLF A;  2HQR A;  3VB2 A;  1ZEL A;  2JZY A;  1DDN A;  2CH0 A;  2GOX B;  3K2Z A;  4XKW A;  1XPX A;  5DYM A;  4N3N A;  1OCC H;  3W6J B;  5D5U B;  1E2X A;  4BUP A;  3K70 D;  5AIP A;  1QFJ A;  4GRI A;  3HPH A;  5C4J J;  1L1I A;  2E36 A;  2EPF A;  3DF8 A;  4JX6 A;  2R5Y B;  2E1R A;  3S1R J;  1QVU A;  5FRO A;  2QEX I;  1PP7 U;  1UD6 A;  3L9F A;  5J1Y A;  5FO5 A;  5AON A;  3GME A;  1QVT A;  3OMY A;  3B73 A;  3BG6 A;  3H5N A;  3BTJ A;  1PJ7 A;  1P92 A;  2H8W A;  2ISZ A;  3OEH A;  3ZPP A;  1LFU P;  4KN4 X;  1OCP A;  3FXO A;  3AGQ A;  4YFO A;  3OE7 A;  2K9M A;  5IT9 Z;  2W84 A;  1E0E A;  3RYR A;  1EZG A;  5GAH J;  2HZT A;  2IAI A;  4LLL A;  3E6C C;  1K73 D;  2H27 A;  4CHU A;  1JT6 A;  3QYF A;  1PJ6 A;  4G7X A;  1HVX A;  5BSY A;  2HCJ B;  1I3A A;  2W85 A;  5L3D A;  2KKO A;  2DI3 A;  3RYP A;  3V7C A;  5L3C A;  1T8I A;  2IS6 A;  1XGN A;  3E7L A;  1GUU A;  2WB1 N;  1RQR A;  5IYQ A;  2GAU A;  3DP7 A;  4ZDL A;  4F91 B;  4PSX A;  2WZN A;  2IQ7 A;  1BL0 A;  4YC5 A;  3BP8 A;  2DW4 A;  2VLA A;  3N05 A;  3MD2 A;  3VNV A;  1QA2 A;  2QYO A;  4CCO A;  2C4U A;  2M3A A;  2R7Q A;  3JRC A;  1MGT A;  4LBZ A;  4P25 A;  4EJU A;  1JB9 A;  2KZV A;  2HTJ A;  4HV6 A;  4C0S A;  1WMR A;  1WKM A;  3LYC A;  5D8K B;  1LFB A;  5DD4 A;  1Z7U A;  5BQT A;  3DU6 A;  2WYR A;  2D9R A;  2PFB A;  3MMY B;  3DEU A;  1XGS A;  2Q0O A;  1F36 A;  4GDF A;  1BPL A;  4RMN A;  4K1X A;  4YDT A;  3PJR A;  3RCO A;  2Q2E A;  2BY1 A;  1YRN B;  3GQB A;  4V2F A;  3LQE A;  4M1K A;  5A2Q K;  1KGS A;  3H5R A;  3S1M J;  4P1V A;  3VPR A;  4LIU A;  4ZDP A;  2WAF A;  4TV7 A;  1V5E A;  2P6T A;  2LY2 A;  1ZLJ A;  2CW8 A;  3CUO A;  2MBF A;  3MQ0 A;  5HOO A;  4BQO A;  1JE8 A;  2CF4 A;  2V7T A;  3A8I A;  1PVE A;  2PI0 A;  2INU A;  4NQW B;  1NHA A;  4I0B A;  2DA2 A;  5KW9 A;  2EA2 A;  3LVB A;  2HDC A;  3LFU A;  4BY7 J;  4II2 A;  4WF2 A;  4E70 A;  4HNU A;  3F8B A;  2XC7 A;  1RUO A;  1RUN A;  3ZSC A;  3LNQ A;  1F9N A;  5FL7 A;  1IO2 A;  4OPO A;  3W2H A;  3L1P A;  2QZ8 A;  3GEZ A;  3OYJ A;  2DA1 A;  2OBP A;  4PAA A;  1QRC A;  4U0W A;  2F5C A;  4TN1 A;  2XSD C;  4WWV A;  2MC3 A;  4DNR B;  2WAD A;  3LA7 A;  5F0H A;  3BR6 A;  5HS7 A;  2FEZ A;  5IPA A;  4CCL A;  4UUS B;  3WGI A;  2HGC A;  1E3Z A;  2CWE A;  3PUB A;  1TW2 A;  1QGY A;  1R5B A;  1XB2 A;  4RDK A;  2XTY A;  2IGO A;  4GYG A;  2K9N A;  3VYS B;  3ELK A;  3KEY A;  2VBX A;  3OS0 A;  5IYR A;  4HRI A;  1I3Q J;  4M73 A;  1U5T B;  1Z3Y A;  1KTV A;  1ZUN B;  1SVL A;  5B66 C;  3RZD J;  3HAG A;  3CCJ B;  2KLO A;  3K2A A;  4F52 A;  1GO2 A;  2E1B A;  5J3O A;  2YX7 A;  1FX7 A;  3G6E B;  2DEU A;  4QLC U;  4MYT A;  5DUK A;  3KEW A;  2QSH X;  2DA3 A;  2EIK H;  3E6D A;  4RS8 A;  1O7L A;  3CMA I;  1UHS A;  3CCE B;  4WWC A;  4HST A;  2NAZ A;  5TR9 A;  3P9C A;  3ONQ A;  4C3H J;  1FNB A;  4ACA A;  4R71 A;  3KP3 A;  1GVD A;  1N08 A;  3EQO A;  2H6C A;  1JTX A;  2V1X A;  1WP6 A;  3OY9 A;  2K85 A;  1G2H A;  4PGH A;  4Z4W A;  2L4A A;  2XGE A;  1XDU A;  3J81 Z;  1XD7 A;  1T56 A;  3H9Q A;  4DQL A;  4RB1 A;  2A6T A;  1FNN A;  2X0L A;  3OKX A;  4U49 A;  3IWF A;  3T8T A;  3UNG C;  3LSH A;  3S2W A;  1IUY A;  5CPR B;  3RKW A;  4DGW B;  4DIQ A;  1Z3X A;  1WQ2 A;  1A04 A;  3SZT A;  4HQM A;  2P5K A;  4HV5 A;  4EGZ A;  4KMF A;  1RWR A;  1BHE A;  5JVG F;  2M7B A;  3HXL A;  1WTH D;  2C78 A;  3S3N A;  3G3Z A;  3BQJ A;  4HF1 A;  4YAO A;  2BBY A;  2XNC A;  3OEE A;  3TW7 A;  3Q39 A;  4ABZ A;  3SJM A;  2YUS A;  4G6D A;  1H88 C;  3FK7 A;  3I71 A;  3NAR A;  2CV1 A;  4GFB A;  3OOU A;  3CTA A;  3CPW B;  3PET A;  4UV8 A;  2PLF A;  1UHW A;  1O7F A;  4MTD A;  2P8T A;  1ENH A;  2DER A;  1DBO A;  1HBX G;  1FLI A;  2BM4 A;  1ZK8 A;  5H2F C;  1Z91 A;  5FLX Z;  3LO8 A;  5E3N A;  1KK1 A;  5EJC A;  3WTX C;  3CF2 A;  2Q2E B;  2ZFU A;  2JA7 J;  2P0W A;  1U8B A;  2FJ1 A;  3BTC A;  3KIO A;  3PFI A;  2HDD A;  4M3B A;  5BMZ A;  1MRZ A;  4M74 A;  3F0C A;  1ACI A;  1FEX A;  2QQ8 A;  4CXF A;  5DCM A;  3BCB A;  2Y0S N;  1ZN2 A;  1RET A;  3FXR A;  1DGW Y;  5M3M J;  3OOP A;  3RI4 A;  3PSF A;  1D8J A;  3QOP A;  2ZZF A;  4MR0 A;  3CF5 F;  2Q6O A;  4DK0 A;  3E0J B;  2LKS A;  4CZC A;  2EFQ A;  2WR8 A;  3KZZ A;  1ZM3 A;  2KRF A;  2M5W A;  3JQR A;  2MH2 A;  1KYZ A;  1P4X A;  1O3R A;  4X05 A;  2INV A;  1BIB A;  3FHN A;  4I0A A;  1WCM J;  3GQ9 A;  2OZ6 A;  2WV1 A;  4E7H A;  4CYC A;  1VQP I;  2JQ7 A;  1XMK A;  5F04 A;  4P6V F;  3AST A;  2P7V B;  3B02 A;  1MND A;  4M3E A;  2X0K A;  1VQ7 I;  3HOY J;  3OAA A;  4CUG A;  2WZP P;  5IP6 A;  2BY2 A;  1X1C A;  2UUZ A;  5FKK A;  2X9D A;  2W4S A;  5HDN A;  2DXI A;  3BH4 A;  1SEU A;  4FE4 A;  5F27 A;  1QZE A;  1BR2 A;  4BQQ A;  5DNS A;  3BCD A;  2LKP A;  1M1K D;  2E60 A;  2BPO A;  3I1F A;  1TWF J;  1IDZ A;  2E2I J;  2DOA A;  3B8H A;  1TW3 A;  3BZC A;  4D5F A;  1NH3 A;  1BBY A;  2X1E A;  4KT5 C;  2DOF A;  3K1M A;  5CQE A;  2YU9 J;  3K0L A;  4BGD A;  4A3F J;  3S1N J;  2Z8G A;  1G59 A;  1NB9 A;  2LK2 A;  4S05 A;  4KKU A;  2MG4 A;  2XKP A;  1JKR C;  5BOX A;  1HA3 A;  4RDJ A;  5CKT A;  2RV8 A;  2BGI A;  4CZZ A;  4UXN A;  1O8D A;  4KIG A;  2QN6 A;  2F2E A;  4XOP A;  2V79 A;  3QU6 A;  2ESN A;  4A2U A;  3GTM J;  3OIQ A;  3JSO A;  1HW1 A;  1VLO A;  1H42 A;  4Z4S A;  2F4I A;  2F5F A;  1EA3 A;  2V7V A;  3F6V A;  4N4O B;  5J40 A;  4HW0 A;  4A6D A;  1IGN A;  3MKY B;  5KVR A;  3BCA A;  1E1Q A;  2PBI A;  1KU9 A;  2VJ4 A;  4IHT A;  3FBN B;  2NV4 A;  2HYJ A;  2M8G X;  4Y33 A;  3HB9 A;  3MN2 A;  1JGG A;  2K5C A;  1VQK I;  1T6S A;  3OYH A;  5EG0 A;  3HOX J;  1WSU A;  1KK3 A;  3GIR A;  4ACB A;  2E1M B;  4KUM A;  4Y7C A;  2G7U A;  5E1W A;  1N07 A;  2F5V A;  2CQX A;  4HWV A;  1FRQ A;  2JPC A;  2FML A;  1FBU A;  3OWT A;  3K4N A;  1EFT A;  3W2V A;  3R60 A;  5HLI A;  1N05 A;  3DKX A;  3LQQ A;  3F8C A;  4MFD A;  5LGU A;  4HE6 A;  3KEQ A;  1QGZ A;  4NK6 A;  2F6C A;  4F7D A;  4IXA A;  2R7V A;  2UZK A;  4FET A;  2KZG A;  1Z21 A;  3FX3 A;  3GFJ A;  3OSF A;  4BJ6 C;  4PC2 A;  3P4G A;  1IN8 A;  4ASN A;  4XKC A;  2PG4 A;  4OOS A;  3C18 A;  3OV8 A;  1N8R D;  3ASP A;  1N75 A;  5HNH A;  4BHP A;  4EMS A;  4XLP F;  1IDJ A;  4LLG F;  2RDP A;  2KQR A;  2R7S A;  2TDX A;  2AHQ A;  3TL4 X;  2ZZQ A;  1BN8 A;  2EFN A;  3EUH A;  4CSW A;  5FO0 A;  5FLM J;  4YEL A;  3ZMS A;  3SQN A;  3VYR B;  4I7H A;  2KRH A;  2OU2 A;  1ODD A;  1BR4 A;  1R4M B;  2XB0 X;  5DCM B;  2A69 F;  2ZXJ A;  4DBR A;  2XOK A;  1B9N A;  4JBA A;  4FN5 A;  1IUF A;  3WBK A;  3U6K A;  1YYV A;  2DIE A;  1G3W A;  1H9G A;  3N97 A;  1QGP A;  2V26 A;  3X2Q H;  4IJA A;  1T38 A;  2XAG A;  1TYX A;  4KJZ A;  3VFZ A;  2BV6 A;  3KPH A;  4Y17 A;  2ZBK A;  5EZG A;  4HDV A;  2M7A A;  2A5Y B;  4DYC A;  5GAE J;  3CP2 A;  5CVI A;  2C6Y A;  5CDF A;  4CYC B;  2V7W A;  1G7C A;  5D5V B;  1WI3 A;  5FLV A;  1IF1 A;  1X58 A;  2L7Z A;  1SFU A;  4YEJ A;  1VFC A;  1ELO A;  4BE0 A;  2O9L A;  3AVV A;  2HYF A;  1PJR A;  1K79 A;  2STW A;  1BX0 A;  1E64 A;  1OR7 A;  1WJE A;  1FSE A;  2DT5 A;  4I01 A;  2WJY A;  2ZL7 A;  1KU3 A;  1MKM A;  1PE9 A;  1VQP B;  2DET A;  1IXR C;  4CGZ A;  4XLN F;  4LOC A;  3HSR A;  4HQE A;  1B23 P;  2XZP A;  5KSW B;  1VQ7 B;  1WDT A;  1OFD A;  1B9M A;  2VON A;  3HRU A;  2CV2 A;  4KN7 X;  5FJ8 J;  4BQN A;  2OTL I;  2XB5 A;  2XPV A;  1YIT B;  2PMH A;  3KLN A;  1U6G A;  4BEH A;  3KZY A;  3QWL A;  5DV5 A;  4KIT B;  3SFI A;  4BQA A;  2Z9O A;  3W6K B;  3ZMT A;  3T9G A;  1XFO A;  1W2B B;  1ZRE A;  3EUH C;  3HOS A;  3HPG A;  2E34 A;  2JWT A;  3AVX A;  3ML6 A;  1IN5 A;  2L7F P;  3BRO A;  4WXD A;  3ZR8 X;  1N78 A;  2L01 A;  2GK7 A;  1SFK A;  3JAM Z;  1N77 A;  2STT A;  5K5Q A;  2ESH A;  5HZA A;  4YZQ A;  1WPK A;  4KIB A;  5K7H A;  1ZR2 A;  5EG0 B;  3RDI A;  4PJM A;  1XGM A;  5J4Y A;  2HQ5 A;  3EDP A;  2DPD A;  2QSF X;  3M1C A;  5HKK A;  2GA1 A;  3Q0W A;  1LJ9 A;  4XQF A;  4M9X A;  2LYC A;  1CZF A;  4RAY A;  1Y0N A;  1FOY A;  1V5G A;  2W7N A;  4HLX A;  2NS8 A;  4OZZ A;  5C1C A;  2Y30 A;  3COA C;  1JJ6 C;  4QVJ A;  1VQK B;  2XT4 A;  3O3K A;  1QQ1 A;  4RD4 A;  4RCY A;  3M8E A;  4DZJ A;  2IS2 A;  1K6Y A;  3L00 A;  1X19 A;  2Y69 H;  5J1R A;  4EJO A;  1FZP B;  3I0T A;  5L3F A;  5D6E A;  3BJO A;  1OR7 C;  4P1W A;  2CYY A;  5ILU A;  2PMU A;  3BR5 A;  1JA0 A;  1VJS A;  4OIQ F;  2ADU A;  1MW7 A;  4AUX A;  1VQ8 I;  2FBK A;  1VF7 A;  3SYJ A;  4XMY A;  2XVC A;  1SFX A;  2A61 A;  2NSP A;  3DFG A;  2X3U A;  2ZNY A;  2XEX A;  1S6L A;  4P6Y A;  3RKQ A;  2CND A;  3RPU D;  4OP7 A;  4TMV A;  1YOV B;  3KZI C;  3M9A A;  1QA1 A;  3BJA A;  1XS9 A;  2UVF A;  1D0Y A;  5D5W B;  1QX4 A;  2ZO4 A;  3AVU A;  4A12 A;  2FMY A;  2M0C A;  3VSL A;  2XTX A;  3GBG A;  3G05 A;  2QA4 I;  4C43 A;  5L3B A;  2XSJ C;  4CCJ A;  4BDY A;  1QUE A;  3FMR A;  3WNB A;  3SKB A;  3BY6 A;  1QG0 A;  5E3O A;  4XON A;  3KP5 A;  4QVA A;  5E6T A;  4JP0 A;  2BYV E;  3TED A;  4AF7 A;  1IA5 A;  2DYS H;  3M7G A;  4L9T A;  1OHH A;  4Z1M A;  2V7F A;  1R5H A;  2W00 A;  2M30 A;  3AAF A;  1I18 A;  1LE8 A;  1UEL B;  2PMZ A;  4ENM A;  2X1D A;  3L2R A;  4EM0 B;  3I4P A;  1WH7 A;  2VAS A;  4UNO A;  3SZE A;  4HBL A;  1TYU A;  4Y7N J;  2VFP A;  4LK1 F;  3NRV A;  2QSG X;  3VO2 A;  3F22 A;  1GV5 A;  1UD2 A;  2M8E A;  1SD6 A;  1PKV A;  2VBK A;  3FY3 A;  2CGP A;  1VQO I;  3K10 A;  3EQL F;  3JW4 A;  2RQP A;  3HOV J;  4ZTJ A;  5ILV A;  5E3M A;  4LMY A;  5DD8 A;  4D9J A;  3B90 A;  4FE7 A;  2VIX A;  4QTR A;  5J35 A;  3I53 A;  3SLN A;  1O88 A;  3AVT A;  3EUA A;  1QRB A;  1R58 A;  4RA2 A;  4EVI A;  4ZH4 F;  3CC2 I;  2Q6I A;  3VNU A;  3S3M A;  1LKX A;  2L54 A;  4YG2 F;  2BHY A;  2H1L A;  3TP3 A;  4C2U A;  4XN3 A;  5C4X J;  2K9S A;  1QZY A;  1A6I A;  4WX9 A;  2VNH A;  5ICE A;  3SLD A;  4BEH B;  2CMP A;  1JUP A;  5K7F A;  1S72 I;  1FTZ A;  5FRN A;  1JHF A;  2M4G A;  3QYE A;  3PVD A;  4Z4R A;  2JVG A;  3TDU C;  5M3F J;  3Q6R A;  3UR3 C;  1VQN B;  1LLZ A;  3ZMZ A;  3ZPN A;  4R8H A;  5D8L B;  1IB0 A;  1IB4 A;  1Q1H A;  3ZGK A;  3AG4 H;  4OOX A;  2HQA A;  1EH6 A;  1DP7 P;  4J0Q A;  1R9T J;  2OTL B;  3PFY A;  2COB A;  1QQI A;  3ZZ0 A;  2EZK A;  2YWE A;  2PYG A;  4B43 A;  2NRA C;  2QWW A;  3I4M J;  1QU3 A;  3LNN A;  4LB5 A;  3S15 J;  2RRE A;  1BI1 A;  3K9T A;  3ABT A;  1APL C;  1NHC A;  1RC9 A;  1WHU A;  1YFH A;  5M5X J;  1V5V A;  2OK7 A;  3GFI A;  3H92 A;  3CCU I;  2EBI A;  3SZP A;  3HIF A;  1DPR A;  5LRS A;  5HZB A;  1ETV A;  2EJR A;  4MIM A;  4GXO A;  1GAQ A;  3MEX A;  3F6O A;  4QPO A; 
#chains in the Genus database with same CATH homology
 4XLH A;  3OMY A;  4PK4 A;  4E7J A;  3BG6 A;  3H5N A;  2ZSH B;  1YX3 A;  4NUB A;  4YXW A;  3U21 A;  2CK3 A;  3K4B A;  3OEH A;  4G6I A;  3ZPP A;  3OR2 C;  2X51 A;  5TGT A;  1H8H A;  4XOR A;  3OE7 A;  2K9M A;  1E0E A;  2D3N A;  3E1S A;  1TZL A;  2MFZ A;  3QYF A;  3S93 A;  1HVX A;  1UD4 A;  3ZQQ A;  4G7X A;  1O8G A;  4OJ5 A;  1KCC A;  4B3F X;  2IS6 A;  1D1C A;  3QYB A;  2ZSI B;  4PSW A;  4KKS A;  3SYT A;  4XN0 A;  4J00 A;  4ZDL A;  4F91 B;  2IQ7 A;  2VJJ A;  3OIP A;  4PSX A;  2R7X A;  3H9J A;  4YZX A;  5FRM A;  3GQ7 A;  4CCN A;  3SEQ A;  2VLA A;  3N05 A;  3MD2 A;  4CCO A;  3VMW A;  4DOZ A;  2M3A A;  2R7Q A;  1GLN A;  3HOT A;  3M8J A;  3VR6 A;  4JOM A;  2KZV A;  1WMR A;  2Z2S B;  5CQG A;  1E1R A;  3T51 B;  1FMW A;  1O8L A;  2BVM A;  2KP6 A;  3DU6 A;  4PFP A;  2R7R A;  1K5C A;  3MMY B;  1KTW A;  2LH9 A;  1BPL A;  2E5N A;  4RMN A;  3PJR A;  3RCO A;  4DK1 A;  4R79 A;  4AU7 A;  1X4O A;  3GQB A;  1W9X A;  2VKH A;  1P9Q C;  1QHG A;  4E0F A;  2GOM A;  1Y56 A;  3H5R A;  1FMV A;  3L2W A;  3W2A A;  4LIU A;  1V0E A;  4DNT B;  4YZA A;  4ZDP A;  2WAF A;  1V5E A;  2LY2 A;  2CW8 A;  4F92 B;  5HOO A;  3VSU A;  1W0K A;  4BQO A;  3VST A;  1LVK A;  4E7K A;  1AA7 A;  2INU A;  4NQW B;  3H35 A;  3V42 A;  2BSP A;  3IUO A;  3OL4 A;  1OGO X;  2KVO A;  3HKZ A;  3LFU A;  3D5R C;  4II2 A;  4HNU A;  1O8J A;  2XC7 A;  2XF7 A;  1O8I A;  2KDO A;  3ZSC A;  3ZCO A;  4BU2 A;  3G2B A;  5FL7 A;  3DPL C;  2XF5 A;  3OYJ A;  2W6J A;  4W8S A;  3K4J A;  3OYC A;  4DNR B;  4BE2 A;  3OYE A;  2WAD A;  3LSM A;  3S3O A;  2PJR A;  5LFA A;  1E3Z A;  4OJ6 A;  4CCL A;  3OS2 A;  1COW A;  3PUB A;  1J09 A;  2X6Y A;  2IGO A;  3VYS B;  4XLF A;  3OS0 A;  3A1Y A;  3KEY A;  2GJR A;  3RTR A;  3DKY A;  3HG9 A;  3OYK A;  4HRI A;  2MYS A;  1YE9 A;  1WJA A;  2WY8 Q;  1Z3Y A;  2WBM A;  3K4L A;  4XR6 A;  2Q1Z B;  3DLA A;  2BOL A;  3HAG A;  2KLO A;  1WJB A;  3PNY A;  4PFO A;  4F52 A;  2E1B A;  4E7Z A;  3OYN A;  4B44 A;  1EE6 A;  1IDK A;  2R7O A;  3KEW A;  2IXS A;  2VJ5 A;  3T53 B;  3C2G A;  3OS1 A;  2V7Q A;  4HST A;  4GQN A;  3MKW B;  1W36 C;  3ONQ A;  1BLI A;  4OZY A;  3BG7 A;  1NBM A;  4P5O A;  3H9G A;  4CH7 A;  4N4N B;  1Y6I A;  4IZZ A;  4II3 A;  3NE5 B;  3EQO A;  1R6R A;  2K9L A;  1WP6 A;  2DT7 B;  1T95 A;  3OY9 A;  1RU4 A;  4YZ0 A;  2EWE A;  1E79 A;  1IRX A;  3TMO A;  1WFX A;  3H9Q A;  2PEC A;  2A6T A;  4U49 A;  1NG7 A;  1PLU A;  3UNG C;  3LSH A;  4XOT A;  2F43 A;  5CPR B;  4DGW B;  4DIQ A;  1Z3X A;  5C1E A;  4CCM A;  3EUK L;  4IKF A;  1RWR A;  2L7K A;  1S9H A;  3KYL A;  1BHE A;  2JDI A;  2M7B A;  3HXL A;  1WTH D;  1XG2 A;  2GK6 A;  3S3N A;  4URR A;  1OGM X;  3L2V A;  3F9K A;  4E7S A;  4W8Q A;  1SKY B;  3CJR B;  3OEE A;  2O04 A;  1G8X A;  2R4G A;  4KIS A;  3SDB A;  2HNH A;  1SAU A;  3QOE A;  2CV1 A;  3OOU A;  4F93 B;  1WJD A;  4IX7 A;  2NTQ A;  2MD0 A;  4E7L A;  2NST A;  3CJQ B;  1DBO A;  2X53 S;  1TT0 A;  2M4K A;  4XNF A;  2JUG A;  3LMM A;  2MAB A;  4UZU A;  4HPQ A;  3CF2 A;  3C2H A;  4L8J A;  1WJC A;  2Q2E B;  2ZFU A;  4AVZ A;  2P0W A;  3CZ6 A;  2IGN A;  3VYU B;  2RNG A;  4XKV A;  3RSN A;  1X1D A;  3LSG A;  3BCB A;  4QPQ A;  3VMV A;  4PJL A;  1DGW Y;  4ZC3 A;  2ZZF A;  4IQ4 A;  3PSF A;  4JQF A;  3BCF A;  4MR0 A;  2L2O A;  4DK0 A;  4W8T A;  3E0J B;  2X6W A;  2XGJ A;  2LBF A;  2Y0S A;  4CZC A;  4E4H A;  1BR1 A;  4G7W A;  1X1B A;  2INV A;  1KON A;  2L5Q A;  2V31 A;  3FHN A;  2WB1 A;  2XZL A;  3DEE A;  4YRV A;  1VZ0 A;  2XND A;  2JJ1 A;  3CP8 A;  1YX5 A;  4E7H A;  2Z6B D;  3PSI A;  2D3L A;  3GQ9 A;  4XL9 A;  2IGK A;  1LFP A;  1MND A;  4F3Q A;  4BL0 B;  4C30 A;  1D1B A;  1Z7L A;  5KHD A;  2PJR B;  3OAA A;  4CUG A;  1AIR A;  3JUR A;  2VBM A;  2VJI A;  2WZP P;  3FDY A;  3FBI B;  1X1C A;  2UUZ A;  2DXI A;  2W4S A;  4ANJ A;  3BH4 A;  2CS3 A;  4BQQ A;  3PNV A;  1BR2 A;  4XKB A;  4XLA A;  3BCD A;  2QY1 A;  1MMD A;  2E60 A;  4RM3 A;  3QOD A;  2JA2 A;  3IAS 2;  2DOA A;  4B47 A;  4BXF A;  4EAT A;  4EW9 A;  4XM3 A;  2X1E A;  4KT6 A;  2M0M A;  4F55 A;  3WWG A;  5CQE A;  1QJV A;  2JJ2 A;  2KMU A;  4RLQ A;  1UD3 A;  4BGD A;  2XAU A;  2Z8G A;  3OYD A;  2V4J C;  2WAE A;  1G59 A;  1KCD A;  3DU5 A;  3CES A;  4KKU A;  1ERD A;  1E3X A;  5CKT A;  4ZDO A;  1O8D A;  3ZRG A;  4XOP A;  2WAQ A;  3OIQ A;  1HG8 A;  2F4I A;  2X1C A;  3OYM A;  1EA3 A;  2BVL A;  1JRG A;  4OJO A;  4NK8 A;  4N4O B;  3NWS A;  3MKY B;  1QCX A;  2Z1D A;  3BCA A;  4OAZ A;  1OLT A;  1E1Q A;  2VJ4 A;  3FBN B;  2QKL B;  2IS4 A;  4TT3 A;  1OOC A;  4Y33 A;  2WJV A;  4LIT A;  2K5C A;  3OYH A;  2VQL A;  2VKD A;  1V0F A;  1U0J A;  2E1M B;  3K4K A;  4PJN A;  1QHH D;  2F5V A;  2W1O A;  3AFH A;  2L9S A;  1E43 A;  2W6I A;  4IQJ A;  4HWV A;  3DWL E;  3OWT A;  4DJA A;  3K4N A;  1VLY A;  3W2V A;  3A2K A;  2IGM A;  1W36 D;  2XF6 A;  2HZD A;  2CV0 A;  1H8E A;  3DKX A;  3FKJ A;  1O8H A;  5AMV A;  2NZM A;  2LRD A;  2HU9 A;  4NK6 A;  2JSP A;  2F6C A;  3ZIA A;  3H5A A;  2R7V A;  4FET A;  1Z21 A;  1FX0 A;  1DQU A;  4BJ6 C;  4PMH A;  3DTE A;  4OAY A;  4XKC A;  1KMH A;  3VWB A;  3S8P A;  4FXU A;  5KNL A;  1N75 A;  3GVK A;  3GRH A;  4D1Q A;  4E6K G;  3A4C A;  5HNH A;  3FKS A;  3H0D A;  2LOO A;  3LSK A;  1IDJ A;  1HA8 A;  1KZL A;  2KQR A;  3GQA A;  2R7S A;  5JHF A;  2V1N A;  3TL4 X;  1LDK B;  1NRK A;  2ZZQ A;  1BN8 A;  1JTA A;  2QX3 A;  1X4P A;  2O5R A;  3VDX A;  1X1A A;  2OUM A;  4CSW A;  2HPI A;  2JVH A;  2QKM B;  4LG3 A;  4YEL A;  2ZZE A;  2DT6 A;  3VYR B;  4OJL A;  3J7A Y;  2KRH A;  5HVQ C;  2NT6 A;  1BR4 A;  1HZE A;  1UD5 A;  2O0W A;  2UV1 A;  4DBR A;  2M5S A;  4CA0 A;  2XOK A;  2XZO A;  4U4B A;  2WA0 A;  2LRE A;  2DIE A;  4LIV A;  2JIZ A;  3OYF A;  2V26 A;  3DPU A;  2LBF B;  2VBE A;  4B3X A;  3OW7 A;  1D0X A;  4H4K C;  2KPM A;  4B3G A;  4HSR A;  2CUZ A;  4KJZ A;  4TKO B;  2M7A A;  3CP2 A;  3K6G A;  4BJ5 C;  3RQ4 A;  5CDF A;  1GQ8 A;  1O8E A;  2NTP A;  2V6E A;  3HC7 A;  3D5L A;  4Z05 A;  1JI8 A;  4YEJ A;  3W3C A;  2UWM A;  2AQF A;  4BE0 A;  4KKT A;  4U7B A;  1PJR A;  2QE7 A;  2CFO A;  3CMM A;  4G6T B;  1WJE A;  1EFR A;  2WJY A;  4C2T A;  1H80 A;  3PL8 A;  1PE9 A;  5DN6 A;  2NTB A;  3K4M A;  2CUJ A;  3OR1 C;  1W0J A;  3HL2 A;  3NWT A;  2XZP A;  3I9V 2;  3KRG A;  3SZG A;  2CV2 A;  1VBL A;  4BQN A;  1NG6 A;  2L9N A;  3L2U A;  4Z06 A;  2ZXH A;  3DQV C;  3K70 C;  2OC6 A;  2R7U A;  4BEH A;  4Y3O A;  4KIT B;  1WJ5 A;  2IS1 A;  4NNJ A;  3OYA A;  2V4D A;  3T9G A;  5HNF A;  1WJF A;  3OYL A;  3H94 A;  3EUH C;  3A3G A;  4XLC A;  3HPG A;  3HOS A;  4BE1 A;  2LZJ A;  2O1D A;  2E1M C;  2WY7 Q;  1I8D A;  3B4N A;  1DGR M;  4HEA 2;  3ZR8 X;  1N78 A;  2GK7 A;  1SFK A;  1N77 A;  1WPC A;  4YZQ A;  3VSV A;  2R7W A;  2AQE A;  3T56 B;  2O0V A;  2HDW A;  2X3H A;  4PJM A;  1MNE A;  2HVS A;  3ZXS A;  3SUC A;  3EQN A;  2BW3 A;  3M1C A;  5HKK A;  4B48 A;  4XQF A;  2VQG A;  2LYC A;  2VPL A;  1CZF A;  2R9V A;  2ZXI A;  1PXZ A;  4OZZ A;  1V5G A;  3D5S C;  2W7N A;  4J01 A;  4E7I A;  5C1C A;  3AKZ A;  3AL0 C;  1MMN A;  2DCE A;  2UVE A;  4BS9 A;  1V5F A;  4HIZ A;  4I84 A;  4RM2 A;  4PJJ A;  2IS2 A;  1D1A A;  2RQQ A;  1K6Y A;  5IK2 A;  1X19 A;  1D0Z A;  2VQH A;  3FPP A;  4P22 A;  3LSI A;  3I3L A;  1MAB A;  2X8K A;  2QXZ A;  1OR7 C;  4P1W A;  1OB0 A;  1MMG A;  1VJS A;  2VQC A;  4FAS D;  2HLD A;  2LY1 A;  2V9K A;  2F1M A;  1MW7 A;  1T5E A;  1VF7 A;  3A3B A;  4XMY A;  2NSP A;  2ZTN A;  3SEZ A;  2DJI A;  2E5Z A;  3DTK A;  4C2L A;  3RPU D;  1DP3 A;  1UAA A;  2UVF A;  1D0Y A;  1O8F A;  5KCM A;  5LD2 C;  1BMF A;  4HNT A;  2LG4 A;  3VSL A;  3B8Y A;  3VYT B;  3GBG A;  4JMQ A;  2R7T A;  4NC8 A;  2GJK A;  3G05 A;  3OOC A;  2XSJ C;  3EPZ A;  2VL8 A;  3KX2 A;  1UD8 A;  4CCJ A;  4BDY A;  2KL4 A;  2W82 A;  2GJP A;  3TBI A;  2KRC A;  3DDY A;  3GVL A;  4PUS A;  4XON A;  2HPM A;  3OPO A;  2VXZ A;  2WPD A;  2O17 A;  1IA5 A;  1OHH A;  3IP4 B;  3PNT A;  3OYI A;  3JU4 A;  4Z1M A;  2V7F A;  2PYH A;  2W00 A;  2VXD A;  4MLO A;  3K4C A;  1I18 A;  4DBQ A;  2LC2 A;  1UEL B;  2PMZ A;  3W2W A;  2X1D A;  2X6X A;  3VSK A;  4CCK A;  3L2R A;  3AL0 B;  2VAS A;  3A35 A;  2OV7 A;  3OYG A;  3GVJ A;  1OFL A;  1X0C A;  2HVQ A;  3OL3 A;  3OYB A;  3HUG B;  1BOB A;  2NOJ B;  2Z16 A;  1UD2 A;  3FY3 A;  1PKV A;  2VBK A;  4BDZ A;  3L2Q A;  3K10 A;  1O8M A;  2I8D A;  2VB6 A;  4Z03 A;  3GQ8 A;  3LMW A;  4ZTJ A;  4Y4R A;  4MXN A;  4D9J A;  3B90 A;  2VIX A;  4U87 A;  4AYB A;  4C9Y A;  4ZTF A;  1O88 A;  3EUA A;  3MKZ A;  2NT9 A;  4NC7 A;  1T0F C;  2X85 A;  4HG2 A;  1LKX A;  2A5W A;  4XLE A;  2KHM A;  3S3M A;  2ZTG A;  4C2U A;  4XN3 A;  4TSF A;  3LL7 A;  4W8R A;  3DTI A;  4BEH B;  2CMP A;  1PYV A;  2M4G A;  5FRN A;  3QYE A;  1O8K A;  1DBG A;  2FUG 2;  2JVG A;  5HLT A;  2HVR A;  3UR3 C;  4OWR B;  4OJP A;  2WSS A;  3ZPN A;  3DPT A;  4BJT A;  3BC9 A;  4XD7 A;  1IB4 A;  4BAC A;  1K28 D;  3ZGK A;  4ASU A;  2HQA A;  3BC8 A;  3OFN A;  3PFY A;  2ELJ A;  2MC4 A;  4ZJZ A;  4ITV A;  4RLF A;  3WQZ A;  2PYG A;  3UW0 A;  4B43 A;  1QU3 A;  4X0G A;  1ZEL A;  2K3P A;  3LNN A;  1OFM A;  2RRE A;  2CH0 A;  2GOX B;  1RMG A;  4XKW A;  1UG0 A;  2XDV A;  3IAM 2;  1NHC A;  3K70 D;  4BUP A;  2BW3 B;  4GRI A;  3HPH A;  4ZYA A;  5FRO A;  2ZZG A;  2ODL A;  1UD6 A;  2CW7 A;  1MMA A;  3BLY A;  3S32 A;  4QPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...