2VJJA

Tailspike protein of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN
total genus 232
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjjA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjjA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjjA02
2Z8GA 3B4NA 4XM3A 4MR0A 4Z03A 4W8TA 4XLCA 3UW0A 2NT9A 1RU4A 4HWVA 1QCXA 4YZ0A 4OJLA 1O8DA 4YZXA 3GQAA 1CZFA 1OFLA 4XN0A 1O8GA 4YEJA 1O8EA 1PLUA 2NT6A 3VMVA 2VBMA 2IQ7A 2VJJA 1O8KA 1OGMX 4XORA 1KCCA 3ZSCA 1HG8A 4YELA 1BN8A 4MXNA 3KRGA 1WMRA 2X6YA 2VJIA 2O1DA 2QX3A 2X6WA 4NK6A 1O8MA 1RWRA 5C1EA 2BSPA 4EW9A 4OJ5A 3VSUA 4OJPA 2X3HA 3WWGA 1OGOX 4XOTA 4W8QA 4Z05A 4XLEA 2VBKA 1JTAA 2EWEA 4U49A 4XKWA 4W8RA 4OZZA 2VBEA 1K5CA 2QY1A 1IDJA 4XONA 1O88A 4PMHA 3VMWA 4NK8A 1GQ8A 4I84A 4OJ6A 4XLHA 2O0WA 2NSTA 3GQ8A 2X85A 1XG2A 2NTPA 2QXZA 2NSPA 4OJOA 1O8IA 1NHCA 1AIRA 4U4BA 1EE6A 2UVEA 3GQ7A 5AMVA 1VBLA 4XLAA 2UVFA 4W8SA 1JRGA 4OZYA 4AVZA 4XOPA 3LMWA 5C1CA 1O8HA 4C2LA 3GRHA 4XQFA 1O8JA 3EQOA 3EQNA 1KTWA 4XR6A 1OFMA 2ODLA 2PYGA 1O8FA 2O04A 2INVA 1DBOA 4XLFA 2PYHA 2NTQA 2O17A 3B90A 1RMGA 1BHEA 1IB4A 4Z06A 2NTBA 3B8YA 1KCDA 3SUCA 4XNFA 1X0CA 2INUA 3FY3A 4XL9A 1PXZA 4YZAA 1PE9A 3GQ9A 4XN3A 2PECA 2X6XA 3JURA 4YZQA 1IA5A 3ZPPA 2O0VA 1IDKA 1O8LA 2NZMA 4XMYA 1DBGA 1H80A 3T9GA 4URRA 3VSTA 3VSVA 4XKVA 1OOCA 1QJVA
chains in the Genus database with same CATH superfamily
1SD6A 1MBHA 1ZAOA 1SEUA 3S2DJ 3DKYA 1LDDA 2JK3A 4TV7A 1RU4A 3DLAA 5D5UB 4E7LA 2ELJA 4YRVA 2VBVA 4EEFG 4ITVA 1FWZA 1A8PA 2AS5F 1QPIA 1CZFA 4E6KG 4AC9A 5E3OA 3WG9A 1CLWA 1Z7UA 1O8EA 3LA2A 3OY9A 1YG2A 2PG4A 1ON2A 4LLGF 1YO5C 2KIQA 3VFZA 3OKXA 2ZXWH 4HQMA 2HVSA 4N9HA 3G05A 1VQ4B 1TQMA 4B4CA 2AO9A 1DUXC 3HOUJ 1P4XA 1GVHA 3HL2A 4JX6A 2V31A 3ZC3A 1YJNB 4D0PA 5J3OA 3HTSB 3CTAA 2ESHA 5DEQA 3L2UA 5GTHC 2XPWA 5A2QZ 2JA6J 2KZVA 5KHDA 5F08A 3HOWJ 4UVCA 3ABTA 1K78B 2IA1A 1JUPA 1USSA 2AQEA 3ECOA 4U87A 2K3PA 1OR7C 1B8IA 4HSRA 1PJ5A 3QFCA 4A69C 5JR3A 1UD6A 2L5QA 2BSAA 3ML6A 2VBXA 4WQMA 2HGCA 4AIDA 1D3YA 3DDYA 4TN1A 3ZMUA 2IVMA 3K6GA 1X4OA 2OC6A 4O5VA 1Y56A 2Q2EB 1BC7C 1JTAA 1Z1DA 3BCFA 2MYSA 3BTJA 3ZZUA 4G7WA 2QUFA 2DYSH 1IJEA 4I98B 4P1WA 2EK5A 1RETA 4NHJA 1FOKA 3GTOJ 1E1QA 1RQPA 1ZLKA 2L4AA 4ZJZA 2V6EA 1ZR4A 2H6CA 3LVBA 4ZGNB 2M34A 4GYIA 1OFDA 2PIAA 1XSVA 4HDVA 1G7CA 1XFOA 3DCFA 1HVXA 2O7OA 2E2HJ 1EE6A 2WC2A 3DTEA 3V42A 4HF1A 1PUEE 3HZJA 2WY8Q 5LFAA 2RC5A 2OTJB 4DYRA 4ENKA 3O8HA 2QA4B 4R1HA 1WZ2A 1APLC 2IT0A 4B3XA 1WJAA 1R5OA 3GO5A 3TL4X 2MA3A 1FLIA 4KKUA 1K78A 3CJNA 4HX4A 4FE4A 1E3HA 5GP9A 2LBFB 3A1YA 4BYYA 3IAS2 1W0UA 2IOUG 2DJIA 3K0LA 1N08A 2FMYA 3EETA 5ILUA 4M4SA 4F7DA 1BR2A 2EFWA 2VNKA 1MBJA 5ILSA 4DGWB 1K4ZA 1YS6A 5A89A 1LDKB 1IF1A 1K28D 3WBKA 2BM7A 2M1BA 2DAOA 3EQLF 1A36A 1JHHA 2J5PA 5D5XB 3I59A 4LK0F 2R93J 1VQLB 3G71I 1VLYA 1ZM3A 5B5EC 1R5NA 2CBXA 1C0WA 4QHYA 4ZZDA 1KZHA 1N0UA 1I3AA 3CUQA 4C2TA 3LSHA 2WR8A 5IK2A 3AVYA 1N75A 2WBMA 4MYUA 4YDTA 1XDSA 3HSEA 2ICWG 1FC3A 3SZPA 2QYUA 4OJ6A 4Z03A 3IKVA 3QQAA 1IO2A 4M3FA 3KCCA 4XLCA 2PLYA 2BW3A 2DEUA 2XB0X 5F4OA 2KIFA 2OUMA 4NDLA 1I7PA 5EEAA 3VO1A 1VQ5B 3MZHA 2CC2A 4RM2A 3K1NA 4OMZA 2H1LA 5AIPA 2K85A 3WU2C 1S7OA 5K7FA 5EEHA 1K6OA 4YG2F 4IRHA 4YIFA 3NWTA 1CGPA 4U88A 4OIPF 5J4YA 3WYAA 1SFUA 4NB5A 1I8DA 2A69F 2XPVA 3MN2A 3F8NA 3U2RA 2V1XA 3LFUA 4B43A 2C78A 4A3GJ 2QWWA 1OGJA 3IWFA 4FT8A 4V19K 2VOOA 2H27A 2QX3A 1VNDA 1IDZA 3E7LA 4D7MA 1BW5A 4N4OB 5EGOA 2X9DA 2Y69H 2A3SA 3C7JA 5E8GA 3RJPA 4EGZA 1LE8B 5IY5H 2F4NA 2CRGA 1M90D 2YSRA 2A6HF 3OYJA 4UZUA 2VPLA 2BVNA 4Y7NJ 1DPUA 1NTCA 5IYWA 3CCRB 3CCUB 4GQNA 1V54H 2VBKA 3BY1A 3BCAA 2E35A 4IOAF 4DIQA 2V4DA 4MIMA 2XAHA 1YIJI 4JQFA 3I0TA 2R9VA 2QY1A 4IEJA 3L2VA 4OP7A 1D0YA 1YW7A 4M74A 1YI2I 4I84A 2A68F 3KZZA 2XZLA 1OFCX 3V8JA 4OJOA 2DFFA 1Z6TA 3I58A 2M30A 3KYDB 3CMAI 1JT0A 1K6YA 1S5LC 2O5RA 1D5VA 2JT1A 2HDDA 2HNHA 5GAHJ 1I6HJ 2XASA 2DFEA 2DYIA 3ERMA 2HYGD 4LC0A 1O8HA 2JWTA 1UELB 2R7DA 3OS1A 1VQPB 4IW3B 4DW6A 1GT0C 4Z4YA 1J2XA 5HVQC 1FNDA 3MMPA 3DPUA 1UHSA 5HS9A 4N3NA 3WU0A 5ICEA 1WRJA 3GX4X 2CO5A 3ONYA 4G6DA 4MQVA 1LFPA 1XB2A 3HAGA 3S1NJ 5JFRA 2ZTNA 4DK0A 3CC4B 4K1XA 3K4MA 1STZA 3BR2A 4PC6A 1HBXG 1U0JA 3QAHA 5IYDJ 1P7JA 1BMFA 1SKYB 1GDTA 2VT2A 2BX6A 1KCDA 3OS0A 4HEA2 1Y1WJ 1BR1A 2Q1ZB 4WK8F 3A35A 5CDFA 3KEQA 4UHTA 2P8TA 1BA5A 1MKMA 3H1CA 4PJNA 1IA5A 1ERDA 3ZPPA 1XSDA 2G0EA 5E3NA 1KK2A 4G9YA 1VI0A 4B44A 5FKMA 5F0HA 3CCSI 4EGYA 2CF4A 4URRA 2BZTA 1N8RD 1H8HA 1VQNI 3OOCA 2Y30A 1JB9A 3TOBA 4RB1A 2WAQA 3HRUA 1ZUNB 2VQCA 4DNRB 1QCXA 3K4CA 1TT0A 2VFMA 2CMPA 3L2RA 4OJLA 5IYPA 4D7NA 2AHQA 1W87A 3IAM2 3RDIA 4FQGA 5DS0A 3GTLJ 1HA3A 2FUG2 3BH6B 2MSYA 1WHUA 3D0SA 3WTVC 4A3CJ 2FQ4A 1NG7A 4TMTA 4G94A 1Z05A 2YU9J 2C4UA 3EUHC 1L0OC 3A03A 4OPOA 2CQNA 3W5VA 4V02C 5CVUA 2KJCA 1ETXA 3GTQJ 1Y6IA 3AG2H 3KRGA 4BBSJ 5FKLA 2FBKA 1Y0YA 2XC1A 3WG7H 3QOPA 3B73A 1QU3A 2ZJQF 4X8IA 1WJFA 1W2BB 4GO1A 3CPWB 4JRAC 1VLOA 3FX3A 3KLNA 1BX0A 3QYBA 4HE5A 1I6XA 2MABA 2COMA 3KP3A 2F5DA 2EIJH 4P55A 2PBIA 1YOVB 4IRIA 3GVAA 4L5JA 3NE5B 3S32A 1E2XA 3OW2B 2CUJA 2MW8A 3C2HA 1I18A 1WQ2A 5EZHA 4I02A 1HW5A 1O3TA 3T51B 4RB0A 2KJBA 1HC8A 2XTXA 1LFUP 4BQQA 2ZL5A 4FX4A 1W36C 1IDJA 2HXIA 2RAEA 2XGXA 1CQXA 2IBDA 1ETQA 2NRAC 4LG0B 3A8IA 5L3BA 2X85A 4RCYA 4X0GA 1OB2A 5KAIC 5TRDA 2GJKA 2DQRA 4QTRA 5DCMA 3Q0UA 3CDIA 4JOMA 1GUUA 1VQKI 2M45A 4A3LJ 3MEXA 2DJNA 2Y75A 2ZJRF 4A6EA 2DOFA 4YAOA 3KYCB 2YU3A 1YIJB 3GSIA 2X0LA 2MGQA 3RIRA 4IVNA 2IJLA 3T5XA 1X4PA 4P6VF 3PNYA 3GMEA 3W6KB 2HOEA 5EYRA 3H3UA 1GJRA 4EJUA 3U6KA 2DETA 1WOSA 1LNWA 4CUGA 1UZCA 1JTYA 2JTVA 1PKVA 2PYHA 3GVJA 2VB6A 4AYBA 1EV7A 2BEOA 3HHHA 1Z3YA 2ISZA 5FL7A 2XSJC 2HQRA 2P6SA 3GFIA 4ROXA 4BUPA 5J1UA 2MLGA 3AL0B 2O6WA 5A8AA 4Z6YA 2IA0A 1XQBA 3QE2A 1POGA 1QVFB 3TOAA 4XKCA 4C3HJ 4LBZA 2HVRA 1HSTA 3I5UA 4G6TB 4RGUA 3RPUA 1EZGA 4ENJA 1FNCA 2D5VA 2F4MB 2VFQA 1S6LA 5DM6F 2PLFA 3LO8A 2CW5A 3VMFA 4OIQF 4YFOA 1FNBA 5JHFA 3CESA 2GIVA 4AYBN 3AK5A 1R6RA 2B7CA 3BR6A 4FE7A 2V9VA 1U9NA 4A6DA 4C9YA 5K5QA 2DI3A 1KU9A 3DU5A 3I53A 5EGOB 4HWVA 3H94A 4I99C 3GQAA 2O3FA 1JGSA 2CV2A 1IRXA 1IN7A 1IN6A 1M1KD 3ZBTA 3J81K 3WTXC 4AM3A 1KK0A 1KMHA 1HQCA 1P4AA 1KQSB 4M71A 4E4HA 2OF7A 2DOEA 2ADUA 3OIOA 4ZYAA 2K7LA 2UV1A 4D5FA 1JGGA 3JR9A 2GREA 3AVVA 1MBFA 5LEJA 4M9SA 2DT7B 3G4SI 1JA0A 1BN8A 1AU7A 2R7FA 3OYCA 4BQAA 1OCCH 2EJRA 1K8FA 1NDHA 1FX7A 1ZTRA 4BY7J 4JX5A 2K9LA 4C3IJ 1SAUA 3F6VA 1ZGJA 3BR3A 1SD5A 3BPXA 1R1VA 1X3WB 3FDYA 4C30A 4HQEA 2GPJA 1QNTA 2VFOA 1LE8A 2JN6A 2K40A 2ZC2A 4OU0A 3VPRA 2LVSA 1UMKA 4C43A 2R7TA 3G4SB 1UD8A 3CCEB 2OK8A 1OCZH 2VL8A 4PC2A 1U2WA 3PUBA 4QIWN 3KP2A 4BKXA 3RI4A 2CV0A 3IWZA 2H09A 2HPIA 5AIQA 4ZZLA 1JKQC 5JVTA 4ZTJA 1QQ1A 2GXBA 1WJBA 3O2PE 1ZRFA 3OYAA 2A05A 1R7JA 1TBXA 4G12A 1JT6A 2BV6A 1MRZA 4MO7A 5GADJ 2PN6A 2Z3YA 2EIMH 2QA4I 1F20A 2LTPA 5ED4A 3AAFA 3MZYA 1JHFA 4LGWA 4OZZA 3SQNA 2WSSA 2W6IA 3EYYA 2P7VB 3CCJI 1MSEC 2O6GE 3ELKA 4F93B 1ETWA 5J4VA 4CGZA 3E97A 4CH7A 2R7UA 3LOCA 4TMWA 5F6FA 4DYQA 1FP2A 3SZTA 3F72A 2PX9A 5C1CA 3T0YA 1V0FA 2X51A 3IKTA 2RQPA 1J09A 3FJOA 5D5WB 4FWTA 1D8TA 2M0CA 3CCMI 3AVXA 4M6YA 5E1XA 4XR6A 3Q6QA 3EQNA 3AG4H 2DIEA 4RM0A 1WSUA 3GBGA 4FISA 1I1GA 2L54A 2NVUB 5FKNA 1YTYA 5HXBA 2D45A 2NTQA 3LAPA 3B90A 4OPSA 1P92A 4BQOA 3U6BA 3J81Z 3RKYA 2Y9ZA 1R58A 4NBQA 2VBTA 3SJPA 4NNJA 5IT3A 4PGOA 1FRNA 5GV8A 4R8HA 4G7HF 2E19A 1T0FC 3C3WA 4OM9A 4Z06A 5DCFA 1SFEA 3SLNA 2IW5A 3LSKA 4HNVA 3FZVA 4Y9RA 1YJNI 3Q3AA 1OISA 1S29A 3OYEA 4A5NA 4LFUA 2CW8A 1OYWA 1U5TC 3BLYA 3ONQA 4MTEA 5FB2A 1PE9A 4JP0A 4HZFA 2CG4A 2EV5A 1FTTA 3S8PA 5LLQA 5K7ZA 3GVKA 2F5EA 2ZFUA 1W36D 1XX5A 2Z9OA 2JUCA 2IEKA 1IHMA 1T6ZA 4XRSG 3OP1A 2K3FA 2V7WA 3FM5A 5HNFA 2D3LA 2XT2A 2XSDC 4UB6C 2KFDA 2ELKA 3E6DA 5HDGA 4KMFA 1KK1A 5HDNA 1WORA 3CCYA 4OIRF 3RY8A 2R7WA 4I76A 4V2FA 1LEAA 3ZN0A 3H92A 1R5BA 4Q7JB 4MTDA 3CC7B 3GFLA 2VPRA 3BTIA 2HOAA 4DZJA 1TVCA 2WJYA 2Y48A 4BJTA 5F1JA 4B47A 2Q2EA 2E2JJ 1Y8RB 1WI3A 3LAJA 1S0UA 2HCJB 2G9WA 3B78A 4CDGA 4O3MA 5LBQA 2NOGA 3CZ6A 5FLVA 4P9FA 4Z4RA 1VJSA 4P22A 2O1DA 3HBLA 2ME0A 2DW4A 2FRHA 4HPQA 4ZYHA 1EP1B 5C1EA 1ETKA 3BZKA 4PZJA 3I64A 1YHQB 2JIZA 2VXDA 4M73A 3F3XA 2XNDA 5TGTA 3VODA 3V76A 5CLSA 1R9TJ 3GYHX 3ES9A 2JRTA 3K4LA 4BNCA 5L46A 3DPTA 2CUEA 3L00A 5E1ZB 3TBIA 1QVGB 1IXRC 4W8QA 1GHCA 1O3QA 4B3FX 2XGEA 3KIOA 4ENMA 2H94A 1VTNC 1F4KA 2GJRA 4IF4A 1FRQA 2NV4A 2N8GA 4FN5A 3K4JA 1ACIA 1R5ID 1MMGA 1Z67A 1MBEA 1UHMA 5E3LA 2L9SA 2PMZA 1ETVA 4M3GA 4IHTA 4P12A 3JSPA 2KISA 1TC3C 2VONA 2KKOA 2DO7A 4QPOA 5L3DA 2EILH 3IL2A 1NK2P 1DABA 3M1CA 5IPAA 2I8DA 4IHWA 4P6YA 4BXXJ 3CDHA 2QTZA 4EQQA 4II2A 3VOEA 3HTUA 3L9FA 5D8LB 3BY2A 3ECHA 1XPXA 1JRGA 3T1BA 4XOPA 4ZYDA 4LIUA 3RKQA 3ZZ0A 4E7HA 3F0CA 3B6CA 1AKHA 3ZPLA 4PDKA 3K9TA 3F23A 1H88C 2DA6A 1O8JA 1QQIA 1Y0NA 5M5XJ 2WADA 4CO8A 3E5QA 1DDIA 3QYFA 2DA4A 1RZ4A 4Z1MA 3OMYA 2GA1A 2E7WA 2QQAA 2LSOA 3G2BA 1USTA 3OYKA 2XC7A 4J0QA 2G7HA 4KIGA 4EATA 1X2NA 1Q81D 5CQGA 3BG9A 1WH7A 1SFXA 4EM2A 2RC6A 2LMDA 2IA2A 3WNCA 1REPC 1HA8A 1P4MA 2R5ZB 2XOKA 3JTHA 3V8KA 2K9MA 3TQNA 1X1CA 3SYTA 1OCPA 3VWBA 1AIPA 3G3ZA 1KYWA 4Z2YA 3FY3A 1VQPI 3L1PA 4DQLA 1BIBA 4F7ZA 4ZCMA 3PUMA 2JN9A 1YW8A 5D4SA 1MH4A 4M3EA 2IS2A 1UJ8A 3IH2A 3ZMZA 3DBHB 1FZPB 1XMAA 3SQVA 4BE1A 5F4MA 3I71A 4XICA 1ZR2A 2HZDA 2LC2A 3ZIAA 1QRCA 2R3SA 2F48A 3G1OA 5ERIA 1YX3A 1KONA 1KJZA 4W8TA 1GVDA 1VQ9I 2OJED 4G7ZF 1VQOI 3A4CA 4KICA 1BBYA 2QQ8A 2R7QA 3AG3H 1HF0A 1S8NA 1V0EA 3KYLA 2ZO4A 1HKSA 3BTLA 2OQRA 2ZMEB 1QHHD 2JVGA 3DKXA 4IXAA 3L2WA 1OFLA 2PEXA 3FXUA 4A3IJ 4YEJA 5L3GA 3NB2A 3SY2A 3WODF 3Q0VA 1IRZA 3K1MA 1R00A 2A6TA 2R92J 1T6XA 3VMVA 3VDXA 1LM1A 1OCRH 2VI6A 2VJJA 3OYHA 1X1BA 1I39A 2E1OA 1OFEA 4XORA 2O03A 2IGMA 1W0KA 2VFNA 2BOLA 2Q0OA 4ETSA 1JTXA 5C4XJ 2PMDA 2I10A 1QX4A 2EINH 2F3LA 1O3SA 2V1DA 3CD6I 2M8EA 4Y13A 4QLCU 2OA4A 4YAWA 5F64A 1S7AA 2BGCA 5CPRB 4U7DA 5M3FJ 1SC7A 3HC7A 3A01B 5J47A 4KITB 3M07A 1Z9CA 2LDUA 3OOUA 5L3FA 2Q6OA 1HLVA 1GAQA 5H6QA 1JNYA 3EDPA 2V1NA 1XG1A 2HXOA 3KP6A 1HW2A 4G7XA 1WXRA 5JLVC 2ME6A 1E62A 1HXDA 3Q9SA 4RM3A 4RCZA 1N25A 3BTCA 1FTZA 3GQ9A 3W5UA 4UUTA 2LNBA 1TTTA 2NVTJ 3CMYA 1ORKA 3BQYA 1ZKGA 4XKWA 1VQKB 5F1RA 4PJ0C 4EJTA 3Q39A 1RKWA 3G1MA 1E79A 2DCUA 1O88A 2DODA 4WZKA 1H9TA 5F4JA 1WI9A 2HKOA 2XDVA 1J7KA 2V9KA 2NSTA 5FD5A 3GTMJ 3LQRA 1DP7P 3IRRA 1T98A 3OS2A 5FKKA 3CLOA 4IHVA 1T39A 1ZQ3P 3CJTB 5BPDA 3F8CA 3FM3A 2IRFG 3ZQFA 4RMNA 3KP4A 1P4WA 4R79A 1IV8A 3LSRA 1G6NA 1R36A 3RZOJ 1OKRA 4E7JA 2CNDA 4I0AA 4OOSA 1K4SA 3EQOA 4RS8A 1KTWA 4GDFA 3RPUD 1IGNA 2PYGA 4P96A 1ZG3A 2R4GA 5EDNA 1PP8F 2E1BA 4DQKA 4YEIA 1ZLJA 2KDZA 4XLFA 5IYBJ 4ZV4A 2ZSIB 1DDGA 1X1AA 2DA7A 3I4NJ 3RCOA 1B9MA 4Z4WA 4CCKA 3AVUA 4IRGA 2XKPA 4RAFA 1OMIA 1N0VC 2QEXB 2D74A 4AC0A 3DEWA 4L9NA 3Q3SA 3VSLA 1BI3A 4CZCA 5AN9A 1PJ6A 1A6QA 2JZYA 2DT5A 4OOIA 3FHNA 1BHEA 1GLNA 2B7EA 3SEZA 4BGDA 2DXIA 3WTYC 4DQ2A 2E60A 3BG5A 1GV5A 4XRMA 2OTJI 4YZQA 4PFOA 2EPFA 5TJJA 4XMYA 1EJ9A 3S2HJ 1FX0A 1PVEA 1EFTA 4F55A 2P0WA 1MDMB 3R6SA 3DXJF 2ZZGA 2P4WA 1FSHA 2FBIA 1FT9A 3I55B 4XM3A 4FASD 1V55H 2BPOA 4MR0A 4FXUA 3HRSA 2XPUA 2JJ1A 4HV6A 2V7QA 1CF7B 3GXOA 2G7UA 2Q6IA 3ABKH 4YZ0A 1O8DA 4JK1X 2JQ7A 2DMNA 4ESBA 4WF2A 4EH1A 1D1AA 4UVAA 4RLFA 3HOXJ 2HKXA 2MBFA 3B6AA 1U2RA 1B72A 1E3ZA 3ZQIA 3QPTA 4HE6A 2VJ5A 3C18A 4JX4A 3A1PA 2VBMA 4BBRJ 3MCAA 1AWCA 2V7XA 3SJZA 3GIRA 1QFJA 4RD6A 1A6IA 3JAMK 1YW9A 3P5JA 1GXQA 3S3NA 1KK3A 5F0CA 1T2KA 1SMTA 1WOPA 2B5OA 5C3EJ 2F5CA 3W2AA 3M1EA 3QPSA 1OQYA 5E3MA 3FHZA 5EMNA 1T33A 4I0BA 4UUSB 3OYMA 2OZ6A 2FF4A 4PJLA 1L3LA 2IPQX 4QFMA 1IV6A 4L0YB 4Z05A 1W5SA 1QA1A 3U9GA 2LFBA 3I54A 2QSGX 1IUYA 4G6IA 2QGGA 2LY9A 3S1QJ 5DTDA 3NRVA 4ZTFA 2PI0A 4PAAA 2XF7A 2GLOA 1HDPA 4A3MJ 1G3SA 3VB2A 1N07A 4QSHA 4XRSA 1MH3A 5H59A 3LSIA 5LGNA 2ID3A 2V4JC 2ZKZA 3HRMA 5FFZA 4LG0A 2DMPA 3CMAB 1UMQA 1K5CA 1EWYA 4IZZA 1XS9A 4KKTA 2O0WA 4L18B 2W84A 3FPPA 1YI2B 2MD5A 2QKMB 3L7WA 4WX9A 3CUQB 3EYIA 2L01A 2DOAA 3H5NA 2HDCA 1S4MA 1TYVA 3KETA 3CP2A 4I7HA 3Q5FA 5D8KB 3PO3J 2E5ZA 2BBYA 1MW7A 5B3SH 5IOYA 4PCQA 5H6RA 3ZQ7A 3R4KA 2W6JA 1NG6A 1BM9A 3H5AA 2CU7A 2WAFA 3G1LA 2EB7A 5J8FA 3J7ZI 2K5CA 4L9TA 1TUIA 1ULYA 1PUFA 1U9OA 3IH3A 2ZL6A 3AGQA 4JMQA 2WJVA 4AVPA 2DQLA 4U0VA 1BJAA 4XBFA 4RBOA 1EXMA 2HWVA 2P3MA 3CCLB 3HG9A 5HLTA 4RD4A 1IB4A 1IJWC 2DPUA 2MG4A 3QFTA 3OAAA 4ACBA 1DGWY 1R49A 2BY0A 1U5TA 1VHOA 1W9XA 1Q1HA 2PMZN 3HM5A 3HGYA 4RLQA 1W34A 4N9IA 1YLOA 5C4JJ 3BT9A 2F1MA 1VQ8B 2BHYA 2DA2A 3JCUC 4EJOA 3AGPA 3DEUA 5HLIA 2Z6BD 2GXAA 4RGXA 2ZL7A 4Y7CA 2HYJA 2DLLA 3W2FA 3F8BA 5A2QK 3WHBA 1X1PA 2B7BA 3WBJA 4CCMA 3TDZC 3DU1X 1BJKA 4DNTB 3ASRA 4H4KC 2EA4A 2ZBVA 1V5EA 2MH2A 1J0RA 4W1UA 2YX4A 1X1DA 2BE5F 4CCNA 3OZUA 1QRBA 1QA2A 2VNIA 4NQWB 1A5JA 2LP0A 2RQQA 4GFBA 3A01A 1ZARA 5LRSA 3N4MA 3TP3A 1WOOA 4PC1A 3LSJA 1XB4A 3MD2A 4Z4ZA 3VNUA 3GW2A 2A07F 4E7SA 4RGRA 4UZEA 1EP2B 5FROA 1TLHB 1LPQA 1GO2A 4FETA 2HYFA 4YAFA 3V7RA 1DQUA 3KEYA 1IG7A 3H36A 3CRZA 2GOMA 3E6BA 1PUFB 1UD3A 3E1YE 1TLLA 3AVTA 4G1VA 2E1NA 1VQLI 1H8AC 2MFZA 4UZFA 2BVMA 1OGMX 4RJLA 1T5EA 2CQQA 3QPHA 1G2HA 3HSRA 2ZBKA 2EBIA 5BSXA 3JSOA 4QUZA 1W7PA 3FMRA 2M3AA 3JRBA 4QVAA 5KW9A 2VT3A 2VJIA 3KE2A 5GPCA 4E7ZA 3ZQHA 5KSWB 3B82A 1UHWA 2WB1N 2Z1DA 4HNTA 2BM5A 4ZDOA 3ASSA 2VXZA 5HODA 3HHGA 3K70C 3CJQB 3GUDA 5E17F 4X7DA 2V5IA 5EF6A 1G3TA 2BM6A 3SZEA 4B3GA 1YFHA 4YC5A 5LHHA 3N90A 3WWGA 4XOTA 1KGSA 3RKWA 2D1VA 1OHHA 4IPAA 4F52A 1TWAJ 2KRFA 4EJVA 1B23P 1YE9A 3CF5F 4X7CA 3AKZA 2L0KA 4KA4A 5TISC 1QGAA 1ZELA 3H5RA 5KCMA 3OE7A 3HOYJ 4DJAA 2DERA 2FOWA 5IYCJ 2LF7A 1GQ8A 5JLXA 1U3EM 1OCOH 2Y9YA 2F4OB 3NQOA 1FNMA 2HI3A 2NSPA 3OOPA 4O6JA 2ZNZA 2KMUA 3GFMA 2VNJA 4FCYA 2HQAA 3P26A 4RAGA 2XNJA 1IB0A 4G7OF 1N77A 2O61A 4KT5C 4OAYA 5IP9J 2XF6A 3TO6A 1SVMA 1K9MD 2UUZA 3SDGA 1G4DA 3GZ6A 4II3A 4YCQA 3I4MJ 3E3VA 3EPZA 3D5SC 1V5FA 2EFOA 4IHYA 2L4MA 1JA1A 1R4MB 2R6HA 3QFRA 1HZEA 3HIFA 4X6AJ 3CF2A 3TEDA 4M0LA 1BOBA 1QUFA 4RDUA 1OYYA 3WGHA 1KQ9A 3TW7A 3K10A 4BACA 1QA6A 1O57A 1RMGA 3OFNA 2TRTA 1BOAA 2X1CA 4OIOF 3S16J 3CMEB 2BV3A 2QQ9A 3ASQA 3OYBA 5BS6A 2X4HA 2NTBA 1GV2A 4ZYGA 1VQ4I 4WWCA 1CNEA 2ZSHB 2IS4A 2QZAA 5B6IA 2LRDA 2F2EA 4BHPA 3K2AA 4EMSA 1RQRA 2EQRA 1QH0A 2M4GA 3ZCOA 2M9HA 3ZOBA 4ZH4F 1W1WE 3DWLE 2FQ3A 2ZB9A 3CC2I 2AHOA 2L3DA 3V7AA 2PECA 2ZZFA 4PK4A 4HDUA 4HV5A 3GZNB 2O0VA 1O8LA 4IO9F 1H80A 3EUHA 3ULQB 2PMHA 1D1BA 3GEZA 3MKWB 3KEWA 3WNDA 2DDBA 1OOCA 3IUOA 3KZYA 3A2KA 4EVIA 1FEXA 5IP7J 1UCRA 3QRFF 2JA8J 2FOKA 2BN4A 2ZBUA 1BI0A 1NB0A 3UW0A 2X48A 4HRIA 3K4BA 1H89C 3LA3A 4YIRX 2FJ1A 1I3QJ 1Y39A 1HCRA 2C4TA 4YZXA 2HEOA 3HJEA 3H09A 3JRGA 3N6ZA 5DS9A 2DA3A 2TCTA 3PVDA 5E6TA 2RV8A 1G3YA 4U0YA 3SKBA 4HLYA 5FO5A 3FMSA 2VBZA 3WE2A 1N78A 4ENNA 1WP6A 4E7KA 5L3CA 2WPDA 5THXA 1KCCA 2XUBA 1BLIA 2QCOA 3JAMZ 1N05A 1R1UA 3SDBA 1MNMC 1QRYA 2O8XA 1LVAA 3CJRB 4L9VA 4C0SA 4KUMA 2H6BA 2HZTA 4OWRB 1VQ7I 2HS5A 1TYXA 4RGSA 2CWEA 3L2QA 2E34A 3R60A 3PNVA 4MLOA 4ZC3A 3IV5A 2R7XA 1LB2A 3HKZA 4OINF 1TP4A 1FOXA 3HXLA 3OL4A 5LD2C 3DTIA 3GQBA 4XLNF 4M3DA 2ZZEA 2B0RA 1P2FA 3FIWA 2JRMA 3PFYA 2O9LA 4W8RA 2YWFA 5LHIA 4ZDLA 3FKSA 2M0MA 3NWSA 2UXXA 4XONA 2ZZQA 1TW3A 5FFXA 4ABZA 1O4XA 2M8GX 1MD0A 2BXYA 1QFYA 3CCQB 3PQKA 3GVLA 1K73D 4PSXA 1SAXA 1WJ5A 4ESFA 1AIRA 2KLOA 3W2GA 3MQ0A 2OK7A 4BE2A 5AMVA 2CK3A 4IQ4A 1COWA 4W8SA 1MMNA 2JPBA 2NNNA 1UG2A 2EZHA 3HPHA 3OL3A 3U1KA 4H0EA 1QBJA 2LKXA 2XZOA 1S72I 2CW0F 1Z91A 3BJOA 1OYIA 1J75A 3MHPA 1S72B 4C2LA 4TKOB 1TZLA 1WTHD 5IYRA 1B8IB 5J8CA 1Q82D 1XDUA 1TQPA 4BHBA 1JKOC 3E20A 1FY7A 1I1SA 1E63A 3U1DA 3BJ6A 4QVJA 2B9SA 1X19A 3KZIC 2VBYA 3HKZN 1HF2A 3REOA 4QV2A 2VKVA 3A8KA 2L9NA 3JRHA 4HF2A 4X05A 1S3JA 2FU4A 1V5GA 4YIIA 1XN7A 1FBQA 3LWFA 1Z6RA 3QYEA 4CSWA 2KHMA 1JI8A 2W85A 3HOVJ 1F43A 3HUGA 4HF0A 2JJ7A 4Q5SF 4U0WA 4Y33A 2E7XA 3E0JB 1VQ8I 1F60A 2Z33A 4TT3A 3ASPA 1B9NA 5HS7A 3M8EA 3FMQA 4UV9A 2EIKH 5DYMA 1SMYF 2X6XA 3ZUGA 4Y52J 3IP4B 3CW2A 1VF9A 4OOVA 4X07A 4OPWA 4FHTA 2KIMA 1R23A 4BAYA 5M3MJ 3SEQA 3VSVA 3LQEA 2GM4A 2GWRA 2F1LA 1FIPA 4GYGA 2CV1A 3MMYB 2AQFA 3FK7A 3PSZA 1WJDA 2OYNA 1D0XA 3S1RJ 3OV8A 3FXKA 3RQIA 2COBA 4LLNA 4HX8A 2DPDA 4CCOA 1OGIA 3NEUA 2W4SA 3MZ8A 3H0GJ 1BIAA 1ZHFA 4E0FA 5K5OA 4D5CA 1JJ2B 3VNVA 4Z4UA 5CJ9A 3DP7A 1X3UA 4AIKA 5BNGA 4YALA 2EV6A 3MAJA 1U6GA 3IHUA 3B8HA 2MD0A 4PGHA 1WMRA 5CQEA 4Y17A 1XCBA 4KN7X 1BN5A 3ZQCA 1D5YA 5EJCA 2QDXA 2KT0A 3HOSA 3FBNB 3OJXA 1X3ZB 2VKDA 1RUOA 4OJPA 3C2BA 2QENA 2QSHX 3PA1A 1LLZA 1YLFA 2YWEA 1X58A 3I59B 5JBQA 3GF2A 2ZTGA 3LQ6A 2LR8A 3CO6C 4M72A 1KTVA 1IXCA 2PE3A 2ISYA 2K27A 3E1SA 3LSGA 2OBPA 4WXCA 3SJMA 1MMSA 2I1LA 2XROA 4YFKF 1FMVA 1CF7A 2M5WA 4YAUA 3MVPA 4I01A 4OOXA 2YPRA 4XLHA 5JHUA 2DTRA 3J80K 3J80Z 3GQ8A 1MBKA 2X53S 4HSTA 3CUOA 2QQBA 3V8LA 5LGUA 2UZKA 3I1FA 3CCVI 3QP6A 1JXSA 3W2HA 1IAWA 1HOMA 2PQ8A 1YRNA 1ZYRF 1VBLA 1O7LA 3TKYA 2XHKA 2ZCWA 4F91B 2EFQA 1LLWA 2VFPA 5KVRA 1ZRDA 1LVKA 4BY1J 1WWXA 1EH7A 5E18F 2QTLA 2ECBA 3BWGA 2VLAA 2J8KA 2OTLI 2H8RA 3P4GA 5EG0B 1YS7A 1UFMA 2V9PA 1TTYA 3F21A 2VQGA 1FDRA 5TV2A 1I27A 1I5ZA 2DT6A 1VQ9B 5DV5A 1FIAA 1FYMA 3V7CA 2P81A 4B09A 4DYCA 4U7BA 1UG0A 1Y1VJ 4DZPA 4UY8I 3B8YA 1UD2A 3RKXA 3S3MA 2NVYJ 3SLDA 3F8FA 1A31A 2FA5A 1FYKA 2MLKA 4B8XA 2C6YA 4A12A 3B02A 3CPXA 3JX8A 3R6JA 2EFGA 4LMYA 2A6EF 2MC3A 5J35A 4ASUA 4J19A 2FEZA 3GLLA 1IDKA 2NZMA 4NC8A 4MEXF 2X0KA 3CP8A 2RGVA 4PFPA 4ZCLA 1VQ6I 1VQMI 3VSTA 1K61A 1MNDA 2QKLB 2HVQA 3ASOH 3PUFA 2GBYA 2A61A 4DNCA 1K79A 3VYTB 5DN6A 3TDUC 2GA2A 1T08B 2XAUA 1OB0A 4UVBA 2ZITA 1E3PA 3ZGKA 1YX2A 5DCMB 2JUGA 3H0DA 2BW3B 1R22A 1JJ8C 1XGOA 2Y0MA 1BW6A 1GR1A 4DBRA 3FXLA 4XN0A 1VQ6B 4BDZA 3BC9A 2V1UA 3V7SA 5J3LA 2VNHA 2EZKA 1PLUA 2VJ4A 4G8XA 2C77A 2DMQA 2XNCA 5ICFA 3AG1H 1FPQA 2NS0A 2CFOA 3IH4A 1T6YA 2DYRH 1TQIA 2JSCA 2CW7A 4IL6C 2DCEA 2KQRA 1E64A 1M1EB 3D26A 5TY0A 2BVLA 2X6YA 1K83J 3LMMA 2XTWA 2KRHA 3CB4A 1NJID 1TNTA 1ITYA 1QGYA 4NK6A 4TMZA 2JA2A 1BPLA 2I5UA 4S05A 1AA7A 1QZEA 2C5BA 2X3UA 1SVOA 1XMXA 4BU2A 5FO1A 4XD7A 4Y3OA 2D9RA 4LB5A 1RI7A 3Q9VA 4ASNA 2OTLB 1SM4A 1A35A 4X06A 4TMXA 1IUFA 5IYNA 3IRQA 4Q47A 2CUFA 3WXMA 1W7PD 2WV1A 2QGUA 5BPIA 5BQTA 1DP3A 3FBIB 1WSRA 1WVRA 3PENA 2GOXB 3LSPA 3ZN1A 5FRMA 4PMHA 1H8EA 3BR1A 2KPMA 3OSFA 3CD6B 4CZZA 3G6EI 3ISXA 4FK8A 4XIDA 1FBSA 5HZAA 2NTPA 1H9GA 1SD7A 2Q6KA 1XGSA 3ASTA 1K4TA 1ZGAA 5GAEJ 4M3BA 4M9ZA 2P7CB 2VZLA 5IT9Z 4ZDPA 1O7FA 2VE9A 5GAGJ 2UVEA 5ICGA 5DM7F 3KFWX 2RREA 2Y31A 4HYEA 2IS1A 2EFPA 3LMWA 4XLPF 2PJRB 2ZXHA 5A88A 1TYWA 2VKHA 3WGIA 2CSOA 4XQFA 3NARA 3RSNA 5H2FC 1EFUA 3CC7I 1B1BA 4NCNA 3GWZA 1R4NB 1P6RA 4U9UA 4CYCA 3OYFA 2HDWA 2ETHA 2D1HA 2EV0A 4FTHA 4P2NA 3BZ6A 1MDMA 5H5JA 1DBOA 4MHGA 2DOGA 2O17A 4YFNF 3UR3C 4A3JJ 3ABUA 2XGJA 2VIXA 3ABLH 2ZXIA 5DSZA 3W2WA 2PFBA 3WNBA 1KD1D 2P6TA 2GJPA 1E0EA 4TSFA 4RD2A 4Z4SA 3PIOF 1K8AD 5FD6A 3ZXSA 1F9NA 1VFCA 4PC3A 3OR1C 3A0HC 2RNGA 1OJLA 2WV0A 5HLHA 2GZWA 1MMAA 5EZGA 4XN3A 3T8RA 9ANTA 3DFGA 2K4JA 5BOXA 1KZLA 4B4DA 5FLXK 1YJ9B 3BG3A 2VKEA 1WH5A 2YS9A 2F5FA 3T9GA 1ELOA 3LL7A 4UV8A 2RDPA 3ASNH 2NVXJ 4B3AA 4FX0A 4KN4X 4RPBA 2VYQA 1BI1A 4KIBA 1P9QC 3LNQA 2QBYB 1XTAA 4F3QA 5ILVA 1OB5A 4AF6A 4HX7A 2D3NA 2W25A 1H42A 4X7EA 3I56B 3FF5A 2HTJA 3RZDJ 3F6OA 4IHSA 3QPLA 5CVRA 5GPAA 2OQGA 4A93J 3CCMB 3GCMA 2HFHA 2CS3A 4IX7A 1JUMA 3CQZJ 3Q38A 2M5SA 2K02A 2VQLA 3SFIA 3ZPNA 3DU6A 1HG8A 1RPWA 4RDJA 2IS6A 4P9SA 2WYRA 1B6AA 2LF8A 1ZM4A 3H3ZA 3M8JA 3TGNA 5HNHA 3I55I 1U78A 2H1KA 2W7ZA 2LYCA 1B2RA 2BM1A 1MJ9A 2HQ5A 2R0QC 1A04A 1WPCA 4H9GA 4A0ZA 1AMOA 4S0HB 1PJ7A 3LJYA 5HOOA 4LBYA 2X3HA 4MGRA 3HEFA 2WZPP 1B59A 1G7SA 2XTYA 4RDKA 2ESNA 4K2EA 1EP3B 3RYPA 1EKEA 4DOZA 1ZREA 4NBSA 2XT4A 3K4KA 4M1KA 3ZMDA 1G7TA 1DPRA 5F04A 3JQQA 4CYDA 4YHBA 4BQNA 4MEYF 2QEXI 4E70A 3E6MA 5B1BH 5TR9A 2WB1A 2VBUA 5HS8A 4RAZA 3VMWA 3OSGA 4NK8A 2ZMEC 2WY7Q 3HUGB 2R7SA 3A8JA 2M2EA 2NPFA 2JJ2A 2GK7A 3SEJA 3TH0A 1WKMA 2CFXA 2RC4A 2E2IJ 4P3YA 1OLTA 1WJCA 1RRJA 2K4BA 2OU2A 3PJRA 1WSVA 4M2LA 4OZYA 3F22A 2DBBA 1E43A 4HLXA 4G1BA 3DBLB 1W4MA 2JPCA 1UB9A 3ZMSA 1H85A 1XMKA 3BROA 2OBSA 4RB3C 3ZP5A 2LH9A 2Z5UA 2L9RA 3QU3A 1IZ1A 1Y0RA 1W0TA 4C3JJ 3TO9A 1BQEA 4N3GA 1R5GA 1RKTA 2Z16A 4BL0B 2KVOA 3LA7A 1F36A 3BR0A 1J9ZA 1EH6A 5D6EA 3OR2C 2EWNA 3KEOA 1ONVA 3RTRA 1G59A 3SUCA 2EA2A 5F0FA 4J00A 2QF7A 3WY9A 2STWA 3SZGA 4G6QA 3C1DA 1ZGWA 1E1RA 1YX5A 4UUSA 1XGNA 2DMTA 2L7KA 3OYLA 3OW7A 5GV7A 3OYGA 3CCUI 2JVHA 5K5RA 4UUVA 2DU9A 5E8IA 1R5HA 1W0JA 4AIHA 3W3CA 4NC6A 4A0YA 2XGDA 1GVJA 4XKVA 2RNJA 3WTZA 2VBWA 3TP0A 2Z8GA 3QFSA 2UXNA 2CGPA 4UAJA 4GRIA 4ON0A 2C5HA 2D2WA 3A02A 5HKKA 1IN8A 4Y15A 5E1WA 3CCVB 2NT9A 2QVOA 3HB9A 1TL8A 2E71A 2NXNB 2B0LA 3WHCA 2PJPA 2X1DA 2VBSA 4LG3A 2DTZA 2Y2ZA 1YQAA 4NQWA 3P9IA 3WU1B 1FOWA 2XF5A 5FIUA 3W2EA 2FSWA 2Z99A 2XEXA 2OZUA 2STTA 1EA3A 2DMUA 2IP2A 3RQ4A 5LEKA 1G3WA 4L5IA 2FNAA 2XGCA 1KU7A 4HAMA 4L5EA 2J7KA 3O3KA 1IRGA 3ZZTA 4A0XA 4YELA 5M5WJ 4A3FJ 1VQ5I 2XRLA 4A3DJ 1QVTA 2ACJA 1PJRA 2XB5A 5DD8A 4AUXA 1JKPC 1OCTC 3R61A 2K9SA 2L02A 4L9JA 4P25A 3ZBUA 3HDDA 3K69A 1X2MA 4OJ5A 1FNNA 1D1CA 2W24A 4Q4ZF 3BH4A 3JU4A 3E6CC 4CHUA 3S15J 1W35A 4X7FA 3JRDA 4I6ZA 1D1NA 4B48A 5CVJA 4A2UA 2JDIA 4GXOA 4LJZF 2CH0A 2RKHA 3SYJA 5HZBA 3W5HA 3E5UA 3AL0C 3CCEI 1QG0A 4S04A 1LEBA 4RAYA 1ZRCA 2IGKA 3HOZJ 4KFCA 1JKRC 4LD5A 1V5VA 4CQJA 2IAIA 4MYTA 1SD4A 4WWVA 3M4OJ 2W57A 1UAAA 1B4AA 4X0CA 1TT5B 2X6OA 1I50J 1PDNC 2FD5A 3DF8A 3O8GA 4MFEA 2ZNYA 3Q6RA 1SANA 1TWHJ 1WJEA 2DA1A 5LRRA 3ZQGA 2GQQA 2W1OA 3PSFA 2FXAA 3JQRA 1QGPA 2XAGA 4U4BA 1L1IA 3VYUB 3GQ7A 2YWGA 4XLAA 3N05A 3WGGA 4AVZA 5IT9K 3MCZA 4W97A 4RPDA 5J1RA 4QWQA 2V7UA 2X8KA 4IKFA 2LD5A 4PGGA 1KQ8A 3BP8A 2V79A 5FLMJ 2V7FA 4OPVA 2ODLA 1TW2A 3I9V2 3GTPJ 5M5YJ 3CDLA 3ISPA 2E1MC 1XC5A 2QSFX 1WU8A 3K1PA 2CYYA 3ONUA 2NS8A 1W5CC 3E5XA 3K4NA 2BHZA 3HSFA 3BG7A 4MFDA 2ELHA 2HR3A 2BGJA 2C2WA 3VR6A 1MBGA 2BMWA 2HOSA 2XVCA 2IGOA 4LOCA 3J7YJ 2OCCH 3W6JB 5DDGA 2OCEA 1VQNB 4RD0A 4Y9UA 4XSZF 5FA6A 2DK8A 2CRVA 2NS7A 5KK1A 3PUNA 1V3FA 2PJRA 5JVGF 1X0CA 1BJZA 4MQ9F 3JW4A 1G7RA 4KIFA 4XL9A 5K1YA 4X1EA 2KP6A 2VASA 4J01A 3ROUA 1SFOJ 1WCMJ 3QOEA 1NK3P 1FSEA 1DBGA 2BGIA 4BS9A 1YHQI 1JE8A 3I56I 3BCBA 1WGXA 5JI6A 2E1CA 3PETA 1KYZA 2WTEA 1ETYA 3FXQA 3TO7A 2VUMJ 1S7EA 1E3OC 1KQ0A 2L9VA 1VHEA 2CJJA 1NBMA 3B4NA 4HBLA 1MABA 2BY1A 2QLZA 2QZ8A 2OBRA 2NVQJ 1XD7A 1LQ1A 5CYVA 1RR8C 1KRHA 2FX3A 3PIPF 2KIUA 3CC4I 4BE0A 4AD9A 4C2MJ 1HKTA 2IXSA 1RESA 2HQNA 1ZG5A 2DFIA 3RPQA 1YJ9I 1E3XA 2RVCA 1W7PB 4BHCA 4EJWA 2LBFA 4PJJA 3VEPA 1Y8QB 5JLWA 4P3IA 1O8GA 5IP6A 5AONA 3PNTA 2LKSA 3BDDA 5L3EA 1Z21A 2ZXJA 5HDKA 1DU6A 4KT6A 3DLLF 1T38A 2VC0A 3BG6A 2FVGA 3S2WA 3IC7A 2L7MP 2KZGA 4IJAA 4PJMA 4EM0B 2NYXA 2AXTC 4A3EJ 1NH3A 4PUSA 4CCJA 2P5VA 3ESWB 4LIVA 4RB2C 3FK6A 5IOZA 1UD5A 2HOTA 5LGTA 3FPKA 1RWRA 4EW9A 2PMUA 2RN7A 1LDJA 1J5YA 2H8WA 3KP5A 3MKLA 1E17A 2HLDA 2WWYA 4QPQA 4WZEA 1WPKA 2LG4A 1BR4A 2A5WA 4XLEA 3S93A 4CXFA 1KU3A 4XRFA 2WA0A 3K7AJ 2E1RA 2Y0SA 2QM3A 1GAWA 3D5RC 3VYSB 2OBTA 2W48A 4LBWA 4U49A 3BZCA 1BC8C 1HW1A 2VBEA 2DDAA 1MMDA 3I4PA 1FYLA 5DUKA 4BXFA 1RUNA 3OIPA 2GXGA 1NRKA 4YXWA 2M7BA 3G6EB 4D9JA 1Z3XA 2QXZA 1KQ5A 2L2OA 2XIGA 3H9QA 4Y4RA 4C2UA 2BXZA 2BM0A 1KC8D 1Q9SA 5LMZA 1O8IA 4CICA 3MWMA 1T0FA 2R7VA 2W7NA 3OZVA 2BY3A 2XAQA 1AHDP 1LFBA 3J7AO 1ZM9A 2AXLA 2P5LC 1YYVA 4E7IA 2XRNA 4KKSA 1TSPA 3GRHA 3AFHA 2R5YB 3FISA 4BH9A 4WZTA 2KRCA 3CC2B 2LY2A 1QUEA 2HDNB 1IRFA 1QZZA 2QBYA 1ZH5A 1KA8A 2WAEA 1Z0XA 3VO2A 3CCJB 2O04A 2CQ7A 2BYVE 5CVVA 5EEGA 2VQHA 4D1QA 3T53B 3SXYA 1ON1A 4BPRA 3GTJJ 1P7IA 1U5TB 3UNGC 3CMEI 3JRIA 4WXHA 3COAC 4N0BA 1D8KA 4YFXF 3ABMH 3CCSB 3BH7B 3QU6A 5F27A 5C44J 1BL0A 1EF4A 3U21A 2Z2SB 1OPCA 1H0MA 4HW0A 2JA5J 3OWTA 4BEHA 1U8BA 1VF7A 3OEHA 4XNFA 4P9UA 2GK6A 3WE3A 2W00A 3BPVA 3OIQA 2ZJ2A 3MKYB 3GTGJ 2VN2A 3WTSC 1G8XA 3DV8A 1YRNB 3VYRB 5GTIC 3T56B 1LKXA 1T56A 3HOTA 2F5VA 3HYIA 3CXCB 3S14J 3JRAA 2NOJB 3EUAA 3OZWA 3J81k 2QN6A 3MFKA 1T6SA 3BCDA 3K2ZA 3KX2A 2FMLA 3N97A 4CYCB 1O3RA 5FRNA 5DD4A 1YJWI 1J9IA 2LY1A 1JJ6C 2XKOA 1D2EA 4LB6B 3DPLC 3P7NA 3FWEA 2O8KA 4G5GA 1VQMB 3FXOA 5CKTA 3FXRA 4XKBA 3OEEA 4NUBA 5E20A 4F92B 4UNOA 1QGZA 4LITA 2K9NA 4PC7A 3DKWA 4RD3A 2NT6A 5HLGA 2HTSA 3I3LA 4RDLA 2K9QA 3AVWA 5B1AH 1Z77A 5K7HA 3FKIJ 3ERED 2LOOA 1B72B 3ZMTA 3P27A 2J5OA 2WAQN 4HOBA 2XAJA 5B66C 1R71A 4MXNA 2F6CA 3FXMA 3BOQA 3BR5A 4LLLA 2X6WA 3WTTC 2LLKA 1T8IA 2HPMA 2EH3A 2QMUA 2BSPA 4IQJA 1ODDA 1D8JA 1TWCJ 2BF4A 3FXJA 4UXNA 5KAFC 4KJZA 5D4RA 3LNNA 5DNSA 4Q48A 3HRTA 4N4NB 3ZMVA 2LKPA 1ZM2A 4UB8C 4RD1A 4L8JA 4BDYA 3BQZA 3R0AA 1QA3A 2A5YB 3CCRI 1XSXA 3CO7C 1TYUA 2Q6LA 4OAZA 3VSKA 1LJ9A 4IOCF 4XSXF 5DUIA 3S3OA 3L2CA 1QVUA 3CUQC 2M7AA 2EWEA 4A5MA 4Z4TA 5JMCB 1IDYA 1ZG1A 1Q86D 3Q0WA 4ANJA 2OD5A 2LK2A 1AKHB 2FX0A 1EH8A 4HIZA 5D6FA 3MKZA 4ZGQB 3O6BB 3RIQA 1T95A 3V4GA 2YX7A 1PYVA 1TWFJ 1SKQA 2VC1A 3GTKJ 5FJ8J 2FBHA 3EUKL 4JBAA 1EFCA 3HGGA 4JYKA 1CNFA 3FKJA 3H9NA 1Q7YD 2ECCA 4GCVA 4KYWA 4I09A 2KL4A 3BY6A 5FLXZ 4WZLA 2M4KA 2DY1A 5FO0A 5J40A 3KP7A 2L7FP 3PSIA 3BC8A 4ESJA 2CQKA 4P5OA 1R1TA 2KDOA 3PO2J 1QFZA 4BXUA 4RLZA 1RNLA 1U8RA 1DDNA 3OYIA 1YIOA 2JMWA 4I2OA 1OFMA 3R6KA 4ZYEA 3R0JA 1RC9A 3PQJA 1O8FA 1F5TA 3KLOA 3WTWC 2EZLA 4A3BJ 4P1VA 3LFKA 1ZK8A 1V4RA 2E36A 3F9KA 3DEEA 1OR7A 2XAFA 3SHFA 5BSYA 4BEHB 1ZN2A 3JTGA 1N06A 3OJWA 2E1MB 1QPMA 5FNZA 4R71A 3H9GA 1MGTA 4OMYA 2CQXA 4WCGA 3G73A 1DARA 3X2QH 3G71B 1JUSA 1PXZA 1IW7F 3OYNA 4YZAA 3BNWA 4M53A 3M7GA 1J59A 3JURA 4PSWA 3ZQLA 2QE7A 3ZRGA 3LSTA 3DTKA 1DG1G 4WXDA 1NHAA 2GIZA 1UD4A 2JA7J 2JSPA 4KH3A 2R5YA 1XGMA 3H3VK 1XE1A 3OPOA 4DBQA 2XV4S 3ZQQA 2ZFWA 1QJVA 3M3YJ 4AF7A 2OPTA 1VZ0A 4HA8A 5EG0A 2P5KA 4HG2A 2GQFA 3M8FA 1Y0UA 1VQOB 1TNSA 5CVIA 4CCLA 2VE8A 2R7OA 3JQPA 1PP7U 1Q1VA 3P9KA 3W2VA 3UKGA 3PA2A 4BJ5C 4KNYA 1IC8A 3M9AA 3QODA 2R7ZJ 2MC4A 4AU7A 4L0ZB 4AWXB 2BM4A 2X1EA 5ICCA 1IN5A 3HPGA 3J7AY 2IQ7A 1HKQA 4GGGA 2FNPA 2NNYA 5IYQA 1O8KA 3F8MA 1RIOH 2LZJA 3QSYA 1FBUA 1DU0A 2VOPA 2L7ZA 3SFZA 2XZPA 3ZSCA 1QZYA 3BJAA 1QHGA 2TDXA 4MNUA 3JRFA 1GXPA 1EFRA 3LSMA 3GLXA 1F1ZA 1SVLA 2LREA 1YITB 4PABA 2EFNA 2V6CA 1YJWB 1O8MA 2ID6A 5J6XA 3VSUA 4EV0A 3P9CA 2YUHA 3TMOA 1TWGJ 3OYDA 1EA0A 1OGOX 1BX1A 2EZIA 4Z4VA 4P26A 3PSSA 1BI2A 2FE3A 1MNEA 3T8TA 2DK5A 3L09A 3LYCA 4A3KJ 3NAUA 3H9JA 5BMZA 2Y0SN 3KPHA 2Q8KA 1FP1D 1NB9A 1FOYA 1DGRM 2DFHA 3ML3A 2M87A 2OV7A 1KU2A 2MH9A 2V7TA 2YWHA 3DQVC 3JRCA 3BQJA 3U2QA 5H20A 4CA0A 3KL9A 2F43A 2ZMEA 1WFXA 3CCQI 2DN0A 2BY2A 4XK4A 1XG2A 1W5TA 1YITI 2W82A 3PL8A 3D1NI 2G0YA 1NHCA 4IHXA 4LK1F 3W2IA 2YUSA 3W6VA 1MIJA 4AIJA 2UVFA 1SFKA 3CLQA 4ZCIA 2NAZA 3QWLA 1IN4A 2HU9A 4BJ6C 3PM1A 4KISA 2YR2A 3S17J 1IJFA 5E79C 2F4IA 2OAZA 1AOYA 3A0BC 4RA2A 3GFJA 5KNLA 1LUJB 1FMWA 4KDPA 1ENHA 1MJBA 3A3GA 2GAUA 2O0YA 4HNUA 2B63J 4M6XA 2J8IA 1S9HA 4DK1A 3GZ5A 2E5NA 4EM1A 2INVA 4M9XA 4LBVA 1VQ7B 3NAWA 1IXSB 3C2GA 1MZBA 3D5LA 4KMUX 4V2GA 5FGMA 5FKOA 2V26A 2ZJPF 3CCLI 3S1MJ 2HMAA 2IGNA 1HDDC 2V7VA 1WDTA 2DA5A 3A3BA 1QO0D 1K7AA 2R5ZA 3ZR8X 2QYOA 2VODA 1XCVA 6PAXA 3RYRA 3CMMA 5LHGA 3WTUC 3DBRB 4ACAA 5J1YA 1CQTA 2CUZA 1MJAA 3K70D 2INUA 4NC7A 2UWMA 3H35A 3LQQA 4B1RA 5D5VB 4TMVA 1D0ZA 3TW6A 2WZNA 1ETOA 3JREA 1RR7A 1HSJA 2K86A 3QP5A 1MSFC 3PFIA 3WQZA 4M6VA 1Z7LA 1FJLA 2R7RA 2EIXA
chains in the Genus database with same CATH topology
3A2KA 2Z8GA 3JU4A 4GRIA 5HNFA 5HKKA 2D3LA 3UW0A 3DKYA 2NT9A 4HRIA 1RU4A 3K4BA 3DLAA 4E7LA 2ELJA 4YRVA 2X1DA 2R7WA 4LG3A 4YZXA 4ITVA 2XF5A 4E6KG 1CZFA 1EA3A 3RQ4A 3OY9A 1O8EA 2WJYA 4BJTA 1N78A 4B47A 2HVSA 1WP6A 2WPDA 4E7KA 3G05A 1KCCA 4YELA 1BLIA 2V31A 3HL2A 3CZ6A 3SDBA 1PJRA 3L2UA 1VJSA 4P22A 2O1DA 2KZVA 3CJRB 5KHDA 4HPQA 5C1EA 4OWRB 4OJ5A 2AQEA 1D1CA 3L2QA 4U87A 2JIZA 2K3PA 2VXDA 1OR7C 2XNDA 3PNVA 4HSRA 4MLOA 4ZC3A 5TGTA 2R7XA 1UD6A 2L5QA 3K4LA 3HKZA 4B48A 4W8QA 3DPTA 3HXLA 3TBIA 2JDIA 3OL4A 2CH0A 3DDYA 4B3FX 5LD2C 3DTIA 1X4OA 2OC6A 3K6GA 3GQBA 1Y56A 3AL0C 2Q2EB 2ZZEA 1JTAA 2GJRA 3BCFA 2MYSA 4G7WA 2IGKA 3K4JA 3PFYA 4W8RA 1MMGA 4P1WA 4ZDLA 3FKSA 2L9SA 2M0MA 2PMZA 3NWSA 4XONA 2ZZQA 1UAAA 1E1QA 4ZJZA 2V6EA 3GVLA 4QPOA 1WJEA 2W1OA 3M1CA 3PSFA 2I8DA 1WJ5A 4PSXA 1HVXA 1AIRA 2KLOA 4U4BA 1EE6A 5AMVA 3VYUB 4BE2A 2CK3A 3GQ7A 3DTEA 4IQ4A 4II2A 4XLAA 3V42A 1COWA 1MMNA 3HPHA 3N05A 3OL3A 1JRGA 2WY8Q 4AVZA 5LFAA 2XZOA 4XOPA 4LIUA 4E7HA 2X8KA 4IKFA 4C2LA 4TKOB 1TZLA 4B3XA 1WJAA 1WTHD 1O8JA 3TL4X 2WADA 2V7FA 2ODLA 4KKUA 3QYFA 3I9V2 4Z1MA 3OMYA 2E1MC 2LBFB 2XC7A 1X19A 3G2BA 3OYKA 3A1YA 3K4NA 4EATA 3IAS2 2DJIA 3BG7A 5CQGA 2L9NA 3VR6A 1BR2A 1V5GA 2IGOA 4DGWB 3QYEA 4CSWA 1HA8A 2KHMA 1JI8A 2XOKA 1LDKB 1K28D 2K9MA 1X1CA 3SYTA 3VWBA 4Y33A 2PJRA 1X0CA 3E0JB 3FY3A 1VLYA 4TT3A 4XL9A 2KP6A 2VASA 4J01A 2X6XA 2IS2A 3IP4B 3QOEA 1DBGA 5IK2A 4C2TA 4BS9A 3LSHA 4BE1A 3BCBA 1N75A 2WBMA 3SEQA 2LC2A 2HZDA 3VSVA 3ZIAA 4OJ6A 4Z03A 3B4NA 1NBMA 2CV1A 1YX3A 1KONA 1MABA 4W8TA 3MMYB 2AQFA 4XLCA 2BW3A 3A4CA 1WJDA 2OUMA 1D0XA 2R7QA 4BE0A 1V0EA 2IXSA 3KYLA 1E3XA 4CCOA 1QHHD 2JVGA 3DKXA 4RM2A 3L2WA 1OFLA 2LBFA 2W4SA 4PJJA 1O8GA 4YEJA 3PNTA 2A6TA 3NWTA 1Z21A 3VDXA 4E0FA 3VMVA 2VJJA 3OYHA 4KT6A 1X1BA 4XORA 2IGMA 1W0KA 1I8DA 2BOLA 3BG6A 3LFUA 4B43A 2MD0A 4PJMA 1WMRA 5CQEA 4PUSA 4CCJA 2QX3A 4LIVA 5CPRB 1UD5A 4N4OB 3HC7A 1RWRA 3HOSA 4EW9A 4KITB 3FBNB 2VKDA 3OOUA 4OJPA 3OYJA 2HLDA 2V1NA 4UZUA 2VPLA 4QPQA 2LG4A 1BR4A 2A5WA 4XLEA 3S93A 2ZTGA 4G7XA 4RM3A 2WA0A 4GQNA 3GQ9A 2Y0SA 2VBKA 3BCAA 3E1SA 3LSGA 3D5RC 3VYSB 4DIQA 2V4DA 1FMVA 4JQFA 4XKWA 4U49A 2R9VA 2VBEA 2QY1A 1E79A 1MMDA 3L2VA 1O88A 1D0YA 4BXFA 4I84A 3OIPA 2XDVA 1NRKA 4YXWA 4XLHA 2XZLA 2M7BA 2V9KA 4D9JA 1Z3XA 2NSTA 3GQ8A 2X53S 2QXZA 4HSTA 2L2OA 3H9QA 4Y4RA 4C2UA 4OJOA 1O8IA 3OS2A 1K6YA 2R7VA 2O5RA 2W7NA 1VBLA 2HNHA 4RMNA 4E7IA 4R79A 1O8HA 4F91B 4KKSA 4E7JA 3GRHA 3AFHA 1LVKA 1UELB 3OS1A 3EQOA 1KTWA 5HVQC 2KRCA 2VLAA 2LY2A 3RPUD 2PYGA 3DPUA 2R4GA 2E1BA 2WAEA 3HAGA 1LFPA 2O04A 4XLFA 2VQGA 4DK0A 2ZTNA 4W8SA 2ZSIB 2VQHA 4D1QA 1X1AA 3K4MA 2DT6A 3RCOA 3UNGC 1BHEA 1U0JA 4U7BA 4CCKA 1UG0A 1BMFA 1SKYB 3U21A 2Z2SB 1UD2A 3B8YA 3S3MA 1KCDA 3OS0A 3OWTA 4HEA2 4BEHA 1VF7A 3VSLA 3OEHA 4XNFA 2GK6A 1BR1A 4CZCA 2W00A 2Q1ZB 3A35A 3OIQA 3MKYB 3FHNA 1GLNA 5CDFA 3SEZA 4BGDA 2DXIA 1G8XA 2E60A 3VYRB 3T56B 1LKXA 3HOTA 4PJNA 4YZQA 1IA5A 2F5VA 4PFOA 1ERDA 4ASUA 1IDKA 3ZPPA 4XMYA 4NC8A 2NZMA 2NOJB 3EUAA 3CP8A 4PFPA 1FX0A 4URRA 4B44A 3VSTA 4F55A 2P0WA 3BCDA 3KX2A 1MNDA 2QKLB 2HVQA 2ZZGA 3BH4A 1H8HA 3VYTB 4XM3A 4FASD 5FRNA 3OOCA 5DN6A 4MR0A 4FXUA 2LY1A 2WAQA 2XAUA 2JJ1A 3DPLC 1OB0A 2V7QA 2VQCA 4DNRB 3ZGKA 1QCXA 3K4CA 1TT0A 2JUGA 2CMPA 3L2RA 1O8DA 4OJLA 4YZ0A 3IAM2 2BW3B 3H0DA 2FUG2 5CKTA 1D1AA 4DBRA 4RLFA 4XKBA 4XN0A 3OEEA 1NG7A 4NUBA 4F92B 4BDZA 3BC9A 4LITA 1PLUA 2VJ4A 2NT6A 1E3ZA 3EUHC 3I3LA 2VJ5A 2VBMA 2CFOA 2LOOA 2CW7A 2DCEA 2KQRA 3T53B 1Y6IA 2BVLA 4MXNA 3S3NA 2F6CA 3KRGA 2X6YA 3LMMA 2KRHA 1QU3A 3W2AA 2X6WA 4NK6A 2HPMA 1WJFA 2JA2A 1BPLA 2BSPA 4IQJA 1AA7A 3OYMA 4KJZA 3LNNA 3QYBA 4PJLA 4N4NB 4BU2A 2MABA 4L8JA 4BDYA 4XD7A 4Y3OA 4Z05A 4G6IA 3NE5B 4OAZA 3VSKA 3S32A 2CUJA 4ZTFA 2XF7A 3C2HA 3S3OA 1I18A 2M7AA 3T51B 2EWEA 3LSIA 3FBIB 1DP3A 2V4JC 4BQQA 1K5CA 2GOXB 4ANJA 1W36C 1IDJA 5FRMA 4PMHA 4HIZA 1H8EA 2KPMA 3MKZA 4IZZA 4KKTA 2O0WA 1T95A 3FPPA 1PYVA 2QKMB 2X85A 4X0GA 2NTPA 2DOAA 3H5NA 2GJKA 4JOMA 3CP2A 3EUKL 4ZDPA 2UVEA 3FKJA 2E5ZA 1MW7A 2KL4A 2RREA 2IS1A 3LMWA 2M4KA 2W6JA 3PSIA 3BC8A 2PJRB 2ZXHA 1NG6A 4P5OA 3H5AA 2KDOA 2VKHA 2WAFA 4XQFA 1X4PA 3RSNA 3PNYA 3OYIA 2K5CA 1OFMA 3OYFA 1O8FA 4JMQA 2HDWA 2WJVA 4CUGA 1PKVA 1DBOA 2PYHA 3GVJA 2O17A 2VB6A 3F9KA 3UR3C 3DEEA 4AYBA 1Z3YA 2VIXA 2XGJA 5FL7A 2XSJC 2ZXIA 3HG9A 4BEHB 5HLTA 1IB4A 3W2WA 3OAAA 4BUPA 1DGWY 3AL0B 2E1MB 2GJPA 1E0EA 4TSFA 1W9XA 3H9GA 4RLQA 3ZXSA 3OR1C 4XKCA 2F1MA 1PXZA 4YZAA 2RNGA 3OYNA 2HVRA 1MMAA 4G6TB 4XN3A 1KZLA 2Z6BD 3JURA 4PSWA 2QE7A 3ZRGA 3DTKA 1UD4A 4CCMA 2JSPA 3T9GA 5JHFA 3CESA 3LL7A 4DNTB 3OPOA 1R6RA 4DBQA 3ZQQA 4H4KC 1QJVA 1V5EA 1P9QC 1X1DA 4CCNA 1VZ0A 4F3QA 4C9YA 4HG2A 4NQWB 3DU5A 2RQQA 2D3NA 4HWVA 4CCLA 3MD2A 2R7OA 3H94A 4E7SA 3GQAA 5FROA 2CV2A 3W2VA 4FETA 1IRXA 4BJ5C 1DQUA 3KEYA 1KMHA 2GOMA 3QODA 1UD3A 2MC4A 4AU7A 2CS3A 4E4HA 2X1EA 4ZYAA 4IX7A 3HPGA 2MFZA 3J7AY 2M5SA 2UV1A 2BVMA 1O8KA 1OGMX 2VQLA 2IQ7A 1T5EA 3ZPNA 2LZJA 3DU6A 1HG8A 3ZSCA 2DT7B 2XZPA 2IS6A 1BN8A 1QHGA 3OYCA 1EFRA 2M3AA 3LSMA 3M8JA 2VJIA 5HNHA 2LREA 4E7ZA 2K9LA 1SAUA 2LYCA 3FDYA 2Z1DA 4C30A 4HNTA 4ZDOA 1O8MA 2VXZA 1WPCA 3K70C 3VSUA 3CJQB 2R7TA 5HOOA 2X3HA 1UD8A 3TMOA 4B3GA 3OYDA 2VL8A 2WZPP 3PUBA 1OGOX 4XOTA 3WWGA 2CV0A 2HPIA 1OHHA 4DOZA 4F52A 4ZTJA 1MNEA 1WJBA 3K4KA 3OYAA 1YE9A 3H9JA 3AKZA 4BQNA 1ZELA 1DGRM 3H5RA 5KCMA 2WB1A 3OE7A 4DJAA 2OV7A 4OZZA 3VMWA 3DQVC 4NK8A 1GQ8A 4CA0A 2WSSA 2F43A 1WFXA 2WY7Q 2W6IA 3HUGB 2R7SA 2JJ2A 2GK7A 1XG2A 2NSPA 4F93B 2W82A 3PL8A 2KMUA 4CH7A 2R7UA 1NHCA 1OLTA 2HQAA 1WJCA 2UVFA 3PJRA 1N77A 4OZYA 1SFKA 4OAYA 5C1CA 2XF6A 2HU9A 4BJ6C 1E43A 4KISA 2UUZA 1V0FA 4II3A 2X51A 2F4IA 3EPZA 1J09A 1V5FA 3D5SC 3EQNA 5KNLA 4XR6A 1FMWA 1HZEA 2DIEA 3CF2A 3A3GA 2LH9A 3GBGA 4HNUA 1S9HA 4DK1A 1BOBA 2E5NA 2INVA 3K10A 3C2GA 4BACA 3D5LA 2NTQA 3B90A 1RMGA 2V26A 4BQOA 3OFNA 2IGNA 2Z16A 4BL0B 2KVOA 2X1CA 4NNJA 3OYBA 3A3BA 4Z06A 1T0FC 3ZR8X 2NTBA 3CMMA 3OR2C 3LSKA 3RTRA 2ZSHB 1G59A 3SUCA 4J00A 2CUZA 3K70D 2IS4A 3OYEA 2LRDA 2INUA 4NC7A 2UWMA 3H35A 2CW8A 3BLYA 2M4GA 3ONQA 3SZGA 3ZCOA 1D0ZA 1PE9A 3DWLE 1E1RA 1YX5A 3OW7A 3OYLA 2L7KA 2PECA 3S8PA 2ZZFA 3GVKA 3OYGA 4PK4A 2O0VA 2ZFUA 1W36D 1O8LA 2JVHA 1H80A 3WQZA 3KEWA 1D1BA 3MKWB 1W0JA 3W3CA 1Z7LA 4XKVA 1OOCA 2R7RA 3IUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8G A;  3B4N A;  4XM3 A;  4MR0 A;  4Z03 A;  4W8T A;  4XLC A;  3UW0 A;  2NT9 A;  1RU4 A;  4HWV A;  1QCX A;  4YZ0 A;  4OJL A;  1O8D A;  4YZX A;  3GQA A;  1CZF A;  1OFL A;  4XN0 A;  1O8G A;  4YEJ A;  1O8E A;  1PLU A;  2NT6 A;  3VMV A;  2VBM A;  2IQ7 A;  2VJJ A;  1O8K A;  1OGM X;  4XOR A;  1KCC A;  3ZSC A;  1HG8 A;  4YEL A;  1BN8 A;  4MXN A;  3KRG A;  1WMR A;  2X6Y A;  2VJI A;  2O1D A;  2QX3 A;  2X6W A;  4NK6 A;  1O8M A;  1RWR A;  5C1E A;  2BSP A;  4EW9 A;  4OJ5 A;  3VSU A;  4OJP A;  2X3H A;  3WWG A;  1OGO X;  4XOT A;  4W8Q A;  4Z05 A;  4XLE A;  2VBK A;  1JTA A;  2EWE A;  4U49 A;  4XKW A;  4W8R A;  4OZZ A;  2VBE A;  1K5C A;  2QY1 A;  1IDJ A;  4XON A;  1O88 A;  4PMH A;  3VMW A;  4NK8 A;  1GQ8 A;  4I84 A;  4OJ6 A;  4XLH A;  2O0W A;  2NST A;  3GQ8 A;  2X85 A;  1XG2 A;  2NTP A;  2QXZ A;  2NSP A;  4OJO A;  1O8I A;  1NHC A;  1AIR A;  4U4B A;  1EE6 A;  2UVE A;  3GQ7 A;  5AMV A;  1VBL A;  4XLA A;  2UVF A;  4W8S A;  1JRG A;  4OZY A;  4AVZ A;  4XOP A;  3LMW A;  5C1C A;  1O8H A;  4C2L A;  3GRH A;  4XQF A;  1O8J A;  3EQO A;  3EQN A;  1KTW A;  4XR6 A;  1OFM A;  2ODL A;  2PYG A;  1O8F A;  2O04 A;  2INV A;  1DBO A;  4XLF A;  2PYH A;  2NTQ A;  2O17 A;  3B90 A;  1RMG A;  1BHE A;  1IB4 A;  4Z06 A;  2NTB A;  3B8Y A;  1KCD A;  3SUC A;  4XNF A;  1X0C A;  2INU A;  3FY3 A;  4XL9 A;  1PXZ A;  4YZA A;  1PE9 A;  3GQ9 A;  4XN3 A;  2PEC A;  2X6X A;  3JUR A;  4YZQ A;  1IA5 A;  3ZPP A;  2O0V A;  1IDK A;  1O8L A;  2NZM A;  4XMY A;  1DBG A;  1H80 A;  3T9G A;  4URR A;  3VST A;  3VSV A;  4XKV A;  1OOC A;  1QJV A; 
#chains in the Genus database with same CATH topology
 1SD6 A;  1MBH A;  1ZAO A;  1SEU A;  3S2D J;  3DKY A;  1LDD A;  2JK3 A;  4TV7 A;  1RU4 A;  3DLA A;  5D5U B;  4E7L A;  2ELJ A;  4YRV A;  2VBV A;  4EEF G;  4ITV A;  1FWZ A;  1A8P A;  2AS5 F;  1QPI A;  1CZF A;  4E6K G;  4AC9 A;  5E3O A;  3WG9 A;  1CLW A;  1Z7U A;  1O8E A;  3LA2 A;  3OY9 A;  1YG2 A;  2PG4 A;  1ON2 A;  4LLG F;  1YO5 C;  2KIQ A;  3VFZ A;  3OKX A;  2ZXW H;  4HQM A;  2HVS A;  4N9H A;  3G05 A;  1VQ4 B;  1TQM A;  4B4C A;  2AO9 A;  1DUX C;  3HOU J;  1P4X A;  1GVH A;  3HL2 A;  4JX6 A;  2V31 A;  3ZC3 A;  1YJN B;  4D0P A;  5J3O A;  3HTS B;  3CTA A;  2ESH A;  5DEQ A;  3L2U A;  5GTH C;  2XPW A;  5A2Q Z;  2JA6 J;  2KZV A;  5KHD A;  5F08 A;  3HOW J;  4UVC A;  3ABT A;  1K78 B;  2IA1 A;  1JUP A;  1USS A;  2AQE A;  3ECO A;  4U87 A;  2K3P A;  1OR7 C;  1B8I A;  4HSR A;  1PJ5 A;  3QFC A;  4A69 C;  5JR3 A;  1UD6 A;  2L5Q A;  2BSA A;  3ML6 A;  2VBX A;  4WQM A;  2HGC A;  4AID A;  1D3Y A;  3DDY A;  4TN1 A;  3ZMU A;  2IVM A;  3K6G A;  1X4O A;  2OC6 A;  4O5V A;  1Y56 A;  2Q2E B;  1BC7 C;  1JTA A;  1Z1D A;  3BCF A;  2MYS A;  3BTJ A;  3ZZU A;  4G7W A;  2QUF A;  2DYS H;  1IJE A;  4I98 B;  4P1W A;  2EK5 A;  1RET A;  4NHJ A;  1FOK A;  3GTO J;  1E1Q A;  1RQP A;  1ZLK A;  2L4A A;  4ZJZ A;  2V6E A;  1ZR4 A;  2H6C A;  3LVB A;  4ZGN B;  2M34 A;  4GYI A;  1OFD A;  2PIA A;  1XSV A;  4HDV A;  1G7C A;  1XFO A;  3DCF A;  1HVX A;  2O7O A;  2E2H J;  1EE6 A;  2WC2 A;  3DTE A;  3V42 A;  4HF1 A;  1PUE E;  3HZJ A;  2WY8 Q;  5LFA A;  2RC5 A;  2OTJ B;  4DYR A;  4ENK A;  3O8H A;  2QA4 B;  4R1H A;  1WZ2 A;  1APL C;  2IT0 A;  4B3X A;  1WJA A;  1R5O A;  3GO5 A;  3TL4 X;  2MA3 A;  1FLI A;  4KKU A;  1K78 A;  3CJN A;  4HX4 A;  4FE4 A;  1E3H A;  5GP9 A;  2LBF B;  3A1Y A;  4BYY A;  3IAS 2;  1W0U A;  2IOU G;  2DJI A;  3K0L A;  1N08 A;  2FMY A;  3EET A;  5ILU A;  4M4S A;  4F7D A;  1BR2 A;  2EFW A;  2VNK A;  1MBJ A;  5ILS A;  4DGW B;  1K4Z A;  1YS6 A;  5A89 A;  1LDK B;  1IF1 A;  1K28 D;  3WBK A;  2BM7 A;  2M1B A;  2DAO A;  3EQL F;  1A36 A;  1JHH A;  2J5P A;  5D5X B;  3I59 A;  4LK0 F;  2R93 J;  1VQL B;  3G71 I;  1VLY A;  1ZM3 A;  5B5E C;  1R5N A;  2CBX A;  1C0W A;  4QHY A;  4ZZD A;  1KZH A;  1N0U A;  1I3A A;  3CUQ A;  4C2T A;  3LSH A;  2WR8 A;  5IK2 A;  3AVY A;  1N75 A;  2WBM A;  4MYU A;  4YDT A;  1XDS A;  3HSE A;  2ICW G;  1FC3 A;  3SZP A;  2QYU A;  4OJ6 A;  4Z03 A;  3IKV A;  3QQA A;  1IO2 A;  4M3F A;  3KCC A;  4XLC A;  2PLY A;  2BW3 A;  2DEU A;  2XB0 X;  5F4O A;  2KIF A;  2OUM A;  4NDL A;  1I7P A;  5EEA A;  3VO1 A;  1VQ5 B;  3MZH A;  2CC2 A;  4RM2 A;  3K1N A;  4OMZ A;  2H1L A;  5AIP A;  2K85 A;  3WU2 C;  1S7O A;  5K7F A;  5EEH A;  1K6O A;  4YG2 F;  4IRH A;  4YIF A;  3NWT A;  1CGP A;  4U88 A;  4OIP F;  5J4Y A;  3WYA A;  1SFU A;  4NB5 A;  1I8D A;  2A69 F;  2XPV A;  3MN2 A;  3F8N A;  3U2R A;  2V1X A;  3LFU A;  4B43 A;  2C78 A;  4A3G J;  2QWW A;  1OGJ A;  3IWF A;  4FT8 A;  4V19 K;  2VOO A;  2H27 A;  2QX3 A;  1VND A;  1IDZ A;  3E7L A;  4D7M A;  1BW5 A;  4N4O B;  5EGO A;  2X9D A;  2Y69 H;  2A3S A;  3C7J A;  5E8G A;  3RJP A;  4EGZ A;  1LE8 B;  5IY5 H;  2F4N A;  2CRG A;  1M90 D;  2YSR A;  2A6H F;  3OYJ A;  4UZU A;  2VPL A;  2BVN A;  4Y7N J;  1DPU A;  1NTC A;  5IYW A;  3CCR B;  3CCU B;  4GQN A;  1V54 H;  2VBK A;  3BY1 A;  3BCA A;  2E35 A;  4IOA F;  4DIQ A;  2V4D A;  4MIM A;  2XAH A;  1YIJ I;  4JQF A;  3I0T A;  2R9V A;  2QY1 A;  4IEJ A;  3L2V A;  4OP7 A;  1D0Y A;  1YW7 A;  4M74 A;  1YI2 I;  4I84 A;  2A68 F;  3KZZ A;  2XZL A;  1OFC X;  3V8J A;  4OJO A;  2DFF A;  1Z6T A;  3I58 A;  2M30 A;  3KYD B;  3CMA I;  1JT0 A;  1K6Y A;  1S5L C;  2O5R A;  1D5V A;  2JT1 A;  2HDD A;  2HNH A;  5GAH J;  1I6H J;  2XAS A;  2DFE A;  2DYI A;  3ERM A;  2HYG D;  4LC0 A;  1O8H A;  2JWT A;  1UEL B;  2R7D A;  3OS1 A;  1VQP B;  4IW3 B;  4DW6 A;  1GT0 C;  4Z4Y A;  1J2X A;  5HVQ C;  1FND A;  3MMP A;  3DPU A;  1UHS A;  5HS9 A;  4N3N A;  3WU0 A;  5ICE A;  1WRJ A;  3GX4 X;  2CO5 A;  3ONY A;  4G6D A;  4MQV A;  1LFP A;  1XB2 A;  3HAG A;  3S1N J;  5JFR A;  2ZTN A;  4DK0 A;  3CC4 B;  4K1X A;  3K4M A;  1STZ A;  3BR2 A;  4PC6 A;  1HBX G;  1U0J A;  3QAH A;  5IYD J;  1P7J A;  1BMF A;  1SKY B;  1GDT A;  2VT2 A;  2BX6 A;  1KCD A;  3OS0 A;  4HEA 2;  1Y1W J;  1BR1 A;  2Q1Z B;  4WK8 F;  3A35 A;  5CDF A;  3KEQ A;  4UHT A;  2P8T A;  1BA5 A;  1MKM A;  3H1C A;  4PJN A;  1IA5 A;  1ERD A;  3ZPP A;  1XSD A;  2G0E A;  5E3N A;  1KK2 A;  4G9Y A;  1VI0 A;  4B44 A;  5FKM A;  5F0H A;  3CCS I;  4EGY A;  2CF4 A;  4URR A;  2BZT A;  1N8R D;  1H8H A;  1VQN I;  3OOC A;  2Y30 A;  1JB9 A;  3TOB A;  4RB1 A;  2WAQ A;  3HRU A;  1ZUN B;  2VQC A;  4DNR B;  1QCX A;  3K4C A;  1TT0 A;  2VFM A;  2CMP A;  3L2R A;  4OJL A;  5IYP A;  4D7N A;  2AHQ A;  1W87 A;  3IAM 2;  3RDI A;  4FQG A;  5DS0 A;  3GTL J;  1HA3 A;  2FUG 2;  3BH6 B;  2MSY A;  1WHU A;  3D0S A;  3WTV C;  4A3C J;  2FQ4 A;  1NG7 A;  4TMT A;  4G94 A;  1Z05 A;  2YU9 J;  2C4U A;  3EUH C;  1L0O C;  3A03 A;  4OPO A;  2CQN A;  3W5V A;  4V02 C;  5CVU A;  2KJC A;  1ETX A;  3GTQ J;  1Y6I A;  3AG2 H;  3KRG A;  4BBS J;  5FKL A;  2FBK A;  1Y0Y A;  2XC1 A;  3WG7 H;  3QOP A;  3B73 A;  1QU3 A;  2ZJQ F;  4X8I A;  1WJF A;  1W2B B;  4GO1 A;  3CPW B;  4JRA C;  1VLO A;  3FX3 A;  3KLN A;  1BX0 A;  3QYB A;  4HE5 A;  1I6X A;  2MAB A;  2COM A;  3KP3 A;  2F5D A;  2EIJ H;  4P55 A;  2PBI A;  1YOV B;  4IRI A;  3GVA A;  4L5J A;  3NE5 B;  3S32 A;  1E2X A;  3OW2 B;  2CUJ A;  2MW8 A;  3C2H A;  1I18 A;  1WQ2 A;  5EZH A;  4I02 A;  1HW5 A;  1O3T A;  3T51 B;  4RB0 A;  2KJB A;  1HC8 A;  2XTX A;  1LFU P;  4BQQ A;  2ZL5 A;  4FX4 A;  1W36 C;  1IDJ A;  2HXI A;  2RAE A;  2XGX A;  1CQX A;  2IBD A;  1ETQ A;  2NRA C;  4LG0 B;  3A8I A;  5L3B A;  2X85 A;  4RCY A;  4X0G A;  1OB2 A;  5KAI C;  5TRD A;  2GJK A;  2DQR A;  4QTR A;  5DCM A;  3Q0U A;  3CDI A;  4JOM A;  1GUU A;  1VQK I;  2M45 A;  4A3L J;  3MEX A;  2DJN A;  2Y75 A;  2ZJR F;  4A6E A;  2DOF A;  4YAO A;  3KYC B;  2YU3 A;  1YIJ B;  3GSI A;  2X0L A;  2MGQ A;  3RIR A;  4IVN A;  2IJL A;  3T5X A;  1X4P A;  4P6V F;  3PNY A;  3GME A;  3W6K B;  2HOE A;  5EYR A;  3H3U A;  1GJR A;  4EJU A;  3U6K A;  2DET A;  1WOS A;  1LNW A;  4CUG A;  1UZC A;  1JTY A;  2JTV A;  1PKV A;  2PYH A;  3GVJ A;  2VB6 A;  4AYB A;  1EV7 A;  2BEO A;  3HHH A;  1Z3Y A;  2ISZ A;  5FL7 A;  2XSJ C;  2HQR A;  2P6S A;  3GFI A;  4ROX A;  4BUP A;  5J1U A;  2MLG A;  3AL0 B;  2O6W A;  5A8A A;  4Z6Y A;  2IA0 A;  1XQB A;  3QE2 A;  1POG A;  1QVF B;  3TOA A;  4XKC A;  4C3H J;  4LBZ A;  2HVR A;  1HST A;  3I5U A;  4G6T B;  4RGU A;  3RPU A;  1EZG A;  4ENJ A;  1FNC A;  2D5V A;  2F4M B;  2VFQ A;  1S6L A;  5DM6 F;  2PLF A;  3LO8 A;  2CW5 A;  3VMF A;  4OIQ F;  4YFO A;  1FNB A;  5JHF A;  3CES A;  2GIV A;  4AYB N;  3AK5 A;  1R6R A;  2B7C A;  3BR6 A;  4FE7 A;  2V9V A;  1U9N A;  4A6D A;  4C9Y A;  5K5Q A;  2DI3 A;  1KU9 A;  3DU5 A;  3I53 A;  5EGO B;  4HWV A;  3H94 A;  4I99 C;  3GQA A;  2O3F A;  1JGS A;  2CV2 A;  1IRX A;  1IN7 A;  1IN6 A;  1M1K D;  3ZBT A;  3J81 K;  3WTX C;  4AM3 A;  1KK0 A;  1KMH A;  1HQC A;  1P4A A;  1KQS B;  4M71 A;  4E4H A;  2OF7 A;  2DOE A;  2ADU A;  3OIO A;  4ZYA A;  2K7L A;  2UV1 A;  4D5F A;  1JGG A;  3JR9 A;  2GRE A;  3AVV A;  1MBF A;  5LEJ A;  4M9S A;  2DT7 B;  3G4S I;  1JA0 A;  1BN8 A;  1AU7 A;  2R7F A;  3OYC A;  4BQA A;  1OCC H;  2EJR A;  1K8F A;  1NDH A;  1FX7 A;  1ZTR A;  4BY7 J;  4JX5 A;  2K9L A;  4C3I J;  1SAU A;  3F6V A;  1ZGJ A;  3BR3 A;  1SD5 A;  3BPX A;  1R1V A;  1X3W B;  3FDY A;  4C30 A;  4HQE A;  2GPJ A;  1QNT A;  2VFO A;  1LE8 A;  2JN6 A;  2K40 A;  2ZC2 A;  4OU0 A;  3VPR A;  2LVS A;  1UMK A;  4C43 A;  2R7T A;  3G4S B;  1UD8 A;  3CCE B;  2OK8 A;  1OCZ H;  2VL8 A;  4PC2 A;  1U2W A;  3PUB A;  4QIW N;  3KP2 A;  4BKX A;  3RI4 A;  2CV0 A;  3IWZ A;  2H09 A;  2HPI A;  5AIQ A;  4ZZL A;  1JKQ C;  5JVT A;  4ZTJ A;  1QQ1 A;  2GXB A;  1WJB A;  3O2P E;  1ZRF A;  3OYA A;  2A05 A;  1R7J A;  1TBX A;  4G12 A;  1JT6 A;  2BV6 A;  1MRZ A;  4MO7 A;  5GAD J;  2PN6 A;  2Z3Y A;  2EIM H;  2QA4 I;  1F20 A;  2LTP A;  5ED4 A;  3AAF A;  3MZY A;  1JHF A;  4LGW A;  4OZZ A;  3SQN A;  2WSS A;  2W6I A;  3EYY A;  2P7V B;  3CCJ I;  1MSE C;  2O6G E;  3ELK A;  4F93 B;  1ETW A;  5J4V A;  4CGZ A;  3E97 A;  4CH7 A;  2R7U A;  3LOC A;  4TMW A;  5F6F A;  4DYQ A;  1FP2 A;  3SZT A;  3F72 A;  2PX9 A;  5C1C A;  3T0Y A;  1V0F A;  2X51 A;  3IKT A;  2RQP A;  1J09 A;  3FJO A;  5D5W B;  4FWT A;  1D8T A;  2M0C A;  3CCM I;  3AVX A;  4M6Y A;  5E1X A;  4XR6 A;  3Q6Q A;  3EQN A;  3AG4 H;  2DIE A;  4RM0 A;  1WSU A;  3GBG A;  4FIS A;  1I1G A;  2L54 A;  2NVU B;  5FKN A;  1YTY A;  5HXB A;  2D45 A;  2NTQ A;  3LAP A;  3B90 A;  4OPS A;  1P92 A;  4BQO A;  3U6B A;  3J81 Z;  3RKY A;  2Y9Z A;  1R58 A;  4NBQ A;  2VBT A;  3SJP A;  4NNJ A;  5IT3 A;  4PGO A;  1FRN A;  5GV8 A;  4R8H A;  4G7H F;  2E19 A;  1T0F C;  3C3W A;  4OM9 A;  4Z06 A;  5DCF A;  1SFE A;  3SLN A;  2IW5 A;  3LSK A;  4HNV A;  3FZV A;  4Y9R A;  1YJN I;  3Q3A A;  1OIS A;  1S29 A;  3OYE A;  4A5N A;  4LFU A;  2CW8 A;  1OYW A;  1U5T C;  3BLY A;  3ONQ A;  4MTE A;  5FB2 A;  1PE9 A;  4JP0 A;  4HZF A;  2CG4 A;  2EV5 A;  1FTT A;  3S8P A;  5LLQ A;  5K7Z A;  3GVK A;  2F5E A;  2ZFU A;  1W36 D;  1XX5 A;  2Z9O A;  2JUC A;  2IEK A;  1IHM A;  1T6Z A;  4XRS G;  3OP1 A;  2K3F A;  2V7W A;  3FM5 A;  5HNF A;  2D3L A;  2XT2 A;  2XSD C;  4UB6 C;  2KFD A;  2ELK A;  3E6D A;  5HDG A;  4KMF A;  1KK1 A;  5HDN A;  1WOR A;  3CCY A;  4OIR F;  3RY8 A;  2R7W A;  4I76 A;  4V2F A;  1LEA A;  3ZN0 A;  3H92 A;  1R5B A;  4Q7J B;  4MTD A;  3CC7 B;  3GFL A;  2VPR A;  3BTI A;  2HOA A;  4DZJ A;  1TVC A;  2WJY A;  2Y48 A;  4BJT A;  5F1J A;  4B47 A;  2Q2E A;  2E2J J;  1Y8R B;  1WI3 A;  3LAJ A;  1S0U A;  2HCJ B;  2G9W A;  3B78 A;  4CDG A;  4O3M A;  5LBQ A;  2NOG A;  3CZ6 A;  5FLV A;  4P9F A;  4Z4R A;  1VJS A;  4P22 A;  2O1D A;  3HBL A;  2ME0 A;  2DW4 A;  2FRH A;  4HPQ A;  4ZYH A;  1EP1 B;  5C1E A;  1ETK A;  3BZK A;  4PZJ A;  3I64 A;  1YHQ B;  2JIZ A;  2VXD A;  4M73 A;  3F3X A;  2XND A;  5TGT A;  3VOD A;  3V76 A;  5CLS A;  1R9T J;  3GYH X;  3ES9 A;  2JRT A;  3K4L A;  4BNC A;  5L46 A;  3DPT A;  2CUE A;  3L00 A;  5E1Z B;  3TBI A;  1QVG B;  1IXR C;  4W8Q A;  1GHC A;  1O3Q A;  4B3F X;  2XGE A;  3KIO A;  4ENM A;  2H94 A;  1VTN C;  1F4K A;  2GJR A;  4IF4 A;  1FRQ A;  2NV4 A;  2N8G A;  4FN5 A;  3K4J A;  1ACI A;  1R5I D;  1MMG A;  1Z67 A;  1MBE A;  1UHM A;  5E3L A;  2L9S A;  2PMZ A;  1ETV A;  4M3G A;  4IHT A;  4P12 A;  3JSP A;  2KIS A;  1TC3 C;  2VON A;  2KKO A;  2DO7 A;  4QPO A;  5L3D A;  2EIL H;  3IL2 A;  1NK2 P;  1DAB A;  3M1C A;  5IPA A;  2I8D A;  4IHW A;  4P6Y A;  4BXX J;  3CDH A;  2QTZ A;  4EQQ A;  4II2 A;  3VOE A;  3HTU A;  3L9F A;  5D8L B;  3BY2 A;  3ECH A;  1XPX A;  1JRG A;  3T1B A;  4XOP A;  4ZYD A;  4LIU A;  3RKQ A;  3ZZ0 A;  4E7H A;  3F0C A;  3B6C A;  1AKH A;  3ZPL A;  4PDK A;  3K9T A;  3F23 A;  1H88 C;  2DA6 A;  1O8J A;  1QQI A;  1Y0N A;  5M5X J;  2WAD A;  4CO8 A;  3E5Q A;  1DDI A;  3QYF A;  2DA4 A;  1RZ4 A;  4Z1M A;  3OMY A;  2GA1 A;  2E7W A;  2QQA A;  2LSO A;  3G2B A;  1UST A;  3OYK A;  2XC7 A;  4J0Q A;  2G7H A;  4KIG A;  4EAT A;  1X2N A;  1Q81 D;  5CQG A;  3BG9 A;  1WH7 A;  1SFX A;  4EM2 A;  2RC6 A;  2LMD A;  2IA2 A;  3WNC A;  1REP C;  1HA8 A;  1P4M A;  2R5Z B;  2XOK A;  3JTH A;  3V8K A;  2K9M A;  3TQN A;  1X1C A;  3SYT A;  1OCP A;  3VWB A;  1AIP A;  3G3Z A;  1KYW A;  4Z2Y A;  3FY3 A;  1VQP I;  3L1P A;  4DQL A;  1BIB A;  4F7Z A;  4ZCM A;  3PUM A;  2JN9 A;  1YW8 A;  5D4S A;  1MH4 A;  4M3E A;  2IS2 A;  1UJ8 A;  3IH2 A;  3ZMZ A;  3DBH B;  1FZP B;  1XMA A;  3SQV A;  4BE1 A;  5F4M A;  3I71 A;  4XIC A;  1ZR2 A;  2HZD A;  2LC2 A;  3ZIA A;  1QRC A;  2R3S A;  2F48 A;  3G1O A;  5ERI A;  1YX3 A;  1KON A;  1KJZ A;  4W8T A;  1GVD A;  1VQ9 I;  2OJE D;  4G7Z F;  1VQO I;  3A4C A;  4KIC A;  1BBY A;  2QQ8 A;  2R7Q A;  3AG3 H;  1HF0 A;  1S8N A;  1V0E A;  3KYL A;  2ZO4 A;  1HKS A;  3BTL A;  2OQR A;  2ZME B;  1QHH D;  2JVG A;  3DKX A;  4IXA A;  3L2W A;  1OFL A;  2PEX A;  3FXU A;  4A3I J;  4YEJ A;  5L3G A;  3NB2 A;  3SY2 A;  3WOD F;  3Q0V A;  1IRZ A;  3K1M A;  1R00 A;  2A6T A;  2R92 J;  1T6X A;  3VMV A;  3VDX A;  1LM1 A;  1OCR H;  2VI6 A;  2VJJ A;  3OYH A;  1X1B A;  1I39 A;  2E1O A;  1OFE A;  4XOR A;  2O03 A;  2IGM A;  1W0K A;  2VFN A;  2BOL A;  2Q0O A;  4ETS A;  1JTX A;  5C4X J;  2PMD A;  2I10 A;  1QX4 A;  2EIN H;  2F3L A;  1O3S A;  2V1D A;  3CD6 I;  2M8E A;  4Y13 A;  4QLC U;  2OA4 A;  4YAW A;  5F64 A;  1S7A A;  2BGC A;  5CPR B;  4U7D A;  5M3F J;  1SC7 A;  3HC7 A;  3A01 B;  5J47 A;  4KIT B;  3M07 A;  1Z9C A;  2LDU A;  3OOU A;  5L3F A;  2Q6O A;  1HLV A;  1GAQ A;  5H6Q A;  1JNY A;  3EDP A;  2V1N A;  1XG1 A;  2HXO A;  3KP6 A;  1HW2 A;  4G7X A;  1WXR A;  5JLV C;  2ME6 A;  1E62 A;  1HXD A;  3Q9S A;  4RM3 A;  4RCZ A;  1N25 A;  3BTC A;  1FTZ A;  3GQ9 A;  3W5U A;  4UUT A;  2LNB A;  1TTT A;  2NVT J;  3CMY A;  1ORK A;  3BQY A;  1ZKG A;  4XKW A;  1VQK B;  5F1R A;  4PJ0 C;  4EJT A;  3Q39 A;  1RKW A;  3G1M A;  1E79 A;  2DCU A;  1O88 A;  2DOD A;  4WZK A;  1H9T A;  5F4J A;  1WI9 A;  2HKO A;  2XDV A;  1J7K A;  2V9K A;  2NST A;  5FD5 A;  3GTM J;  3LQR A;  1DP7 P;  3IRR A;  1T98 A;  3OS2 A;  5FKK A;  3CLO A;  4IHV A;  1T39 A;  1ZQ3 P;  3CJT B;  5BPD A;  3F8C A;  3FM3 A;  2IRF G;  3ZQF A;  4RMN A;  3KP4 A;  1P4W A;  4R79 A;  1IV8 A;  3LSR A;  1G6N A;  1R36 A;  3RZO J;  1OKR A;  4E7J A;  2CND A;  4I0A A;  4OOS A;  1K4S A;  3EQO A;  4RS8 A;  1KTW A;  4GDF A;  3RPU D;  1IGN A;  2PYG A;  4P96 A;  1ZG3 A;  2R4G A;  5EDN A;  1PP8 F;  2E1B A;  4DQK A;  4YEI A;  1ZLJ A;  2KDZ A;  4XLF A;  5IYB J;  4ZV4 A;  2ZSI B;  1DDG A;  1X1A A;  2DA7 A;  3I4N J;  3RCO A;  1B9M A;  4Z4W A;  4CCK A;  3AVU A;  4IRG A;  2XKP A;  4RAF A;  1OMI A;  1N0V C;  2QEX B;  2D74 A;  4AC0 A;  3DEW A;  4L9N A;  3Q3S A;  3VSL A;  1BI3 A;  4CZC A;  5AN9 A;  1PJ6 A;  1A6Q A;  2JZY A;  2DT5 A;  4OOI A;  3FHN A;  1BHE A;  1GLN A;  2B7E A;  3SEZ A;  4BGD A;  2DXI A;  3WTY C;  4DQ2 A;  2E60 A;  3BG5 A;  1GV5 A;  4XRM A;  2OTJ I;  4YZQ A;  4PFO A;  2EPF A;  5TJJ A;  4XMY A;  1EJ9 A;  3S2H J;  1FX0 A;  1PVE A;  1EFT A;  4F55 A;  2P0W A;  1MDM B;  3R6S A;  3DXJ F;  2ZZG A;  2P4W A;  1FSH A;  2FBI A;  1FT9 A;  3I55 B;  4XM3 A;  4FAS D;  1V55 H;  2BPO A;  4MR0 A;  4FXU A;  3HRS A;  2XPU A;  2JJ1 A;  4HV6 A;  2V7Q A;  1CF7 B;  3GXO A;  2G7U A;  2Q6I A;  3ABK H;  4YZ0 A;  1O8D A;  4JK1 X;  2JQ7 A;  2DMN A;  4ESB A;  4WF2 A;  4EH1 A;  1D1A A;  4UVA A;  4RLF A;  3HOX J;  2HKX A;  2MBF A;  3B6A A;  1U2R A;  1B72 A;  1E3Z A;  3ZQI A;  3QPT A;  4HE6 A;  2VJ5 A;  3C18 A;  4JX4 A;  3A1P A;  2VBM A;  4BBR J;  3MCA A;  1AWC A;  2V7X A;  3SJZ A;  3GIR A;  1QFJ A;  4RD6 A;  1A6I A;  3JAM K;  1YW9 A;  3P5J A;  1GXQ A;  3S3N A;  1KK3 A;  5F0C A;  1T2K A;  1SMT A;  1WOP A;  2B5O A;  5C3E J;  2F5C A;  3W2A A;  3M1E A;  3QPS A;  1OQY A;  5E3M A;  3FHZ A;  5EMN A;  1T33 A;  4I0B A;  4UUS B;  3OYM A;  2OZ6 A;  2FF4 A;  4PJL A;  1L3L A;  2IPQ X;  4QFM A;  1IV6 A;  4L0Y B;  4Z05 A;  1W5S A;  1QA1 A;  3U9G A;  2LFB A;  3I54 A;  2QSG X;  1IUY A;  4G6I A;  2QGG A;  2LY9 A;  3S1Q J;  5DTD A;  3NRV A;  4ZTF A;  2PI0 A;  4PAA A;  2XF7 A;  2GLO A;  1HDP A;  4A3M J;  1G3S A;  3VB2 A;  1N07 A;  4QSH A;  4XRS A;  1MH3 A;  5H59 A;  3LSI A;  5LGN A;  2ID3 A;  2V4J C;  2ZKZ A;  3HRM A;  5FFZ A;  4LG0 A;  2DMP A;  3CMA B;  1UMQ A;  1K5C A;  1EWY A;  4IZZ A;  1XS9 A;  4KKT A;  2O0W A;  4L18 B;  2W84 A;  3FPP A;  1YI2 B;  2MD5 A;  2QKM B;  3L7W A;  4WX9 A;  3CUQ B;  3EYI A;  2L01 A;  2DOA A;  3H5N A;  2HDC A;  1S4M A;  1TYV A;  3KET A;  3CP2 A;  4I7H A;  3Q5F A;  5D8K B;  3PO3 J;  2E5Z A;  2BBY A;  1MW7 A;  5B3S H;  5IOY A;  4PCQ A;  5H6R A;  3ZQ7 A;  3R4K A;  2W6J A;  1NG6 A;  1BM9 A;  3H5A A;  2CU7 A;  2WAF A;  3G1L A;  2EB7 A;  5J8F A;  3J7Z I;  2K5C A;  4L9T A;  1TUI A;  1ULY A;  1PUF A;  1U9O A;  3IH3 A;  2ZL6 A;  3AGQ A;  4JMQ A;  2WJV A;  4AVP A;  2DQL A;  4U0V A;  1BJA A;  4XBF A;  4RBO A;  1EXM A;  2HWV A;  2P3M A;  3CCL B;  3HG9 A;  5HLT A;  4RD4 A;  1IB4 A;  1IJW C;  2DPU A;  2MG4 A;  3QFT A;  3OAA A;  4ACB A;  1DGW Y;  1R49 A;  2BY0 A;  1U5T A;  1VHO A;  1W9X A;  1Q1H A;  2PMZ N;  3HM5 A;  3HGY A;  4RLQ A;  1W34 A;  4N9I A;  1YLO A;  5C4J J;  3BT9 A;  2F1M A;  1VQ8 B;  2BHY A;  2DA2 A;  3JCU C;  4EJO A;  3AGP A;  3DEU A;  5HLI A;  2Z6B D;  2GXA A;  4RGX A;  2ZL7 A;  4Y7C A;  2HYJ A;  2DLL A;  3W2F A;  3F8B A;  5A2Q K;  3WHB A;  1X1P A;  2B7B A;  3WBJ A;  4CCM A;  3TDZ C;  3DU1 X;  1BJK A;  4DNT B;  3ASR A;  4H4K C;  2EA4 A;  2ZBV A;  1V5E A;  2MH2 A;  1J0R A;  4W1U A;  2YX4 A;  1X1D A;  2BE5 F;  4CCN A;  3OZU A;  1QRB A;  1QA2 A;  2VNI A;  4NQW B;  1A5J A;  2LP0 A;  2RQQ A;  4GFB A;  3A01 A;  1ZAR A;  5LRS A;  3N4M A;  3TP3 A;  1WOO A;  4PC1 A;  3LSJ A;  1XB4 A;  3MD2 A;  4Z4Z A;  3VNU A;  3GW2 A;  2A07 F;  4E7S A;  4RGR A;  4UZE A;  1EP2 B;  5FRO A;  1TLH B;  1LPQ A;  1GO2 A;  4FET A;  2HYF A;  4YAF A;  3V7R A;  1DQU A;  3KEY A;  1IG7 A;  3H36 A;  3CRZ A;  2GOM A;  3E6B A;  1PUF B;  1UD3 A;  3E1Y E;  1TLL A;  3AVT A;  4G1V A;  2E1N A;  1VQL I;  1H8A C;  2MFZ A;  4UZF A;  2BVM A;  1OGM X;  4RJL A;  1T5E A;  2CQQ A;  3QPH A;  1G2H A;  3HSR A;  2ZBK A;  2EBI A;  5BSX A;  3JSO A;  4QUZ A;  1W7P A;  3FMR A;  2M3A A;  3JRB A;  4QVA A;  5KW9 A;  2VT3 A;  2VJI A;  3KE2 A;  5GPC A;  4E7Z A;  3ZQH A;  5KSW B;  3B82 A;  1UHW A;  2WB1 N;  2Z1D A;  4HNT A;  2BM5 A;  4ZDO A;  3ASS A;  2VXZ A;  5HOD A;  3HHG A;  3K70 C;  3CJQ B;  3GUD A;  5E17 F;  4X7D A;  2V5I A;  5EF6 A;  1G3T A;  2BM6 A;  3SZE A;  4B3G A;  1YFH A;  4YC5 A;  5LHH A;  3N90 A;  3WWG A;  4XOT A;  1KGS A;  3RKW A;  2D1V A;  1OHH A;  4IPA A;  4F52 A;  1TWA J;  2KRF A;  4EJV A;  1B23 P;  1YE9 A;  3CF5 F;  4X7C A;  3AKZ A;  2L0K A;  4KA4 A;  5TIS C;  1QGA A;  1ZEL A;  3H5R A;  5KCM A;  3OE7 A;  3HOY J;  4DJA A;  2DER A;  2FOW A;  5IYC J;  2LF7 A;  1GQ8 A;  5JLX A;  1U3E M;  1OCO H;  2Y9Y A;  2F4O B;  3NQO A;  1FNM A;  2HI3 A;  2NSP A;  3OOP A;  4O6J A;  2ZNZ A;  2KMU A;  3GFM A;  2VNJ A;  4FCY A;  2HQA A;  3P26 A;  4RAG A;  2XNJ A;  1IB0 A;  4G7O F;  1N77 A;  2O61 A;  4KT5 C;  4OAY A;  5IP9 J;  2XF6 A;  3TO6 A;  1SVM A;  1K9M D;  2UUZ A;  3SDG A;  1G4D A;  3GZ6 A;  4II3 A;  4YCQ A;  3I4M J;  3E3V A;  3EPZ A;  3D5S C;  1V5F A;  2EFO A;  4IHY A;  2L4M A;  1JA1 A;  1R4M B;  2R6H A;  3QFR A;  1HZE A;  3HIF A;  4X6A J;  3CF2 A;  3TED A;  4M0L A;  1BOB A;  1QUF A;  4RDU A;  1OYY A;  3WGH A;  1KQ9 A;  3TW7 A;  3K10 A;  4BAC A;  1QA6 A;  1O57 A;  1RMG A;  3OFN A;  2TRT A;  1BOA A;  2X1C A;  4OIO F;  3S16 J;  3CME B;  2BV3 A;  2QQ9 A;  3ASQ A;  3OYB A;  5BS6 A;  2X4H A;  2NTB A;  1GV2 A;  4ZYG A;  1VQ4 I;  4WWC A;  1CNE A;  2ZSH B;  2IS4 A;  2QZA A;  5B6I A;  2LRD A;  2F2E A;  4BHP A;  3K2A A;  4EMS A;  1RQR A;  2EQR A;  1QH0 A;  2M4G A;  3ZCO A;  2M9H A;  3ZOB A;  4ZH4 F;  1W1W E;  3DWL E;  2FQ3 A;  2ZB9 A;  3CC2 I;  2AHO A;  2L3D A;  3V7A A;  2PEC A;  2ZZF A;  4PK4 A;  4HDU A;  4HV5 A;  3GZN B;  2O0V A;  1O8L A;  4IO9 F;  1H80 A;  3EUH A;  3ULQ B;  2PMH A;  1D1B A;  3GEZ A;  3MKW B;  3KEW A;  3WND A;  2DDB A;  1OOC A;  3IUO A;  3KZY A;  3A2K A;  4EVI A;  1FEX A;  5IP7 J;  1UCR A;  3QRF F;  2JA8 J;  2FOK A;  2BN4 A;  2ZBU A;  1BI0 A;  1NB0 A;  3UW0 A;  2X48 A;  4HRI A;  3K4B A;  1H89 C;  3LA3 A;  4YIR X;  2FJ1 A;  1I3Q J;  1Y39 A;  1HCR A;  2C4T A;  4YZX A;  2HEO A;  3HJE A;  3H09 A;  3JRG A;  3N6Z A;  5DS9 A;  2DA3 A;  2TCT A;  3PVD A;  5E6T A;  2RV8 A;  1G3Y A;  4U0Y A;  3SKB A;  4HLY A;  5FO5 A;  3FMS A;  2VBZ A;  3WE2 A;  1N78 A;  4ENN A;  1WP6 A;  4E7K A;  5L3C A;  2WPD A;  5THX A;  1KCC A;  2XUB A;  1BLI A;  2QCO A;  3JAM Z;  1N05 A;  1R1U A;  3SDB A;  1MNM C;  1QRY A;  2O8X A;  1LVA A;  3CJR B;  4L9V A;  4C0S A;  4KUM A;  2H6B A;  2HZT A;  4OWR B;  1VQ7 I;  2HS5 A;  1TYX A;  4RGS A;  2CWE A;  3L2Q A;  2E34 A;  3R60 A;  3PNV A;  4MLO A;  4ZC3 A;  3IV5 A;  2R7X A;  1LB2 A;  3HKZ A;  4OIN F;  1TP4 A;  1FOX A;  3HXL A;  3OL4 A;  5LD2 C;  3DTI A;  3GQB A;  4XLN F;  4M3D A;  2ZZE A;  2B0R A;  1P2F A;  3FIW A;  2JRM A;  3PFY A;  2O9L A;  4W8R A;  2YWF A;  5LHI A;  4ZDL A;  3FKS A;  2M0M A;  3NWS A;  2UXX A;  4XON A;  2ZZQ A;  1TW3 A;  5FFX A;  4ABZ A;  1O4X A;  2M8G X;  1MD0 A;  2BXY A;  1QFY A;  3CCQ B;  3PQK A;  3GVL A;  1K73 D;  4PSX A;  1SAX A;  1WJ5 A;  4ESF A;  1AIR A;  2KLO A;  3W2G A;  3MQ0 A;  2OK7 A;  4BE2 A;  5AMV A;  2CK3 A;  4IQ4 A;  1COW A;  4W8S A;  1MMN A;  2JPB A;  2NNN A;  1UG2 A;  2EZH A;  3HPH A;  3OL3 A;  3U1K A;  4H0E A;  1QBJ A;  2LKX A;  2XZO A;  1S72 I;  2CW0 F;  1Z91 A;  3BJO A;  1OYI A;  1J75 A;  3MHP A;  1S72 B;  4C2L A;  4TKO B;  1TZL A;  1WTH D;  5IYR A;  1B8I B;  5J8C A;  1Q82 D;  1XDU A;  1TQP A;  4BHB A;  1JKO C;  3E20 A;  1FY7 A;  1I1S A;  1E63 A;  3U1D A;  3BJ6 A;  4QVJ A;  2B9S A;  1X19 A;  3KZI C;  2VBY A;  3HKZ N;  1HF2 A;  3REO A;  4QV2 A;  2VKV A;  3A8K A;  2L9N A;  3JRH A;  4HF2 A;  4X05 A;  1S3J A;  2FU4 A;  1V5G A;  4YII A;  1XN7 A;  1FBQ A;  3LWF A;  1Z6R A;  3QYE A;  4CSW A;  2KHM A;  1JI8 A;  2W85 A;  3HOV J;  1F43 A;  3HUG A;  4HF0 A;  2JJ7 A;  4Q5S F;  4U0W A;  4Y33 A;  2E7X A;  3E0J B;  1VQ8 I;  1F60 A;  2Z33 A;  4TT3 A;  3ASP A;  1B9N A;  5HS7 A;  3M8E A;  3FMQ A;  4UV9 A;  2EIK H;  5DYM A;  1SMY F;  2X6X A;  3ZUG A;  4Y52 J;  3IP4 B;  3CW2 A;  1VF9 A;  4OOV A;  4X07 A;  4OPW A;  4FHT A;  2KIM A;  1R23 A;  4BAY A;  5M3M J;  3SEQ A;  3VSV A;  3LQE A;  2GM4 A;  2GWR A;  2F1L A;  1FIP A;  4GYG A;  2CV1 A;  3MMY B;  2AQF A;  3FK7 A;  3PSZ A;  1WJD A;  2OYN A;  1D0X A;  3S1R J;  3OV8 A;  3FXK A;  3RQI A;  2COB A;  4LLN A;  4HX8 A;  2DPD A;  4CCO A;  1OGI A;  3NEU A;  2W4S A;  3MZ8 A;  3H0G J;  1BIA A;  1ZHF A;  4E0F A;  5K5O A;  4D5C A;  1JJ2 B;  3VNV A;  4Z4U A;  5CJ9 A;  3DP7 A;  1X3U A;  4AIK A;  5BNG A;  4YAL A;  2EV6 A;  3MAJ A;  1U6G A;  3IHU A;  3B8H A;  2MD0 A;  4PGH A;  1WMR A;  5CQE A;  4Y17 A;  1XCB A;  4KN7 X;  1BN5 A;  3ZQC A;  1D5Y A;  5EJC A;  2QDX A;  2KT0 A;  3HOS A;  3FBN B;  3OJX A;  1X3Z B;  2VKD A;  1RUO A;  4OJP A;  3C2B A;  2QEN A;  2QSH X;  3PA1 A;  1LLZ A;  1YLF A;  2YWE A;  1X58 A;  3I59 B;  5JBQ A;  3GF2 A;  2ZTG A;  3LQ6 A;  2LR8 A;  3CO6 C;  4M72 A;  1KTV A;  1IXC A;  2PE3 A;  2ISY A;  2K27 A;  3E1S A;  3LSG A;  2OBP A;  4WXC A;  3SJM A;  1MMS A;  2I1L A;  2XRO A;  4YFK F;  1FMV A;  1CF7 A;  2M5W A;  4YAU A;  3MVP A;  4I01 A;  4OOX A;  2YPR A;  4XLH A;  5JHU A;  2DTR A;  3J80 K;  3J80 Z;  3GQ8 A;  1MBK A;  2X53 S;  4HST A;  3CUO A;  2QQB A;  3V8L A;  5LGU A;  2UZK A;  3I1F A;  3CCV I;  3QP6 A;  1JXS A;  3W2H A;  1IAW A;  1HOM A;  2PQ8 A;  1YRN A;  1ZYR F;  1VBL A;  1O7L A;  3TKY A;  2XHK A;  2ZCW A;  4F91 B;  2EFQ A;  1LLW A;  2VFP A;  5KVR A;  1ZRD A;  1LVK A;  4BY1 J;  1WWX A;  1EH7 A;  5E18 F;  2QTL A;  2ECB A;  3BWG A;  2VLA A;  2J8K A;  2OTL I;  2H8R A;  3P4G A;  5EG0 B;  1YS7 A;  1UFM A;  2V9P A;  1TTY A;  3F21 A;  2VQG A;  1FDR A;  5TV2 A;  1I27 A;  1I5Z A;  2DT6 A;  1VQ9 B;  5DV5 A;  1FIA A;  1FYM A;  3V7C A;  2P81 A;  4B09 A;  4DYC A;  4U7B A;  1UG0 A;  1Y1V J;  4DZP A;  4UY8 I;  3B8Y A;  1UD2 A;  3RKX A;  3S3M A;  2NVY J;  3SLD A;  3F8F A;  1A31 A;  2FA5 A;  1FYK A;  2MLK A;  4B8X A;  2C6Y A;  4A12 A;  3B02 A;  3CPX A;  3JX8 A;  3R6J A;  2EFG A;  4LMY A;  2A6E F;  2MC3 A;  5J35 A;  4ASU A;  4J19 A;  2FEZ A;  3GLL A;  1IDK A;  2NZM A;  4NC8 A;  4MEX F;  2X0K A;  3CP8 A;  2RGV A;  4PFP A;  4ZCL A;  1VQ6 I;  1VQM I;  3VST A;  1K61 A;  1MND A;  2QKL B;  2HVQ A;  3ASO H;  3PUF A;  2GBY A;  2A61 A;  4DNC A;  1K79 A;  3VYT B;  5DN6 A;  3TDU C;  2GA2 A;  1T08 B;  2XAU A;  1OB0 A;  4UVB A;  2ZIT A;  1E3P A;  3ZGK A;  1YX2 A;  5DCM B;  2JUG A;  3H0D A;  2BW3 B;  1R22 A;  1JJ8 C;  1XGO A;  2Y0M A;  1BW6 A;  1GR1 A;  4DBR A;  3FXL A;  4XN0 A;  1VQ6 B;  4BDZ A;  3BC9 A;  2V1U A;  3V7S A;  5J3L A;  2VNH A;  2EZK A;  1PLU A;  2VJ4 A;  4G8X A;  2C77 A;  2DMQ A;  2XNC A;  5ICF A;  3AG1 H;  1FPQ A;  2NS0 A;  2CFO A;  3IH4 A;  1T6Y A;  2DYR H;  1TQI A;  2JSC A;  2CW7 A;  4IL6 C;  2DCE A;  2KQR A;  1E64 A;  1M1E B;  3D26 A;  5TY0 A;  2BVL A;  2X6Y A;  1K83 J;  3LMM A;  2XTW A;  2KRH A;  3CB4 A;  1NJI D;  1TNT A;  1ITY A;  1QGY A;  4NK6 A;  4TMZ A;  2JA2 A;  1BPL A;  2I5U A;  4S05 A;  1AA7 A;  1QZE A;  2C5B A;  2X3U A;  1SVO A;  1XMX A;  4BU2 A;  5FO1 A;  4XD7 A;  4Y3O A;  2D9R A;  4LB5 A;  1RI7 A;  3Q9V A;  4ASN A;  2OTL B;  1SM4 A;  1A35 A;  4X06 A;  4TMX A;  1IUF A;  5IYN A;  3IRQ A;  4Q47 A;  2CUF A;  3WXM A;  1W7P D;  2WV1 A;  2QGU A;  5BPI A;  5BQT A;  1DP3 A;  3FBI B;  1WSR A;  1WVR A;  3PEN A;  2GOX B;  3LSP A;  3ZN1 A;  5FRM A;  4PMH A;  1H8E A;  3BR1 A;  2KPM A;  3OSF A;  3CD6 B;  4CZZ A;  3G6E I;  3ISX A;  4FK8 A;  4XID A;  1FBS A;  5HZA A;  2NTP A;  1H9G A;  1SD7 A;  2Q6K A;  1XGS A;  3AST A;  1K4T A;  1ZGA A;  5GAE J;  4M3B A;  4M9Z A;  2P7C B;  2VZL A;  5IT9 Z;  4ZDP A;  1O7F A;  2VE9 A;  5GAG J;  2UVE A;  5ICG A;  5DM7 F;  3KFW X;  2RRE A;  2Y31 A;  4HYE A;  2IS1 A;  2EFP A;  3LMW A;  4XLP F;  2PJR B;  2ZXH A;  5A88 A;  1TYW A;  2VKH A;  3WGI A;  2CSO A;  4XQF A;  3NAR A;  3RSN A;  5H2F C;  1EFU A;  3CC7 I;  1B1B A;  4NCN A;  3GWZ A;  1R4N B;  1P6R A;  4U9U A;  4CYC A;  3OYF A;  2HDW A;  2ETH A;  2D1H A;  2EV0 A;  4FTH A;  4P2N A;  3BZ6 A;  1MDM A;  5H5J A;  1DBO A;  4MHG A;  2DOG A;  2O17 A;  4YFN F;  3UR3 C;  4A3J J;  3ABU A;  2XGJ A;  2VIX A;  3ABL H;  2ZXI A;  5DSZ A;  3W2W A;  2PFB A;  3WNB A;  1KD1 D;  2P6T A;  2GJP A;  1E0E A;  4TSF A;  4RD2 A;  4Z4S A;  3PIO F;  1K8A D;  5FD6 A;  3ZXS A;  1F9N A;  1VFC A;  4PC3 A;  3OR1 C;  3A0H C;  2RNG A;  1OJL A;  2WV0 A;  5HLH A;  2GZW A;  1MMA A;  5EZG A;  4XN3 A;  3T8R A;  9ANT A;  3DFG A;  2K4J A;  5BOX A;  1KZL A;  4B4D A;  5FLX K;  1YJ9 B;  3BG3 A;  2VKE A;  1WH5 A;  2YS9 A;  2F5F A;  3T9G A;  1ELO A;  3LL7 A;  4UV8 A;  2RDP A;  3ASN H;  2NVX J;  4B3A A;  4FX0 A;  4KN4 X;  4RPB A;  2VYQ A;  1BI1 A;  4KIB A;  1P9Q C;  3LNQ A;  2QBY B;  1XTA A;  4F3Q A;  5ILV A;  1OB5 A;  4AF6 A;  4HX7 A;  2D3N A;  2W25 A;  1H42 A;  4X7E A;  3I56 B;  3FF5 A;  2HTJ A;  3RZD J;  3F6O A;  4IHS A;  3QPL A;  5CVR A;  5GPA A;  2OQG A;  4A93 J;  3CCM B;  3GCM A;  2HFH A;  2CS3 A;  4IX7 A;  1JUM A;  3CQZ J;  3Q38 A;  2M5S A;  2K02 A;  2VQL A;  3SFI A;  3ZPN A;  3DU6 A;  1HG8 A;  1RPW A;  4RDJ A;  2IS6 A;  4P9S A;  2WYR A;  1B6A A;  2LF8 A;  1ZM4 A;  3H3Z A;  3M8J A;  3TGN A;  5HNH A;  3I55 I;  1U78 A;  2H1K A;  2W7Z A;  2LYC A;  1B2R A;  2BM1 A;  1MJ9 A;  2HQ5 A;  2R0Q C;  1A04 A;  1WPC A;  4H9G A;  4A0Z A;  1AMO A;  4S0H B;  1PJ7 A;  3LJY A;  5HOO A;  4LBY A;  2X3H A;  4MGR A;  3HEF A;  2WZP P;  1B59 A;  1G7S A;  2XTY A;  4RDK A;  2ESN A;  4K2E A;  1EP3 B;  3RYP A;  1EKE A;  4DOZ A;  1ZRE A;  4NBS A;  2XT4 A;  3K4K A;  4M1K A;  3ZMD A;  1G7T A;  1DPR A;  5F04 A;  3JQQ A;  4CYD A;  4YHB A;  4BQN A;  4MEY F;  2QEX I;  4E70 A;  3E6M A;  5B1B H;  5TR9 A;  2WB1 A;  2VBU A;  5HS8 A;  4RAZ A;  3VMW A;  3OSG A;  4NK8 A;  2ZME C;  2WY7 Q;  3HUG B;  2R7S A;  3A8J A;  2M2E A;  2NPF A;  2JJ2 A;  2GK7 A;  3SEJ A;  3TH0 A;  1WKM A;  2CFX A;  2RC4 A;  2E2I J;  4P3Y A;  1OLT A;  1WJC A;  1RRJ A;  2K4B A;  2OU2 A;  3PJR A;  1WSV A;  4M2L A;  4OZY A;  3F22 A;  2DBB A;  1E43 A;  4HLX A;  4G1B A;  3DBL B;  1W4M A;  2JPC A;  1UB9 A;  3ZMS A;  1H85 A;  1XMK A;  3BRO A;  2OBS A;  4RB3 C;  3ZP5 A;  2LH9 A;  2Z5U A;  2L9R A;  3QU3 A;  1IZ1 A;  1Y0R A;  1W0T A;  4C3J J;  3TO9 A;  1BQE A;  4N3G A;  1R5G A;  1RKT A;  2Z16 A;  4BL0 B;  2KVO A;  3LA7 A;  1F36 A;  3BR0 A;  1J9Z A;  1EH6 A;  5D6E A;  3OR2 C;  2EWN A;  3KEO A;  1ONV A;  3RTR A;  1G59 A;  3SUC A;  2EA2 A;  5F0F A;  4J00 A;  2QF7 A;  3WY9 A;  2STW A;  3SZG A;  4G6Q A;  3C1D A;  1ZGW A;  1E1R A;  1YX5 A;  4UUS A;  1XGN A;  2DMT A;  2L7K A;  3OYL A;  3OW7 A;  5GV7 A;  3OYG A;  3CCU I;  2JVH A;  5K5R A;  4UUV A;  2DU9 A;  5E8I A;  1R5H A;  1W0J A;  4AIH A;  3W3C A;  4NC6 A;  4A0Y A;  2XGD A;  1GVJ A;  4XKV A;  2RNJ A;  3WTZ A;  2VBW A;  3TP0 A;  2Z8G A;  3QFS A;  2UXN A;  2CGP A;  4UAJ A;  4GRI A;  4ON0 A;  2C5H A;  2D2W A;  3A02 A;  5HKK A;  1IN8 A;  4Y15 A;  5E1W A;  3CCV B;  2NT9 A;  2QVO A;  3HB9 A;  1TL8 A;  2E71 A;  2NXN B;  2B0L A;  3WHC A;  2PJP A;  2X1D A;  2VBS A;  4LG3 A;  2DTZ A;  2Y2Z A;  1YQA A;  4NQW A;  3P9I A;  3WU1 B;  1FOW A;  2XF5 A;  5FIU A;  3W2E A;  2FSW A;  2Z99 A;  2XEX A;  2OZU A;  2STT A;  1EA3 A;  2DMU A;  2IP2 A;  3RQ4 A;  5LEK A;  1G3W A;  4L5I A;  2FNA A;  2XGC A;  1KU7 A;  4HAM A;  4L5E A;  2J7K A;  3O3K A;  1IRG A;  3ZZT A;  4A0X A;  4YEL A;  5M5W J;  4A3F J;  1VQ5 I;  2XRL A;  4A3D J;  1QVT A;  2ACJ A;  1PJR A;  2XB5 A;  5DD8 A;  4AUX A;  1JKP C;  1OCT C;  3R61 A;  2K9S A;  2L02 A;  4L9J A;  4P25 A;  3ZBU A;  3HDD A;  3K69 A;  1X2M A;  4OJ5 A;  1FNN A;  1D1C A;  2W24 A;  4Q4Z F;  3BH4 A;  3JU4 A;  3E6C C;  4CHU A;  3S15 J;  1W35 A;  4X7F A;  3JRD A;  4I6Z A;  1D1N A;  4B48 A;  5CVJ A;  4A2U A;  2JDI A;  4GXO A;  4LJZ F;  2CH0 A;  2RKH A;  3SYJ A;  5HZB A;  3W5H A;  3E5U A;  3AL0 C;  3CCE I;  1QG0 A;  4S04 A;  1LEB A;  4RAY A;  1ZRC A;  2IGK A;  3HOZ J;  4KFC A;  1JKR C;  4LD5 A;  1V5V A;  4CQJ A;  2IAI A;  4MYT A;  1SD4 A;  4WWV A;  3M4O J;  2W57 A;  1UAA A;  1B4A A;  4X0C A;  1TT5 B;  2X6O A;  1I50 J;  1PDN C;  2FD5 A;  3DF8 A;  3O8G A;  4MFE A;  2ZNY A;  3Q6R A;  1SAN A;  1TWH J;  1WJE A;  2DA1 A;  5LRR A;  3ZQG A;  2GQQ A;  2W1O A;  3PSF A;  2FXA A;  3JQR A;  1QGP A;  2XAG A;  4U4B A;  1L1I A;  3VYU B;  3GQ7 A;  2YWG A;  4XLA A;  3N05 A;  3WGG A;  4AVZ A;  5IT9 K;  3MCZ A;  4W97 A;  4RPD A;  5J1R A;  4QWQ A;  2V7U A;  2X8K A;  4IKF A;  2LD5 A;  4PGG A;  1KQ8 A;  3BP8 A;  2V79 A;  5FLM J;  2V7F A;  4OPV A;  2ODL A;  1TW2 A;  3I9V 2;  3GTP J;  5M5Y J;  3CDL A;  3ISP A;  2E1M C;  1XC5 A;  2QSF X;  1WU8 A;  3K1P A;  2CYY A;  3ONU A;  2NS8 A;  1W5C C;  3E5X A;  3K4N A;  2BHZ A;  3HSF A;  3BG7 A;  4MFD A;  2ELH A;  2HR3 A;  2BGJ A;  2C2W A;  3VR6 A;  1MBG A;  2BMW A;  2HOS A;  2XVC A;  2IGO A;  4LOC A;  3J7Y J;  2OCC H;  3W6J B;  5DDG A;  2OCE A;  1VQN B;  4RD0 A;  4Y9U A;  4XSZ F;  5FA6 A;  2DK8 A;  2CRV A;  2NS7 A;  5KK1 A;  3PUN A;  1V3F A;  2PJR A;  5JVG F;  1X0C A;  1BJZ A;  4MQ9 F;  3JW4 A;  1G7R A;  4KIF A;  4XL9 A;  5K1Y A;  4X1E A;  2KP6 A;  2VAS A;  4J01 A;  3ROU A;  1SFO J;  1WCM J;  3QOE A;  1NK3 P;  1FSE A;  1DBG A;  2BGI A;  4BS9 A;  1YHQ I;  1JE8 A;  3I56 I;  3BCB A;  1WGX A;  5JI6 A;  2E1C A;  3PET A;  1KYZ A;  2WTE A;  1ETY A;  3FXQ A;  3TO7 A;  2VUM J;  1S7E A;  1E3O C;  1KQ0 A;  2L9V A;  1VHE A;  2CJJ A;  1NBM A;  3B4N A;  4HBL A;  1MAB A;  2BY1 A;  2QLZ A;  2QZ8 A;  2OBR A;  2NVQ J;  1XD7 A;  1LQ1 A;  5CYV A;  1RR8 C;  1KRH A;  2FX3 A;  3PIP F;  2KIU A;  3CC4 I;  4BE0 A;  4AD9 A;  4C2M J;  1HKT A;  2IXS A;  1RES A;  2HQN A;  1ZG5 A;  2DFI A;  3RPQ A;  1YJ9 I;  1E3X A;  2RVC A;  1W7P B;  4BHC A;  4EJW A;  2LBF A;  4PJJ A;  3VEP A;  1Y8Q B;  5JLW A;  4P3I A;  1O8G A;  5IP6 A;  5AON A;  3PNT A;  2LKS A;  3BDD A;  5L3E A;  1Z21 A;  2ZXJ A;  5HDK A;  1DU6 A;  4KT6 A;  3DLL F;  1T38 A;  2VC0 A;  3BG6 A;  2FVG A;  3S2W A;  3IC7 A;  2L7M P;  2KZG A;  4IJA A;  4PJM A;  4EM0 B;  2NYX A;  2AXT C;  4A3E J;  1NH3 A;  4PUS A;  4CCJ A;  2P5V A;  3ESW B;  4LIV A;  4RB2 C;  3FK6 A;  5IOZ A;  1UD5 A;  2HOT A;  5LGT A;  3FPK A;  1RWR A;  4EW9 A;  2PMU A;  2RN7 A;  1LDJ A;  1J5Y A;  2H8W A;  3KP5 A;  3MKL A;  1E17 A;  2HLD A;  2WWY A;  4QPQ A;  4WZE A;  1WPK A;  2LG4 A;  1BR4 A;  2A5W A;  4XLE A;  3S93 A;  4CXF A;  1KU3 A;  4XRF A;  2WA0 A;  3K7A J;  2E1R A;  2Y0S A;  2QM3 A;  1GAW A;  3D5R C;  3VYS B;  2OBT A;  2W48 A;  4LBW A;  4U49 A;  3BZC A;  1BC8 C;  1HW1 A;  2VBE A;  2DDA A;  1MMD A;  3I4P A;  1FYL A;  5DUK A;  4BXF A;  1RUN A;  3OIP A;  2GXG A;  1NRK A;  4YXW A;  2M7B A;  3G6E B;  4D9J A;  1Z3X A;  2QXZ A;  1KQ5 A;  2L2O A;  2XIG A;  3H9Q A;  4Y4R A;  4C2U A;  2BXZ A;  2BM0 A;  1KC8 D;  1Q9S A;  5LMZ A;  1O8I A;  4CIC A;  3MWM A;  1T0F A;  2R7V A;  2W7N A;  3OZV A;  2BY3 A;  2XAQ A;  1AHD P;  1LFB A;  3J7A O;  1ZM9 A;  2AXL A;  2P5L C;  1YYV A;  4E7I A;  2XRN A;  4KKS A;  1TSP A;  3GRH A;  3AFH A;  2R5Y B;  3FIS A;  4BH9 A;  4WZT A;  2KRC A;  3CC2 B;  2LY2 A;  1QUE A;  2HDN B;  1IRF A;  1QZZ A;  2QBY A;  1ZH5 A;  1KA8 A;  2WAE A;  1Z0X A;  3VO2 A;  3CCJ B;  2O04 A;  2CQ7 A;  2BYV E;  5CVV A;  5EEG A;  2VQH A;  4D1Q A;  3T53 B;  3SXY A;  1ON1 A;  4BPR A;  3GTJ J;  1P7I A;  1U5T B;  3UNG C;  3CME I;  3JRI A;  4WXH A;  3COA C;  4N0B A;  1D8K A;  4YFX F;  3ABM H;  3CCS B;  3BH7 B;  3QU6 A;  5F27 A;  5C44 J;  1BL0 A;  1EF4 A;  3U21 A;  2Z2S B;  1OPC A;  1H0M A;  4HW0 A;  2JA5 J;  3OWT A;  4BEH A;  1U8B A;  1VF7 A;  3OEH A;  4XNF A;  4P9U A;  2GK6 A;  3WE3 A;  2W00 A;  3BPV A;  3OIQ A;  2ZJ2 A;  3MKY B;  3GTG J;  2VN2 A;  3WTS C;  1G8X A;  3DV8 A;  1YRN B;  3VYR B;  5GTI C;  3T56 B;  1LKX A;  1T56 A;  3HOT A;  2F5V A;  3HYI A;  3CXC B;  3S14 J;  3JRA A;  2NOJ B;  3EUA A;  3OZW A;  3J81 k;  2QN6 A;  3MFK A;  1T6S A;  3BCD A;  3K2Z A;  3KX2 A;  2FML A;  3N97 A;  4CYC B;  1O3R A;  5FRN A;  5DD4 A;  1YJW I;  1J9I A;  2LY1 A;  1JJ6 C;  2XKO A;  1D2E A;  4LB6 B;  3DPL C;  3P7N A;  3FWE A;  2O8K A;  4G5G A;  1VQM B;  3FXO A;  5CKT A;  3FXR A;  4XKB A;  3OEE A;  4NUB A;  5E20 A;  4F92 B;  4UNO A;  1QGZ A;  4LIT A;  2K9N A;  4PC7 A;  3DKW A;  4RD3 A;  2NT6 A;  5HLG A;  2HTS A;  3I3L A;  4RDL A;  2K9Q A;  3AVW A;  5B1A H;  1Z77 A;  5K7H A;  3FKI J;  3ERE D;  2LOO A;  1B72 B;  3ZMT A;  3P27 A;  2J5O A;  2WAQ N;  4HOB A;  2XAJ A;  5B66 C;  1R71 A;  4MXN A;  2F6C A;  3FXM A;  3BOQ A;  3BR5 A;  4LLL A;  2X6W A;  3WTT C;  2LLK A;  1T8I A;  2HPM A;  2EH3 A;  2QMU A;  2BSP A;  4IQJ A;  1ODD A;  1D8J A;  1TWC J;  2BF4 A;  3FXJ A;  4UXN A;  5KAF C;  4KJZ A;  5D4R A;  3LNN A;  5DNS A;  4Q48 A;  3HRT A;  4N4N B;  3ZMV A;  2LKP A;  1ZM2 A;  4UB8 C;  4RD1 A;  4L8J A;  4BDY A;  3BQZ A;  3R0A A;  1QA3 A;  2A5Y B;  3CCR I;  1XSX A;  3CO7 C;  1TYU A;  2Q6L A;  4OAZ A;  3VSK A;  1LJ9 A;  4IOC F;  4XSX F;  5DUI A;  3S3O A;  3L2C A;  1QVU A;  3CUQ C;  2M7A A;  2EWE A;  4A5M A;  4Z4T A;  5JMC B;  1IDY A;  1ZG1 A;  1Q86 D;  3Q0W A;  4ANJ A;  2OD5 A;  2LK2 A;  1AKH B;  2FX0 A;  1EH8 A;  4HIZ A;  5D6F A;  3MKZ A;  4ZGQ B;  3O6B B;  3RIQ A;  1T95 A;  3V4G A;  2YX7 A;  1PYV A;  1TWF J;  1SKQ A;  2VC1 A;  3GTK J;  5FJ8 J;  2FBH A;  3EUK L;  4JBA A;  1EFC A;  3HGG A;  4JYK A;  1CNF A;  3FKJ A;  3H9N A;  1Q7Y D;  2ECC A;  4GCV A;  4KYW A;  4I09 A;  2KL4 A;  3BY6 A;  5FLX Z;  4WZL A;  2M4K A;  2DY1 A;  5FO0 A;  5J40 A;  3KP7 A;  2L7F P;  3PSI A;  3BC8 A;  4ESJ A;  2CQK A;  4P5O A;  1R1T A;  2KDO A;  3PO2 J;  1QFZ A;  4BXU A;  4RLZ A;  1RNL A;  1U8R A;  1DDN A;  3OYI A;  1YIO A;  2JMW A;  4I2O A;  1OFM A;  3R6K A;  4ZYE A;  3R0J A;  1RC9 A;  3PQJ A;  1O8F A;  1F5T A;  3KLO A;  3WTW C;  2EZL A;  4A3B J;  4P1V A;  3LFK A;  1ZK8 A;  1V4R A;  2E36 A;  3F9K A;  3DEE A;  1OR7 A;  2XAF A;  3SHF A;  5BSY A;  4BEH B;  1ZN2 A;  3JTG A;  1N06 A;  3OJW A;  2E1M B;  1QPM A;  5FNZ A;  4R71 A;  3H9G A;  1MGT A;  4OMY A;  2CQX A;  4WCG A;  3G73 A;  1DAR A;  3X2Q H;  3G71 B;  1JUS A;  1PXZ A;  1IW7 F;  3OYN A;  4YZA A;  3BNW A;  4M53 A;  3M7G A;  1J59 A;  3JUR A;  4PSW A;  3ZQL A;  2QE7 A;  3ZRG A;  3LST A;  3DTK A;  1DG1 G;  4WXD A;  1NHA A;  2GIZ A;  1UD4 A;  2JA7 J;  2JSP A;  4KH3 A;  2R5Y A;  1XGM A;  3H3V K;  1XE1 A;  3OPO A;  4DBQ A;  2XV4 S;  3ZQQ A;  2ZFW A;  1QJV A;  3M3Y J;  4AF7 A;  2OPT A;  1VZ0 A;  4HA8 A;  5EG0 A;  2P5K A;  4HG2 A;  2GQF A;  3M8F A;  1Y0U A;  1VQO B;  1TNS A;  5CVI A;  4CCL A;  2VE8 A;  2R7O A;  3JQP A;  1PP7 U;  1Q1V A;  3P9K A;  3W2V A;  3UKG A;  3PA2 A;  4BJ5 C;  4KNY A;  1IC8 A;  3M9A A;  3QOD A;  2R7Z J;  2MC4 A;  4AU7 A;  4L0Z B;  4AWX B;  2BM4 A;  2X1E A;  5ICC A;  1IN5 A;  3HPG A;  3J7A Y;  2IQ7 A;  1HKQ A;  4GGG A;  2FNP A;  2NNY A;  5IYQ A;  1O8K A;  3F8M A;  1RIO H;  2LZJ A;  3QSY A;  1FBU A;  1DU0 A;  2VOP A;  2L7Z A;  3SFZ A;  2XZP A;  3ZSC A;  1QZY A;  3BJA A;  1QHG A;  2TDX A;  4MNU A;  3JRF A;  1GXP A;  1EFR A;  3LSM A;  3GLX A;  1F1Z A;  1SVL A;  2LRE A;  1YIT B;  4PAB A;  2EFN A;  2V6C A;  1YJW B;  1O8M A;  2ID6 A;  5J6X A;  3VSU A;  4EV0 A;  3P9C A;  2YUH A;  3TMO A;  1TWG J;  3OYD A;  1EA0 A;  1OGO X;  1BX1 A;  2EZI A;  4Z4V A;  4P26 A;  3PSS A;  1BI2 A;  2FE3 A;  1MNE A;  3T8T A;  2DK5 A;  3L09 A;  3LYC A;  4A3K J;  3NAU A;  3H9J A;  5BMZ A;  2Y0S N;  3KPH A;  2Q8K A;  1FP1 D;  1NB9 A;  1FOY A;  1DGR M;  2DFH A;  3ML3 A;  2M87 A;  2OV7 A;  1KU2 A;  2MH9 A;  2V7T A;  2YWH A;  3DQV C;  3JRC A;  3BQJ A;  3U2Q A;  5H20 A;  4CA0 A;  3KL9 A;  2F43 A;  2ZME A;  1WFX A;  3CCQ I;  2DN0 A;  2BY2 A;  4XK4 A;  1XG2 A;  1W5T A;  1YIT I;  2W82 A;  3PL8 A;  3D1N I;  2G0Y A;  1NHC A;  4IHX A;  4LK1 F;  3W2I A;  2YUS A;  3W6V A;  1MIJ A;  4AIJ A;  2UVF A;  1SFK A;  3CLQ A;  4ZCI A;  2NAZ A;  3QWL A;  1IN4 A;  2HU9 A;  4BJ6 C;  3PM1 A;  4KIS A;  2YR2 A;  3S17 J;  1IJF A;  5E79 C;  2F4I A;  2OAZ A;  1AOY A;  3A0B C;  4RA2 A;  3GFJ A;  5KNL A;  1LUJ B;  1FMW A;  4KDP A;  1ENH A;  1MJB A;  3A3G A;  2GAU A;  2O0Y A;  4HNU A;  2B63 J;  4M6X A;  2J8I A;  1S9H A;  4DK1 A;  3GZ5 A;  2E5N A;  4EM1 A;  2INV A;  4M9X A;  4LBV A;  1VQ7 B;  3NAW A;  1IXS B;  3C2G A;  1MZB A;  3D5L A;  4KMU X;  4V2G A;  5FGM A;  5FKO A;  2V26 A;  2ZJP F;  3CCL I;  3S1M J;  2HMA A;  2IGN A;  1HDD C;  2V7V A;  1WDT A;  2DA5 A;  3A3B A;  1QO0 D;  1K7A A;  2R5Z A;  3ZR8 X;  2QYO A;  2VOD A;  1XCV A;  6PAX A;  3RYR A;  3CMM A;  5LHG A;  3WTU C;  3DBR B;  4ACA A;  5J1Y A;  1CQT A;  2CUZ A;  1MJA A;  3K70 D;  2INU A;  4NC7 A;  2UWM A;  3H35 A;  3LQQ A;  4B1R A;  5D5V B;  4TMV A;  1D0Z A;  3TW6 A;  2WZN A;  1ETO A;  3JRE A;  1RR7 A;  1HSJ A;  2K86 A;  3QP5 A;  1MSF C;  3PFI A;  3WQZ A;  4M6V A;  1Z7L A;  1FJL A;  2R7R A;  2EIX A; 
#chains in the Genus database with same CATH homology
 3A2K A;  2Z8G A;  3JU4 A;  4GRI A;  5HNF A;  5HKK A;  2D3L A;  3UW0 A;  3DKY A;  2NT9 A;  4HRI A;  1RU4 A;  3K4B A;  3DLA A;  4E7L A;  2ELJ A;  4YRV A;  2X1D A;  2R7W A;  4LG3 A;  4YZX A;  4ITV A;  2XF5 A;  4E6K G;  1CZF A;  1EA3 A;  3RQ4 A;  3OY9 A;  1O8E A;  2WJY A;  4BJT A;  1N78 A;  4B47 A;  2HVS A;  1WP6 A;  2WPD A;  4E7K A;  3G05 A;  1KCC A;  4YEL A;  1BLI A;  2V31 A;  3HL2 A;  3CZ6 A;  3SDB A;  1PJR A;  3L2U A;  1VJS A;  4P22 A;  2O1D A;  2KZV A;  3CJR B;  5KHD A;  4HPQ A;  5C1E A;  4OWR B;  4OJ5 A;  2AQE A;  1D1C A;  3L2Q A;  4U87 A;  2JIZ A;  2K3P A;  2VXD A;  1OR7 C;  2XND A;  3PNV A;  4HSR A;  4MLO A;  4ZC3 A;  5TGT A;  2R7X A;  1UD6 A;  2L5Q A;  3K4L A;  3HKZ A;  4B48 A;  4W8Q A;  3DPT A;  3HXL A;  3TBI A;  2JDI A;  3OL4 A;  2CH0 A;  3DDY A;  4B3F X;  5LD2 C;  3DTI A;  1X4O A;  2OC6 A;  3K6G A;  3GQB A;  1Y56 A;  3AL0 C;  2Q2E B;  2ZZE A;  1JTA A;  2GJR A;  3BCF A;  2MYS A;  4G7W A;  2IGK A;  3K4J A;  3PFY A;  4W8R A;  1MMG A;  4P1W A;  4ZDL A;  3FKS A;  2L9S A;  2M0M A;  2PMZ A;  3NWS A;  4XON A;  2ZZQ A;  1UAA A;  1E1Q A;  4ZJZ A;  2V6E A;  3GVL A;  4QPO A;  1WJE A;  2W1O A;  3M1C A;  3PSF A;  2I8D A;  1WJ5 A;  4PSX A;  1HVX A;  1AIR A;  2KLO A;  4U4B A;  1EE6 A;  5AMV A;  3VYU B;  4BE2 A;  2CK3 A;  3GQ7 A;  3DTE A;  4IQ4 A;  4II2 A;  4XLA A;  3V42 A;  1COW A;  1MMN A;  3HPH A;  3N05 A;  3OL3 A;  1JRG A;  2WY8 Q;  4AVZ A;  5LFA A;  2XZO A;  4XOP A;  4LIU A;  4E7H A;  2X8K A;  4IKF A;  4C2L A;  4TKO B;  1TZL A;  4B3X A;  1WJA A;  1WTH D;  1O8J A;  3TL4 X;  2WAD A;  2V7F A;  2ODL A;  4KKU A;  3QYF A;  3I9V 2;  4Z1M A;  3OMY A;  2E1M C;  2LBF B;  2XC7 A;  1X19 A;  3G2B A;  3OYK A;  3A1Y A;  3K4N A;  4EAT A;  3IAS 2;  2DJI A;  3BG7 A;  5CQG A;  2L9N A;  3VR6 A;  1BR2 A;  1V5G A;  2IGO A;  4DGW B;  3QYE A;  4CSW A;  1HA8 A;  2KHM A;  1JI8 A;  2XOK A;  1LDK B;  1K28 D;  2K9M A;  1X1C A;  3SYT A;  3VWB A;  4Y33 A;  2PJR A;  1X0C A;  3E0J B;  3FY3 A;  1VLY A;  4TT3 A;  4XL9 A;  2KP6 A;  2VAS A;  4J01 A;  2X6X A;  2IS2 A;  3IP4 B;  3QOE A;  1DBG A;  5IK2 A;  4C2T A;  4BS9 A;  3LSH A;  4BE1 A;  3BCB A;  1N75 A;  2WBM A;  3SEQ A;  2LC2 A;  2HZD A;  3VSV A;  3ZIA A;  4OJ6 A;  4Z03 A;  3B4N A;  1NBM A;  2CV1 A;  1YX3 A;  1KON A;  1MAB A;  4W8T A;  3MMY B;  2AQF A;  4XLC A;  2BW3 A;  3A4C A;  1WJD A;  2OUM A;  1D0X A;  2R7Q A;  4BE0 A;  1V0E A;  2IXS A;  3KYL A;  1E3X A;  4CCO A;  1QHH D;  2JVG A;  3DKX A;  4RM2 A;  3L2W A;  1OFL A;  2LBF A;  2W4S A;  4PJJ A;  1O8G A;  4YEJ A;  3PNT A;  2A6T A;  3NWT A;  1Z21 A;  3VDX A;  4E0F A;  3VMV A;  2VJJ A;  3OYH A;  4KT6 A;  1X1B A;  4XOR A;  2IGM A;  1W0K A;  1I8D A;  2BOL A;  3BG6 A;  3LFU A;  4B43 A;  2MD0 A;  4PJM A;  1WMR A;  5CQE A;  4PUS A;  4CCJ A;  2QX3 A;  4LIV A;  5CPR B;  1UD5 A;  4N4O B;  3HC7 A;  1RWR A;  3HOS A;  4EW9 A;  4KIT B;  3FBN B;  2VKD A;  3OOU A;  4OJP A;  3OYJ A;  2HLD A;  2V1N A;  4UZU A;  2VPL A;  4QPQ A;  2LG4 A;  1BR4 A;  2A5W A;  4XLE A;  3S93 A;  2ZTG A;  4G7X A;  4RM3 A;  2WA0 A;  4GQN A;  3GQ9 A;  2Y0S A;  2VBK A;  3BCA A;  3E1S A;  3LSG A;  3D5R C;  3VYS B;  4DIQ A;  2V4D A;  1FMV A;  4JQF A;  4XKW A;  4U49 A;  2R9V A;  2VBE A;  2QY1 A;  1E79 A;  1MMD A;  3L2V A;  1O88 A;  1D0Y A;  4BXF A;  4I84 A;  3OIP A;  2XDV A;  1NRK A;  4YXW A;  4XLH A;  2XZL A;  2M7B A;  2V9K A;  4D9J A;  1Z3X A;  2NST A;  3GQ8 A;  2X53 S;  2QXZ A;  4HST A;  2L2O A;  3H9Q A;  4Y4R A;  4C2U A;  4OJO A;  1O8I A;  3OS2 A;  1K6Y A;  2R7V A;  2O5R A;  2W7N A;  1VBL A;  2HNH A;  4RMN A;  4E7I A;  4R79 A;  1O8H A;  4F91 B;  4KKS A;  4E7J A;  3GRH A;  3AFH A;  1LVK A;  1UEL B;  3OS1 A;  3EQO A;  1KTW A;  5HVQ C;  2KRC A;  2VLA A;  2LY2 A;  3RPU D;  2PYG A;  3DPU A;  2R4G A;  2E1B A;  2WAE A;  3HAG A;  1LFP A;  2O04 A;  4XLF A;  2VQG A;  4DK0 A;  2ZTN A;  4W8S A;  2ZSI B;  2VQH A;  4D1Q A;  1X1A A;  3K4M A;  2DT6 A;  3RCO A;  3UNG C;  1BHE A;  1U0J A;  4U7B A;  4CCK A;  1UG0 A;  1BMF A;  1SKY B;  3U21 A;  2Z2S B;  1UD2 A;  3B8Y A;  3S3M A;  1KCD A;  3OS0 A;  3OWT A;  4HEA 2;  4BEH A;  1VF7 A;  3VSL A;  3OEH A;  4XNF A;  2GK6 A;  1BR1 A;  4CZC A;  2W00 A;  2Q1Z B;  3A35 A;  3OIQ A;  3MKY B;  3FHN A;  1GLN A;  5CDF A;  3SEZ A;  4BGD A;  2DXI A;  1G8X A;  2E60 A;  3VYR B;  3T56 B;  1LKX A;  3HOT A;  4PJN A;  4YZQ A;  1IA5 A;  2F5V A;  4PFO A;  1ERD A;  4ASU A;  1IDK A;  3ZPP A;  4XMY A;  4NC8 A;  2NZM A;  2NOJ B;  3EUA A;  3CP8 A;  4PFP A;  1FX0 A;  4URR A;  4B44 A;  3VST A;  4F55 A;  2P0W A;  3BCD A;  3KX2 A;  1MND A;  2QKL B;  2HVQ A;  2ZZG A;  3BH4 A;  1H8H A;  3VYT B;  4XM3 A;  4FAS D;  5FRN A;  3OOC A;  5DN6 A;  4MR0 A;  4FXU A;  2LY1 A;  2WAQ A;  2XAU A;  2JJ1 A;  3DPL C;  1OB0 A;  2V7Q A;  2VQC A;  4DNR B;  3ZGK A;  1QCX A;  3K4C A;  1TT0 A;  2JUG A;  2CMP A;  3L2R A;  1O8D A;  4OJL A;  4YZ0 A;  3IAM 2;  2BW3 B;  3H0D A;  2FUG 2;  5CKT A;  1D1A A;  4DBR A;  4RLF A;  4XKB A;  4XN0 A;  3OEE A;  1NG7 A;  4NUB A;  4F92 B;  4BDZ A;  3BC9 A;  4LIT A;  1PLU A;  2VJ4 A;  2NT6 A;  1E3Z A;  3EUH C;  3I3L A;  2VJ5 A;  2VBM A;  2CFO A;  2LOO A;  2CW7 A;  2DCE A;  2KQR A;  3T53 B;  1Y6I A;  2BVL A;  4MXN A;  3S3N A;  2F6C A;  3KRG A;  2X6Y A;  3LMM A;  2KRH A;  1QU3 A;  3W2A A;  2X6W A;  4NK6 A;  2HPM A;  1WJF A;  2JA2 A;  1BPL A;  2BSP A;  4IQJ A;  1AA7 A;  3OYM A;  4KJZ A;  3LNN A;  3QYB A;  4PJL A;  4N4N B;  4BU2 A;  2MAB A;  4L8J A;  4BDY A;  4XD7 A;  4Y3O A;  4Z05 A;  4G6I A;  3NE5 B;  4OAZ A;  3VSK A;  3S32 A;  2CUJ A;  4ZTF A;  2XF7 A;  3C2H A;  3S3O A;  1I18 A;  2M7A A;  3T51 B;  2EWE A;  3LSI A;  3FBI B;  1DP3 A;  2V4J C;  4BQQ A;  1K5C A;  2GOX B;  4ANJ A;  1W36 C;  1IDJ A;  5FRM A;  4PMH A;  4HIZ A;  1H8E A;  2KPM A;  3MKZ A;  4IZZ A;  4KKT A;  2O0W A;  1T95 A;  3FPP A;  1PYV A;  2QKM B;  2X85 A;  4X0G A;  2NTP A;  2DOA A;  3H5N A;  2GJK A;  4JOM A;  3CP2 A;  3EUK L;  4ZDP A;  2UVE A;  3FKJ A;  2E5Z A;  1MW7 A;  2KL4 A;  2RRE A;  2IS1 A;  3LMW A;  2M4K A;  2W6J A;  3PSI A;  3BC8 A;  2PJR B;  2ZXH A;  1NG6 A;  4P5O A;  3H5A A;  2KDO A;  2VKH A;  2WAF A;  4XQF A;  1X4P A;  3RSN A;  3PNY A;  3OYI A;  2K5C A;  1OFM A;  3OYF A;  1O8F A;  4JMQ A;  2HDW A;  2WJV A;  4CUG A;  1PKV A;  1DBO A;  2PYH A;  3GVJ A;  2O17 A;  2VB6 A;  3F9K A;  3UR3 C;  3DEE A;  4AYB A;  1Z3Y A;  2VIX A;  2XGJ A;  5FL7 A;  2XSJ C;  2ZXI A;  3HG9 A;  4BEH B;  5HLT A;  1IB4 A;  3W2W A;  3OAA A;  4BUP A;  1DGW Y;  3AL0 B;  2E1M B;  2GJP A;  1E0E A;  4TSF A;  1W9X A;  3H9G A;  4RLQ A;  3ZXS A;  3OR1 C;  4XKC A;  2F1M A;  1PXZ A;  4YZA A;  2RNG A;  3OYN A;  2HVR A;  1MMA A;  4G6T B;  4XN3 A;  1KZL A;  2Z6B D;  3JUR A;  4PSW A;  2QE7 A;  3ZRG A;  3DTK A;  1UD4 A;  4CCM A;  2JSP A;  3T9G A;  5JHF A;  3CES A;  3LL7 A;  4DNT B;  3OPO A;  1R6R A;  4DBQ A;  3ZQQ A;  4H4K C;  1QJV A;  1V5E A;  1P9Q C;  1X1D A;  4CCN A;  1VZ0 A;  4F3Q A;  4C9Y A;  4HG2 A;  4NQW B;  3DU5 A;  2RQQ A;  2D3N A;  4HWV A;  4CCL A;  3MD2 A;  2R7O A;  3H94 A;  4E7S A;  3GQA A;  5FRO A;  2CV2 A;  3W2V A;  4FET A;  1IRX A;  4BJ5 C;  1DQU A;  3KEY A;  1KMH A;  2GOM A;  3QOD A;  1UD3 A;  2MC4 A;  4AU7 A;  2CS3 A;  4E4H A;  2X1E A;  4ZYA A;  4IX7 A;  3HPG A;  2MFZ A;  3J7A Y;  2M5S A;  2UV1 A;  2BVM A;  1O8K A;  1OGM X;  2VQL A;  2IQ7 A;  1T5E A;  3ZPN A;  2LZJ A;  3DU6 A;  1HG8 A;  3ZSC A;  2DT7 B;  2XZP A;  2IS6 A;  1BN8 A;  1QHG A;  3OYC A;  1EFR A;  2M3A A;  3LSM A;  3M8J A;  2VJI A;  5HNH A;  2LRE A;  4E7Z A;  2K9L A;  1SAU A;  2LYC A;  3FDY A;  2Z1D A;  4C30 A;  4HNT A;  4ZDO A;  1O8M A;  2VXZ A;  1WPC A;  3K70 C;  3VSU A;  3CJQ B;  2R7T A;  5HOO A;  2X3H A;  1UD8 A;  3TMO A;  4B3G A;  3OYD A;  2VL8 A;  2WZP P;  3PUB A;  1OGO X;  4XOT A;  3WWG A;  2CV0 A;  2HPI A;  1OHH A;  4DOZ A;  4F52 A;  4ZTJ A;  1MNE A;  1WJB A;  3K4K A;  3OYA A;  1YE9 A;  3H9J A;  3AKZ A;  4BQN A;  1ZEL A;  1DGR M;  3H5R A;  5KCM A;  2WB1 A;  3OE7 A;  4DJA A;  2OV7 A;  4OZZ A;  3VMW A;  3DQV C;  4NK8 A;  1GQ8 A;  4CA0 A;  2WSS A;  2F43 A;  1WFX A;  2WY7 Q;  2W6I A;  3HUG B;  2R7S A;  2JJ2 A;  2GK7 A;  1XG2 A;  2NSP A;  4F93 B;  2W82 A;  3PL8 A;  2KMU A;  4CH7 A;  2R7U A;  1NHC A;  1OLT A;  2HQA A;  1WJC A;  2UVF A;  3PJR A;  1N77 A;  4OZY A;  1SFK A;  4OAY A;  5C1C A;  2XF6 A;  2HU9 A;  4BJ6 C;  1E43 A;  4KIS A;  2UUZ A;  1V0F A;  4II3 A;  2X51 A;  2F4I A;  3EPZ A;  1J09 A;  1V5F A;  3D5S C;  3EQN A;  5KNL A;  4XR6 A;  1FMW A;  1HZE A;  2DIE A;  3CF2 A;  3A3G A;  2LH9 A;  3GBG A;  4HNU A;  1S9H A;  4DK1 A;  1BOB A;  2E5N A;  2INV A;  3K10 A;  3C2G A;  4BAC A;  3D5L A;  2NTQ A;  3B90 A;  1RMG A;  2V26 A;  4BQO A;  3OFN A;  2IGN A;  2Z16 A;  4BL0 B;  2KVO A;  2X1C A;  4NNJ A;  3OYB A;  3A3B A;  4Z06 A;  1T0F C;  3ZR8 X;  2NTB A;  3CMM A;  3OR2 C;  3LSK A;  3RTR A;  2ZSH B;  1G59 A;  3SUC A;  4J00 A;  2CUZ A;  3K70 D;  2IS4 A;  3OYE A;  2LRD A;  2INU A;  4NC7 A;  2UWM A;  3H35 A;  2CW8 A;  3BLY A;  2M4G A;  3ONQ A;  3SZG A;  3ZCO A;  1D0Z A;  1PE9 A;  3DWL E;  1E1R A;  1YX5 A;  3OW7 A;  3OYL A;  2L7K A;  2PEC A;  3S8P A;  2ZZF A;  3GVK A;  3OYG A;  4PK4 A;  2O0V A;  2ZFU A;  1W36 D;  1O8L A;  2JVH A;  1H80 A;  3WQZ A;  3KEW A;  1D1B A;  3MKW B;  1W0J A;  3W3C A;  1Z7L A;  4XKV A;  1OOC A;  2R7R A;  3IUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...