2VJJA

Tailspike protein of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN
total genus 232
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjjA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjjA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjjA02
1OGMX 3UW0A 1DBGA 2O04A 3FY3A 3GQ7A 1O8DA 4I84A 1O8FA 4Z03A 4YZAA 2NSPA 4PMHA 4XLAA 1RU4A 1O8EA 4W8RA 1O8LA 2X6WA 4XLFA 2BSPA 1JRGA 4XKWA 1O8GA 2INUA 1BN8A 3VMVA 4XLCA 2X6XA 1O8JA 3JURA 1O8KA 1H80A 1EE6A 4NK8A 4AVZA 4YZXA 2VBMA 4XN0A 4XORA 2PYHA 2VBEA 2INVA 3WWGA 2UVEA 5AMVA 4URRA 4Z06A 4W8QA 2QX3A 4XLEA 1O8HA 2X85A 1IA5A 1O8MA 4XOTA 4XNFA 1CZFA 2EWEA 3EQOA 3VSVA 2VBKA 3KRGA 4HWVA 4XL9A 1GQ8A 1KCDA 1RWRA 4OJPA 1BHEA 1QCXA 4EW9A 2X3HA 2X6YA 4U4BA 1K5CA 3EQNA 4OJOA 3B90A 2NZMA 2Z8GA 4YZ0A 4XM3A 3LMWA 4OJ6A 1OFMA 1WMRA 3VMWA 1PXZA 4MR0A 1KCCA 4XLHA 3GQAA 4XKVA 1OGOX 2O0VA 2NT9A 1VBLA 4OJ5A 3GQ9A 3GQ8A 1DBOA 1JTAA 2QY1A 3GRHA 2UVFA 4XOPA 2NSTA 1AIRA 3ZSCA 1HG8A 4NK6A 2O0WA 2QXZA 1RMGA 1NHCA 4OJLA 3ZPPA 1KTWA 2NT6A 4XONA 4OZZA 4YELA 4U49A 2PECA 1QJVA 2O1DA 4YEJA 5C1CA 1IDJA 1PLUA 2NTQA 4MXNA 4W8SA 1XG2A 1IDKA 2VJIA 2NTPA 4XN3A 2O17A 4Z05A 3B4NA 1O88A 3VSTA 4XR6A 4C2LA 3T9GA 1PE9A 2NTBA 3B8YA 4XQFA 2ODLA 4XMYA 3SUCA 5C1EA 1O8IA 4YZQA 1X0CA 3VSUA 1OFLA 2VJJA 1OOCA 2IQ7A 4OZYA 1IB4A 2PYGA 4W8TA
chains in the Genus database with same CATH superfamily
1F36A 3WTZA 2X48A 2O6GE 1OB0A 2L7KA 3HSRA 4F3QA 3HUGA 1Y8QB 4K2EA 2DOGA 3IV5A 1ELOA 1SD7A 2BVMA 4DJAA 3RYRA 1XMXA 4I7HA 1IN4A 3K4JA 2XF6A 1T8IA 5CKTA 1Z9CA 2HOAA 1ON2A 1QPMA 4KKSA 2Q0OA 3KYLA 3ZBUA 2HQAA 2CJJA 3DKYA 5FKLA 1Z77A 3NRVA 4II2A 1ERDA 3I59B 3T53B 2VQLA 2HVRA 1FLIA 4RM2A 4WZLA 2GA2A 5ED4A 2DFFA 2O3FA 4HW0A 4I98B 3J7YJ 2H6BA 3E20A 4K1XA 1QA1A 2J5PA 4G6TB 1VQKB 5LRRA 2R7QA 2WV1A 5K7FA 1ZH5A 3QU3A 3QPLA 4CCKA 1T38A 2HDCA 2VC1A 2FRHA 1FTTA 1IN8A 1WGXA 2ZJPF 2WJYA 3LSTA 4AF7A 4LK0F 4RJLA 3GZ5A 3R0AA 3LJYA 4EJTA 5DV5A 1LPQA 1W4MA 4N4NB 4P12A 2EIKH 1UMKA 3TKYA 3Q5FA 2JJ1A 5CVJA 3O8GA 1OCZH 3RJPA 3FXJA 2LKSA 1YX3A 3DWLE 4Y13A 2R7SA 1E62A 1Y0UA 4FTHA 3M4OJ 5FLXK 1XDUA 2EBIA 3JQQA 4U9UA 1RKWA 3S2DJ 3I56I 2LD5A 4RB3C 4L9JA 2E5ZA 1GT0C 4A6DA 2QN6A 2BXZA 4KA4A 1TWCJ 3K1PA 2PI0A 3J7AO 4X0GA 1K78B 1TNSA 1R71A 3QU6A 3I4MJ 4OJ6A 2XPVA 3CC2I 1K9MD 1BW6A 2F4NA 2Y0SA 1LDJA 1LVKA 1I50J 5ILUA 2P5LC 2OK8A 2BY0A 3HOVJ 2LRDA 2QZAA 3ZQGA 2O9LA 4ABZA 1OYWA 2CFXA 2XASA 1VQOI 2DFHA 3RPUD 4A0ZA 3BY2A 3SJZA 2V5IA 3QP6A 5TR9A 1NK3P 5KK1A 4OPWA 3CMEI 2GXBA 4N9HA 3S3OA 2NPFA 2BY2A 3GFJA 2H09A 3H9QA 3X2QH 1A6QA 4CZCA 3E6CC 4L0ZB 1SFUA 1UHSA 1Z91A 3CUQA 4WXCA 5H2FC 3MZHA 5GPAA 4A5NA 2BE5F 1NHCA 2LF8A 4ZDPA 2XAQA 2QQ9A 4U87A 2KHMA 4I6ZA 3ULQB 4M1KA 2X6OA 1TQIA 3VYRB 1TVCA 1SVMA 3CDLA 4L5EA 4RDLA 1JJ6C 1FNDA 3ZQQA 4BE1A 1UD2A 5ICGA 3LSKA 1YTYA 1NDHA 3K70D 2NS8A 1LFPA 4HRIA 3G6EI 1DQUA 3WE2A 2CQ7A 1V3FA 2OBPA 1MNEA 2E60A 3DP7A 3GCMA 1ZG1A 2QZ8A 2MC4A 3AL0B 1V5VA 1QVFB 2RC6A 3DU6A 4QPQA 2QSHX 1ZTRA 3V7CA 4EQQA 2P6TA 4FK8A 1SFXA 1RR7A 1WRJA 1TBXA 2X0KA 1X0CA 3LA2A 4L5IA 2VJJA 4NNJA 2ZNYA 5F0CA 2FQ4A 3FMSA 4OZYA 4BE2A 3MMYB 3LFUA 1ETOA 4CHUA 3MZYA 3L2UA 1KTVA 4LK1F 4D7NA 1O8DA 2Y48A 1ETYA 2E19A 5EGOB 4V2FA 1TYVA 5EDNA 3F21A 1J2XA 1Z21A 3E0JB 2QE7A 3S1MJ 4ESBA 4IJAA 1YS7A 5E1WA 1RNLA 1YJ9I 2KPMA 1D0ZA 3DBRB 3E5UA 1O8GA 3I71A 4YDTA 4HPQA 4JBAA 1KQ8A 3CDHA 2FNPA 3UNGC 1ZRCA 1QFYA 1EA0A 2QQ8A 5LEJA 3JURA 5GTHC 1TWAJ 2Z1DA 1IC8A 1MNMC 1VQ8I 3GZNB 2F1LA 4NQWB 4E4HA 4EEFG 5H20A 1N77A 5DNSA 2F3LA 2I1LA 4OPOA 3Q0UA 1XSDA 1V5FA 4C2MJ 3A3BA 4X8IA 4RA2A 2IA2A 2R7ZJ 1I39A 4KYWA 3QPTA 1E43A 1TWHJ 4WXDA 4ZZLA 2L9RA 1K4ZA 3OYLA 1LQ1A 2A6HF 4A3FJ 2KIFA 5EJCA 1GDTA 1F4KA 2NNNA 1O8MA 3T0YA 1ETVA 4HZFA 3TW6A 3NWTA 4M3BA 1Q1HA 3DPUA 2VBKA 4KMUX 1CNFA 2W7NA 2F1MA 3ABUA 1MSFC 1MBGA 2BZTA 2K4JA 2LK2A 2VBXA 3HDDA 2X3HA 4BXXJ 2OTJB 4JX4A 5DUKA 3JRFA 4QLCU 5C44J 5L3CA 2PMZA 5AIPA 3H0DA 1T6YA 2KVOA 2WA0A 3FMQA 1FC3A 3OSGA 4DW6A 4WZEA 3H1CA 2IS2A 3U1KA 4RMNA 2IEKA 3HL2A 1W87A 3R60A 3QFTA 3G71B 3OE7A 4B48A 1FT9A 2WAFA 4DNCA 1FSHA 2YWHA 1CF7B 1FYLA 3H9JA 1MBFA 2PJRA 4LBVA 3GVJA 2MG4A 2DA4A 3S8PA 5K5OA 3CD6I 3LAJA 2STTA 3ZBTA 1STZA 2JK3A 2KKOA 3QYFA 4BYYA 2JMWA 3ELKA 2VXZA 3I59A 5HLHA 4KT6A 4X6AJ 1UFMA 4OAYA 3VDXA 2R7RA 2QY1A 4YFOA 2XF5A 4Z6YA 4YHBA 2IRFG 2KIMA 1I8DA 2LNBA 4GQNA 4PJMA 2FBKA 2NS0A 1ZM9A 1W36C 3E3VA 3S3NA 4IHWA 4TMWA 4WX9A 4OZZA 3M7GA 3H3ZA 2LY9A 3OOUA 4CCJA 2QTLA 2K86A 2JA5J 1BW5A 5IYCJ 1Y8RB 1ZRFA 2XNJA 3SLDA 2D5VA 1XTAA 1LFBA 3Q3SA 1USTA 3BQJA 1F5TA 2V7TA 2MGQA 3TP0A 1OB5A 3CP2A 2M30A 2XPWA 2HDNB 2E1BA 1QUFA 1Q7YD 2QLZA 2I8DA 1IRGA 5KVRA 2Z16A 1YG2A 4TMZA 1QZZA 2XGXA 2DEUA 3V4GA 5E3MA 2ODLA 3LA3A 1HKQA 4CGZA 3P5JA 3CLQA 3TOBA 2ME0A 2XTXA 2LKPA 4JQFA 2EFWA 3RIRA 1QPIA 3G4SB 2R6HA 2IQ7A 1L1IA 2CFOA 2HZDA 3H9GA 2X1DA 3AG3H 1QZEA 1QQIA 4ZYHA 1O3QA 2V31A 4ZGNB 3H92A 3ZP5A 5J6XA 1M1KD 4WZKA 2HPMA 3DEEA 1R23A 5HDKA 3IL2A 3HHGA 4JX6A 1ITYA 3K4MA 2GJPA 2B7BA 4Z4VA 3BH4A 5HODA 1IO2A 4GDFA 3PQJA 1PJ7A 3ZMVA 5E79C 1CQXA 2NXNB 3GVLA 4Y9UA 2L3DA 2A61A 2OA4A 2Q6OA 2VFPA 3HRUA 2OU2A 1R4NB 2OYNA 3LQ6A 1IZ1A 2IXSA 2L9VA 3VODA 1WH5A 3TBIA 5J8FA 4PJLA 1KMHA 3OY9A 3ZGKA 2M0CA 4F55A 1YI2B 4FETA 4LMYA 3JRAA 3GXOA 1VQPI 1EFCA 2C4UA 5F0HA 1JNYA 2VYQA 3ROUA 5JVTA 1FBQA 2R7DA 4RD2A 3HG9A 2YS9A 4G7ZF 3KRGA 4RAZA 3S17J 3VWBA 2ZL5A 2W7ZA 2HOEA 1LM1A 3KIOA 4I01A 1HA3A 5DEQA 1SMYF 2NNYA 3ONQA 5C4XJ 2GJRA 3KP5A 1WHUA 1Y1WJ 1BC7C 5FGMA 5LHIA 2XC1A 1JT0A 3DFGA 2EFOA 3TDUC 5HNHA 3WODF 5E1ZB 3CC4B 4HIZA 3WGGA 4BAYA 1OR7A 1X3WB 2YUHA 5EG0A 5HOOA 5DS0A 1G3TA 3OAAA 2JVHA 1PXZA 2R5ZB 4W97A 2ZXHA 3VSKA 2AHQA 3NAWA 2O0VA 3HIFA 2XC7A 2A05A 3ZZUA 1GVJA 1KK1A 3DU1X 3LA7A 3GQ8A 3CCQB 2FOKA 1U6GA 2XRNA 3BWGA 4RGRA 2G9WA 2CWEA 4UHTA 4AD9A 2VBYA 4BKXA 4MEXF 3LYCA 1N07A 4P6VF 2DXIA 4GFBA 2ELJA 3GF2A 4UUVA 4HLYA 3CRZA 1LE8B 2VBSA 3RQIA 2LVSA 3Q0WA 3GLLA 2WC2A 1EXMA 4P22A 4C43A 3CO6C 5EYRA 4M71A 1QBJA 1FNMA 1IN7A 1BI3A 1SAUA 2VBWA 3PNYA 4PC2A 1I6XA 4IZZA 3ASSA 2PJPA 1OMIA 2LBFB 3A8JA 2R7TA 1FBUA 2PBIA 1H8EA 3HM5A 1S9HA 2ZITA 4L9NA 2BX6A 5M5WJ 3A2KA 4E70A 4QVJA 3AVYA 1BR2A 4HEA2 1XSVA 3L9FA 2M4KA 3VYSB 4KITB 1EFRA 4X7DA 1G8XA 1IV8A 2XIGA 2X4HA 5HDGA 2L9SA 3M8FA 1NH3A 2NTPA 2O17A 2BV6A 1W5SA 5F04A 3G73A 5LFAA 4C2LA 2P7VB 1XGNA 2M7AA 4Z4WA 1O3RA 4XQFA 3QODA 5LLQA 3EUAA 3I56B 5E17F 2C5BA 4LG0B 1MMGA 3TO9A 3SUCA 3A3GA 1QO0D 4AWXB 1O8IA 1N06A 1QUEA 1R49A 1U5TA 4OM9A 4M4SA 2FBIA 4ENKA 2AXLA 4L9VA 5GAGJ 1E3XA 4P6YA 2HU9A 4Z2YA 1HSJA 1DGRM 1HW1A 2E2JJ 4HF2A 4UV9A 2ZZFA 1UELB 2XNDA 3S3MA 1BX1A 4KUMA 2ZBUA 2GA1A 4FHTA 3BCFA 4XKWA 2LY1A 3GTMJ 5F6FA 1WVRA 5K7HA 2QYOA 3OKXA 2BM5A 2IGMA 1XGOA 1HBXG 3CC7B 2BHYA 2BW3B 2F4OB 4HV5A 1FRNA 3C2BA 5EG0B 4RLQA 1LJ9A 2VBZA 1UG2A 3DV8A 1CF7A 3HXLA 2GQFA 3WNCA 3AVUA 3GVAA 4A0YA 3FPPA 2LKXA 1R5ID 5TISC 3H9NA 4LBZA 1QA2A 1HW5A 2X51A 3VB2A 5EF6A 1NK2P 2PLFA 1BJZA 3GTLJ 3PNTA 2K9SA 4N4OB 5IT3A 1HVXA 2Q2EA 1FZPB 4AYBN 2M8GX 3EUHC 2HYGD 4XSXF 2EWEA 5DUIA 4BXFA 2R7FA 2ZMEB 3IRQA 4Z4UA 2V26A 5JLVC 1R36A 2X6YA 1X3UA 4G7HF 2NYXA 3BZCA 4YCQA 2BM0A 4ZYDA 3FIWA 3HOSA 3LSIA 2L0KA 1YFHA 4HQMA 3DLLF 1LEAA 2KRCA 2LLKA 3J7AY 1TUIA 1WOPA 4ZCMA 2LTPA 4CCNA 1U8BA 3GWZA 3Q9SA 2DT6A 5HZBA 1WJ5A 2R9VA 3AG1H 3E6BA 4KDPA 3JW4A 4LLGF 2JA6J 4XLHA 2P0WA 4IRHA 4EGZA 1WJBA 4UZEA 3TGNA 2VFOA 2ZSHB 2VT3A 4RAFA 4BUPA 1S7EA 1IRZA 3ML3A 2RV8A 5FNZA 5HKKA 2KDZA 5E18F 1J75A 3KP4A 5B3SH 4EVIA 1YW8A 5HNFA 1A5JA 1AIRA 4YRVA 2NSTA 3WHCA 1ZN2A 3BZ6A 3KLOA 4LFUA 1KYZA 3SZGA 4RLZA 3TW7A 4DNRB 4BY7J 4Z4RA 2AXTC 2IVMA 1BR4A 3G1LA 2VL8A 2HQNA 2PMZN 3FXUA 4YELA 3CCSB 4HV6A 4UUSB 4QTRA 1AIPA 2J8IA 4DZJA 3BG7A 1ZG3A 1UMQA 4WXHA 2OPTA 2DN0A 4XRFA 1VQ9I 3VEPA 4OOIA 2PG4A 2EFNA 4B09A 2OBSA 4HA8A 5GPCA 4C2UA 3OR1C 2DA5A 4FE4A 1PUEE 3L2WA 9ANTA 4V19K 1MH3A 4EM1A 3B4NA 4ZC3A 1X58A 4XKCA 1R4MB 1K61A 1MBJA 1QHHD 3JSOA 1YJ9B 3ASOH 5CDFA 3IWFA 2E1CA 2VKVA 4Y33A 3BT9A 2QDXA 1B6AA 3RDIA 2UXNA 2ID3A 1FP1D 3ZMUA 3O6BB 4MQVA 4W8TA 1Z67A 1TL8A 2K3PA 1HKSA 1JHFA 3H3UA 2DTZA 1EKEA 3KFWX 4BEHB 1D0YA 4HF1A 1NHAA 2IA1A 3RCOA 5EEHA 4BU2A 2BGIA 1VQPB 1O8EA 4XRMA 1XMKA 1PP7U 1S72B 3HYIA 1VLYA 2JWTA 2VOOA 4EV0A 2CQQA 1WSVA 5CQGA 5KAIC 2IBDA 3HKZA 3OZVA 1O3SA 1FOKA 5FFZA 1S72I 4PGHA 1PKVA 2W24A 3V7AA 1MMDA 1JKRC 1PUFA 1YX5A 5E20A 3MZ8A 2LH9A 4XORA 3ASRA 5EZGA 2MC3A 3Q9VA 4U0YA 3V7SA 4UVBA 1D2EA 2Y2ZA 4IHVA 1LUJB 4Z1MA 4G7XA 1XC5A 2R7UA 2A3SA 1ZGAA 4L18B 3OYEA 1BIBA 4B8XA 3T1BA 4J0QA 2EIJH 2X8KA 2M9HA 3A8IA 1TYUA 3R4KA 5B6IA 4IL6C 4KN4X 2X53S 2OCEA 1IUYA 1B1BA 2XSJC 5FRMA 4IW3B 3FDYA 4U7BA 3WGHA 1YO5C 3KEYA 4LG0A 4RCZA 3FZVA 1W9XA 1GVDA 1X4PA 2OK7A 3B90A 2DT7B 1BIAA 5FIUA 1I6HJ 4YC5A 3OIPA 1QVGB 1LDDA 1FPQA 3SYTA 3E1YE 3JTHA 2GAUA 3K69A 4G1BA 1BX0A 5B5EC 1U8RA 4YZ0A 3PVDA 4AC9A 1D3YA 4OOXA 1CLWA 2A5YB 2DYIA 1WMRA 3QYBA 4AC0A 1X1CA 1JKOC 1P4WA 1DDGA 1WPCA 3CC2B 3CCSI 3QSYA 3LQEA 2DA7A 3GLXA 3GQAA 2L7FP 1JT6A 1EF4A 2KISA 3U21A 4AVPA 2EZIA 2XAHA 5H6RA 4A3JJ 2H8RA 2XAFA 2NAZA 1ZR4A 2NV4A 2GIVA 4M3GA 2EZLA 3HTSB 2DBBA 4LLNA 4OJ5A 1OLTA 4UB8C 2RREA 1DBOA 2UVFA 4YIRX 3LNQA 1FP2A 4UV8A 2QA4B 3ZSCA 2O8XA 3V8LA 2ID6A 2QBYB 2QQBA 1KRHA 2OBTA 1VQOB 3PUMA 3ZPPA 1YE9A 3SFIA 3KL9A 1YIOA 4A3CJ 2CQXA 5LHHA 1SD4A 4AM3A 3WU0A 4F7DA 3CD6B 4OAZA 3MMPA 3FHNA 2NRAC 4P1WA 4FX4A 4PFOA 5J47A 4BJ6C 3G71I 3SQVA 1KU7A 2HTSA 1VQKI 1X1PA 3HRSA 2VE9A 4A3IJ 1COWA 2BSAA 5J4VA 2LOOA 1BI1A 4HNUA 1H88C 4B3GA 3CUOA 2A6TA 2XKOA 1O88A 3T9GA 2Q6IA 1JTXA 1WPKA 1YITB 4RD0A 1IRFA 1XDSA 1P6RA 3FJOA 2IW5A 3CJQB 3BR3A 2OJED 3E7LA 2MSYA 3TOAA 3VPRA 3OYMA 2OTJI 3VSUA 4Y7CA 4EGYA 1CGPA 3LSGA 5C4JJ 1U9NA 4HBLA 3KP3A 4BPRA 3U6KA 5F4OA 1U5TC 4M0LA 2R4GA 2K27A 2LFBA 3KEOA 1UB9A 4LLLA 1XFOA 3CCRI 1W34A 1OFCX 4NBSA 1K28D 1V54H 2EB7A 3C1DA 4S05A 2Z33A 4V02C 2FVGA 1ZK8A 4HSRA 4MQ9F 1Q9SA 3P26A 1JA0A 3OW2B 4Q5SF 4UUSA 4HE5A 3KE2A 1IRXA 4P3IA 3K1MA 3U9GA 4AVZA 4A3DJ 1OHHA 2AQFA 5H59A 1T0FC 5A88A 4P26A 2XGJA 2XTYA 2MBFA 2RVCA 3WWGA 3JU4A 3IUOA 5TV2A 4W8QA 4NQWA 4DZPA 4KMFA 4LB5A 4HE6A 1VQ5B 1ZAOA 3KEQA 3PFIA 3VSVA 3H3VK 5M5XJ 2Z2SB 3RZDJ 1I5ZA 5L3GA 3EUHA 2R92J 2VOPA 3OS2A 4BL0B 4MNUA 4WWCA 3MCZA 3W3CA 1BHEA 4LOCA 5BPDA 3SDBA 4GO1A 2I5UA 1PVEA 3ES9A 2JIZA 3N97A 2VASA 2EZKA 4XLNF 3JQRA 2HXOA 2Q1ZB 3A4CA 4X1EA 2X1CA 1Y0NA 2XT2A 4P5OA 3V42A 4BY1J 2NZMA 2FX3A 1QVTA 2QA4I 2Z8GA 4P96A 1QFJA 1JGGA 2FQ3A 3F8BA 1MJBA 2ZC2A 1YHQB 3OYJA 2DK8A 5DM6F 1Z05A 3CQZJ 1I18A 1RIOH 3LOCA 3GTOJ 3DDYA 1TC3C 3B6AA 1CQTA 4D5CA 1RRJA 1T56A 2FJ1A 2O03A 4AYBA 1ZQ3P 2V7QA 5DCMB 5JFRA 3FKSA 2L5QA 3WG7H 4YAUA 2FEZA 4PJJA 4A69C 1VLOA 2D9RA 3EYYA 2A68F 1PJ6A 2W4SA 4HX7A 3CMAI 2K40A 1PUFB 2Q2EB 2QSFX 1HZEA 2HDWA 2QXZA 1QA3A 3H09A 4FX0A 1PYVA 5M5YJ 1ZLKA 3GO5A 2CH0A 2KDOA 3FISA 3FM3A 3Q39A 1S29A 2O6WA 1NG6A 5D5XB 2A07F 5LRSA 5C3EJ 2Y31A 1XX5A 2BVNA 5C1CA 5FKKA 3CMYA 5F27A 1D8TA 3B78A 4EJOA 3JX8A 2ICWG 3LSJA 3GX4X 1VZ0A 5D6EA 2M2EA 2DMQA 1W7PD 4PC6A 5CPRB 3R6KA 2TCTA 2ZTGA 2M4GA 5JI6A 2V9VA 3W2FA 2V4DA 3IKTA 1BM9A 1I3AA 2HQRA 3BLYA 3KYCB 4IOAF 2B5OA 4EMSA 3OFNA 6PAXA 4G9YA 4XR6A 3BH7B 3SEQA 1S7AA 2OF7A 3W2IA 1OFDA 2HQ5A 2JVGA 2BPOA 3B8YA 2F5FA 1SMTA 1IHMA 2M45A 2VNJA 1OFLA 3L00A 4UVCA 4R8HA 1Q1VA 3WTYC 3FK6A 2HMAA 3ZMDA 4PGGA 3MEXA 3S93A 2AS5F 4RGUA 5HS7A 2YUSA 4U7DA 3MKWB 1YRNA 3BCAA 5KNLA 3VO1A 2HWVA 1FNBA 4I84A 1MNDA 1REPC 2E1OA 4YZAA 2DA3A 2ZJRF 1X1BA 2EINH 5JVGF 3UKGA 2CRGA 4W8RA 4IRIA 1QNTA 4Z4ZA 2ESNA 1BA5A 2LR8A 4D7MA 4MGRA 2R7WA 1H0MA 1JE8A 3F8NA 1SM4A 3G1OA 4E7LA 3WTTC 1ZM2A 2LDUA 1SVOA 3SEZA 4EJVA 3ERMA 1H80A 3KETA 4D1QA 3ZCOA 3TH0A 5LGNA 1EH8A 2ISYA 4UY8I 4UZFA 3BJ6A 2UUZA 5FL7A 5DTDA 3L2CA 4DQLA 3W6JB 5B1AH 5B66C 2IS1A 1JTYA 2X9DA 1TNTA 2HGCA 1WZ2A 3V8JA 2MA3A 2Y9ZA 3ZQ7A 3G6EB 4RGXA 1N8RD 2F48A 3ZRGA 2DDAA 3CPWB 2FMYA 2CUEA 2VXDA 3EQOA 2DMUA 3VYUB 2CF4A 3E5XA 2E71A 1A35A 1KYWA 2PEXA 3F8FA 1E1RA 4RM3A 1R5GA 2KLOA 1J59A 3ASNH 2Z6BD 1GUUA 1P7IA 2IGNA 2VQHA 1ZR2A 2OC6A 2XAJA 2YSRA 4RB0A 1S6LA 3LO8A 1J0RA 3DXJF 2HNHA 4XSZF 1WOOA 3HSEA 1RETA 2V7FA 5THXA 3HKZN 1D8KA 3K1NA 4CZZA 1SEUA 2Y30A 3Q0VA 4CCLA 4XM3A 3K2ZA 1V5GA 2K9MA 2VONA 3F0CA 3CCVB 5LGTA 2VNIA 3P9IA 1APLC 2STWA 2BGJA 4ZGQB 4LIUA 2Z5UA 3ZMSA 3KP6A 2PMDA 2XOKA 2LMDA 1W0TA 1TLHB 5ICCA 1OCTC 3ERED 5ILVA 4CH7A 1X2NA 2JN9A 2RNJA 3CCUI 2QGUA 1R6RA 1MDMB 2VODA 2VBTA 3WTUC 3AAFA 3ABKH 2OBRA 2QKLB 3A01A 1QHGA 1WCMJ 1XCBA 4B3AA 3GQ9A 3CCVI 4HOBA 3BNWA 1R1VA 3PUFA 2MFZA 2KQRA 5FB2A 5DS9A 1Y56A 2O5RA 2ZJ2A 2EFPA 2OV7A 3J81Z 4ITVA 2NT6A 3FBNB 2X3UA 2C2WA 3QQAA 1NB9A 3PETA 3WYAA 2ZNZA 3H5RA 4RD3A 3CDIA 5J40A 1LE8A 3CXCB 1E79A 1IDYA 1S5LC 1X1AA 2Y0MA 4IHTA 1D5YA 2GK7A 4PGOA 3P9CA 1K83J 2W1OA 3WU2C 1K8AD 4Y15A 3CW2A 2F2EA 2FA5A 2LBFA 2E36A 4M9XA 4ASUA 1Q86D 2DCUA 3LMMA 2LY2A 4N9IA 5FKMA 1TZLA 2GBYA 3D5RC 3H36A 3HBLA 1EFTA 1PE9A 2BY1A 2JQ7A 2C78A 1T95A 1XB2A 3ZC3A 1YLFA 4LBWA 1SFOJ 3I55B 4MTDA 2D45A 1KK3A 1OOCA 1NJID 1BQEA 4Q47A 1FX0A 3ZQCA 2R7XA 1DDNA 3OOCA 1E2XA 4FE7A 2A5WA 1I3QJ 4TMXA 4XD7A 2KRFA 4DK0A 1IXSB 4OPSA 5J1UA 4KN7X 5J35A 3C2GA 3ESWB 3OYAA 1ZM3A 5DCMA 4RGSA 3KZYA 1P7JA 2ZZGA 2V6CA 2VBVA 3RKQA 2CQKA 5HVQC 3WBKA 2D74A 1X4OA 3JTGA 4MYTA 2HCJB 4DQKA 3H5AA 1R1TA 3ML6A 4BNCA 5BQTA 2FMLA 4BACA 3NQOA 1WFXA 2H94A 1H9TA 3W2VA 1R5HA 1EE6A 1XMAA 1E3ZA 1K73D 2CYYA 2O7OA 4UUTA 4ZDOA 3WY9A 4YZXA 2GIZA 4XN0A 2PYHA 1BR1A 2HOTA 1VQ6I 1KU2A 5GAHJ 1G6NA 2BW3A 5CJ9A 1QRYA 3IH4A 3RSNA 1E3PA 3FKJA 1ZYRF 3MKLA 5CVIA 4F91B 1Z7LA 4G8XA 2I10A 2V4JC 4XLEA 5CLSA 5D4RA 4OMZA 4OMYA 2MH2A 1G4DA 4ESJA 5IOYA 4S04A 1DU0A 2VQGA 1KK2A 2P5VA 1VQ7I 3A0BC 4AUXA 5FLMJ 2HS5A 1BOAA 2J5OA 4HAMA 2VFNA 3RTRA 5TJJA 1IN5A 3FK7A 3O8HA 1PP8F 1AU7A 1W35A 4O6JA 1IXCA 3FXQA 3CO7C 3CCJB 1DU6A 4HX4A 4L0YB 3ZZ0A 1BI2A 5J1YA 5K7ZA 1QGZA 5TY0A 3WG9A 5IYNA 1B8IB 3LMWA 4A3EJ 1QGYA 2WB1N 3VMWA 4MTEA 1A04A 4PJ0C 5FROA 2OZUA 3CMMA 4OWRB 4CCMA 3ASTA 2XSDC 4OPVA 1YIJI 2HZTA 2LREA 3ISPA 2EILH 1F1ZA 3CTAA 4I09A 4PSXA 1EJ9A 2JJ2A 1JGSA 1AKHA 1T33A 4S0HB 2ELHA 4B43A 1B59A 2C4TA 3BQYA 2ME6A 4Y52J 2CUJA 3IAS2 2XGDA 1FYKA 4KIFA 3HOTA 1XPXA 2C77A 1OGIA 3FWEA 2O0WA 3EQLF 1OJLA 1OISA 3RYPA 3HPGA 3PSIA 2VPRA 1W0KA 1D1BA 1SD6A 4J19A 2HEOA 4A6EA 4CQJA 3FX3A 1JHHA 2B0LA 3ZPNA 1QJVA 2RNGA 2COMA 4KISA 2X1EA 2WYRA 5L3FA 1S3JA 1IDJA 1T0FA 3JRCA 3BR6A 4PCQA 1UD5A 5LEKA 2BMWA 3A8KA 5BS6A 2V79A 3G05A 4W8SA 2BBYA 3HSFA 3ZQHA 4QV2A 2KIQA 3BG5A 2PMHA 2CBXA 2OQRA 1FNNA 4RAGA 1AMOA 2GWRA 5FLXZ 4E6KG 3S14J 1Z0XA 5LMZA 3VSTA 3SKBA 3FF5A 2XPUA 1FEXA 1U9OA 1F9NA 1RUOA 2QVOA 2NTBA 1MBHA 3PSZA 5ICFA 1FOXA 3RI4A 2WV0A 2K5CA 3BY6A 5FO5A 4YZQA 1E63A 3GZ6A 2ADUA 1H9GA 1IUFA 3COAC 1N0UA 4BHPA 3QE2A 1EP1B 1HSTA 3VOEA 2CNDA 1D1NA 3BPXA 1S8NA 5K5QA 2ZTNA 3BZKA 1R7JA 2X6WA 4XLFA 2PJRB 3R0JA 2CG4A 2L7ZA 2INUA 3M8JA 4XIDA 1ZUNB 2M5WA 1IG7A 3O2PE 1HLVA 4YFXF 2FBHA 3I53A 4E7JA 2OD5A 1VQ8B 2DMTA 4PC7A 3OWTA 1VF7A 2K9LA 3L7WA 2WY7Q 5DDGA 1YITI 1IV6A 4GGGA 3M07A 4EM2A 3RQ4A 3BTIA 2YX4A 2EIMH 1HA8A 2INVA 4RB1A 3KP7A 4EJUA 1VQ9B 2WBMA 2QX3A 2W6JA 4RD1A 1RESA 2BHZA 5CQEA 2FSWA 1R5OA 4KICA 4A3BJ 4G6IA 5DD4A 4LD5A 3DKXA 4C3HJ 1SC7A 1ON1A 2P5KA 3IAM2 3S1QJ 4IF4A 4NC6A 4NDLA 2VPLA 2IJLA 2M7BA 4BDZA 4G94A 3OEHA 1K5CA 3MHPA 4YFKF 1MW7A 2DFEA 3NE5B 5E3NA 4C2TA 2HXIA 2VIXA 1MRZA 2CV2A 3JCUC 3S1NJ 2BF4A 5IYRA 2G0YA 4Q4ZF 3L2RA 2Y69H 2EV5A 2E5NA 4RPBA 5EEAA 3K4CA 3QPSA 4D0PA 2K3FA 1VI0A 4DYCA 4ESFA 2VLAA 2JUGA 4JOMA 4RLFA 4RAYA 3MQ0A 1RQPA 4YAFA 2Y9YA 4FCYA 4CCOA 3S15J 3AKZA 1H8HA 5K5RA 1TWGJ 4P1VA 1VQMI 1B23P 4CO8A 2IA0A 3DKWA 2L7MP 2XB5A 3FXKA 5D8LB 3U2RA 3BR0A 2XEXA 1DPUA 2AO9A 5LBQA 3T51B 3GTGJ 1T08B 4XONA 3TEDA 3QYEA 4NUBA 1E3HA 4ANJA 4PC3A 3CJNA 2NVTJ 3CMEB 1W0JA 4LJZF 2GOMA 2ZCWA 3OEEA 3U6BA 2HDDA 1YHQI 3PSFA 3ZIAA 2HKXA 4E7ZA 3SY2A 4WZTA 2CMPA 3IH3A 3ZR8X 3BH6B 5F0FA 3WTXC 4DOZA 3BG6A 3GMEA 3H35A 4XN3A 3WTWC 1OCCH 3A03A 4IO9F 1MJAA 1E17A 4FASD 2V7WA 5J1RA 4B47A 4ZYGA 3I4PA 3CCJI 4C30A 5K1YA 1BOBA 2IS6A 3W5VA 3F8CA 4GXOA 4M3FA 2L54A 3GFLA 1U2WA 2GZWA 5D5UB 3A01B 1OGMX 3P7NA 2O04A 3BJOA 5J8CA 4PK4A 4EH1A 1XCVA 3CCEI 2BY3A 3TO7A 3Q3AA 3GVKA 1O8FA 3P27A 1OFEA 1IGNA 2JRTA 3AVTA 1ZLJA 4M3DA 3ZMZA 3E1SA 1RZ4A 3J80K 3HOWJ 3W5HA 2IT0A 5BSXA 2D2WA 1B4AA 2X6XA 3FXLA 4DBRA 3VNVA 1JUPA 3E6MA 4AIJA 1MMAA 2YU9J 4R1HA 3A35A 3U1DA 3JAMZ 1IAWA 4KNYA 1O4XA 1JI8A 1UD3A 4YG2F 1FIPA 4WK8F 1MSEC 4YIFA 2DTRA 1EP2B 4RD6A 4ROXA 2FF4A 1FMVA 2B7CA 5FKNA 3I9V2 2DA1A 2LC2A 3K4KA 2V7VA 3BROA 1R5BA 1TP4A 3GEZA 4XNFA 3CF5F 2BEOA 4R71A 5BPIA 1JB9A 1KCDA 4A2UA 2B7EA 5IP7J 3ECOA 1A31A 4M53A 4UAJA 2FU4A 5AIQA 3OL4A 2RGVA 2DDBA 1BPLA 4HDUA 4ENNA 4A12A 1D0XA 2RKHA 4PUSA 3DPLC 3ZMTA 1AWCA 1UD8A 2JJ7A 2L9NA 1MKMA 1Y0YA 3BC9A 4X0CA 5GV7A 2XV4S 1FOWA 1ZGWA 4P25A 3I54A 2GOXB 2W25A 4BE0A 3TMOA 4AU7A 5F4JA 3W2GA 5EZHA 2QENA 1RUNA 2VB6A 3W6VA 3GYHX 4ZYEA 4UXNA 1IJWC 4RD4A 1YYVA 5J3LA 3SZTA 1V5EA 3GIRA 2F5CA 4XRSA 3HAGA 4O3MA 3CCUB 2BGCA 1NB0A 4IQJA 3O3KA 4HSTA 1SKYB 3CC4I 2P4WA 3IRRA 1YJWI 3VNUA 3BPVA 1ZKGA 5ICEA 3MN2A 2XZOA 3FMRA 2BOLA 3JSPA 2EZHA 3ZN0A 4Y3OA 4PABA 2JN6A 3KCCA 2V9PA 3A0HC 2QKMB 3VYTB 3F3XA 1I1SA 3OYFA 1W7PB 4W1UA 5DCFA 1BI0A 3V8KA 1G2HA 1U0JA 1XGMA 1BL0A 2HR3A 2VJ4A 2K7LA 1ETKA 3AG2H 2R5YB 2XGEA 4AF6A 4BHCA 3N05A 3PL8A 2VKEA 1WI9A 4HNTA 2WB1A 5IP6A 2H8WA 1HW2A 3NB2A 2L02A 1N0VC 1UG0A 2EQRA 1VNDA 2FX0A 3AFHA 4TKOB 2E2IJ 2ZZQA 4Z05A 5HZAA 2EWNA 2XAGA 4LG3A 1ZHFA 2V9KA 2R93J 1EH6A 1ETWA 2ZMEA 5KHDA 2H1KA 3LNNA 5FA6A 3CESA 3TQNA 2QEXI 3OSFA 1QVUA 2M3AA 2LYCA 1HDDC 1RQRA 1SD5A 4YFNF 2A69F 4N3NA 2V6EA 3CC7I 4Q48A 3OYNA 4PFPA 4ENJA 2Y75A 5FO1A 1MZBA 2NVUB 4Y9RA 2ZBKA 2WZPP 3RY8A 3UR3C 3UW0A 3V7RA 3LQQA 1VTNC 3QWLA 1QGAA 4PMHA 4AIDA 4XLAA 4RB2C 3J81K 2HPIA 4CYCB 1JKPC 2NOJB 2GM4A 3ZUGA 1QRCA 2W85A 1W1WE 4YAWA 3ABTA 1D1CA 1T6SA 2HI3A 3W2EA 1DPRA 3IC7A 1LEBA 2FNAA 2ETHA 1SFKA 2HLDA 5HXBA 4RDUA 4M9SA 3VMVA 2K9NA 1VHOA 1IW7F 1MMNA 3JRHA 4NB5A 2VBMA 1HOMA 1QH0A 3BCDA 4LC0A 3K2AA 3BG9A 4YALA 3WQZA 5AMVA 3WU1B 2RAEA 4KFCA 1AOYA 4O5VA 3U2QA 1Y39A 2XDVA 3LL7A 2QBYA 1ZM4A 1BLIA 4HYEA 3CUQB 2QGGA 1T98A 1IA5A 5HLIA 1KQ9A 1OCRH 2QWWA 3LAPA 5CVVA 1DG1G 4F92B 3OJWA 4PDKA 4CXFA 3ONUA 3HEFA 5IYPA 1ULYA 4OJPA 4RDKA 5LGUA 1HF0A 1G59A 2XHKA 2W6IA 1RPWA 3HUGB 3IWZA 2G7UA 3GBGA 2R7OA 1G7TA 3L09A 1HC8A 1KJZA 2KZGA 3SJPA 2IS4A 2JT1A 1WSRA 3ZQLA 1KD1D 4KH3A 2R5YA 5HLTA 4FT8A 1UAAA 3R6JA 5JMCB 1OFMA 3QFSA 3JRGA 3KYDB 3K10A 2DY1A 1IJFA 1UHMA 1D8JA 2J7KA 2F5EA 4B1RA 2CGPA 3OYBA 1Y6IA 4A5MA 3WGIA 3GFIA 2DPUA 2ZSIB 3K4LA 2V1UA 3GTQJ 2OQGA 3PM1A 1IDZA 1XE1A 3WBJA 1OYIA 2CW8A 2DOFA 1UD6A 5FKOA 5F1RA 1RR8C 2OTLI 4L9TA 3P9KA 2KT0A 4NK6A 3GSIA 4LGWA 3GW2A 2D3LA 1WJEA 1E0EA 5HS9A 3Q38A 2IPQX 1W2BB 5IP9J 2A6EF 2H6CA 2F5DA 4IXAA 1N78A 3IKVA 3ZXSA 2XAUA 1B72B 1YW9A 5H5JA 1H89C 1SANA 2TDXA 3P4GA 1UJ8A 1V0FA 3PNVA 4H0EA 2VN2A 3OR2C 3ABLH 4D9JA 1J9IA 3CB4A 4MHGA 2D1HA 3A1YA 3FPKA 1QGPA 3MAJA 2ZFWA 2O0YA 3T8TA 3N4MA 4A3GJ 1VJSA 1M90D 5F4MA 1B2RA 2VI6A 2E35A 2VE8A 3OL3A 1UCRA 4EJWA 4OIQF 3D26A 3QFCA 1JUSA 4IKFA 4D5FA 4TMVA 1GXQA 1ODDA 3QPHA 4MYUA 1FOYA 4BDYA 1TLLA 2IGKA 4BQOA 1X2MA 3G3ZA 4ETSA 1W0UA 2DMNA 2E34A 4U88A 4BXUA 3H0GJ 1DP3A 4RCYA 2DJIA 1E1QA 2UZKA 3REOA 3FXOA 1GV2A 2E1NA 4JP0A 4DIQA 5FRNA 4MO7A 2DQRA 4YAOA 4KIBA 1R22A 3BP8A 3F9KA 5EEGA 4E0FA 5L3DA 2P7CB 1RC9A 2P8TA 4XKBA 1E3OC 2LZJA 3CJRB 2DQLA 2RC4A 1OQYA 2PLYA 4G7OF 3HRTA 2GXAA 1BN8A 4IPAA 2K02A 2KIUA 3T8RA 1XS9A 1HCRA 1J09A 2EA2A 3BR5A 1OYYA 4NC8A 3SZPA 3MKZA 1HF2A 1ZELA 2HYJA 4XRSG 2EFGA 1WORA 1QQ1A 1Y0RA 2JSCA 4CICA 3TO6A 2E1MB 4E7IA 4P9UA 2VUMJ 2Q6KA 1UZCA 4I2OA 1T2KA 2NVXJ 1T5EA 2F43A 4XOTA 4Z4SA 2BXYA 2HYFA 4HLXA 2MW8A 3DTEA 5KAFC 4X05A 2QEXB 3OYGA 3AGQA 3F6VA 2M5SA 3S32A 1RWRA 3OS0A 3CPXA 3HOZJ 1ACIA 5IYQA 1KQ5A 2CU7A 2W48A 3DPTA 1MMSA 1HDPA 1TQMA 2JTVA 3WXMA 1NG7A 2O8KA 3JREA 3W6KB 5B1BH 2CS3A 1KONA 3A02A 4UVAA 1TYXA 3EETA 3KZZA 4JX5A 2XTWA 1GJRA 5FFXA 2JSPA 4IQ4A 5JLWA 2OAZA 3QFRA 5TGTA 2JA8J 2MD0A 5D4SA 2B9SA 1N05A 1E64A 4Z4TA 5IOZA 2E7WA 2JZYA 2CW5A 4Z06A 1BBYA 1ONVA 3KLNA 4KJZA 2ZL7A 1H8AC 3DF8A 2NT9A 4F93B 4MIMA 4II3A 1R9TJ 2OUMA 1GHCA 1WJCA 4P3YA 2XNCA 3HZJA 4NCNA 3SYJA 1WTHD 3WTSC 3CCQI 3CCYA 4C0SA 1JJ2B 2HFHA 2E2HJ 2CV0A 4RS8A 1JJ8C 1GAQA 1HG8A 1FY7A 1FDRA 4Y17A 2JA2A 2ZXIA 4ZCLA 4G12A 1GXPA 2OTLB 4BBRJ 1WU8A 1VQ4I 1B72A 2MABA 5IY5H 5AONA 1TSPA 1U3EM 4DK1A 3J81k 5GTIC 4HQEA 1I1GA 1T6ZA 2DA2A 5BSYA 1YJNB 4E7SA 3PA2A 1PLUA 2VKDA 4M6XA 1YIJB 2VQCA 4GYIA 2P3MA 1W5CC 4E7HA 3AGPA 2IP2A 4DYQA 2MLGA 4IHXA 3OOPA 4PAAA 1RKTA 2VJIA 2WWYA 3SXYA 1MABA 1P4MA 2KP6A 4QWQA 1WJAA 1MD0A 3OP1A 2GXGA 1O57A 2LP0A 1S7OA 5FD6A 2DERA 4A3MJ 1LNWA 3L2QA 1ZG5A 3I1FA 4NBQA 4RDJA 2BN4A 3OPOA 2M34A 1A8PA 1V0EA 1LKXA 1PJRA 3BTJA 1S4MA 5IYWA 5KW9A 2R3SA 3K4BA 3H5NA 3EUKL 5IYBJ 3BY1A 3FHZA 3MWMA 3AG4H 1IXRC 5DN6A 2F5VA 1W36D 2F4MB 3VSLA 1QZYA 1TYWA 2KJBA 3E5QA 4OINF 1QFZA 1GVHA 3R61A 2W82A 1PJ5A 1X3ZB 4V2GA 1IN6A 1XB4A 3K0LA 5GAEJ 2V1NA 1JKQC 5LD2C 5A89A 3CCLB 3AVXA 1OCPA 2CW0F 3B6CA 4YIIA 4MLOA 3C7JA 2VBUA 1O8JA 3N90A 3HGGA 4M6VA 3NWSA 4H4KC 4NK8A 2NOGA 2Q8KA 3LWFA 2DYRH 1QRBA 1YS6A 4M3EA 4BGDA 1WXRA 3PO2J 3CCEB 2UXXA 1ETXA 3B73A 3HJEA 2DETA 3F23A 2HOSA 3C2HA 2DMPA 1C0WA 3LFKA 4URRA 5L3BA 1XSXA 5H6QA 2W00A 3G4SI 1WI3A 3ZPLA 3HB9A 1YLOA 5GADJ 4I0BA 2X85A 3W2HA 1SKQA 2WR8A 1FNCA 1O8HA 1DDIA 2DA6A 4ENMA 3DBLB 4PJNA 2IAIA 1LFUP 2YX7A 2XGCA 4XL9A 4DNTB 1VQNB 3EPZA 3PENA 2DAOA 3WHBA 1O7FA 1Z7UA 2JPCA 1KU3A 3PA1A 4C9YA 4U4BA 3JQPA 4EATA 4OJOA 2XF7A 3H94A 1QA6A 2BV3A 3SQNA 1K4TA 2RN7A 1AKHB 1ZREA 1TTYA 2EFQA 4QPOA 3KX2A 2EPFA 2MD5A 3GUDA 2V7XA 3CP8A 3S2HJ 1MBEA 1P4XA 5DM7F 1OGJA 4MR0A 3BOQA 4B44A 2ZZEA 4IOCF 1KCCA 3SEJA 2Z99A 5DD8A 1OGOX 1I27A 4M2LA 1L0OC 1FJLA 4N3GA 2VZLA 3ISXA 2CO5A 3GFMA 3QOPA 4P55A 2XZPA 1Z6TA 1FWZA 2VFQA 3I0TA 3BR1A 3J80Z 2PX9A 5CVUA 4ZZDA 3BTLA 2UV1A 1TWFJ 1TT0A 2KFDA 2AHOA 4DYRA 3HOXJ 5IK2A 4M73A 5D5VB 1WP6A 3IP4B 2K4BA 3HOUJ 3C18A 4RM0A 5EMNA 2B63J 1R00A 4XBFA 2PFBA 1YX2A 4U0VA 3ECHA 2WAQN 1Z3XA 4IRGA 3WNDA 1Q82D 3JRIA 2W84A 4FISA 3R6SA 1GO2A 1TTTA 2EK5A 4UB6C 1MDMA 2AQEA 2F4IA 4ZDLA 5D6FA 2GLOA 3LQRA 2V7UA 3OZWA 4UZUA 1KA8A 2XT4A 4I0AA 3RIQA 1W7PA 2BM7A 1FIAA 2JPBA 4CUGA 2O61A 2EJRA 2CW7A 3N6ZA 1SAXA 4RBOA 4BHBA 2R5ZA 2CSOA 3BG3A 2B0RA 1LB2A 2R0QC 2MYSA 1QU3A 1IB4A 2PYGA 1PDNC 1S0UA 4NC7A 2FUG2 1VQNI 3RKWA 1XG1A 4B3FX 5CVRA 2VNKA 1V4RA 3LSHA 3FY3A 2KRHA 3PO3J 3GQBA 4ZH4F 3F72A 1G3YA 1FRQA 4TSFA 1K8FA 4Z03A 2F6CA 4OU0A 4CA0A 3K6GA 4B4DA 2DYSH 3G1MA 4ZJZA 3VMFA 1FYMA 3AVVA 4C3JJ 2NSPA 4QSHA 1EH7A 1DP7P 3EYIA 5IYDJ 1O8LA 4I02A 1JRGA 2BSPA 1OB2A 5HDNA 4DBQA 1HXDA 2CUZA 2XROA 1WOSA 2KJCA 4XK4A 3BQZA 3QRFF 2HTJA 2XRLA 4DGWB 2ZBVA 4X06A 2LF7A 2QQAA 2R7VA 2GQQA 2TRTA 3G2BA 1DGWY 5E3OA 2YU3A 2L2OA 2DU9A 3HHHA 1K7AA 1I7PA 2BM1A 4CYCA 3M1EA 2EH3A 3DU5A 2DW4A 4AIHA 1DUXC 1JA1A 5HS8A 2FD5A 3FBIB 4M9ZA 2M8EA 4CDGA 1CZFA 1KZLA 1H85A 2Q6LA 1GQ8A 4IEJA 1KGSA 5L3EA 3GTJJ 4CSWA 1BJAA 4TT3A 1P2FA 1USSA 4YXWA 1R1UA 2QMUA 1GV5A 3EQNA 2WADA 1ETQA 5DYMA 3OIQA 1B9NA 5DSZA 1G3WA 4Y7NJ 2D1VA 2ECBA 1N75A 1U2RA 2YWFA 2XKPA 3HRMA 1WDTA 4NHJA 3KPHA 4GCVA 3PIOF 4EM0B 3PFYA 1SFEA 1SVLA 4ZYAA 3SDGA 5KCMA 1WSUA 2CRVA 3OS1A 2QTZA 3RPUA 3PSSA 3M1CA 3VO2A 4G7WA 2W57A 2V1XA 2Z9OA 4BQQA 3Q6RA 2JDIA 1KC8D 2DCEA 1FBSA 1VQLI 1XN7A 2DI3A 3HTUA 3RKXA 1YJNI 5F08A 4KKUA 3SZEA 2ECCA 5BMZA 4A3LJ 3L1PA 3LSPA 4KKTA 3ZZTA 3GRHA 1KZHA 5E3LA 4XOPA 1VQ4B 2DLLA 3OYDA 1N25A 2P6SA 3BCBA 1LLWA 2EV0A 4M72A 4ACAA 2JA7J 3RKYA 1TT5B 2BYVE 2FOWA 2XB0X 4WF2A 4M74A 1BN5A 5GP9A 3D0SA 3S16J 1A36A 3CMAB 1VQMB 4LITA 1KTWA 4BJ5C 2IGOA 2J8KA 4I99C 2O1DA 2RQPA 2EIXA 2JUCA 2E7XA 4X7EA 1Z3YA 1MGTA 2ZO4A 2COBA 1POGA 1YQAA 1RI7A 3SFZA 1WJDA 4IX7A 3HPHA 3NARA 2K9QA 1XG2A 1A6IA 4KIGA 3DBHB 1HKTA 3JAMK 1OCOH 3MD2A 3WTVC 4LBYA 4N0BA 2CQNA 1YI2I 3MKYB 1NRKA 2VC0A 1IF1A 5A8AA 1K6YA 1VF9A 2ZL6A 4G6DA 2H1LA 1G7RA 3PQKA 4FWTA 3FXRA 2BM6A 1VFCA 2DPDA 3AVWA 3NEUA 4HF0A 4JRAC 5IT9K 3ASPA 2PQ8A 3E97A 4TMTA 1DBGA 3PUBA 3GQ7A 3ABMH 4OIRF 2FXAA 4QIWN 3W2WA 1VQ5I 1M1EB 1IB0A 4G5GA 1RU4A 4OIOF 3S2WA 5M3MJ 1P9QC 1GR1A 5FO0A 3M9AA 3OYHA 1W5TA 2EA4A 1U5TB 4IHSA 2ZXJA 2WY8Q 1U78A 1O8KA 3V76A 1OPCA 4XLPF 3B8HA 3T56B 4ON0A 4CYDA 3WE3A 2UWMA 2Y0SN 1NTCA 3GTKJ 1ENHA 3D5SC 4WQMA 3K9TA 1EA3A 2L4AA 3OMYA 2UVEA 2M1BA 4FQGA 1ZRDA 5E8GA 3L2VA 4G1VA 4QHYA 5GV8A 3AK5A 3ONYA 2DJNA 1K6OA 2DK5A 1DARA 3OIOA 3FXMA 4HWVA 3DQVC 2ZJQF 1F43A 3JRBA 2WTEA 2ZKZA 2E1MC 1D1AA 1ORKA 2X0LA 5ILSA 2PN6A 3CCMI 1YOVB 1P4AA 3PIPF 4IVNA 4BQNA 4B3XA 3S1RJ 1GAWA 4X07A 3BTCA 4U0WA 1VQLB 3D1NI 2ZFUA 1O7LA 4JK1X 1G3SA 4E7KA 5TRDA 4OP7A 2DT5A 3ZQFA 4QVAA 1TW3A 3JRDA 2YPRA 1LVAA 5JHFA 3OZUA 1Y1VJ 4OIPF 2IOUG 4B4CA 1H42A 1VHEA 5M3FJ 1EZGA 4JMQA 3KEWA 1OR7C 1LLZA 3E6DA 4MFEA 2QF7A 3DTKA 5A2QZ 4ZTJA 3B02A 1B9MA 3BJAA 4BH9A 1Z1DA 3F6OA 3I3LA 4HDVA 3HGYA 2D3NA 5IT9Z 3I5UA 4Z4YA 4X7FA 2BVLA 2XVCA 5CYVA 4DQ2A 1AHDP 4Y4RA 2ELKA 2XZLA 4H9GA 2LSOA 3K7AJ 4L8JA 2YWGA 2G0EA 5BNGA 1RMGA 3LVBA 3K4NA 1QG0A 1XGSA 1Q81D 4OJLA 5FD5A 4A3KJ 1KK0A 2NS7A 4KT5C 3GTPJ 4ZV4A 3RPQA 2NVYJ 1XD7A 2CUFA 5JHUA 2PECA 1YRNB 4U49A 3MVPA 1T39A 3I64A 1J9ZA 4YEJA 2JRMA 2L01A 2P81A 1UD4A 4PC1A 4X7CA 1WH7A 1B8IA 5LHGA 1Z6RA 4JYKA 2YWEA 4MXNA 1G7SA 2N8GA 2RDPA 1QX4A 2QYUA 1IDKA 1GLNA 2Z3YA 5E1XA 2C6YA 1N08A 2DOEA 3K70C 3RZOJ 2NVQJ 3CF2A 1K79A 2VJ5A 2CV1A 5J3OA 2DO7A 3J7ZI 4FN5A 4BQAA 1G7CA 3SHFA 1J5YA 2ACJA 4IHYA 4M6YA 3D5LA 1X1DA 1X19A 2RC5A 2PIAA 3BR2A 5F1JA 1MJ9A 1ZARA 1BC8C 1R5NA 4OOVA 3BDDA 4F7ZA 3OYIA 1P92A 3Q6QA 4P2NA 1L3LA 2LG4A 3LSMA 4L5JA 1TQPA 2V1DA 1FX7A 1HQCA 4LB6B 4AIKA 3MCAA 3FKIJ 3DTIA 3CJTB 1VBLA 1EWYA 4J01A 5D5WB 2WAQA 4G6QA 3ZQIA 1T6XA 3VR6A 1VQ6B 2KZVA 4R79A 2OCCH 1LDKB 2HKOA 2HVQA 2RQQA 3CCLI 2VKHA 1WJFA 2E1RA 2PE3A 2WJVA 4XLCA 3T5XA 1EFUA 3CZ6A 3TP3A 2MH9A 3F22A 1EP3B 2M87A 1CNEA 3NAUA 3ZN1A 4F52A 1NBMA 5A2QK 2DIEA 3CLOA 3SLNA 4BEHA 4PSWA 2WAEA 2VBEA 2XUBA 3C3WA 4C3IJ 5BOXA 3W5UA 4MEYF 4I76A 3LSRA 5JLXA 3VFZA 4A93J 3SJMA 4QFMA 3EDPA 1FSEA 1K4SA 2DOAA 1IJEA 1OKRA 3FM5A 4HG2A 4BBSJ 5IPAA 2DODA 1R58A 2GPJA 2DFIA 5FJ8J 5D8KB 5HLGA 1AA7A 1J7KA 2FE3A 1QCXA 3DLAA 2QCOA 4EW9A 4ASNA 5KSWB 3HC7A 4HX8A 3I55I 4QUZA 3IH2A 4TV7A 3OV8A 3TL4X 2ZB9A 3ZOBA 1KQSB 2QSGX 3WNBA 4UNOA 2ZXWH 2QM3A 3PJRA 2WPDA 4BJTA 3PUNA 5E8IA 3OJXA 4FXUA 3I58A 4YEIA 1ZGJA 2OZ6A 2ZMEC 1JXSA 1JUMA 1FTZA 3OW7A 1F20A 2K85A 4BS9A 3A1PA 2VFMA 3KP2A 2QUFA 4P9FA 4A0XA 4TN1A 1TW2A 3TDZC 2H27A 4XKVA 2VNHA 3MFKA 1UHWA 4GYGA 5EGOA 2ESHA 2HVSA 2GK6A 2M0MA 3W2AA 3I4NJ 5FLVA 3M8EA 1JTAA 2C5HA 3M3YJ 1BJKA 3BC8A 3HOYJ 1WQ2A 1V55H 1WKMA 2PMUA 3DEUA 2ISZA 1F60A 4ACBA 1EV7A 2MLKA 3IHUA 1KU9A 3JR9A 4Q7JB 4WWVA 5J4YA 2WSSA 3QP5A 5E6TA 1WWXA 3F8MA 5F64A 1DABA 5L46A 5JR3A 4J00A 3QAHA 3OYKA 1O3TA 2CK3A 2GJKA 3B82A 2KMUA 1YJWB 4ZCIA 3ASQA 4WCGA 1VQ7B 1K78A 4ZTFA 3DCFA 3QOEA 2NTQA 3AL0C 2WZNA 1YW7A 1KQ0A 5JBQA 3OYCA 3DEWA 1D5VA 2BM4A 4LIVA 2L4MA 3CCMB 1MH4A 4PZJA 2KL4A 2VT2A 5AN9A 2CC2A 1MBKA 4GRIA 2YR2A 2EV6A 4OOSA 4XMYA 3KZIC 4MFDA 1MIJA 4HNVA 3CCRB 5C1EA 4XICA 1FMWA 5ERIA 1XQBA 3CUQC 2GREA 4RPDA 2G7HA 4P9SA 1BMFA
chains in the Genus database with same CATH topology
5DN6A 2F5VA 2K3PA 1W36D 1OB0A 2L7KA 3VSLA 4F3QA 2BVMA 4BEHB 1D0YA 2W82A 4DJAA 3RCOA 2ZTNA 3K4JA 4BU2A 1O8EA 2XF6A 2X6WA 4XLFA 5CKTA 2PJRB 1VLYA 2V1NA 5LD2C 4KKSA 2INUA 3M8JA 5CQGA 3KYLA 2HQAA 3DKYA 3HKZA 1ERDA 4II2A 4MLOA 3T53B 4E7JA 1O8JA 2VQLA 2HVRA 4RM2A 1PKVA 3NWSA 1MMDA 3OWTA 1VF7A 2K9LA 4H4KC 4NK8A 1YX5A 4G6TB 2WY7Q 2R7QA 2LH9A 4XORA 4BGDA 4CCKA 3RQ4A 3C2HA 1HA8A 2WJYA 2R7UA 4G7XA 4Z1MA 2INVA 3OYEA 4URRA 2WBMA 2QX3A 2W6JA 2W00A 2X8KA 4N4NB 5CQEA 1O8HA 2X85A 2JJ1A 2X53S 4G6IA 1YX3A 3DWLE 2R7SA 4PJNA 3DKXA 4DNTB 4XL9A 2XSJC 5FRMA 3IAM2 3EPZA 2VPLA 3FDYA 4U7BA 2M7BA 4BDZA 3KEYA 3OEHA 4C9YA 4U4BA 1K5CA 1W9XA 4OJOA 1X4PA 4EATA 3B90A 2DT7B 2XF7A 1MW7A 3H94A 3NE5B 1QJVA 3OIPA 4C2TA 2E5ZA 2VIXA 3SYTA 2CV2A 4QPOA 3KX2A 3L2RA 4YZ0A 2E5NA 3CP8A 4X0GA 3K4CA 4OJ6A 1WMRA 4MR0A 3QYBA 1WPCA 1X1CA 2Y0SA 1LVKA 2JUGA 4JOMA 4RLFA 4B44A 2VLAA 2ZZEA 1KCCA 2LRDA 3GQAA 1OGOX 3U21A 4CCOA 3RPUD 3AKZA 1H8HA 4OJ5A 1OLTA 2XZPA 2RREA 1DBOA 3S3OA 2UVFA 3H9QA 4CZCA 3ZSCA 1NHCA 2UV1A 3T51B 1TT0A 4ZDPA 3ZPPA 1YE9A 2KHMA 4U87A 4XONA 3QYEA 4NUBA 4ANJA 5IK2A 1WP6A 3IP4B 1W0JA 2GOMA 3OEEA 3VYRB 3PSFA 3ZIAA 4E7ZA 4OAZA 2CMPA 3FHNA 3ZR8X 4P1WA 1Z3XA 1UD2A 4PFOA 3ZQQA 4BE1A 3LSKA 4BJ6C 3K70D 4DOZA 3BG6A 1LFPA 2AQEA 4HRIA 1COWA 2F4IA 1DQUA 3H35A 4ZDLA 2LOOA 4HNUA 4XN3A 4UZUA 4B3GA 2A6TA 1O88A 4FASD 1MNEA 2E60A 3T9GA 4B47A 4CUGA 2MC4A 3AL0B 2CW7A 3DU6A 4QPQA 4C30A 3CJQB 1BOBA 2IS6A 1X0CA 3VSUA 3OYMA 2VJJA 4NNJA 1QU3A 2MYSA 3LSGA 4OZYA 4BE2A 2PYGA 1IB4A 3MMYB 3LFUA 4NC7A 1OGMX 2FUG2 3L2UA 4B3FX 3FY3A 2O04A 4PK4A 3LSHA 1O8DA 2KRHA 3GQBA 2R4GA 3GVKA 4TSFA 1O8FA 4Z03A 1Z21A 2F6CA 3E0JB 4CA0A 3K6GA 2QE7A 4ZJZA 2NSPA 1O8LA 2BSPA 1JRGA 2KPMA 1D0ZA 3E1SA 1K28D 4DBQA 1O8GA 2CUZA 4HSRA 4HPQA 3UNGC 4DBRA 2X6XA 3JURA 2Z1DA 1MMAA 4DGWB 4NQWB 4E4HA 1N77A 3A35A 2R7VA 1IRXA 1UD3A 4AVZA 3G2BA 1JI8A 1OHHA 1DGWY 2AQFA 1V5FA 1T0FC 3A3BA 2L2OA 2XGJA 3WWGA 1E43A 3JU4A 1FMVA 3IUOA 3DU5A 3I9V2 3OYLA 4W8QA 2LC2A 3K4KA 3FBIB 1O8MA 4XNFA 1CZFA 1KZLA 3NWTA 2Z2SB 3VSVA 3DPUA 2VBKA 2F1MA 2W7NA 3OS2A 1GQ8A 4BL0B 1KCDA 3W3CA 1BHEA 3OL4A 4CSWA 3SDBA 2X3HA 1BPLA 4TT3A 4YXWA 1D0XA 2JIZA 3EQNA 4PUSA 2VASA 3DPLC 1UD8A 3H0DA 2L9NA 2PMZA 2WADA 3BC9A 3OIQA 2KVOA 2Q1ZB 3A4CA 2WA0A 2X1CA 4P5OA 3V42A 2NZMA 2GOXB 4BE0A 3TMOA 4AU7A 1N75A 2IS2A 2Z8GA 2VB6A 4RMNA 3HL2A 3PFYA 4ZYAA 3OYJA 5KCMA 3OS1A 3OE7A 3M1CA 4B48A 1V5EA 2WAFA 3HAGA 4G7WA 1I18A 3H9JA 2PJRA 3DDYA 4BQQA 4IQJA 3GVJA 2JDIA 4HSTA 1SKYB 2DCEA 3S8PA 2V7QA 4AYBA 1VBLA 3FKSA 2L5QA 3QYFA 4KKUA 4PJJA 2VXZA 4KKTA 4KT6A 2XZOA 2QY1A 4OAYA 3VDXA 2R7RA 3GRHA 4XOPA 2BOLA 2XF5A 2W4SA 3OYDA 1HZEA 2Q2EB 1I8DA 4GQNA 2HDWA 3BCBA 4PJMA 4Y3OA 2QXZA 1W36C 1PYVA 2CH0A 2KDOA 2QKMB 3VYTB 3S3NA 1KTWA 4LITA 4BJ5C 2IGOA 3OYFA 4OZZA 1NG6A 4CCJA 3OOUA 2O1DA 1U0JA 5C1CA 2VJ4A 1Z3YA 3N05A 3PL8A 4HNTA 1VZ0A 2WB1A 1WJDA 4IX7A 3HPHA 1XG2A 5CPRB 4TKOB 1UG0A 3CP2A 3AFHA 2ZTGA 2M4GA 3MD2A 2V4DA 2ZZQA 3BLYA 2E1BA 4LG3A 4Z05A 3OFNA 2V9KA 3MKYB 5KHDA 1NRKA 2I8DA 4XR6A 3LNNA 1K6YA 3CESA 3SEQA 2Z16A 3B8YA 2JVGA 2LYCA 2M3AA 2ODLA 2V6EA 4JQFA 1OFLA 2IQ7A 3OYNA 4PFPA 2CFOA 2HZDA 3H9GA 2X1DA 2V31A 3S93A 2WZPP 3UR3C 3UW0A 1DBGA 3PUBA 3GQ7A 3MKWB 3BCAA 5KNLA 3W2WA 4I84A 1MNDA 2HPMA 3DEEA 4YZAA 1X1BA 4PMHA 2GJPA 3K4MA 4XLAA 1RU4A 2HPIA 4W8RA 3BH4A 2NOJB 1P9QC 3GVLA 3OYHA 1D1CA 2R7WA 4E7LA 3VMVA 2HLDA 1SFKA 2WY8Q 3SEZA 1O8KA 1H80A 3T56B 4D1QA 3ZCOA 2IXSA 1MMNA 3TBIA 2UUZA 2UWMA 4PJLA 1KMHA 5FL7A 2VBMA 3OY9A 3ZGKA 3D5SC 4F55A 2IS1A 3BCDA 1EA3A 4FETA 3OMYA 2UVEA 5AMVA 3WQZA 3L2VA 2XDVA 3LL7A 3ZRGA 1BLIA 1IA5A 2VXDA 3EQOA 3VYUB 3HG9A 3KRGA 3DQVC 4F92B 4HWVA 3VWBA 1E1RA 4RM3A 2E1MC 2KLOA 1D1AA 4OJPA 1G59A 2Z6BD 2IGNA 2VQHA 2W6IA 2OC6A 3ONQA 2GJRA 4BQNA 4B3XA 3HUGB 2HNHA 3GBGA 2R7OA 5HNHA 2V7FA 4HIZA 4E7KA 2ZFUA 4CCLA 2IS4A 4XM3A 5HOOA 1V5GA 2K9MA 5JHFA 5HLTA 1UAAA 3OAAA 1OFMA 2JVHA 1PXZA 4LIUA 2XOKA 3KEWA 1OR7C 3K10A 4JMQA 2ZXHA 3VSKA 3DTKA 2O0VA 4CH7A 4ZTJA 1R6RA 2XC7A 3I3LA 3OYBA 1Y6IA 2QKLB 1QHGA 2D3NA 3GQ8A 2ZSIB 3K4LA 3GQ9A 2CW8A 2BVLA 1UD6A 2MFZA 4Y4RA 2XZLA 2DXIA 4NK6A 2ELJA 2KQRA 2D3LA 1WJEA 1E0EA 4L8JA 1RMGA 1Y56A 2O5RA 3K4NA 2OV7A 4OJLA 4ITVA 4P22A 1N78A 2NT6A 3FBNB 3ZXSA 1SAUA 2XAUA 3PNYA 4U49A 2PECA 4IZZA 4YEJA 1UD4A 2LBFB 3H5RA 2R7TA 1V0FA 3PNVA 1E79A 3OR2C 1S9HA 1H8EA 4D9JA 1X1AA 3A1YA 3A2KA 4MXNA 2GK7A 1BR2A 4HEA2 2W1OA 1EFRA 2M4KA 3VYSB 4KITB 1VJSA 1IDKA 1G8XA 1GLNA 2LBFA 2L9SA 3K70C 4ASUA 3CF2A 3OL3A 2NTPA 2O17A 2VJ5A 2CV1A 3LMMA 4IKFA 2LY2A 5LFAA 4C2LA 1TZLA 3D5RC 1PE9A 4BDYA 2M7AA 2IGKA 4BQOA 4XQFA 3QODA 3EUAA 1T95A 1MMGA 3SUCA 3A3GA 1O8IA 3D5LA 1X1DA 1X19A 1DP3A 2DJIA 1OOCA 1E1QA 1FX0A 2R7XA 3OOCA 2A5WA 4XD7A 3OYIA 4DK0A 4DIQA 5FRNA 2LG4A 1E3XA 3LSMA 3C2GA 3OYAA 2HU9A 1DGRM 3F9KA 2ZZGA 2ZZFA 4E0FA 3DTIA 1UELB 2XNDA 4J01A 3S3MA 5HVQC 2WAQA 1X4OA 3VR6A 3BCFA 2KZVA 4XKWA 2LY1A 4R79A 1LDKB 2RQQA 2HVQA 4XKBA 3H5AA 2LZJA 2VKHA 1WJFA 3CJRB 2WJVA 2IGMA 1BN8A 4XLCA 4BACA 2BW3B 3CZ6A 1WFXA 4RLQA 3W2VA 1EE6A 3HXLA 1E3ZA 4F52A 1NBMA 2DIEA 1J09A 4ZDOA 3FPPA 4XN0A 4BEHA 4PSWA 2PYHA 2WAEA 4NC8A 2VBEA 1BR1A 2X51A 3MKZA 1ZELA 4YZXA 3PNTA 4N4OB 2BW3A 1HVXA 3RSNA 4Z06A 3FKJA 2E1MB 1Z7LA 4F91B 2V4JC 3EUHC 4XLEA 4E7IA 1T5EA 2DOAA 2F43A 2VQGA 4XOTA 2EWEA 4HG2A 3DTEA 4BXFA 3OYGA 2M5SA 3S32A 1AA7A 1QCXA 3OS0A 2V26A 3DLAA 1RWRA 4EW9A 2X6YA 3HC7A 3RTRA 3TL4X 3DPTA 3HOSA 3LSIA 1NG7A 3PJRA 2WPDA 4BJTA 3J7AY 2KRCA 2CS3A 1KONA 4FXUA 4CCNA 2JSPA 4IQ4A 3OW7A 5TGTA 2MD0A 2DT6A 3LMWA 4BS9A 3VMWA 1WJ5A 2R9VA 5FROA 3CMMA 4OWRB 4CCMA 4XLHA 2P0WA 1WJBA 4XKVA 2LREA 2ZSHB 4KJZA 4BUPA 4PSXA 2NT9A 2JJ2A 4F93B 2HVSA 4II3A 2GK6A 5HKKA 2OUMA 2M0MA 4B43A 1WJCA 3W2AA 1WTHD 1JTAA 2CUJA 3IAS2 5HNFA 2NSTA 3BC8A 2CV0A 4YRVA 1AIRA 1HG8A 3HOTA 2O0WA 2JA2A 3SZGA 2ZXIA 3HPGA 4DNRB 3PSIA 1W0KA 1D1BA 2WSSA 1BR4A 2VL8A 4YELA 2MABA 4J00A 2GJKA 3ZPNA 2RNGA 3OYKA 3BG7A 2CK3A 4KISA 2X1EA 4DK1A 2KMUA 1IDJA 4E7SA 1PLUA 2VKDA 4ZTFA 3QOEA 1UD5A 2NTQA 2VQCA 4C2UA 3AL0C 3OR1C 4E7HA 4W8SA 3G05A 3OYCA 3L2WA 2VJIA 4LIVA 1MABA 2KP6A 3B4NA 4ZC3A 4E6KG 1WJAA 2KL4A 3VSTA 4XKCA 4GRIA 2NTBA 1QHHD 3L2QA 5CDFA 4XMYA 3OPOA 2K5CA 1V0EA 1LKXA 1PJRA 4Y33A 4YZQA 5C1EA 1FMWA 3K4BA 3H5NA 3EUKL 1BMFA 4W8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGM X;  3UW0 A;  1DBG A;  2O04 A;  3FY3 A;  3GQ7 A;  1O8D A;  4I84 A;  1O8F A;  4Z03 A;  4YZA A;  2NSP A;  4PMH A;  4XLA A;  1RU4 A;  1O8E A;  4W8R A;  1O8L A;  2X6W A;  4XLF A;  2BSP A;  1JRG A;  4XKW A;  1O8G A;  2INU A;  1BN8 A;  3VMV A;  4XLC A;  2X6X A;  1O8J A;  3JUR A;  1O8K A;  1H80 A;  1EE6 A;  4NK8 A;  4AVZ A;  4YZX A;  2VBM A;  4XN0 A;  4XOR A;  2PYH A;  2VBE A;  2INV A;  3WWG A;  2UVE A;  5AMV A;  4URR A;  4Z06 A;  4W8Q A;  2QX3 A;  4XLE A;  1O8H A;  2X85 A;  1IA5 A;  1O8M A;  4XOT A;  4XNF A;  1CZF A;  2EWE A;  3EQO A;  3VSV A;  2VBK A;  3KRG A;  4HWV A;  4XL9 A;  1GQ8 A;  1KCD A;  1RWR A;  4OJP A;  1BHE A;  1QCX A;  4EW9 A;  2X3H A;  2X6Y A;  4U4B A;  1K5C A;  3EQN A;  4OJO A;  3B90 A;  2NZM A;  2Z8G A;  4YZ0 A;  4XM3 A;  3LMW A;  4OJ6 A;  1OFM A;  1WMR A;  3VMW A;  1PXZ A;  4MR0 A;  1KCC A;  4XLH A;  3GQA A;  4XKV A;  1OGO X;  2O0V A;  2NT9 A;  1VBL A;  4OJ5 A;  3GQ9 A;  3GQ8 A;  1DBO A;  1JTA A;  2QY1 A;  3GRH A;  2UVF A;  4XOP A;  2NST A;  1AIR A;  3ZSC A;  1HG8 A;  4NK6 A;  2O0W A;  2QXZ A;  1RMG A;  1NHC A;  4OJL A;  3ZPP A;  1KTW A;  2NT6 A;  4XON A;  4OZZ A;  4YEL A;  4U49 A;  2PEC A;  1QJV A;  2O1D A;  4YEJ A;  5C1C A;  1IDJ A;  1PLU A;  2NTQ A;  4MXN A;  4W8S A;  1XG2 A;  1IDK A;  2VJI A;  2NTP A;  4XN3 A;  2O17 A;  4Z05 A;  3B4N A;  1O88 A;  3VST A;  4XR6 A;  4C2L A;  3T9G A;  1PE9 A;  2NTB A;  3B8Y A;  4XQF A;  2ODL A;  4XMY A;  3SUC A;  5C1E A;  1O8I A;  4YZQ A;  1X0C A;  3VSU A;  1OFL A;  2VJJ A;  1OOC A;  2IQ7 A;  4OZY A;  1IB4 A;  2PYG A;  4W8T A; 
#chains in the Genus database with same CATH topology
 1F36 A;  3WTZ A;  2X48 A;  2O6G E;  1OB0 A;  2L7K A;  3HSR A;  4F3Q A;  3HUG A;  1Y8Q B;  4K2E A;  2DOG A;  3IV5 A;  1ELO A;  1SD7 A;  2BVM A;  4DJA A;  3RYR A;  1XMX A;  4I7H A;  1IN4 A;  3K4J A;  2XF6 A;  1T8I A;  5CKT A;  1Z9C A;  2HOA A;  1ON2 A;  1QPM A;  4KKS A;  2Q0O A;  3KYL A;  3ZBU A;  2HQA A;  2CJJ A;  3DKY A;  5FKL A;  1Z77 A;  3NRV A;  4II2 A;  1ERD A;  3I59 B;  3T53 B;  2VQL A;  2HVR A;  1FLI A;  4RM2 A;  4WZL A;  2GA2 A;  5ED4 A;  2DFF A;  2O3F A;  4HW0 A;  4I98 B;  3J7Y J;  2H6B A;  3E20 A;  4K1X A;  1QA1 A;  2J5P A;  4G6T B;  1VQK B;  5LRR A;  2R7Q A;  2WV1 A;  5K7F A;  1ZH5 A;  3QU3 A;  3QPL A;  4CCK A;  1T38 A;  2HDC A;  2VC1 A;  2FRH A;  1FTT A;  1IN8 A;  1WGX A;  2ZJP F;  2WJY A;  3LST A;  4AF7 A;  4LK0 F;  4RJL A;  3GZ5 A;  3R0A A;  3LJY A;  4EJT A;  5DV5 A;  1LPQ A;  1W4M A;  4N4N B;  4P12 A;  2EIK H;  1UMK A;  3TKY A;  3Q5F A;  2JJ1 A;  5CVJ A;  3O8G A;  1OCZ H;  3RJP A;  3FXJ A;  2LKS A;  1YX3 A;  3DWL E;  4Y13 A;  2R7S A;  1E62 A;  1Y0U A;  4FTH A;  3M4O J;  5FLX K;  1XDU A;  2EBI A;  3JQQ A;  4U9U A;  1RKW A;  3S2D J;  3I56 I;  2LD5 A;  4RB3 C;  4L9J A;  2E5Z A;  1GT0 C;  4A6D A;  2QN6 A;  2BXZ A;  4KA4 A;  1TWC J;  3K1P A;  2PI0 A;  3J7A O;  4X0G A;  1K78 B;  1TNS A;  1R71 A;  3QU6 A;  3I4M J;  4OJ6 A;  2XPV A;  3CC2 I;  1K9M D;  1BW6 A;  2F4N A;  2Y0S A;  1LDJ A;  1LVK A;  1I50 J;  5ILU A;  2P5L C;  2OK8 A;  2BY0 A;  3HOV J;  2LRD A;  2QZA A;  3ZQG A;  2O9L A;  4ABZ A;  1OYW A;  2CFX A;  2XAS A;  1VQO I;  2DFH A;  3RPU D;  4A0Z A;  3BY2 A;  3SJZ A;  2V5I A;  3QP6 A;  5TR9 A;  1NK3 P;  5KK1 A;  4OPW A;  3CME I;  2GXB A;  4N9H A;  3S3O A;  2NPF A;  2BY2 A;  3GFJ A;  2H09 A;  3H9Q A;  3X2Q H;  1A6Q A;  4CZC A;  3E6C C;  4L0Z B;  1SFU A;  1UHS A;  1Z91 A;  3CUQ A;  4WXC A;  5H2F C;  3MZH A;  5GPA A;  4A5N A;  2BE5 F;  1NHC A;  2LF8 A;  4ZDP A;  2XAQ A;  2QQ9 A;  4U87 A;  2KHM A;  4I6Z A;  3ULQ B;  4M1K A;  2X6O A;  1TQI A;  3VYR B;  1TVC A;  1SVM A;  3CDL A;  4L5E A;  4RDL A;  1JJ6 C;  1FND A;  3ZQQ A;  4BE1 A;  1UD2 A;  5ICG A;  3LSK A;  1YTY A;  1NDH A;  3K70 D;  2NS8 A;  1LFP A;  4HRI A;  3G6E I;  1DQU A;  3WE2 A;  2CQ7 A;  1V3F A;  2OBP A;  1MNE A;  2E60 A;  3DP7 A;  3GCM A;  1ZG1 A;  2QZ8 A;  2MC4 A;  3AL0 B;  1V5V A;  1QVF B;  2RC6 A;  3DU6 A;  4QPQ A;  2QSH X;  1ZTR A;  3V7C A;  4EQQ A;  2P6T A;  4FK8 A;  1SFX A;  1RR7 A;  1WRJ A;  1TBX A;  2X0K A;  1X0C A;  3LA2 A;  4L5I A;  2VJJ A;  4NNJ A;  2ZNY A;  5F0C A;  2FQ4 A;  3FMS A;  4OZY A;  4BE2 A;  3MMY B;  3LFU A;  1ETO A;  4CHU A;  3MZY A;  3L2U A;  1KTV A;  4LK1 F;  4D7N A;  1O8D A;  2Y48 A;  1ETY A;  2E19 A;  5EGO B;  4V2F A;  1TYV A;  5EDN A;  3F21 A;  1J2X A;  1Z21 A;  3E0J B;  2QE7 A;  3S1M J;  4ESB A;  4IJA A;  1YS7 A;  5E1W A;  1RNL A;  1YJ9 I;  2KPM A;  1D0Z A;  3DBR B;  3E5U A;  1O8G A;  3I71 A;  4YDT A;  4HPQ A;  4JBA A;  1KQ8 A;  3CDH A;  2FNP A;  3UNG C;  1ZRC A;  1QFY A;  1EA0 A;  2QQ8 A;  5LEJ A;  3JUR A;  5GTH C;  1TWA J;  2Z1D A;  1IC8 A;  1MNM C;  1VQ8 I;  3GZN B;  2F1L A;  4NQW B;  4E4H A;  4EEF G;  5H20 A;  1N77 A;  5DNS A;  2F3L A;  2I1L A;  4OPO A;  3Q0U A;  1XSD A;  1V5F A;  4C2M J;  3A3B A;  4X8I A;  4RA2 A;  2IA2 A;  2R7Z J;  1I39 A;  4KYW A;  3QPT A;  1E43 A;  1TWH J;  4WXD A;  4ZZL A;  2L9R A;  1K4Z A;  3OYL A;  1LQ1 A;  2A6H F;  4A3F J;  2KIF A;  5EJC A;  1GDT A;  1F4K A;  2NNN A;  1O8M A;  3T0Y A;  1ETV A;  4HZF A;  3TW6 A;  3NWT A;  4M3B A;  1Q1H A;  3DPU A;  2VBK A;  4KMU X;  1CNF A;  2W7N A;  2F1M A;  3ABU A;  1MSF C;  1MBG A;  2BZT A;  2K4J A;  2LK2 A;  2VBX A;  3HDD A;  2X3H A;  4BXX J;  2OTJ B;  4JX4 A;  5DUK A;  3JRF A;  4QLC U;  5C44 J;  5L3C A;  2PMZ A;  5AIP A;  3H0D A;  1T6Y A;  2KVO A;  2WA0 A;  3FMQ A;  1FC3 A;  3OSG A;  4DW6 A;  4WZE A;  3H1C A;  2IS2 A;  3U1K A;  4RMN A;  2IEK A;  3HL2 A;  1W87 A;  3R60 A;  3QFT A;  3G71 B;  3OE7 A;  4B48 A;  1FT9 A;  2WAF A;  4DNC A;  1FSH A;  2YWH A;  1CF7 B;  1FYL A;  3H9J A;  1MBF A;  2PJR A;  4LBV A;  3GVJ A;  2MG4 A;  2DA4 A;  3S8P A;  5K5O A;  3CD6 I;  3LAJ A;  2STT A;  3ZBT A;  1STZ A;  2JK3 A;  2KKO A;  3QYF A;  4BYY A;  2JMW A;  3ELK A;  2VXZ A;  3I59 A;  5HLH A;  4KT6 A;  4X6A J;  1UFM A;  4OAY A;  3VDX A;  2R7R A;  2QY1 A;  4YFO A;  2XF5 A;  4Z6Y A;  4YHB A;  2IRF G;  2KIM A;  1I8D A;  2LNB A;  4GQN A;  4PJM A;  2FBK A;  2NS0 A;  1ZM9 A;  1W36 C;  3E3V A;  3S3N A;  4IHW A;  4TMW A;  4WX9 A;  4OZZ A;  3M7G A;  3H3Z A;  2LY9 A;  3OOU A;  4CCJ A;  2QTL A;  2K86 A;  2JA5 J;  1BW5 A;  5IYC J;  1Y8R B;  1ZRF A;  2XNJ A;  3SLD A;  2D5V A;  1XTA A;  1LFB A;  3Q3S A;  1UST A;  3BQJ A;  1F5T A;  2V7T A;  2MGQ A;  3TP0 A;  1OB5 A;  3CP2 A;  2M30 A;  2XPW A;  2HDN B;  2E1B A;  1QUF A;  1Q7Y D;  2QLZ A;  2I8D A;  1IRG A;  5KVR A;  2Z16 A;  1YG2 A;  4TMZ A;  1QZZ A;  2XGX A;  2DEU A;  3V4G A;  5E3M A;  2ODL A;  3LA3 A;  1HKQ A;  4CGZ A;  3P5J A;  3CLQ A;  3TOB A;  2ME0 A;  2XTX A;  2LKP A;  4JQF A;  2EFW A;  3RIR A;  1QPI A;  3G4S B;  2R6H A;  2IQ7 A;  1L1I A;  2CFO A;  2HZD A;  3H9G A;  2X1D A;  3AG3 H;  1QZE A;  1QQI A;  4ZYH A;  1O3Q A;  2V31 A;  4ZGN B;  3H92 A;  3ZP5 A;  5J6X A;  1M1K D;  4WZK A;  2HPM A;  3DEE A;  1R23 A;  5HDK A;  3IL2 A;  3HHG A;  4JX6 A;  1ITY A;  3K4M A;  2GJP A;  2B7B A;  4Z4V A;  3BH4 A;  5HOD A;  1IO2 A;  4GDF A;  3PQJ A;  1PJ7 A;  3ZMV A;  5E79 C;  1CQX A;  2NXN B;  3GVL A;  4Y9U A;  2L3D A;  2A61 A;  2OA4 A;  2Q6O A;  2VFP A;  3HRU A;  2OU2 A;  1R4N B;  2OYN A;  3LQ6 A;  1IZ1 A;  2IXS A;  2L9V A;  3VOD A;  1WH5 A;  3TBI A;  5J8F A;  4PJL A;  1KMH A;  3OY9 A;  3ZGK A;  2M0C A;  4F55 A;  1YI2 B;  4FET A;  4LMY A;  3JRA A;  3GXO A;  1VQP I;  1EFC A;  2C4U A;  5F0H A;  1JNY A;  2VYQ A;  3ROU A;  5JVT A;  1FBQ A;  2R7D A;  4RD2 A;  3HG9 A;  2YS9 A;  4G7Z F;  3KRG A;  4RAZ A;  3S17 J;  3VWB A;  2ZL5 A;  2W7Z A;  2HOE A;  1LM1 A;  3KIO A;  4I01 A;  1HA3 A;  5DEQ A;  1SMY F;  2NNY A;  3ONQ A;  5C4X J;  2GJR A;  3KP5 A;  1WHU A;  1Y1W J;  1BC7 C;  5FGM A;  5LHI A;  2XC1 A;  1JT0 A;  3DFG A;  2EFO A;  3TDU C;  5HNH A;  3WOD F;  5E1Z B;  3CC4 B;  4HIZ A;  3WGG A;  4BAY A;  1OR7 A;  1X3W B;  2YUH A;  5EG0 A;  5HOO A;  5DS0 A;  1G3T A;  3OAA A;  2JVH A;  1PXZ A;  2R5Z B;  4W97 A;  2ZXH A;  3VSK A;  2AHQ A;  3NAW A;  2O0V A;  3HIF A;  2XC7 A;  2A05 A;  3ZZU A;  1GVJ A;  1KK1 A;  3DU1 X;  3LA7 A;  3GQ8 A;  3CCQ B;  2FOK A;  1U6G A;  2XRN A;  3BWG A;  4RGR A;  2G9W A;  2CWE A;  4UHT A;  4AD9 A;  2VBY A;  4BKX A;  4MEX F;  3LYC A;  1N07 A;  4P6V F;  2DXI A;  4GFB A;  2ELJ A;  3GF2 A;  4UUV A;  4HLY A;  3CRZ A;  1LE8 B;  2VBS A;  3RQI A;  2LVS A;  3Q0W A;  3GLL A;  2WC2 A;  1EXM A;  4P22 A;  4C43 A;  3CO6 C;  5EYR A;  4M71 A;  1QBJ A;  1FNM A;  1IN7 A;  1BI3 A;  1SAU A;  2VBW A;  3PNY A;  4PC2 A;  1I6X A;  4IZZ A;  3ASS A;  2PJP A;  1OMI A;  2LBF B;  3A8J A;  2R7T A;  1FBU A;  2PBI A;  1H8E A;  3HM5 A;  1S9H A;  2ZIT A;  4L9N A;  2BX6 A;  5M5W J;  3A2K A;  4E70 A;  4QVJ A;  3AVY A;  1BR2 A;  4HEA 2;  1XSV A;  3L9F A;  2M4K A;  3VYS B;  4KIT B;  1EFR A;  4X7D A;  1G8X A;  1IV8 A;  2XIG A;  2X4H A;  5HDG A;  2L9S A;  3M8F A;  1NH3 A;  2NTP A;  2O17 A;  2BV6 A;  1W5S A;  5F04 A;  3G73 A;  5LFA A;  4C2L A;  2P7V B;  1XGN A;  2M7A A;  4Z4W A;  1O3R A;  4XQF A;  3QOD A;  5LLQ A;  3EUA A;  3I56 B;  5E17 F;  2C5B A;  4LG0 B;  1MMG A;  3TO9 A;  3SUC A;  3A3G A;  1QO0 D;  4AWX B;  1O8I A;  1N06 A;  1QUE A;  1R49 A;  1U5T A;  4OM9 A;  4M4S A;  2FBI A;  4ENK A;  2AXL A;  4L9V A;  5GAG J;  1E3X A;  4P6Y A;  2HU9 A;  4Z2Y A;  1HSJ A;  1DGR M;  1HW1 A;  2E2J J;  4HF2 A;  4UV9 A;  2ZZF A;  1UEL B;  2XND A;  3S3M A;  1BX1 A;  4KUM A;  2ZBU A;  2GA1 A;  4FHT A;  3BCF A;  4XKW A;  2LY1 A;  3GTM J;  5F6F A;  1WVR A;  5K7H A;  2QYO A;  3OKX A;  2BM5 A;  2IGM A;  1XGO A;  1HBX G;  3CC7 B;  2BHY A;  2BW3 B;  2F4O B;  4HV5 A;  1FRN A;  3C2B A;  5EG0 B;  4RLQ A;  1LJ9 A;  2VBZ A;  1UG2 A;  3DV8 A;  1CF7 A;  3HXL A;  2GQF A;  3WNC A;  3AVU A;  3GVA A;  4A0Y A;  3FPP A;  2LKX A;  1R5I D;  5TIS C;  3H9N A;  4LBZ A;  1QA2 A;  1HW5 A;  2X51 A;  3VB2 A;  5EF6 A;  1NK2 P;  2PLF A;  1BJZ A;  3GTL J;  3PNT A;  2K9S A;  4N4O B;  5IT3 A;  1HVX A;  2Q2E A;  1FZP B;  4AYB N;  2M8G X;  3EUH C;  2HYG D;  4XSX F;  2EWE A;  5DUI A;  4BXF A;  2R7F A;  2ZME B;  3IRQ A;  4Z4U A;  2V26 A;  5JLV C;  1R36 A;  2X6Y A;  1X3U A;  4G7H F;  2NYX A;  3BZC A;  4YCQ A;  2BM0 A;  4ZYD A;  3FIW A;  3HOS A;  3LSI A;  2L0K A;  1YFH A;  4HQM A;  3DLL F;  1LEA A;  2KRC A;  2LLK A;  3J7A Y;  1TUI A;  1WOP A;  4ZCM A;  2LTP A;  4CCN A;  1U8B A;  3GWZ A;  3Q9S A;  2DT6 A;  5HZB A;  1WJ5 A;  2R9V A;  3AG1 H;  3E6B A;  4KDP A;  3JW4 A;  4LLG F;  2JA6 J;  4XLH A;  2P0W A;  4IRH A;  4EGZ A;  1WJB A;  4UZE A;  3TGN A;  2VFO A;  2ZSH B;  2VT3 A;  4RAF A;  4BUP A;  1S7E A;  1IRZ A;  3ML3 A;  2RV8 A;  5FNZ A;  5HKK A;  2KDZ A;  5E18 F;  1J75 A;  3KP4 A;  5B3S H;  4EVI A;  1YW8 A;  5HNF A;  1A5J A;  1AIR A;  4YRV A;  2NST A;  3WHC A;  1ZN2 A;  3BZ6 A;  3KLO A;  4LFU A;  1KYZ A;  3SZG A;  4RLZ A;  3TW7 A;  4DNR B;  4BY7 J;  4Z4R A;  2AXT C;  2IVM A;  1BR4 A;  3G1L A;  2VL8 A;  2HQN A;  2PMZ N;  3FXU A;  4YEL A;  3CCS B;  4HV6 A;  4UUS B;  4QTR A;  1AIP A;  2J8I A;  4DZJ A;  3BG7 A;  1ZG3 A;  1UMQ A;  4WXH A;  2OPT A;  2DN0 A;  4XRF A;  1VQ9 I;  3VEP A;  4OOI A;  2PG4 A;  2EFN A;  4B09 A;  2OBS A;  4HA8 A;  5GPC A;  4C2U A;  3OR1 C;  2DA5 A;  4FE4 A;  1PUE E;  3L2W A;  9ANT A;  4V19 K;  1MH3 A;  4EM1 A;  3B4N A;  4ZC3 A;  1X58 A;  4XKC A;  1R4M B;  1K61 A;  1MBJ A;  1QHH D;  3JSO A;  1YJ9 B;  3ASO H;  5CDF A;  3IWF A;  2E1C A;  2VKV A;  4Y33 A;  3BT9 A;  2QDX A;  1B6A A;  3RDI A;  2UXN A;  2ID3 A;  1FP1 D;  3ZMU A;  3O6B B;  4MQV A;  4W8T A;  1Z67 A;  1TL8 A;  2K3P A;  1HKS A;  1JHF A;  3H3U A;  2DTZ A;  1EKE A;  3KFW X;  4BEH B;  1D0Y A;  4HF1 A;  1NHA A;  2IA1 A;  3RCO A;  5EEH A;  4BU2 A;  2BGI A;  1VQP B;  1O8E A;  4XRM A;  1XMK A;  1PP7 U;  1S72 B;  3HYI A;  1VLY A;  2JWT A;  2VOO A;  4EV0 A;  2CQQ A;  1WSV A;  5CQG A;  5KAI C;  2IBD A;  3HKZ A;  3OZV A;  1O3S A;  1FOK A;  5FFZ A;  1S72 I;  4PGH A;  1PKV A;  2W24 A;  3V7A A;  1MMD A;  1JKR C;  1PUF A;  1YX5 A;  5E20 A;  3MZ8 A;  2LH9 A;  4XOR A;  3ASR A;  5EZG A;  2MC3 A;  3Q9V A;  4U0Y A;  3V7S A;  4UVB A;  1D2E A;  2Y2Z A;  4IHV A;  1LUJ B;  4Z1M A;  4G7X A;  1XC5 A;  2R7U A;  2A3S A;  1ZGA A;  4L18 B;  3OYE A;  1BIB A;  4B8X A;  3T1B A;  4J0Q A;  2EIJ H;  2X8K A;  2M9H A;  3A8I A;  1TYU A;  3R4K A;  5B6I A;  4IL6 C;  4KN4 X;  2X53 S;  2OCE A;  1IUY A;  1B1B A;  2XSJ C;  5FRM A;  4IW3 B;  3FDY A;  4U7B A;  3WGH A;  1YO5 C;  3KEY A;  4LG0 A;  4RCZ A;  3FZV A;  1W9X A;  1GVD A;  1X4P A;  2OK7 A;  3B90 A;  2DT7 B;  1BIA A;  5FIU A;  1I6H J;  4YC5 A;  3OIP A;  1QVG B;  1LDD A;  1FPQ A;  3SYT A;  3E1Y E;  3JTH A;  2GAU A;  3K69 A;  4G1B A;  1BX0 A;  5B5E C;  1U8R A;  4YZ0 A;  3PVD A;  4AC9 A;  1D3Y A;  4OOX A;  1CLW A;  2A5Y B;  2DYI A;  1WMR A;  3QYB A;  4AC0 A;  1X1C A;  1JKO C;  1P4W A;  1DDG A;  1WPC A;  3CC2 B;  3CCS I;  3QSY A;  3LQE A;  2DA7 A;  3GLX A;  3GQA A;  2L7F P;  1JT6 A;  1EF4 A;  2KIS A;  3U21 A;  4AVP A;  2EZI A;  2XAH A;  5H6R A;  4A3J J;  2H8R A;  2XAF A;  2NAZ A;  1ZR4 A;  2NV4 A;  2GIV A;  4M3G A;  2EZL A;  3HTS B;  2DBB A;  4LLN A;  4OJ5 A;  1OLT A;  4UB8 C;  2RRE A;  1DBO A;  2UVF A;  4YIR X;  3LNQ A;  1FP2 A;  4UV8 A;  2QA4 B;  3ZSC A;  2O8X A;  3V8L A;  2ID6 A;  2QBY B;  2QQB A;  1KRH A;  2OBT A;  1VQO B;  3PUM A;  3ZPP A;  1YE9 A;  3SFI A;  3KL9 A;  1YIO A;  4A3C J;  2CQX A;  5LHH A;  1SD4 A;  4AM3 A;  3WU0 A;  4F7D A;  3CD6 B;  4OAZ A;  3MMP A;  3FHN A;  2NRA C;  4P1W A;  4FX4 A;  4PFO A;  5J47 A;  4BJ6 C;  3G71 I;  3SQV A;  1KU7 A;  2HTS A;  1VQK I;  1X1P A;  3HRS A;  2VE9 A;  4A3I J;  1COW A;  2BSA A;  5J4V A;  2LOO A;  1BI1 A;  4HNU A;  1H88 C;  4B3G A;  3CUO A;  2A6T A;  2XKO A;  1O88 A;  3T9G A;  2Q6I A;  1JTX A;  1WPK A;  1YIT B;  4RD0 A;  1IRF A;  1XDS A;  1P6R A;  3FJO A;  2IW5 A;  3CJQ B;  3BR3 A;  2OJE D;  3E7L A;  2MSY A;  3TOA A;  3VPR A;  3OYM A;  2OTJ I;  3VSU A;  4Y7C A;  4EGY A;  1CGP A;  3LSG A;  5C4J J;  1U9N A;  4HBL A;  3KP3 A;  4BPR A;  3U6K A;  5F4O A;  1U5T C;  4M0L A;  2R4G A;  2K27 A;  2LFB A;  3KEO A;  1UB9 A;  4LLL A;  1XFO A;  3CCR I;  1W34 A;  1OFC X;  4NBS A;  1K28 D;  1V54 H;  2EB7 A;  3C1D A;  4S05 A;  2Z33 A;  4V02 C;  2FVG A;  1ZK8 A;  4HSR A;  4MQ9 F;  1Q9S A;  3P26 A;  1JA0 A;  3OW2 B;  4Q5S F;  4UUS A;  4HE5 A;  3KE2 A;  1IRX A;  4P3I A;  3K1M A;  3U9G A;  4AVZ A;  4A3D J;  1OHH A;  2AQF A;  5H59 A;  1T0F C;  5A88 A;  4P26 A;  2XGJ A;  2XTY A;  2MBF A;  2RVC A;  3WWG A;  3JU4 A;  3IUO A;  5TV2 A;  4W8Q A;  4NQW A;  4DZP A;  4KMF A;  4LB5 A;  4HE6 A;  1VQ5 B;  1ZAO A;  3KEQ A;  3PFI A;  3VSV A;  3H3V K;  5M5X J;  2Z2S B;  3RZD J;  1I5Z A;  5L3G A;  3EUH A;  2R92 J;  2VOP A;  3OS2 A;  4BL0 B;  4MNU A;  4WWC A;  3MCZ A;  3W3C A;  1BHE A;  4LOC A;  5BPD A;  3SDB A;  4GO1 A;  2I5U A;  1PVE A;  3ES9 A;  2JIZ A;  3N97 A;  2VAS A;  2EZK A;  4XLN F;  3JQR A;  2HXO A;  2Q1Z B;  3A4C A;  4X1E A;  2X1C A;  1Y0N A;  2XT2 A;  4P5O A;  3V42 A;  4BY1 J;  2NZM A;  2FX3 A;  1QVT A;  2QA4 I;  2Z8G A;  4P96 A;  1QFJ A;  1JGG A;  2FQ3 A;  3F8B A;  1MJB A;  2ZC2 A;  1YHQ B;  3OYJ A;  2DK8 A;  5DM6 F;  1Z05 A;  3CQZ J;  1I18 A;  1RIO H;  3LOC A;  3GTO J;  3DDY A;  1TC3 C;  3B6A A;  1CQT A;  4D5C A;  1RRJ A;  1T56 A;  2FJ1 A;  2O03 A;  4AYB A;  1ZQ3 P;  2V7Q A;  5DCM B;  5JFR A;  3FKS A;  2L5Q A;  3WG7 H;  4YAU A;  2FEZ A;  4PJJ A;  4A69 C;  1VLO A;  2D9R A;  3EYY A;  2A68 F;  1PJ6 A;  2W4S A;  4HX7 A;  3CMA I;  2K40 A;  1PUF B;  2Q2E B;  2QSF X;  1HZE A;  2HDW A;  2QXZ A;  1QA3 A;  3H09 A;  4FX0 A;  1PYV A;  5M5Y J;  1ZLK A;  3GO5 A;  2CH0 A;  2KDO A;  3FIS A;  3FM3 A;  3Q39 A;  1S29 A;  2O6W A;  1NG6 A;  5D5X B;  2A07 F;  5LRS A;  5C3E J;  2Y31 A;  1XX5 A;  2BVN A;  5C1C A;  5FKK A;  3CMY A;  5F27 A;  1D8T A;  3B78 A;  4EJO A;  3JX8 A;  2ICW G;  3LSJ A;  3GX4 X;  1VZ0 A;  5D6E A;  2M2E A;  2DMQ A;  1W7P D;  4PC6 A;  5CPR B;  3R6K A;  2TCT A;  2ZTG A;  2M4G A;  5JI6 A;  2V9V A;  3W2F A;  2V4D A;  3IKT A;  1BM9 A;  1I3A A;  2HQR A;  3BLY A;  3KYC B;  4IOA F;  2B5O A;  4EMS A;  3OFN A;  6PAX A;  4G9Y A;  4XR6 A;  3BH7 B;  3SEQ A;  1S7A A;  2OF7 A;  3W2I A;  1OFD A;  2HQ5 A;  2JVG A;  2BPO A;  3B8Y A;  2F5F A;  1SMT A;  1IHM A;  2M45 A;  2VNJ A;  1OFL A;  3L00 A;  4UVC A;  4R8H A;  1Q1V A;  3WTY C;  3FK6 A;  2HMA A;  3ZMD A;  4PGG A;  3MEX A;  3S93 A;  2AS5 F;  4RGU A;  5HS7 A;  2YUS A;  4U7D A;  3MKW B;  1YRN A;  3BCA A;  5KNL A;  3VO1 A;  2HWV A;  1FNB A;  4I84 A;  1MND A;  1REP C;  2E1O A;  4YZA A;  2DA3 A;  2ZJR F;  1X1B A;  2EIN H;  5JVG F;  3UKG A;  2CRG A;  4W8R A;  4IRI A;  1QNT A;  4Z4Z A;  2ESN A;  1BA5 A;  2LR8 A;  4D7M A;  4MGR A;  2R7W A;  1H0M A;  1JE8 A;  3F8N A;  1SM4 A;  3G1O A;  4E7L A;  3WTT C;  1ZM2 A;  2LDU A;  1SVO A;  3SEZ A;  4EJV A;  3ERM A;  1H80 A;  3KET A;  4D1Q A;  3ZCO A;  3TH0 A;  5LGN A;  1EH8 A;  2ISY A;  4UY8 I;  4UZF A;  3BJ6 A;  2UUZ A;  5FL7 A;  5DTD A;  3L2C A;  4DQL A;  3W6J B;  5B1A H;  5B66 C;  2IS1 A;  1JTY A;  2X9D A;  1TNT A;  2HGC A;  1WZ2 A;  3V8J A;  2MA3 A;  2Y9Z A;  3ZQ7 A;  3G6E B;  4RGX A;  1N8R D;  2F48 A;  3ZRG A;  2DDA A;  3CPW B;  2FMY A;  2CUE A;  2VXD A;  3EQO A;  2DMU A;  3VYU B;  2CF4 A;  3E5X A;  2E71 A;  1A35 A;  1KYW A;  2PEX A;  3F8F A;  1E1R A;  4RM3 A;  1R5G A;  2KLO A;  1J59 A;  3ASN H;  2Z6B D;  1GUU A;  1P7I A;  2IGN A;  2VQH A;  1ZR2 A;  2OC6 A;  2XAJ A;  2YSR A;  4RB0 A;  1S6L A;  3LO8 A;  1J0R A;  3DXJ F;  2HNH A;  4XSZ F;  1WOO A;  3HSE A;  1RET A;  2V7F A;  5THX A;  3HKZ N;  1D8K A;  3K1N A;  4CZZ A;  1SEU A;  2Y30 A;  3Q0V A;  4CCL A;  4XM3 A;  3K2Z A;  1V5G A;  2K9M A;  2VON A;  3F0C A;  3CCV B;  5LGT A;  2VNI A;  3P9I A;  1APL C;  2STW A;  2BGJ A;  4ZGQ B;  4LIU A;  2Z5U A;  3ZMS A;  3KP6 A;  2PMD A;  2XOK A;  2LMD A;  1W0T A;  1TLH B;  5ICC A;  1OCT C;  3ERE D;  5ILV A;  4CH7 A;  1X2N A;  2JN9 A;  2RNJ A;  3CCU I;  2QGU A;  1R6R A;  1MDM B;  2VOD A;  2VBT A;  3WTU C;  3AAF A;  3ABK H;  2OBR A;  2QKL B;  3A01 A;  1QHG A;  1WCM J;  1XCB A;  4B3A A;  3GQ9 A;  3CCV I;  4HOB A;  3BNW A;  1R1V A;  3PUF A;  2MFZ A;  2KQR A;  5FB2 A;  5DS9 A;  1Y56 A;  2O5R A;  2ZJ2 A;  2EFP A;  2OV7 A;  3J81 Z;  4ITV A;  2NT6 A;  3FBN B;  2X3U A;  2C2W A;  3QQA A;  1NB9 A;  3PET A;  3WYA A;  2ZNZ A;  3H5R A;  4RD3 A;  3CDI A;  5J40 A;  1LE8 A;  3CXC B;  1E79 A;  1IDY A;  1S5L C;  1X1A A;  2Y0M A;  4IHT A;  1D5Y A;  2GK7 A;  4PGO A;  3P9C A;  1K83 J;  2W1O A;  3WU2 C;  1K8A D;  4Y15 A;  3CW2 A;  2F2E A;  2FA5 A;  2LBF A;  2E36 A;  4M9X A;  4ASU A;  1Q86 D;  2DCU A;  3LMM A;  2LY2 A;  4N9I A;  5FKM A;  1TZL A;  2GBY A;  3D5R C;  3H36 A;  3HBL A;  1EFT A;  1PE9 A;  2BY1 A;  2JQ7 A;  2C78 A;  1T95 A;  1XB2 A;  3ZC3 A;  1YLF A;  4LBW A;  1SFO J;  3I55 B;  4MTD A;  2D45 A;  1KK3 A;  1OOC A;  1NJI D;  1BQE A;  4Q47 A;  1FX0 A;  3ZQC A;  2R7X A;  1DDN A;  3OOC A;  1E2X A;  4FE7 A;  2A5W A;  1I3Q J;  4TMX A;  4XD7 A;  2KRF A;  4DK0 A;  1IXS B;  4OPS A;  5J1U A;  4KN7 X;  5J35 A;  3C2G A;  3ESW B;  3OYA A;  1ZM3 A;  5DCM A;  4RGS A;  3KZY A;  1P7J A;  2ZZG A;  2V6C A;  2VBV A;  3RKQ A;  2CQK A;  5HVQ C;  3WBK A;  2D74 A;  1X4O A;  3JTG A;  4MYT A;  2HCJ B;  4DQK A;  3H5A A;  1R1T A;  3ML6 A;  4BNC A;  5BQT A;  2FML A;  4BAC A;  3NQO A;  1WFX A;  2H94 A;  1H9T A;  3W2V A;  1R5H A;  1EE6 A;  1XMA A;  1E3Z A;  1K73 D;  2CYY A;  2O7O A;  4UUT A;  4ZDO A;  3WY9 A;  4YZX A;  2GIZ A;  4XN0 A;  2PYH A;  1BR1 A;  2HOT A;  1VQ6 I;  1KU2 A;  5GAH J;  1G6N A;  2BW3 A;  5CJ9 A;  1QRY A;  3IH4 A;  3RSN A;  1E3P A;  3FKJ A;  1ZYR F;  3MKL A;  5CVI A;  4F91 B;  1Z7L A;  4G8X A;  2I10 A;  2V4J C;  4XLE A;  5CLS A;  5D4R A;  4OMZ A;  4OMY A;  2MH2 A;  1G4D A;  4ESJ A;  5IOY A;  4S04 A;  1DU0 A;  2VQG A;  1KK2 A;  2P5V A;  1VQ7 I;  3A0B C;  4AUX A;  5FLM J;  2HS5 A;  1BOA A;  2J5O A;  4HAM A;  2VFN A;  3RTR A;  5TJJ A;  1IN5 A;  3FK7 A;  3O8H A;  1PP8 F;  1AU7 A;  1W35 A;  4O6J A;  1IXC A;  3FXQ A;  3CO7 C;  3CCJ B;  1DU6 A;  4HX4 A;  4L0Y B;  3ZZ0 A;  1BI2 A;  5J1Y A;  5K7Z A;  1QGZ A;  5TY0 A;  3WG9 A;  5IYN A;  1B8I B;  3LMW A;  4A3E J;  1QGY A;  2WB1 N;  3VMW A;  4MTE A;  1A04 A;  4PJ0 C;  5FRO A;  2OZU A;  3CMM A;  4OWR B;  4CCM A;  3AST A;  2XSD C;  4OPV A;  1YIJ I;  2HZT A;  2LRE A;  3ISP A;  2EIL H;  1F1Z A;  3CTA A;  4I09 A;  4PSX A;  1EJ9 A;  2JJ2 A;  1JGS A;  1AKH A;  1T33 A;  4S0H B;  2ELH A;  4B43 A;  1B59 A;  2C4T A;  3BQY A;  2ME6 A;  4Y52 J;  2CUJ A;  3IAS 2;  2XGD A;  1FYK A;  4KIF A;  3HOT A;  1XPX A;  2C77 A;  1OGI A;  3FWE A;  2O0W A;  3EQL F;  1OJL A;  1OIS A;  3RYP A;  3HPG A;  3PSI A;  2VPR A;  1W0K A;  1D1B A;  1SD6 A;  4J19 A;  2HEO A;  4A6E A;  4CQJ A;  3FX3 A;  1JHH A;  2B0L A;  3ZPN A;  1QJV A;  2RNG A;  2COM A;  4KIS A;  2X1E A;  2WYR A;  5L3F A;  1S3J A;  1IDJ A;  1T0F A;  3JRC A;  3BR6 A;  4PCQ A;  1UD5 A;  5LEK A;  2BMW A;  3A8K A;  5BS6 A;  2V79 A;  3G05 A;  4W8S A;  2BBY A;  3HSF A;  3ZQH A;  4QV2 A;  2KIQ A;  3BG5 A;  2PMH A;  2CBX A;  2OQR A;  1FNN A;  4RAG A;  1AMO A;  2GWR A;  5FLX Z;  4E6K G;  3S14 J;  1Z0X A;  5LMZ A;  3VST A;  3SKB A;  3FF5 A;  2XPU A;  1FEX A;  1U9O A;  1F9N A;  1RUO A;  2QVO A;  2NTB A;  1MBH A;  3PSZ A;  5ICF A;  1FOX A;  3RI4 A;  2WV0 A;  2K5C A;  3BY6 A;  5FO5 A;  4YZQ A;  1E63 A;  3GZ6 A;  2ADU A;  1H9G A;  1IUF A;  3COA C;  1N0U A;  4BHP A;  3QE2 A;  1EP1 B;  1HST A;  3VOE A;  2CND A;  1D1N A;  3BPX A;  1S8N A;  5K5Q A;  2ZTN A;  3BZK A;  1R7J A;  2X6W A;  4XLF A;  2PJR B;  3R0J A;  2CG4 A;  2L7Z A;  2INU A;  3M8J A;  4XID A;  1ZUN B;  2M5W A;  1IG7 A;  3O2P E;  1HLV A;  4YFX F;  2FBH A;  3I53 A;  4E7J A;  2OD5 A;  1VQ8 B;  2DMT A;  4PC7 A;  3OWT A;  1VF7 A;  2K9L A;  3L7W A;  2WY7 Q;  5DDG A;  1YIT I;  1IV6 A;  4GGG A;  3M07 A;  4EM2 A;  3RQ4 A;  3BTI A;  2YX4 A;  2EIM H;  1HA8 A;  2INV A;  4RB1 A;  3KP7 A;  4EJU A;  1VQ9 B;  2WBM A;  2QX3 A;  2W6J A;  4RD1 A;  1RES A;  2BHZ A;  5CQE A;  2FSW A;  1R5O A;  4KIC A;  4A3B J;  4G6I A;  5DD4 A;  4LD5 A;  3DKX A;  4C3H J;  1SC7 A;  1ON1 A;  2P5K A;  3IAM 2;  3S1Q J;  4IF4 A;  4NC6 A;  4NDL A;  2VPL A;  2IJL A;  2M7B A;  4BDZ A;  4G94 A;  3OEH A;  1K5C A;  3MHP A;  4YFK F;  1MW7 A;  2DFE A;  3NE5 B;  5E3N A;  4C2T A;  2HXI A;  2VIX A;  1MRZ A;  2CV2 A;  3JCU C;  3S1N J;  2BF4 A;  5IYR A;  2G0Y A;  4Q4Z F;  3L2R A;  2Y69 H;  2EV5 A;  2E5N A;  4RPB A;  5EEA A;  3K4C A;  3QPS A;  4D0P A;  2K3F A;  1VI0 A;  4DYC A;  4ESF A;  2VLA A;  2JUG A;  4JOM A;  4RLF A;  4RAY A;  3MQ0 A;  1RQP A;  4YAF A;  2Y9Y A;  4FCY A;  4CCO A;  3S15 J;  3AKZ A;  1H8H A;  5K5R A;  1TWG J;  4P1V A;  1VQM I;  1B23 P;  4CO8 A;  2IA0 A;  3DKW A;  2L7M P;  2XB5 A;  3FXK A;  5D8L B;  3U2R A;  3BR0 A;  2XEX A;  1DPU A;  2AO9 A;  5LBQ A;  3T51 B;  3GTG J;  1T08 B;  4XON A;  3TED A;  3QYE A;  4NUB A;  1E3H A;  4ANJ A;  4PC3 A;  3CJN A;  2NVT J;  3CME B;  1W0J A;  4LJZ F;  2GOM A;  2ZCW A;  3OEE A;  3U6B A;  2HDD A;  1YHQ I;  3PSF A;  3ZIA A;  2HKX A;  4E7Z A;  3SY2 A;  4WZT A;  2CMP A;  3IH3 A;  3ZR8 X;  3BH6 B;  5F0F A;  3WTX C;  4DOZ A;  3BG6 A;  3GME A;  3H35 A;  4XN3 A;  3WTW C;  1OCC H;  3A03 A;  4IO9 F;  1MJA A;  1E17 A;  4FAS D;  2V7W A;  5J1R A;  4B47 A;  4ZYG A;  3I4P A;  3CCJ I;  4C30 A;  5K1Y A;  1BOB A;  2IS6 A;  3W5V A;  3F8C A;  4GXO A;  4M3F A;  2L54 A;  3GFL A;  1U2W A;  2GZW A;  5D5U B;  3A01 B;  1OGM X;  3P7N A;  2O04 A;  3BJO A;  5J8C A;  4PK4 A;  4EH1 A;  1XCV A;  3CCE I;  2BY3 A;  3TO7 A;  3Q3A A;  3GVK A;  1O8F A;  3P27 A;  1OFE A;  1IGN A;  2JRT A;  3AVT A;  1ZLJ A;  4M3D A;  3ZMZ A;  3E1S A;  1RZ4 A;  3J80 K;  3HOW J;  3W5H A;  2IT0 A;  5BSX A;  2D2W A;  1B4A A;  2X6X A;  3FXL A;  4DBR A;  3VNV A;  1JUP A;  3E6M A;  4AIJ A;  1MMA A;  2YU9 J;  4R1H A;  3A35 A;  3U1D A;  3JAM Z;  1IAW A;  4KNY A;  1O4X A;  1JI8 A;  1UD3 A;  4YG2 F;  1FIP A;  4WK8 F;  1MSE C;  4YIF A;  2DTR A;  1EP2 B;  4RD6 A;  4ROX A;  2FF4 A;  1FMV A;  2B7C A;  5FKN A;  3I9V 2;  2DA1 A;  2LC2 A;  3K4K A;  2V7V A;  3BRO A;  1R5B A;  1TP4 A;  3GEZ A;  4XNF A;  3CF5 F;  2BEO A;  4R71 A;  5BPI A;  1JB9 A;  1KCD A;  4A2U A;  2B7E A;  5IP7 J;  3ECO A;  1A31 A;  4M53 A;  4UAJ A;  2FU4 A;  5AIQ A;  3OL4 A;  2RGV A;  2DDB A;  1BPL A;  4HDU A;  4ENN A;  4A12 A;  1D0X A;  2RKH A;  4PUS A;  3DPL C;  3ZMT A;  1AWC A;  1UD8 A;  2JJ7 A;  2L9N A;  1MKM A;  1Y0Y A;  3BC9 A;  4X0C A;  5GV7 A;  2XV4 S;  1FOW A;  1ZGW A;  4P25 A;  3I54 A;  2GOX B;  2W25 A;  4BE0 A;  3TMO A;  4AU7 A;  5F4J A;  3W2G A;  5EZH A;  2QEN A;  1RUN A;  2VB6 A;  3W6V A;  3GYH X;  4ZYE A;  4UXN A;  1IJW C;  4RD4 A;  1YYV A;  5J3L A;  3SZT A;  1V5E A;  3GIR A;  2F5C A;  4XRS A;  3HAG A;  4O3M A;  3CCU B;  2BGC A;  1NB0 A;  4IQJ A;  3O3K A;  4HST A;  1SKY B;  3CC4 I;  2P4W A;  3IRR A;  1YJW I;  3VNU A;  3BPV A;  1ZKG A;  5ICE A;  3MN2 A;  2XZO A;  3FMR A;  2BOL A;  3JSP A;  2EZH A;  3ZN0 A;  4Y3O A;  4PAB A;  2JN6 A;  3KCC A;  2V9P A;  3A0H C;  2QKM B;  3VYT B;  3F3X A;  1I1S A;  3OYF A;  1W7P B;  4W1U A;  5DCF A;  1BI0 A;  3V8K A;  1G2H A;  1U0J A;  1XGM A;  1BL0 A;  2HR3 A;  2VJ4 A;  2K7L A;  1ETK A;  3AG2 H;  2R5Y B;  2XGE A;  4AF6 A;  4BHC A;  3N05 A;  3PL8 A;  2VKE A;  1WI9 A;  4HNT A;  2WB1 A;  5IP6 A;  2H8W A;  1HW2 A;  3NB2 A;  2L02 A;  1N0V C;  1UG0 A;  2EQR A;  1VND A;  2FX0 A;  3AFH A;  4TKO B;  2E2I J;  2ZZQ A;  4Z05 A;  5HZA A;  2EWN A;  2XAG A;  4LG3 A;  1ZHF A;  2V9K A;  2R93 J;  1EH6 A;  1ETW A;  2ZME A;  5KHD A;  2H1K A;  3LNN A;  5FA6 A;  3CES A;  3TQN A;  2QEX I;  3OSF A;  1QVU A;  2M3A A;  2LYC A;  1HDD C;  1RQR A;  1SD5 A;  4YFN F;  2A69 F;  4N3N A;  2V6E A;  3CC7 I;  4Q48 A;  3OYN A;  4PFP A;  4ENJ A;  2Y75 A;  5FO1 A;  1MZB A;  2NVU B;  4Y9R A;  2ZBK A;  2WZP P;  3RY8 A;  3UR3 C;  3UW0 A;  3V7R A;  3LQQ A;  1VTN C;  3QWL A;  1QGA A;  4PMH A;  4AID A;  4XLA A;  4RB2 C;  3J81 K;  2HPI A;  4CYC B;  1JKP C;  2NOJ B;  2GM4 A;  3ZUG A;  1QRC A;  2W85 A;  1W1W E;  4YAW A;  3ABT A;  1D1C A;  1T6S A;  2HI3 A;  3W2E A;  1DPR A;  3IC7 A;  1LEB A;  2FNA A;  2ETH A;  1SFK A;  2HLD A;  5HXB A;  4RDU A;  4M9S A;  3VMV A;  2K9N A;  1VHO A;  1IW7 F;  1MMN A;  3JRH A;  4NB5 A;  2VBM A;  1HOM A;  1QH0 A;  3BCD A;  4LC0 A;  3K2A A;  3BG9 A;  4YAL A;  3WQZ A;  5AMV A;  3WU1 B;  2RAE A;  4KFC A;  1AOY A;  4O5V A;  3U2Q A;  1Y39 A;  2XDV A;  3LL7 A;  2QBY A;  1ZM4 A;  1BLI A;  4HYE A;  3CUQ B;  2QGG A;  1T98 A;  1IA5 A;  5HLI A;  1KQ9 A;  1OCR H;  2QWW A;  3LAP A;  5CVV A;  1DG1 G;  4F92 B;  3OJW A;  4PDK A;  4CXF A;  3ONU A;  3HEF A;  5IYP A;  1ULY A;  4OJP A;  4RDK A;  5LGU A;  1HF0 A;  1G59 A;  2XHK A;  2W6I A;  1RPW A;  3HUG B;  3IWZ A;  2G7U A;  3GBG A;  2R7O A;  1G7T A;  3L09 A;  1HC8 A;  1KJZ A;  2KZG A;  3SJP A;  2IS4 A;  2JT1 A;  1WSR A;  3ZQL A;  1KD1 D;  4KH3 A;  2R5Y A;  5HLT A;  4FT8 A;  1UAA A;  3R6J A;  5JMC B;  1OFM A;  3QFS A;  3JRG A;  3KYD B;  3K10 A;  2DY1 A;  1IJF A;  1UHM A;  1D8J A;  2J7K A;  2F5E A;  4B1R A;  2CGP A;  3OYB A;  1Y6I A;  4A5M A;  3WGI A;  3GFI A;  2DPU A;  2ZSI B;  3K4L A;  2V1U A;  3GTQ J;  2OQG A;  3PM1 A;  1IDZ A;  1XE1 A;  3WBJ A;  1OYI A;  2CW8 A;  2DOF A;  1UD6 A;  5FKO A;  5F1R A;  1RR8 C;  2OTL I;  4L9T A;  3P9K A;  2KT0 A;  4NK6 A;  3GSI A;  4LGW A;  3GW2 A;  2D3L A;  1WJE A;  1E0E A;  5HS9 A;  3Q38 A;  2IPQ X;  1W2B B;  5IP9 J;  2A6E F;  2H6C A;  2F5D A;  4IXA A;  1N78 A;  3IKV A;  3ZXS A;  2XAU A;  1B72 B;  1YW9 A;  5H5J A;  1H89 C;  1SAN A;  2TDX A;  3P4G A;  1UJ8 A;  1V0F A;  3PNV A;  4H0E A;  2VN2 A;  3OR2 C;  3ABL H;  4D9J A;  1J9I A;  3CB4 A;  4MHG A;  2D1H A;  3A1Y A;  3FPK A;  1QGP A;  3MAJ A;  2ZFW A;  2O0Y A;  3T8T A;  3N4M A;  4A3G J;  1VJS A;  1M90 D;  5F4M A;  1B2R A;  2VI6 A;  2E35 A;  2VE8 A;  3OL3 A;  1UCR A;  4EJW A;  4OIQ F;  3D26 A;  3QFC A;  1JUS A;  4IKF A;  4D5F A;  4TMV A;  1GXQ A;  1ODD A;  3QPH A;  4MYU A;  1FOY A;  4BDY A;  1TLL A;  2IGK A;  4BQO A;  1X2M A;  3G3Z A;  4ETS A;  1W0U A;  2DMN A;  2E34 A;  4U88 A;  4BXU A;  3H0G J;  1DP3 A;  4RCY A;  2DJI A;  1E1Q A;  2UZK A;  3REO A;  3FXO A;  1GV2 A;  2E1N A;  4JP0 A;  4DIQ A;  5FRN A;  4MO7 A;  2DQR A;  4YAO A;  4KIB A;  1R22 A;  3BP8 A;  3F9K A;  5EEG A;  4E0F A;  5L3D A;  2P7C B;  1RC9 A;  2P8T A;  4XKB A;  1E3O C;  2LZJ A;  3CJR B;  2DQL A;  2RC4 A;  1OQY A;  2PLY A;  4G7O F;  3HRT A;  2GXA A;  1BN8 A;  4IPA A;  2K02 A;  2KIU A;  3T8R A;  1XS9 A;  1HCR A;  1J09 A;  2EA2 A;  3BR5 A;  1OYY A;  4NC8 A;  3SZP A;  3MKZ A;  1HF2 A;  1ZEL A;  2HYJ A;  4XRS G;  2EFG A;  1WOR A;  1QQ1 A;  1Y0R A;  2JSC A;  4CIC A;  3TO6 A;  2E1M B;  4E7I A;  4P9U A;  2VUM J;  2Q6K A;  1UZC A;  4I2O A;  1T2K A;  2NVX J;  1T5E A;  2F43 A;  4XOT A;  4Z4S A;  2BXY A;  2HYF A;  4HLX A;  2MW8 A;  3DTE A;  5KAF C;  4X05 A;  2QEX B;  3OYG A;  3AGQ A;  3F6V A;  2M5S A;  3S32 A;  1RWR A;  3OS0 A;  3CPX A;  3HOZ J;  1ACI A;  5IYQ A;  1KQ5 A;  2CU7 A;  2W48 A;  3DPT A;  1MMS A;  1HDP A;  1TQM A;  2JTV A;  3WXM A;  1NG7 A;  2O8K A;  3JRE A;  3W6K B;  5B1B H;  2CS3 A;  1KON A;  3A02 A;  4UVA A;  1TYX A;  3EET A;  3KZZ A;  4JX5 A;  2XTW A;  1GJR A;  5FFX A;  2JSP A;  4IQ4 A;  5JLW A;  2OAZ A;  3QFR A;  5TGT A;  2JA8 J;  2MD0 A;  5D4S A;  2B9S A;  1N05 A;  1E64 A;  4Z4T A;  5IOZ A;  2E7W A;  2JZY A;  2CW5 A;  4Z06 A;  1BBY A;  1ONV A;  3KLN A;  4KJZ A;  2ZL7 A;  1H8A C;  3DF8 A;  2NT9 A;  4F93 B;  4MIM A;  4II3 A;  1R9T J;  2OUM A;  1GHC A;  1WJC A;  4P3Y A;  2XNC A;  3HZJ A;  4NCN A;  3SYJ A;  1WTH D;  3WTS C;  3CCQ I;  3CCY A;  4C0S A;  1JJ2 B;  2HFH A;  2E2H J;  2CV0 A;  4RS8 A;  1JJ8 C;  1GAQ A;  1HG8 A;  1FY7 A;  1FDR A;  4Y17 A;  2JA2 A;  2ZXI A;  4ZCL A;  4G12 A;  1GXP A;  2OTL B;  4BBR J;  1WU8 A;  1VQ4 I;  1B72 A;  2MAB A;  5IY5 H;  5AON A;  1TSP A;  1U3E M;  4DK1 A;  3J81 k;  5GTI C;  4HQE A;  1I1G A;  1T6Z A;  2DA2 A;  5BSY A;  1YJN B;  4E7S A;  3PA2 A;  1PLU A;  2VKD A;  4M6X A;  1YIJ B;  2VQC A;  4GYI A;  2P3M A;  1W5C C;  4E7H A;  3AGP A;  2IP2 A;  4DYQ A;  2MLG A;  4IHX A;  3OOP A;  4PAA A;  1RKT A;  2VJI A;  2WWY A;  3SXY A;  1MAB A;  1P4M A;  2KP6 A;  4QWQ A;  1WJA A;  1MD0 A;  3OP1 A;  2GXG A;  1O57 A;  2LP0 A;  1S7O A;  5FD6 A;  2DER A;  4A3M J;  1LNW A;  3L2Q A;  1ZG5 A;  3I1F A;  4NBQ A;  4RDJ A;  2BN4 A;  3OPO A;  2M34 A;  1A8P A;  1V0E A;  1LKX A;  1PJR A;  3BTJ A;  1S4M A;  5IYW A;  5KW9 A;  2R3S A;  3K4B A;  3H5N A;  3EUK L;  5IYB J;  3BY1 A;  3FHZ A;  3MWM A;  3AG4 H;  1IXR C;  5DN6 A;  2F5V A;  1W36 D;  2F4M B;  3VSL A;  1QZY A;  1TYW A;  2KJB A;  3E5Q A;  4OIN F;  1QFZ A;  1GVH A;  3R61 A;  2W82 A;  1PJ5 A;  1X3Z B;  4V2G A;  1IN6 A;  1XB4 A;  3K0L A;  5GAE J;  2V1N A;  1JKQ C;  5LD2 C;  5A89 A;  3CCL B;  3AVX A;  1OCP A;  2CW0 F;  3B6C A;  4YII A;  4MLO A;  3C7J A;  2VBU A;  1O8J A;  3N90 A;  3HGG A;  4M6V A;  3NWS A;  4H4K C;  4NK8 A;  2NOG A;  2Q8K A;  3LWF A;  2DYR H;  1QRB A;  1YS6 A;  4M3E A;  4BGD A;  1WXR A;  3PO2 J;  3CCE B;  2UXX A;  1ETX A;  3B73 A;  3HJE A;  2DET A;  3F23 A;  2HOS A;  3C2H A;  2DMP A;  1C0W A;  3LFK A;  4URR A;  5L3B A;  1XSX A;  5H6Q A;  2W00 A;  3G4S I;  1WI3 A;  3ZPL A;  3HB9 A;  1YLO A;  5GAD J;  4I0B A;  2X85 A;  3W2H A;  1SKQ A;  2WR8 A;  1FNC A;  1O8H A;  1DDI A;  2DA6 A;  4ENM A;  3DBL B;  4PJN A;  2IAI A;  1LFU P;  2YX7 A;  2XGC A;  4XL9 A;  4DNT B;  1VQN B;  3EPZ A;  3PEN A;  2DAO A;  3WHB A;  1O7F A;  1Z7U A;  2JPC A;  1KU3 A;  3PA1 A;  4C9Y A;  4U4B A;  3JQP A;  4EAT A;  4OJO A;  2XF7 A;  3H94 A;  1QA6 A;  2BV3 A;  3SQN A;  1K4T A;  2RN7 A;  1AKH B;  1ZRE A;  1TTY A;  2EFQ A;  4QPO A;  3KX2 A;  2EPF A;  2MD5 A;  3GUD A;  2V7X A;  3CP8 A;  3S2H J;  1MBE A;  1P4X A;  5DM7 F;  1OGJ A;  4MR0 A;  3BOQ A;  4B44 A;  2ZZE A;  4IOC F;  1KCC A;  3SEJ A;  2Z99 A;  5DD8 A;  1OGO X;  1I27 A;  4M2L A;  1L0O C;  1FJL A;  4N3G A;  2VZL A;  3ISX A;  2CO5 A;  3GFM A;  3QOP A;  4P55 A;  2XZP A;  1Z6T A;  1FWZ A;  2VFQ A;  3I0T A;  3BR1 A;  3J80 Z;  2PX9 A;  5CVU A;  4ZZD A;  3BTL A;  2UV1 A;  1TWF J;  1TT0 A;  2KFD A;  2AHO A;  4DYR A;  3HOX J;  5IK2 A;  4M73 A;  5D5V B;  1WP6 A;  3IP4 B;  2K4B A;  3HOU J;  3C18 A;  4RM0 A;  5EMN A;  2B63 J;  1R00 A;  4XBF A;  2PFB A;  1YX2 A;  4U0V A;  3ECH A;  2WAQ N;  1Z3X A;  4IRG A;  3WND A;  1Q82 D;  3JRI A;  2W84 A;  4FIS A;  3R6S A;  1GO2 A;  1TTT A;  2EK5 A;  4UB6 C;  1MDM A;  2AQE A;  2F4I A;  4ZDL A;  5D6F A;  2GLO A;  3LQR A;  2V7U A;  3OZW A;  4UZU A;  1KA8 A;  2XT4 A;  4I0A A;  3RIQ A;  1W7P A;  2BM7 A;  1FIA A;  2JPB A;  4CUG A;  2O61 A;  2EJR A;  2CW7 A;  3N6Z A;  1SAX A;  4RBO A;  4BHB A;  2R5Z A;  2CSO A;  3BG3 A;  2B0R A;  1LB2 A;  2R0Q C;  2MYS A;  1QU3 A;  1IB4 A;  2PYG A;  1PDN C;  1S0U A;  4NC7 A;  2FUG 2;  1VQN I;  3RKW A;  1XG1 A;  4B3F X;  5CVR A;  2VNK A;  1V4R A;  3LSH A;  3FY3 A;  2KRH A;  3PO3 J;  3GQB A;  4ZH4 F;  3F72 A;  1G3Y A;  1FRQ A;  4TSF A;  1K8F A;  4Z03 A;  2F6C A;  4OU0 A;  4CA0 A;  3K6G A;  4B4D A;  2DYS H;  3G1M A;  4ZJZ A;  3VMF A;  1FYM A;  3AVV A;  4C3J J;  2NSP A;  4QSH A;  1EH7 A;  1DP7 P;  3EYI A;  5IYD J;  1O8L A;  4I02 A;  1JRG A;  2BSP A;  1OB2 A;  5HDN A;  4DBQ A;  1HXD A;  2CUZ A;  2XRO A;  1WOS A;  2KJC A;  4XK4 A;  3BQZ A;  3QRF F;  2HTJ A;  2XRL A;  4DGW B;  2ZBV A;  4X06 A;  2LF7 A;  2QQA A;  2R7V A;  2GQQ A;  2TRT A;  3G2B A;  1DGW Y;  5E3O A;  2YU3 A;  2L2O A;  2DU9 A;  3HHH A;  1K7A A;  1I7P A;  2BM1 A;  4CYC A;  3M1E A;  2EH3 A;  3DU5 A;  2DW4 A;  4AIH A;  1DUX C;  1JA1 A;  5HS8 A;  2FD5 A;  3FBI B;  4M9Z A;  2M8E A;  4CDG A;  1CZF A;  1KZL A;  1H85 A;  2Q6L A;  1GQ8 A;  4IEJ A;  1KGS A;  5L3E A;  3GTJ J;  4CSW A;  1BJA A;  4TT3 A;  1P2F A;  1USS A;  4YXW A;  1R1U A;  2QMU A;  1GV5 A;  3EQN A;  2WAD A;  1ETQ A;  5DYM A;  3OIQ A;  1B9N A;  5DSZ A;  1G3W A;  4Y7N J;  2D1V A;  2ECB A;  1N75 A;  1U2R A;  2YWF A;  2XKP A;  3HRM A;  1WDT A;  4NHJ A;  3KPH A;  4GCV A;  3PIO F;  4EM0 B;  3PFY A;  1SFE A;  1SVL A;  4ZYA A;  3SDG A;  5KCM A;  1WSU A;  2CRV A;  3OS1 A;  2QTZ A;  3RPU A;  3PSS A;  3M1C A;  3VO2 A;  4G7W A;  2W57 A;  2V1X A;  2Z9O A;  4BQQ A;  3Q6R A;  2JDI A;  1KC8 D;  2DCE A;  1FBS A;  1VQL I;  1XN7 A;  2DI3 A;  3HTU A;  3RKX A;  1YJN I;  5F08 A;  4KKU A;  3SZE A;  2ECC A;  5BMZ A;  4A3L J;  3L1P A;  3LSP A;  4KKT A;  3ZZT A;  3GRH A;  1KZH A;  5E3L A;  4XOP A;  1VQ4 B;  2DLL A;  3OYD A;  1N25 A;  2P6S A;  3BCB A;  1LLW A;  2EV0 A;  4M72 A;  4ACA A;  2JA7 J;  3RKY A;  1TT5 B;  2BYV E;  2FOW A;  2XB0 X;  4WF2 A;  4M74 A;  1BN5 A;  5GP9 A;  3D0S A;  3S16 J;  1A36 A;  3CMA B;  1VQM B;  4LIT A;  1KTW A;  4BJ5 C;  2IGO A;  2J8K A;  4I99 C;  2O1D A;  2RQP A;  2EIX A;  2JUC A;  2E7X A;  4X7E A;  1Z3Y A;  1MGT A;  2ZO4 A;  2COB A;  1POG A;  1YQA A;  1RI7 A;  3SFZ A;  1WJD A;  4IX7 A;  3HPH A;  3NAR A;  2K9Q A;  1XG2 A;  1A6I A;  4KIG A;  3DBH B;  1HKT A;  3JAM K;  1OCO H;  3MD2 A;  3WTV C;  4LBY A;  4N0B A;  2CQN A;  1YI2 I;  3MKY B;  1NRK A;  2VC0 A;  1IF1 A;  5A8A A;  1K6Y A;  1VF9 A;  2ZL6 A;  4G6D A;  2H1L A;  1G7R A;  3PQK A;  4FWT A;  3FXR A;  2BM6 A;  1VFC A;  2DPD A;  3AVW A;  3NEU A;  4HF0 A;  4JRA C;  5IT9 K;  3ASP A;  2PQ8 A;  3E97 A;  4TMT A;  1DBG A;  3PUB A;  3GQ7 A;  3ABM H;  4OIR F;  2FXA A;  4QIW N;  3W2W A;  1VQ5 I;  1M1E B;  1IB0 A;  4G5G A;  1RU4 A;  4OIO F;  3S2W A;  5M3M J;  1P9Q C;  1GR1 A;  5FO0 A;  3M9A A;  3OYH A;  1W5T A;  2EA4 A;  1U5T B;  4IHS A;  2ZXJ A;  2WY8 Q;  1U78 A;  1O8K A;  3V76 A;  1OPC A;  4XLP F;  3B8H A;  3T56 B;  4ON0 A;  4CYD A;  3WE3 A;  2UWM A;  2Y0S N;  1NTC A;  3GTK J;  1ENH A;  3D5S C;  4WQM A;  3K9T A;  1EA3 A;  2L4A A;  3OMY A;  2UVE A;  2M1B A;  4FQG A;  1ZRD A;  5E8G A;  3L2V A;  4G1V A;  4QHY A;  5GV8 A;  3AK5 A;  3ONY A;  2DJN A;  1K6O A;  2DK5 A;  1DAR A;  3OIO A;  3FXM A;  4HWV A;  3DQV C;  2ZJQ F;  1F43 A;  3JRB A;  2WTE A;  2ZKZ A;  2E1M C;  1D1A A;  1ORK A;  2X0L A;  5ILS A;  2PN6 A;  3CCM I;  1YOV B;  1P4A A;  3PIP F;  4IVN A;  4BQN A;  4B3X A;  3S1R J;  1GAW A;  4X07 A;  3BTC A;  4U0W A;  1VQL B;  3D1N I;  2ZFU A;  1O7L A;  4JK1 X;  1G3S A;  4E7K A;  5TRD A;  4OP7 A;  2DT5 A;  3ZQF A;  4QVA A;  1TW3 A;  3JRD A;  2YPR A;  1LVA A;  5JHF A;  3OZU A;  1Y1V J;  4OIP F;  2IOU G;  4B4C A;  1H42 A;  1VHE A;  5M3F J;  1EZG A;  4JMQ A;  3KEW A;  1OR7 C;  1LLZ A;  3E6D A;  4MFE A;  2QF7 A;  3DTK A;  5A2Q Z;  4ZTJ A;  3B02 A;  1B9M A;  3BJA A;  4BH9 A;  1Z1D A;  3F6O A;  3I3L A;  4HDV A;  3HGY A;  2D3N A;  5IT9 Z;  3I5U A;  4Z4Y A;  4X7F A;  2BVL A;  2XVC A;  5CYV A;  4DQ2 A;  1AHD P;  4Y4R A;  2ELK A;  2XZL A;  4H9G A;  2LSO A;  3K7A J;  4L8J A;  2YWG A;  2G0E A;  5BNG A;  1RMG A;  3LVB A;  3K4N A;  1QG0 A;  1XGS A;  1Q81 D;  4OJL A;  5FD5 A;  4A3K J;  1KK0 A;  2NS7 A;  4KT5 C;  3GTP J;  4ZV4 A;  3RPQ A;  2NVY J;  1XD7 A;  2CUF A;  5JHU A;  2PEC A;  1YRN B;  4U49 A;  3MVP A;  1T39 A;  3I64 A;  1J9Z A;  4YEJ A;  2JRM A;  2L01 A;  2P81 A;  1UD4 A;  4PC1 A;  4X7C A;  1WH7 A;  1B8I A;  5LHG A;  1Z6R A;  4JYK A;  2YWE A;  4MXN A;  1G7S A;  2N8G A;  2RDP A;  1QX4 A;  2QYU A;  1IDK A;  1GLN A;  2Z3Y A;  5E1X A;  2C6Y A;  1N08 A;  2DOE A;  3K70 C;  3RZO J;  2NVQ J;  3CF2 A;  1K79 A;  2VJ5 A;  2CV1 A;  5J3O A;  2DO7 A;  3J7Z I;  4FN5 A;  4BQA A;  1G7C A;  3SHF A;  1J5Y A;  2ACJ A;  4IHY A;  4M6Y A;  3D5L A;  1X1D A;  1X19 A;  2RC5 A;  2PIA A;  3BR2 A;  5F1J A;  1MJ9 A;  1ZAR A;  1BC8 C;  1R5N A;  4OOV A;  3BDD A;  4F7Z A;  3OYI A;  1P92 A;  3Q6Q A;  4P2N A;  1L3L A;  2LG4 A;  3LSM A;  4L5J A;  1TQP A;  2V1D A;  1FX7 A;  1HQC A;  4LB6 B;  4AIK A;  3MCA A;  3FKI J;  3DTI A;  3CJT B;  1VBL A;  1EWY A;  4J01 A;  5D5W B;  2WAQ A;  4G6Q A;  3ZQI A;  1T6X A;  3VR6 A;  1VQ6 B;  2KZV A;  4R79 A;  2OCC H;  1LDK B;  2HKO A;  2HVQ A;  2RQQ A;  3CCL I;  2VKH A;  1WJF A;  2E1R A;  2PE3 A;  2WJV A;  4XLC A;  3T5X A;  1EFU A;  3CZ6 A;  3TP3 A;  2MH9 A;  3F22 A;  1EP3 B;  2M87 A;  1CNE A;  3NAU A;  3ZN1 A;  4F52 A;  1NBM A;  5A2Q K;  2DIE A;  3CLO A;  3SLN A;  4BEH A;  4PSW A;  2WAE A;  2VBE A;  2XUB A;  3C3W A;  4C3I J;  5BOX A;  3W5U A;  4MEY F;  4I76 A;  3LSR A;  5JLX A;  3VFZ A;  4A93 J;  3SJM A;  4QFM A;  3EDP A;  1FSE A;  1K4S A;  2DOA A;  1IJE A;  1OKR A;  3FM5 A;  4HG2 A;  4BBS J;  5IPA A;  2DOD A;  1R58 A;  2GPJ A;  2DFI A;  5FJ8 J;  5D8K B;  5HLG A;  1AA7 A;  1J7K A;  2FE3 A;  1QCX A;  3DLA A;  2QCO A;  4EW9 A;  4ASN A;  5KSW B;  3HC7 A;  4HX8 A;  3I55 I;  4QUZ A;  3IH2 A;  4TV7 A;  3OV8 A;  3TL4 X;  2ZB9 A;  3ZOB A;  1KQS B;  2QSG X;  3WNB A;  4UNO A;  2ZXW H;  2QM3 A;  3PJR A;  2WPD A;  4BJT A;  3PUN A;  5E8I A;  3OJX A;  4FXU A;  3I58 A;  4YEI A;  1ZGJ A;  2OZ6 A;  2ZME C;  1JXS A;  1JUM A;  1FTZ A;  3OW7 A;  1F20 A;  2K85 A;  4BS9 A;  3A1P A;  2VFM A;  3KP2 A;  2QUF A;  4P9F A;  4A0X A;  4TN1 A;  1TW2 A;  3TDZ C;  2H27 A;  4XKV A;  2VNH A;  3MFK A;  1UHW A;  4GYG A;  5EGO A;  2ESH A;  2HVS A;  2GK6 A;  2M0M A;  3W2A A;  3I4N J;  5FLV A;  3M8E A;  1JTA A;  2C5H A;  3M3Y J;  1BJK A;  3BC8 A;  3HOY J;  1WQ2 A;  1V55 H;  1WKM A;  2PMU A;  3DEU A;  2ISZ A;  1F60 A;  4ACB A;  1EV7 A;  2MLK A;  3IHU A;  1KU9 A;  3JR9 A;  4Q7J B;  4WWV A;  5J4Y A;  2WSS A;  3QP5 A;  5E6T A;  1WWX A;  3F8M A;  5F64 A;  1DAB A;  5L46 A;  5JR3 A;  4J00 A;  3QAH A;  3OYK A;  1O3T A;  2CK3 A;  2GJK A;  3B82 A;  2KMU A;  1YJW B;  4ZCI A;  3ASQ A;  4WCG A;  1VQ7 B;  1K78 A;  4ZTF A;  3DCF A;  3QOE A;  2NTQ A;  3AL0 C;  2WZN A;  1YW7 A;  1KQ0 A;  5JBQ A;  3OYC A;  3DEW A;  1D5V A;  2BM4 A;  4LIV A;  2L4M A;  3CCM B;  1MH4 A;  4PZJ A;  2KL4 A;  2VT2 A;  5AN9 A;  2CC2 A;  1MBK A;  4GRI A;  2YR2 A;  2EV6 A;  4OOS A;  4XMY A;  3KZI C;  4MFD A;  1MIJ A;  4HNV A;  3CCR B;  5C1E A;  4XIC A;  1FMW A;  5ERI A;  1XQB A;  3CUQ C;  2GRE A;  4RPD A;  2G7H A;  4P9S A;  1BMF A; 
#chains in the Genus database with same CATH homology
 5DN6 A;  2F5V A;  2K3P A;  1W36 D;  1OB0 A;  2L7K A;  3VSL A;  4F3Q A;  2BVM A;  4BEH B;  1D0Y A;  2W82 A;  4DJA A;  3RCO A;  2ZTN A;  3K4J A;  4BU2 A;  1O8E A;  2XF6 A;  2X6W A;  4XLF A;  5CKT A;  2PJR B;  1VLY A;  2V1N A;  5LD2 C;  4KKS A;  2INU A;  3M8J A;  5CQG A;  3KYL A;  2HQA A;  3DKY A;  3HKZ A;  1ERD A;  4II2 A;  4MLO A;  3T53 B;  4E7J A;  1O8J A;  2VQL A;  2HVR A;  4RM2 A;  1PKV A;  3NWS A;  1MMD A;  3OWT A;  1VF7 A;  2K9L A;  4H4K C;  4NK8 A;  1YX5 A;  4G6T B;  2WY7 Q;  2R7Q A;  2LH9 A;  4XOR A;  4BGD A;  4CCK A;  3RQ4 A;  3C2H A;  1HA8 A;  2WJY A;  2R7U A;  4G7X A;  4Z1M A;  2INV A;  3OYE A;  4URR A;  2WBM A;  2QX3 A;  2W6J A;  2W00 A;  2X8K A;  4N4N B;  5CQE A;  1O8H A;  2X85 A;  2JJ1 A;  2X53 S;  4G6I A;  1YX3 A;  3DWL E;  2R7S A;  4PJN A;  3DKX A;  4DNT B;  4XL9 A;  2XSJ C;  5FRM A;  3IAM 2;  3EPZ A;  2VPL A;  3FDY A;  4U7B A;  2M7B A;  4BDZ A;  3KEY A;  3OEH A;  4C9Y A;  4U4B A;  1K5C A;  1W9X A;  4OJO A;  1X4P A;  4EAT A;  3B90 A;  2DT7 B;  2XF7 A;  1MW7 A;  3H94 A;  3NE5 B;  1QJV A;  3OIP A;  4C2T A;  2E5Z A;  2VIX A;  3SYT A;  2CV2 A;  4QPO A;  3KX2 A;  3L2R A;  4YZ0 A;  2E5N A;  3CP8 A;  4X0G A;  3K4C A;  4OJ6 A;  1WMR A;  4MR0 A;  3QYB A;  1WPC A;  1X1C A;  2Y0S A;  1LVK A;  2JUG A;  4JOM A;  4RLF A;  4B44 A;  2VLA A;  2ZZE A;  1KCC A;  2LRD A;  3GQA A;  1OGO X;  3U21 A;  4CCO A;  3RPU D;  3AKZ A;  1H8H A;  4OJ5 A;  1OLT A;  2XZP A;  2RRE A;  1DBO A;  3S3O A;  2UVF A;  3H9Q A;  4CZC A;  3ZSC A;  1NHC A;  2UV1 A;  3T51 B;  1TT0 A;  4ZDP A;  3ZPP A;  1YE9 A;  2KHM A;  4U87 A;  4XON A;  3QYE A;  4NUB A;  4ANJ A;  5IK2 A;  1WP6 A;  3IP4 B;  1W0J A;  2GOM A;  3OEE A;  3VYR B;  3PSF A;  3ZIA A;  4E7Z A;  4OAZ A;  2CMP A;  3FHN A;  3ZR8 X;  4P1W A;  1Z3X A;  1UD2 A;  4PFO A;  3ZQQ A;  4BE1 A;  3LSK A;  4BJ6 C;  3K70 D;  4DOZ A;  3BG6 A;  1LFP A;  2AQE A;  4HRI A;  1COW A;  2F4I A;  1DQU A;  3H35 A;  4ZDL A;  2LOO A;  4HNU A;  4XN3 A;  4UZU A;  4B3G A;  2A6T A;  1O88 A;  4FAS D;  1MNE A;  2E60 A;  3T9G A;  4B47 A;  4CUG A;  2MC4 A;  3AL0 B;  2CW7 A;  3DU6 A;  4QPQ A;  4C30 A;  3CJQ B;  1BOB A;  2IS6 A;  1X0C A;  3VSU A;  3OYM A;  2VJJ A;  4NNJ A;  1QU3 A;  2MYS A;  3LSG A;  4OZY A;  4BE2 A;  2PYG A;  1IB4 A;  3MMY B;  3LFU A;  4NC7 A;  1OGM X;  2FUG 2;  3L2U A;  4B3F X;  3FY3 A;  2O04 A;  4PK4 A;  3LSH A;  1O8D A;  2KRH A;  3GQB A;  2R4G A;  3GVK A;  4TSF A;  1O8F A;  4Z03 A;  1Z21 A;  2F6C A;  3E0J B;  4CA0 A;  3K6G A;  2QE7 A;  4ZJZ A;  2NSP A;  1O8L A;  2BSP A;  1JRG A;  2KPM A;  1D0Z A;  3E1S A;  1K28 D;  4DBQ A;  1O8G A;  2CUZ A;  4HSR A;  4HPQ A;  3UNG C;  4DBR A;  2X6X A;  3JUR A;  2Z1D A;  1MMA A;  4DGW B;  4NQW B;  4E4H A;  1N77 A;  3A35 A;  2R7V A;  1IRX A;  1UD3 A;  4AVZ A;  3G2B A;  1JI8 A;  1OHH A;  1DGW Y;  2AQF A;  1V5F A;  1T0F C;  3A3B A;  2L2O A;  2XGJ A;  3WWG A;  1E43 A;  3JU4 A;  1FMV A;  3IUO A;  3DU5 A;  3I9V 2;  3OYL A;  4W8Q A;  2LC2 A;  3K4K A;  3FBI B;  1O8M A;  4XNF A;  1CZF A;  1KZL A;  3NWT A;  2Z2S B;  3VSV A;  3DPU A;  2VBK A;  2F1M A;  2W7N A;  3OS2 A;  1GQ8 A;  4BL0 B;  1KCD A;  3W3C A;  1BHE A;  3OL4 A;  4CSW A;  3SDB A;  2X3H A;  1BPL A;  4TT3 A;  4YXW A;  1D0X A;  2JIZ A;  3EQN A;  4PUS A;  2VAS A;  3DPL C;  1UD8 A;  3H0D A;  2L9N A;  2PMZ A;  2WAD A;  3BC9 A;  3OIQ A;  2KVO A;  2Q1Z B;  3A4C A;  2WA0 A;  2X1C A;  4P5O A;  3V42 A;  2NZM A;  2GOX B;  4BE0 A;  3TMO A;  4AU7 A;  1N75 A;  2IS2 A;  2Z8G A;  2VB6 A;  4RMN A;  3HL2 A;  3PFY A;  4ZYA A;  3OYJ A;  5KCM A;  3OS1 A;  3OE7 A;  3M1C A;  4B48 A;  1V5E A;  2WAF A;  3HAG A;  4G7W A;  1I18 A;  3H9J A;  2PJR A;  3DDY A;  4BQQ A;  4IQJ A;  3GVJ A;  2JDI A;  4HST A;  1SKY B;  2DCE A;  3S8P A;  2V7Q A;  4AYB A;  1VBL A;  3FKS A;  2L5Q A;  3QYF A;  4KKU A;  4PJJ A;  2VXZ A;  4KKT A;  4KT6 A;  2XZO A;  2QY1 A;  4OAY A;  3VDX A;  2R7R A;  3GRH A;  4XOP A;  2BOL A;  2XF5 A;  2W4S A;  3OYD A;  1HZE A;  2Q2E B;  1I8D A;  4GQN A;  2HDW A;  3BCB A;  4PJM A;  4Y3O A;  2QXZ A;  1W36 C;  1PYV A;  2CH0 A;  2KDO A;  2QKM B;  3VYT B;  3S3N A;  1KTW A;  4LIT A;  4BJ5 C;  2IGO A;  3OYF A;  4OZZ A;  1NG6 A;  4CCJ A;  3OOU A;  2O1D A;  1U0J A;  5C1C A;  2VJ4 A;  1Z3Y A;  3N05 A;  3PL8 A;  4HNT A;  1VZ0 A;  2WB1 A;  1WJD A;  4IX7 A;  3HPH A;  1XG2 A;  5CPR B;  4TKO B;  1UG0 A;  3CP2 A;  3AFH A;  2ZTG A;  2M4G A;  3MD2 A;  2V4D A;  2ZZQ A;  3BLY A;  2E1B A;  4LG3 A;  4Z05 A;  3OFN A;  2V9K A;  3MKY B;  5KHD A;  1NRK A;  2I8D A;  4XR6 A;  3LNN A;  1K6Y A;  3CES A;  3SEQ A;  2Z16 A;  3B8Y A;  2JVG A;  2LYC A;  2M3A A;  2ODL A;  2V6E A;  4JQF A;  1OFL A;  2IQ7 A;  3OYN A;  4PFP A;  2CFO A;  2HZD A;  3H9G A;  2X1D A;  2V31 A;  3S93 A;  2WZP P;  3UR3 C;  3UW0 A;  1DBG A;  3PUB A;  3GQ7 A;  3MKW B;  3BCA A;  5KNL A;  3W2W A;  4I84 A;  1MND A;  2HPM A;  3DEE A;  4YZA A;  1X1B A;  4PMH A;  2GJP A;  3K4M A;  4XLA A;  1RU4 A;  2HPI A;  4W8R A;  3BH4 A;  2NOJ B;  1P9Q C;  3GVL A;  3OYH A;  1D1C A;  2R7W A;  4E7L A;  3VMV A;  2HLD A;  1SFK A;  2WY8 Q;  3SEZ A;  1O8K A;  1H80 A;  3T56 B;  4D1Q A;  3ZCO A;  2IXS A;  1MMN A;  3TBI A;  2UUZ A;  2UWM A;  4PJL A;  1KMH A;  5FL7 A;  2VBM A;  3OY9 A;  3ZGK A;  3D5S C;  4F55 A;  2IS1 A;  3BCD A;  1EA3 A;  4FET A;  3OMY A;  2UVE A;  5AMV A;  3WQZ A;  3L2V A;  2XDV A;  3LL7 A;  3ZRG A;  1BLI A;  1IA5 A;  2VXD A;  3EQO A;  3VYU B;  3HG9 A;  3KRG A;  3DQV C;  4F92 B;  4HWV A;  3VWB A;  1E1R A;  4RM3 A;  2E1M C;  2KLO A;  1D1A A;  4OJP A;  1G59 A;  2Z6B D;  2IGN A;  2VQH A;  2W6I A;  2OC6 A;  3ONQ A;  2GJR A;  4BQN A;  4B3X A;  3HUG B;  2HNH A;  3GBG A;  2R7O A;  5HNH A;  2V7F A;  4HIZ A;  4E7K A;  2ZFU A;  4CCL A;  2IS4 A;  4XM3 A;  5HOO A;  1V5G A;  2K9M A;  5JHF A;  5HLT A;  1UAA A;  3OAA A;  1OFM A;  2JVH A;  1PXZ A;  4LIU A;  2XOK A;  3KEW A;  1OR7 C;  3K10 A;  4JMQ A;  2ZXH A;  3VSK A;  3DTK A;  2O0V A;  4CH7 A;  4ZTJ A;  1R6R A;  2XC7 A;  3I3L A;  3OYB A;  1Y6I A;  2QKL B;  1QHG A;  2D3N A;  3GQ8 A;  2ZSI B;  3K4L A;  3GQ9 A;  2CW8 A;  2BVL A;  1UD6 A;  2MFZ A;  4Y4R A;  2XZL A;  2DXI A;  4NK6 A;  2ELJ A;  2KQR A;  2D3L A;  1WJE A;  1E0E A;  4L8J A;  1RMG A;  1Y56 A;  2O5R A;  3K4N A;  2OV7 A;  4OJL A;  4ITV A;  4P22 A;  1N78 A;  2NT6 A;  3FBN B;  3ZXS A;  1SAU A;  2XAU A;  3PNY A;  4U49 A;  2PEC A;  4IZZ A;  4YEJ A;  1UD4 A;  2LBF B;  3H5R A;  2R7T A;  1V0F A;  3PNV A;  1E79 A;  3OR2 C;  1S9H A;  1H8E A;  4D9J A;  1X1A A;  3A1Y A;  3A2K A;  4MXN A;  2GK7 A;  1BR2 A;  4HEA 2;  2W1O A;  1EFR A;  2M4K A;  3VYS B;  4KIT B;  1VJS A;  1IDK A;  1G8X A;  1GLN A;  2LBF A;  2L9S A;  3K70 C;  4ASU A;  3CF2 A;  3OL3 A;  2NTP A;  2O17 A;  2VJ5 A;  2CV1 A;  3LMM A;  4IKF A;  2LY2 A;  5LFA A;  4C2L A;  1TZL A;  3D5R C;  1PE9 A;  4BDY A;  2M7A A;  2IGK A;  4BQO A;  4XQF A;  3QOD A;  3EUA A;  1T95 A;  1MMG A;  3SUC A;  3A3G A;  1O8I A;  3D5L A;  1X1D A;  1X19 A;  1DP3 A;  2DJI A;  1OOC A;  1E1Q A;  1FX0 A;  2R7X A;  3OOC A;  2A5W A;  4XD7 A;  3OYI A;  4DK0 A;  4DIQ A;  5FRN A;  2LG4 A;  1E3X A;  3LSM A;  3C2G A;  3OYA A;  2HU9 A;  1DGR M;  3F9K A;  2ZZG A;  2ZZF A;  4E0F A;  3DTI A;  1UEL B;  2XND A;  4J01 A;  3S3M A;  5HVQ C;  2WAQ A;  1X4O A;  3VR6 A;  3BCF A;  2KZV A;  4XKW A;  2LY1 A;  4R79 A;  1LDK B;  2RQQ A;  2HVQ A;  4XKB A;  3H5A A;  2LZJ A;  2VKH A;  1WJF A;  3CJR B;  2WJV A;  2IGM A;  1BN8 A;  4XLC A;  4BAC A;  2BW3 B;  3CZ6 A;  1WFX A;  4RLQ A;  3W2V A;  1EE6 A;  3HXL A;  1E3Z A;  4F52 A;  1NBM A;  2DIE A;  1J09 A;  4ZDO A;  3FPP A;  4XN0 A;  4BEH A;  4PSW A;  2PYH A;  2WAE A;  4NC8 A;  2VBE A;  1BR1 A;  2X51 A;  3MKZ A;  1ZEL A;  4YZX A;  3PNT A;  4N4O B;  2BW3 A;  1HVX A;  3RSN A;  4Z06 A;  3FKJ A;  2E1M B;  1Z7L A;  4F91 B;  2V4J C;  3EUH C;  4XLE A;  4E7I A;  1T5E A;  2DOA A;  2F43 A;  2VQG A;  4XOT A;  2EWE A;  4HG2 A;  3DTE A;  4BXF A;  3OYG A;  2M5S A;  3S32 A;  1AA7 A;  1QCX A;  3OS0 A;  2V26 A;  3DLA A;  1RWR A;  4EW9 A;  2X6Y A;  3HC7 A;  3RTR A;  3TL4 X;  3DPT A;  3HOS A;  3LSI A;  1NG7 A;  3PJR A;  2WPD A;  4BJT A;  3J7A Y;  2KRC A;  2CS3 A;  1KON A;  4FXU A;  4CCN A;  2JSP A;  4IQ4 A;  3OW7 A;  5TGT A;  2MD0 A;  2DT6 A;  3LMW A;  4BS9 A;  3VMW A;  1WJ5 A;  2R9V A;  5FRO A;  3CMM A;  4OWR B;  4CCM A;  4XLH A;  2P0W A;  1WJB A;  4XKV A;  2LRE A;  2ZSH B;  4KJZ A;  4BUP A;  4PSX A;  2NT9 A;  2JJ2 A;  4F93 B;  2HVS A;  4II3 A;  2GK6 A;  5HKK A;  2OUM A;  2M0M A;  4B43 A;  1WJC A;  3W2A A;  1WTH D;  1JTA A;  2CUJ A;  3IAS 2;  5HNF A;  2NST A;  3BC8 A;  2CV0 A;  4YRV A;  1AIR A;  1HG8 A;  3HOT A;  2O0W A;  2JA2 A;  3SZG A;  2ZXI A;  3HPG A;  4DNR B;  3PSI A;  1W0K A;  1D1B A;  2WSS A;  1BR4 A;  2VL8 A;  4YEL A;  2MAB A;  4J00 A;  2GJK A;  3ZPN A;  2RNG A;  3OYK A;  3BG7 A;  2CK3 A;  4KIS A;  2X1E A;  4DK1 A;  2KMU A;  1IDJ A;  4E7S A;  1PLU A;  2VKD A;  4ZTF A;  3QOE A;  1UD5 A;  2NTQ A;  2VQC A;  4C2U A;  3AL0 C;  3OR1 C;  4E7H A;  4W8S A;  3G05 A;  3OYC A;  3L2W A;  2VJI A;  4LIV A;  1MAB A;  2KP6 A;  3B4N A;  4ZC3 A;  4E6K G;  1WJA A;  2KL4 A;  3VST A;  4XKC A;  4GRI A;  2NTB A;  1QHH D;  3L2Q A;  5CDF A;  4XMY A;  3OPO A;  2K5C A;  1V0E A;  1LKX A;  1PJR A;  4Y33 A;  4YZQ A;  5C1E A;  1FMW A;  3K4B A;  3H5N A;  3EUK L;  1BMF A;  4W8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...