2VJMB

Formyl-coa transferase with aspartyl-formyl anhydide intermediate
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
427
structure length
426
Chain Sequence
TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reinvestigation of the Catalytic Mechanism of Formyl-Coa Transferase, a Class III Coa-Transferase.
pubmed doi rcsb
source organism Oxalobacter formigenes
molecule tags Transferase
molecule keywords FORMYL-COENZYME A TRANSFERASE
total genus 149
structure length 426
sequence length 427
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 2vjmB02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 2vjmB01
2VJMA 1XVTA 1T4CA 1PT7A 1XVUA 2VJKA 2GCEA 2VJNA 1T3ZA 1P5HA 2YIMA 1XA3A 2GCIA 1PQYA 1PT5A 1XA4A 2GD0A 1XVVA 4HL6A 1Q7EA 1VGRA 1P5RA 1Q6YA 2G04A 1VGQA 2GD2A 1T4CB 2VJOA 1PT8A 2VJQA 2VJPA 1XK6A 1X74A 2VJMB 4ED9A 2GD6A 1XK7A 2VJLA 3UBMA
chains in the Genus database with same CATH superfamily
3E2MA 1ATZA 2O07A 2VK4A 1U2SA 1NUSA 2CFRA 4Z9YA 5BSRA 3BGWA 1WVGA 4WOBA 2QTCA 2GA8A 2JJMA 3HA3A 4NBRA 1FFSA 4MMZB 5EXSA 4ZIRB 2WI8A 3SYRA 5C5DA 1BHSA 1YS4A 3M4NA 1WDTA 3TJRA 3FFXA 3DWGA 3X44A 2JAXA 4QJ3A 1ND6A 2GHQA 4I3HA 3TDNA 4WFIA 3ZQKA 1C2TA 5G53C 4HOYA 4D79A 1BJRE 1XK6A 1TI7A 4HZGA 3WLNA 4OFWA 2C4TA 4U7HA 2I22A 1T2UA 2NVUB 4CR8A 2J4CA 1UBEA 1D2RA 3GH1A 2QF7A 3C3WA 2KI5A 3DZDA 9ATCA 4KI0A 1U7WA 3FPHA 2P78A 1MJGA 1IN5A 3ZZMA 2OAQ1 4RVGA 2D1TA 3NI2A 1K27A 3D7SA 3I9V6 3QOXA 3U6KA 3HXOA 3L02A 2J4FA 2I7TA 4YGXB 4DE5A 1D6SA 1QGZA 5FWNA 3U3DA 3IOEA 5IM4F 1J23A 1YTLA 3WYDA 5AM3A 3HJFA 2VYND 3GBVA 3JTMA 5DTJA 2QRVA 1SCUB 4RBNA 3HP4A 2HRDA 1BXZA 4AYWA 1OZAA 2FZWA 2IELA 3PYXA 4GXNA 4XI9A 1BGVA 2I1VB 3L7YA 4EGSA 4UCWA 3A3PA 4U2CA 4RW0A 2G28A 2PSFA 3K9HA 4BU0A 2VHTA 1IHUA 2AYXA 4KIFA 3GBPA 3HC7A 4I5IA 2ZUCA 2VNJA 3CY6A 4K0RA 2WIBA 4JJZA 1TD9A 4YMLA 5J2UA 2YV3A 2ZB2A 3I32A 4OBWA 5BNTA 2FP4A 1P9WA 3HJHA 2GAFA 3H4VA 5E3JA 1IB0A 3IMGA 1JTEA 1HT3A 2B78A 3RWOA 4LBZA 3IX7A 4I81A 1A5ZA 1QCDA 1QX3A 1IPFA 2RHOA 1ZQ9A 2J9RA 1B26A 2GPYA 3ANTA 2O8VA 2ZAYA 4J7AA 1NKSA 3H2KA 1W47A 1XDGA 4OUKX 4C43A 1M1XB 2VZ8A 5JNWA 2G1JA 1E4YA 3HCDA 4MAFA 3QKRA 4DCSA 4Y0AA 1ATIA 2OE2A 4ND7A 4BHTA 1A04A 2WIDA 2ZG6A 2HC9A 2WUWE 4H3VA 1NKVA 4CI9A 3JQ7B 2L18A 3ICVA 3A1VA 4NJMA 2EWMA 5B4VA 3PC7A 5IKXA 2C2GA 2V96A 3DH0A 2MCFA 4TWZA 5F4BA 4H1VA 4B84A 3DTVD 3QOWA 4BV3A 3ZOZA 1XD9A 4DL9A 1UC9A 1MKYA 1Z2OX 3INRA 3CIOA 5FBLB 2EQ5A 3CQ9A 4KUHA 1QFZA 3THWA 4AN0A 1JQEA 1C7JA 1C4OA 2B92A 2IOQA 2NU6B 4RMNA 4I0WB 2AX3A 4F1JA 2P77A 4PBRA 3ZY5A 4B4UA 3HZRA 4AXBA 3W9BA 1MOQA 3H17A 4B76A 4AY4A 4YUVA 4BRSA 2B8TA 3TECE 4HPWA 3FLAA 1YFZA 2G9NA 1US8B 2EU8A 3ISTA 3ZGVA 1EYZA 3M6LA 4YRZA 4B73A 3ROPA 5CYFA 3H1PA 3C70A 2VEOA 3TNDA 4KFRA 1UINA 3PQ8A 1WUTA 4GL4A 2CVOA 1DLJA 3HM2A 4YAWA 1MIHA 1DDOA 4L27A 1L6IA 5DGIA 2P1ZA 4TXJA 1QC5A 2HLDA 4GM0A 1IHYA 4S1WA 5CUQA 3HDTA 3PEEA 2FFBA 5IYZA 1VM6A 1PBTA 4LJKA 3GNQA 3QNMA 4NR0A 4TMTA 3M9XA 4I1SA 1X8KA 5EN4A 4LE1A 3ST7A 3OQMA 3P32A 4Q3DA 2VTKA 3IV9A 1FFDA 4YRAA 3K35A 5EIEA 2I3ZA 4JUAA 3SAJA 4I4TA 3ELWA 1N32B 5GV8A 4IHAA 2JAOA 2X8JB 2A5LA 2PRZA 4B2IA 1BHO1 2YUIA 4OOEA 1M5UA 2Y67A 2YR0A 3RDPA 1V9SA 1OFVA 4Y2QA 2FI1A 3HCWA 4F85A 2IHJA 3Q9UA 3T38A 3GEHA 1CNEA 3L0DA 1J8VA 2E9SA 2HA2A 4FHFA 3T1HB 1W8DA 2WWIA 4K2HA 2BYTA 2ATVA 3ZLUA 1Y5LA 4X94A 1T4CB 1ADJA 3A2NA 4LQCA 4CKBA 5K99A 1AO0A 1Z5WA 3EAGA 1A8HA 2BFFB 4JT2A 3W5IA 4M9RA 1IOLA 2ZYUX 4QFDA 4L72A 1OI3A 5AKIA 3RJTA 1KOFA 4IDCA 1V9CA 2BEWB 2J30A 4Q4JA 2RGWA 3ER9A 4UPDA 1W34A 3CLSD 2H51A 3SR0A 2WV7A 5KWVA 3K5HA 2VL7A 4ZYVA 1ZNYA 4L15A 2WWGA 1P6XA 3INGA 1VYTA 4Q9NA 3ZD8A 5JPCA 3AVWA 1YB7A 3L0BA 4PR0A 3NV7A 4LJ4A 4WLEA 3ZJVA 4LWOA 2QHXA 4E7OA 1JIXA 1HO3A 5JS8A 3U4QA 4PHTA 3TTXA 3FHLA 2PT6A 1N6LA 1B3RA 2GHRA 1G3RA 1ZGJA 4NU5A 1II0A 4TYWA 2AGVA 2FR8A 3AO0B 5TMBA 3IMCA 3CZRA 2IYAA 1I7PA 3O2NA 3QVWA 4PLVA 1RDFA 3AVTA 4MR8B 1E2NA 3VVBA 1FP4B 1UZAA 2GF0A 4LISA 5GV7A 3CZ9A 3S4YA 3PVZA 4G84A 3OQOA 1X13A 4EWLA 1PTKA 1U2DC 4AZ0B 2AF3C 4BFLA 2VHXA 3VR4H 2IHTA 2JIBA 3DDCA 2Z5VA 2NNWB 3DZFA 3TOVA 4HGPA 5K20A 3UPUA 2Q0QA 2WVAA 2X9QA 3WLKX 1CJSA 4JELA 1KJZA 4BJHB 4FJ2A 4D9EA 4F4JA 4RFSB 1NAHA 3WMEA 4Y6QA 3CZMA 3UF0A 4DYVA 3VMFA 4U2KA 3TZHA 5EZSA 4TOIA 3B5JA 4IDEA 1P1BA 4ZCQA 1J42A 5KNBH 4M88A 1S7GA 2QRPA 2VPPA 4C9BA 2K7FA 2AG6A 4RU1A 2IYXA 1CY6A 4FKZA 3QBDA 2JFUA 4PCUA 4RTQA 3G2IA 2FQ1A 4JOQA 1SBTA 1BQEA 5T4EA 2ISSD 1HLFA 2J85A 1R5OA 3PFWO 4Y2UA 4O2BA 4ZZ3A 3EMBA 2LUOA 3VR3D 3WYCA 2G1UA 3FNFA 1Y80A 1N1MA 2A1UA 1RZRD 3DEAA 2BMVA 3FCCA 4U7DA 2XOXA 5LYJB 2O2GA 3O21A 4EQZA 1JI0A 2ICAA 3QSYA 2I4OA 1U5AA 4LXTA 5JZOA 3I62A 1Y82A 2GPTA 1LNQA 4FMBB 1RAEA 4H7JA 1WMAA 4FWBA 3LAWA 4HJRA 4MICA 5E7IA 5HQ3B 2JLBA 2ZJ2A 2B1RA 4MUYA 2JHCA 3GI1A 3RVBA 5JCZA 2IX9A 2HYIC 4LNUA 1KSJA 3AF0A 4MVXA 5EJ9A 4I36A 3T7SA 3VJLA 2IIPA 4DIOA 2FPWA 3UMRA 1FNBA 4FFVA 1E99A 3JVVA 3LHDA 2IYQA 1ZDMA 2VDLB 4Q39A 2OHJA 2XTNA 4TLDA 2B1IA 5A62A 3TOCA 5B3KA 1CQWA 3MS2A 1JVNA 3GEEA 4OH1A 1VBKA 1Z4LA 3H9QA 3QPBA 3QLEA 2BDUA 1UWVA 2P6OA 1X9GA 3BIXA 1EVIA 3JPYA 4KWTA 5CLHA 3TW0A 5CB4B 2F67A 2YZMA 3W5UA 1ZUNB 1ZJ6A 4ZDJA 3IIIA 2RGUA 4W8OA 1J2EA 2WM8A 2KS6A 2WIKA 3HSSA 3NRBA 3SM3A 5K6TA 4BWVA 1DRWA 3D6UA 4KR6A 1K4KA 1E7RA 1ZRMA 1XCMA 3P0RA 4M8NE 1H0SA 1QVWA 4NBUA 3U2QA 1M6WA 3PR2B 2FJ0A 1YE8A 3WYFA 4A4DA 4BJ6A 4Y2GA 2GBPA 1GNVA 3HKEB 3JWEA 1GLNA 1J8MF 2X0RA 3K0AA 4LBVA 1UPAA 2CDNA 2OKGA 3KHTA 2IZ5A 3KWJA 1EZ1A 2J9GA 3MOGA 5E7MA 2PWPA 5EYPB 4DGQA 1R0SA 2JCYA 2P9ZA 4DSAA 3NOQA 4IXMA 1CEYA 4MB0A 2XXAB 3B6MA 1KERA 4MQFB 2VQSA 3FNRA 3DBRA 3LSYA 4V2UA 5AVYA 2PQ2A 3I53A 3ZVMA 1E6UA 1X7WA 1JPVA 1GQOA 3UFXA 5CP8A 4I19A 4F6LA 3SKYA 3NDPA 5I5GA 3H2GA 3QFCA 1V7CA 1ZO8A 4YI3A 4H0FA 4A82A 4ZJPA 6YASA 2PS3A 3NEPX 3RARA 1KXJA 4ZOBA 2B8WA 3KHUA 3AM3A 3FPFA 1CIJA 4BB6A 3K72B 3R9XB 2A9JA 1JF8A 3RKSA 5TIIA 1SBNE 2FRDC 3LWBA 2JGNA 3THXA 3OEED 3LH5A 3B1FA 1IB6A 1KZ7B 1TJPB 1XBTA 2YFHA 5KDLA 2NVUA 3TL2A 4ECAA 4NU0A 2Y6VA 1AKQA 4KITB 3U0VA 1OC4A 2YW2A 3Q3IA 1K2VN 4IQ4A 2QK4A 1SPBS 1FMJA 1W87A 3MUFA 4P82A 3SZUA 1Y5RA 3Q3VA 3WMRA 4J4TA 2R1ZA 1N6PA 3DSRA 3JZAA 4OJKA 3H05A 3NATA 1U0HC 2FPKA 3FAKA 3BXFA 1QNLA 5ALPA 3BA6A 5TLSA 3BHMA 3ILXA 1PR3A 3OZAA 5CPFA 5IAKA 4NATA 1GTRA 2P90A 1M0SA 3GGCA 3M1IA 4FI3F 4GNRA 4MEAA 3HFGA 5I4CA 3VR5A 4R2LA 4HGOA 4I4LA 5HZMA 1BXKA 4RIIA 1NWCA 1OI7A 3CJQA 1GG2A 1DV2A 1Q2XA 5CURA 3AF1A 1LPBB 3DOCA 4WXPA 3L7OA 2WD8A 4Z51A 3J81A 4LX0A 5A2GA 1Q3TA 5IG2A 1WSDA 1GLGA 1TJ4A 3MMZA 4WNAB 5TE9A 2IIQA 2ZSKA 3V9PA 4ETIA 4TZ6A 1P4HA 3QFRA 2CGEA 1QXSA 3DBHA 5TY0A 3MWJA 4TMZA 4JYAB 3QU2A 1DUSA 4LYJA 1FYDA 1NAIA 2NT3A 4EUEA 4N54A 1UBHS 3V4LA 1Q3HA 1K88A 4MGYR 2D59A 4KNWA 5CM2Z 5DW3A 2E4XA 3DBLA 3ADPA 3DL7A 2F9MA 2HMSA 2P4QA 3ZXUB 4V1CA 5I8PA 3S7TA 1QRRA 2CHEA 4DCMA 4XW2A 4BTLA 4LXYA 4OHFA 1GXSA 4FYYA 4OHRA 4RD0A 4EHAA 3ZDZB 1YUBA 2QTBA 4MR9A 4RHCA 4B0PA 1SHKA 2O3SA 4MPJA 5CJ2A 4XGRA 3VPBA 5EINA 2ZYDA 1LKZA 4H3HB 5AVQA 2QM8A 3A9VA 1XZIA 1X9IA 4R8RA 4BVKA 3RFXA 2IYWA 1Q95A 3TTUA 4AP6A 3LO8A 1V26A 3BWCA 4HWTA 2IPNA 1ABEA 2KBFA 1ZH4A 3RVOA 1S01A 2E87A 2YOGA 1SKAA 2ZSIA 3SYLA 1NQWA 1YU9A 1VJTA 4IINA 4F3YA 2FPOA 3AESA 2G7ZA 4ZDWA 3HQ4O 1QO7A 3UAZA 3IPRA 2F55A 1A8UA 4WESA 1L1RA 4DPLA 1P2SA 2J6CA 4MULA 4QTXA 2H59A 2JBWA 4UFPA 1DEHA 4JROA 1EXNA 4OA8A 3KXIA 1L7PA 1WEHA 1GDHA 1RKVA 1LRLA 2NSHA 5LMZA 5I3CA 5BY2A 1JEOA 5GZ3A 2PUAA 2DM6A 5DKFA 1TCUA 3FA2A 1GUYA 3IFSA 4KAXA 1NNEA 1H9BA 3EIQA 4QJBA 2OG1A 1R5JA 3A6KA 3T5DA 2YYAA 3GGOA 2K5UA 1UAAA 1M6VA 1FFYA 1ENZA 3JQRA 3ZDYB 5JXJA 1JV2B 2QI9C 3PDCA 3WGVA 4CIAA 2AKYA 1G19A 4ZJZA 4IV5A 1M2VB 1JHZA 3OPVA 4XIJA 4UUBA 1Q1EA 3H3FA 3IDQA 4V0MA 1RYMA 3JV7A 8AT1A 4GPEA 2FN7A 4OB6A 5DTRA 4QDZA 4GP7A 3VISA 3E4DA 2FUG1 4D9MA 1ZINA 5FO1A 1G18A 1CRQA 2C5GA 2C1ZA 2P1DA 4XX0B 3RADC 1J25A 2E5FA 2J5BA 2WHQA 5LOVA 3GC6A 3IJPA 1ZN9A 4BP1A 3ZJTA 4H6XA 1BXGA 3B1WA 4KZKA 3TVDA 3VU8A 1OFHA 3F2IA 4UASA 1D4ZA 1C1DB 2JH3A 3AFOA 2QT9A 1I14A 2HM7A 5J2UF 3ADKA 2RHTA 4RD4A 3L8ZA 3B53X 1WOMA 1GRNA 5ITZA 3KUDA 2GXAA 3RC8A 3H42B 1KXZA 4ZT2A 4HUTA 1C4WA 4MYUA 4K86A 1NDQA 4N7BA 4FEAA 3I4LA 1HC7A 5I45A 4HN2A 4X1KB 3VR2D 2C2YA 5LKAA 3IEUA 1XEFA 3K70D 3OFNA 1EWKA 1MEJA 3D6HA 1NJ1A 3U7FB 2XUZA 1W2GA 2YHAA 2NX2A 2JGDA 4LY9A 2WLSA 2YIJA 3DOHA 3EIOA 3PKIA 4IIYA 4L50A 4YYEA 1OXTA 4B79A 2OBXA 4DJFC 1KHHA 4MWZA 1RS0A 4UVGA 4C4SA 8LDHA 5J3JA 1Z56C 1N7IA 1IY2A 2WWWA 4HLDA 4CKXA 1EP3B 3LCVB 1FDTA 2DKFA 2QTFA 3NP7A 3ZCSA 4C0QC 4F5ZA 5B4TA 4RTPA 2C9YA 4HYQA 3IDZA 3DMTA 4XIFA 2V0CA 2ONKA 2WVJA 4J16A 2GO7A 2I8CA 3HDYA 4BUZA 4DY4A 2J3KA 3PG5A 5CA1F 4ASUA 4JP2A 5CFLA 4V02A 3P0FA 4K6KA 1ZONA 4OQYA 2PGXA 2QENA 3MQ4A 5CHEA 1IHOA 3IRVA 2E89A 1G8KA 2VEDA 2VXYA 3I09A 5DLPA 4L28A 5EWMB 4WD3A 1FFCA 3ZGNA 3TZEA 4O4LB 1QOPB 3UMGA 1SBHA 2XEXA 3NIDB 2Q1SA 4YIKA 3DDHA 1SG6A 5JQGB 4AJ9A 2WIAA 3PA6A 3HBFA 4UOQA 3ZHYA 2RG1A 2C0CA 1WXWA 2IPLA 5DRYA 2IS2A 3FCYA 5A4KA 2ZWIA 3KTOA 3KJFA 5G0TA 1DFHA 4PRKA 5FV7A 4AUKA 1O6FA 3D59A 3O93A 4E1AA 5LDHA 1U2RA 3BFJA 4LMPA 3PB3A 4JC4A 5JZBA 3RS0A 1AJEA 4M9QA 1AUOA 4LF6B 2X7XA 2OQIA 5FUBA 3GA0A 3CLUD 4HEQA 3LXRA 2BZ0A 4ALJA 3A3KA 3BEDA 4KR3A 3TXYA 3WKEA 2DYKA 3HGMA 2VJNA 1C9NA 3M6AA 3QKSA 4XJXA 4JLOA 4ZARA 2EYQA 4QDOA 5B58T 1XP8A 4A8JB 4B9AA 2G9VA 3AW8A 3EGXA 4UHCA 5F12A 1TVKA 3HH8A 3NH6A 1L8AA 2ZJ1A 3V8NA 1EEXB 1Q0ZA 1H42A 2WLTA 4HQOA 3RRFA 2MYNA 3H8JA 1QCCA 2DR2A 4K1XA 1JFRA 4QBTA 4EITA 1YB2A 3U31A 4AROA 5CFMA 3K9LA 2E1RA 3AV3A 3H2YA 1PJQA 3R6TA 4BFYA 1GTMA 3PNLA 2AYYA 4C29A 5I51A 3GVXA 3NNSA 3I58A 2A4MA 4JQOA 2HV9A 1YE3A 4WHMA 5FUXA 2PM8A 4CMCA 4HRYA 4CV2A 4U2GA 3V2GA 2VOEA 2PWZA 1E9VA 3N2GA 1C8BA 4U7FA 3ILYA 4ZP1A 3V8MA 2JLWA 3RREA 3AQIA 4IPTA 2PKYX 1C7IA 5J2TB 1KQPA 1X1QA 3U0BA 3IP1A 1GYRA 4JBYA 1RWQA 1TVKB 1QIGA 2SKEA 3AEQB 1PL0A 2FK7A 3LGAA 3C41J 4GQIA 4JHLA 4B4KA 4O3MA 2RAUA 3I6BA 3GARA 3H11A 3HKBB 3KCQA 3T95A 3UVEA 1F2DA 1BMDA 2VDKB 4WK2B 4O63O 3EXFA 4U8GA 3E1KA 4R01A 3V4FA 1E59A 5A4DA 3EA4A 3N87A 1YZUA 4UAJA 3P9XA 1IXYA 3KLNA 3NBXX 4HGQA 3CRW1 3QNWA 4TS3A 5BWCA 2Z6AA 3LKVA 1AGPA 4MDFA 1LBIA 1L7QA 5HDQA 3CPJB 3B3AA 4MV7A 5BYKA 5BPFA 2X8WA 2Q8QA 1EFRA 2Y99A 4KIWA 2EW1A 2VKTA 4FW9A 4Y0NA 5JS1A 2EJTA 1JMVA 4AL4A 5JBIA 1R4NB 4FLMA 1COZA 4GICA 3VR5H 2RKBA 5JVDB 5DMXA 1HEIA 4BQOA 5EXDA 2QM0A 2MDTA 2PCLA 4Y9UA 5DMHA 5BYBA 2NGRA 1PJAA 1CLUA 1SHLA 5TT0A 1AZSC 2BZSA 3U16A 4F8YA 1PJ2A 1HDYA 1JHQA 1NMXA 3B36A 1ZH0A 4C0AC 4RNDB 2WKWA 1P1CA 4OQFA 3WDSA 5ADUS 3RRMA 2I3AA 3QQPA 1S4QA 3D4BA 3L0ZA 2EL7A 4UTOA 2ZRKA 5BQXA 2NO5A 1VMDA 4D0GA 3A36A 4R2HA 3TUJC 1I13A 5CJJA 1E2MA 3H18A 4FWIB 5DHTA 1QS0B 3LC2O 2DOKA 4HB2A 1Z4OA 2D7CA 3B6IA 5F9MA 5DWDA 4AMZA 1NBME 2IZ6A 3V33A 3B5EA 5HUQA 4M1SA 4PE5B 3VNUA 3MTGA 4S0ZA 3L8YA 1E7WA 1SH7A 1WXGA 2QP9X 1M2HA 3MB8A 4ZCMA 3HVHA 4LZOA 4IH9A 1Q1ZA 4LNAA 1U4NA 2YRXA 3H2SA 3OMXA 1AKNA 1M66A 1TO6A 5EIXA 2NV2B 3DFMA 1YBVA 4AS2A 4Z9AA 4HEA1 5F5NA 3JQEA 2NSYA 4DMUB 5GIPE 3ZQ4A 2P35A 5L4SA 3O90A 2G83A 1WSBA 4GX0A 2ARKA 3J80A 1OSNA 4DDHA 2IT1A 3TRIA 3HVUA 3UW1A 1HUQA 3S1SA 3D6JA 4IWNA 1KS9A 2A2ZA 2OFWA 4YK7A 5COQA 1OQAA 4GMGA 5FRDA 3GJ3A 3S2SA 2HK6A 3SOPA 4KMSA 1WQ3A 1MOZA 3GOQA 3D3NA 4HAIA 1W52X 121PA 2ZRGA 3KAKA 2KX7A 3N28A 3SICE 1U4SA 4DLKA 5AWFC 4J1TC 2Z2ZA 4AG3A 4NEQA 2NV6A 1JFFA 2OZLB 3IO5A 1JHMA 2F1IA 3JCZA 3RK4A 4ICIA 1AY0A 1GT6A 1UPCA 2PX0A 4OBBA 4ARVA 1M5RA 4ODIA 3HBJA 1G8MA 3RYHA 16PKA 3M83A 5KUTA 4FE3A 5FB3A 2CUKA 2CEAA 4AM8A 1QYVA 1Z22A 2D0DA 2J45A 1L4BA 2GYWA 3H3JA 3REFA 1UADA 2YJ3A 3DVRX 2HFJA 4QL3A 3P9NA 4GMKA 2JIZD 3W8EA 1RI1A 2V7TA 3VOTA 1UOOA 2FR8C 1DAOA 3GW8A 1QB8A 3JQGB 5DLDA 4CM6A 4QUIA 1U2GC 2XMSA 2W42A 4DB4A 5IWAB 2JA1A 1NRXA 1MGOA 1Y6RA 3LBAA 1GXSB 3U1TA 1NLUA 1VJDA 4HNSA 1A97A 4LX8A 3VHLB 2P7HA 3F1KA 4A6PA 3FBGA 1TQ4A 2A3NA 4IZ6A 5EE5B 1CUZA 1X80A 2XDYA 3DMTC 2GM3A 3WB1A 2ZUWA 3KEMA 1WB6A 4B87A 2AFHB 4X3OA 5C1BA 2G9UA 4FYIA 5BMVB 1IMJA 1Y7IA 4LYDA 4RADA 5F1YA 2FB9A 4F4UA 3AVYA 3WLIA 3GDHA 2A9FA 3N2KB 3OWXA 4BNYA 2QWXA 2AN9A 3FHCB 3TLXA 4WLFA 2ERCA 5LWHA 1SQ5A 4RHXA 4LCEA 4RD3A 1Y5IA 2FZ5A 4LFBB 1FMTA 3F67A 4MTCA 4WXMA 5G2OA 2BW0A 4GNKA 3JSXA 1PW5A 2GX6A 2QRUA 2JK1A 4FC7A 3ZZNA 3OC0A 1CR4A 1VPEA 3B1ZA 3EJ6A 4YP0A 3VR2A 1WB9A 4C04A 4E5SA 1L6RA 2QXYA 3D7KA 3LLSA 2EG5A 2VO1A 1EINA 2ZBQA 4ND8A 4CKEB 5LMCA 1E3TA 4UNNA 2NUBA 3QUCA 2WKSA 4F92B 3AUFA 2J7PD 3AYXB 1CF4A 3IUNA 3WMGA 4US2R 2OCYC 5I9LA 1OPRA 3N3BC 4CLEA 3DEIA 4LIPD 1QH8B 2XADA 1RM4A 1CKEA 4C7XA 3BXHA 1CRWG 3E18A 4RH1A 4TV9B 2CLDX 1EK6A 2PZLA 3JWGA 4K3UA 2CWWA 1LLCA 1ARZA 4L08A 3RAJA 2CJPA 3KR0A 5ADVA 4IUYA 4KE7A 3OF5A 5CLFA 1KI2A 2AJTA 3VUFA 3ZBTA 3PD0A 2CXTA 4QODA 1DB3A 2CCGA 3BQ9A 1GNTA 3Q6IA 4U8HA 5ADHA 4FHGA 4AJNA 4M0CA 5K0EA 1IY1A 2ORIA 2WAMA 2Y1KA 4H7EA 4I14A 5DBFA 4C1NA 1S2MA 3G0IA 5J1TB 5K6RA 3LL7A 5KTYA 3ZTWA 1RCTE 3HWSA 5C8XA 5JMPA 3DULA 1B6SA 2RGYA 4WNAA 3FTPA 4MQFA 2Q8PA 4HYEA 3K9WA 3EZFA 1DGQA 3R8CA 4L5YA 1W19A 1THTA 3DUFA 1GCIA 4G0NA 2CF5A 4L75A 2DE0X 5TS2A 4YLYA 3A14A 2UU9B 2O2DA 2B6HA 3GEDA 2V5AA 3UV6A 2H11A 2I62A 4YWHA 2GNOA 4L8LA 4WUVA 2PYIA 2ZIXB 2B5WA 3SNHA 3OTWA 4NYJR 2O8EA 1XTIA 4E03A 4R31A 1USWA 1LLUA 4EGFA 3O7WA 3EVNA 2OBYA 4N03A 2O6HA 4HYYA 5DNEA 1P3Y1 3LQ2A 1MXHA 3ETEA 1BIFA 1HH4A 3GEGA 5JNSA 1JIUA 1ZCBA 4YIHA 3WLQA 4PVDA 2I4NA 3DFKA 1VBFA 2KWIA 2I2WA 3FJOA 4RY8A 4TLAA 4YAFA 2IEBA 3E7FA 3BJIC 4L5CA 3KZ1E 5FUMA 2HIHA 3AF3A 5F7ZA 1USKA 5GP1A 1BC5A 4EKDA 4FB4A 1ZA2A 3OI7A 1IY9A 5B1DA 2ZJYA 2B2CA 2CFSA 4OQQA 3OMLA 4BXOB 4MHTA 3PJEA 3PUHA 1HSZA 1AQIA 2G67A 1YB6A 2QTVA 4JP3A 1FTGA 2W2PA 4YQFA 4KSYA 4DR5B 3SQXA 2UVQA 4CT5A 4HAWA 3PEWA 2HMWA 4JI4B 3D3JA 1YJQA 1KQ3A 1XIVA 3B2EA 2AE1A 1R4AA 1IK4A 2B99A 2I2AA 4HGYA 2VIIA 5AK6A 4CQJA 5MGNA 1NE2A 4JMPA 2PUTA 1F6DA 1HE5A 2JLAA 2Z9DA 1N33B 1Z2CA 3IULA 3ZE1B 1DI0A 2OBBA 2ZRCA 4K9MA 1CR0A 3EA5A 4HI0E 2K4MA 4F96A 3P9PA 4XPZA 3EFBA 4Y9SA 1IG0A 1V3UA 2DFKB 3E03A 4EG0A 3NX4A 1XZJA 2YC2C 3KAPA 1LBTA 2HMVA 1DRKA 2CK3D 2J9YB 1RE1A 1EFPB 1WV0A 2VAVA 1M1NB 1T1IA 2OV2A 2QXTA 3PI7A 4I5EA 1E1LA 4KX5A 3L8CA 5LOVF 5HRAA 4EW1A 4B3XA 1LVGA 2ZYHA 4JUIA 1DWOA 3KTFA 2BFNA 3OT1A 2AG1A 2CMHA 5HHTA 3KSBC 2JFQA 4DAOA 3Q4GA 3PLAE 1C0EA 2WJ4A 3WWEA 4KK3A 1Z2NX 4E2XA 4HDAA 2PD4A 3GUZA 5CCEA 3U13A 4OGFA 4RK5A 2JLSA 5GM2A 2NPIA 3W5JA 3WIEA 2WJPA 3OQIB 1QP4A 2KLHA 4KBFA 2XNSA 3PU6A 2I9KA 2PMDA 1JSZA 4KBGA 1QRSA 4DBVO 4E5DA 3B1JA 5NULA 3M3HA 4W1SA 1UFOA 1FS6A 3P2EA 2OHGA 4FYMA 2IGTA 1IXSB 2QROA 1E8MA 4YH1A 1C7RA 2WNSA 5TVGA 2V7PA 2AQHA 4TLMB 2AMFA 1RWMA 5IVKA 1C7FA 4HPJB 4PLCA 3WA6A 3D31A 5L40A 3M4YA 2QW1A 1ZK1A 1SZDA 4W7SA 4FN4A 5C34B 4FOPA 2QVZX 3ENWA 4H3SA 3I5YA 4K46A 1G8HA 2Q5EA 4XOIA 4G0OA 5DN6A 5G0VA 3U6BA 3L8GA 1YQUA 2UV8A 5K1ZA 3HY6A 1M2EA 3CLSC 4JZYA 3LT0A 1QOZA 3KVVA 4W9RA 1R16A 5KMGB 3ZG6A 5AFSA 4PAMA 1L5FA 1OX5A 1J8DA 4CIYA 1NSYA 3ECAA 2B9VA 3FFWA 2QV7A 3I6ZA 2RMKA 3NS7A 4JLJA 4R84A 4ND1A 3L8EA 1QO9A 2LTAA 4X8OA 3ZV7A 2BKAA 1DKRA 1P7VA 2P65A 1G55A 1LH0A 1E0AA 3MTAA 4G0XA 4ENRA 1SIUA 5JHHB 3A4IA 1U0RA 4R9UC 4ZRMA 4JXKA 2C1EA 1U3WA 1VGRA 1IY8A 2P5TB 2YXEA 3LL4A 4G0PA 4J1NA 3HB5X 5ALKA 3SYMA 2XCTB 3ENKA 1PWXA 1K8YB 2H9YA 2J31A 1L4GA 2Y68A 3EGOA 3VGPA 5KNLA 2WHEA 3U4HA 1L5KA 3GZNA 3TLYA 1JHYA 1AQYA 4BECA 2GM5A 5B7QA 2QM7A 1PWZA 4EZIA 4GI3A 2EGUA 5ALGA 1U8ZA 2FLWA 2VHYA 2GBCA 3GFRA 4PG4A 2YQZA 3T1OA 3ZWPA 4C2TA 3A4MA 4GE0A 3ONWA 3HLKA 5D3QA 1FNSA 5K3FB 4E5VA 1QIEA 1SXIA 3I6YA 4M1MA 1C30A 2A92A 3MWEB 2OXRA 4NENA 1YR2A 1R0ZA 3A6JA 3AFNA 4BFSA 4CDGA 1Y8AA 4JJ8A 4KIGA 4DLBA 3GLHE 3KQSA 1ADGA 4O02B 1C8LA 4GLOA 1FBNA 1FYFA 2HJ9A 3CHYA 3H0KA 3BGOS 1QVRA 4X64B 4L3VA 5IUJC 4O2AA 5LWQA 5HSGA 2Q49A 4KODA 4PSUA 2G4VA 2GF9A 4TSRA 1VLVA 1FSGA 4A2QA 4KPFC 5HPYB 2R1TB 4Z9XA 5G1PA 2R8ZA 3G85A 4NMHA 3EYWA 4MYHA 1OLUA 2ZJ5A 5DXFA 4F9FA 3BE5A 2SBTA 2E82A 2RIRA 3CRMA 3DNMA 1V8BA 5EP2A 5F78A 3X1DA 3COZA 5FOXA 3WO1A 1SOUA 1V5IA 4KP7A 4J0JA 2OXEA 3SF0A 3VI4B 1PSZA 4ZQHA 3UO8B 4XYLA 2JCSA 3PUJA 2IXGA 1G5FA 2H8KA 1YRBA 1IZ8A 3SM9A 1QYDA 2NACA 5A9SB 1VMIA 2WE8A 3PJDA 1HTBA 4S12A 1O0SA 2HHJA 4ZQGA 4BGEA 3ETNA 3VJKA 4I4TB 4AJ1A 2J8ZA 5EERA 4GOLD 4XFJA 3WDMA 1IQPA 3R23A 2DFTA 2OT3B 1DV1A 3H0CA 3VZCA 2IYOA 2XMZA 2ZVJA 4HTFB 1H2AS 1MBZA 2N75A 3TSOA 3TLEA 4FM9A 1IOZA 4JEIA 3EWSA 3OURA 4KBYA 5ALVA 1OHHA 5KQPA 1N2CA 4M21A 3TS1A 4JSYA 2IPXA 4KGVA 4POOA 2X2FA 5EPEA 2QL9A 5IRCD 4AKIA 2PFKA 4FK8A 4CBVA 1UXJA 1WU8A 2FP4B 3QX9A 3DONA 2BP7B 1PLLA 2GZ3A 1AS3A 1G2OA 3KVOA 4PNZA 5IWCA 2X22A 3TQIA 3STTA 1WP4A 3UGKA 1OFUA 2PMWB 4ER6A 4ZEVA 3F9RA 1RWBA 1NVUQ 1WXEA 4GGOA 4HDRA 3T0GA 2VDUE 3CRQA 3HUFA 5EE0A 1QMPA 2BMDA 5B7GA 2B1QA 5BSKA 2W0MA 4ZO7A 2Q5CA 1UJMA 4B40A 2W71A 1TEHA 4IOKA 4DCVA 1N5MA 1MB4A 1U28C 3HTXA 1JB9A 3HRKA 4QBHA 3IKTA 3ICEA 3IAUA 1Q14A 4L8GA 3LX6A 2M2IA 2FN9A 1R18A 2Z6VA 4H59A 5C9ZA 4NJMB 3PJRA 4ZJUA 1PG2A 3JQ7A 1OI4A 1YT5A 3TSWA 3DZBA 1LF5A 4Q66C 3ZWNA 1EK0A 2G3YA 4OGWA 5FV4A 1N7GA 4ND5A 4BYMA 2Q4BA 2HNBA 3FUWA 3GJ8A 4ZC8A 3PHJA 1EBUA 4BNJA 2CMDA 3ABOB 5I3ZA 5EZYB 2ZYRA 4N0EA 2DWQA 3CVWA 2CVZA 4NS1A 4LF8B 1AHNA 3TW8B 2P30A 3ZV4A 1LK7A 1PGJA 3LFUA 4CTMA 3VU0A 5JJCA 2P67A 1MA3A 4EMUA 3DDSA 3JATB 4R7ZA 1ECCA 1F2TB 4PIPA 4NCNA 2GVDC 1H05A 3VR1A 1AMNA 3KU1A 3R3ZA 2TYSB 5FQNA 5CDHA 1BAPA 2J3LA 1IJKA 2Z1MA 2PMBA 4AJHA 5D2CA 4GI5A 2JFYA 1F3LA 1S8NA 3RVMA 5BSEA 1UKZA 4NBNA 2ESRA 2VJCA 3E5NA 2F64A 1I7LA 1N2JA 3LVQE 3HSYA 2XUHA 1B15A 4AQDA 1UL1X 3NHLA 5K3BA 3DP7A 1X7HA 4OPMA 4MP6A 4RVFA 3UHPA 3MT0A 4ENWA 3COJA 5KYGA 4GP9A 4ZV4A 2O8BA 3A4YA 2OYRA 4ACBA 5EJ6A 1UXKA 1Y1SA 3GVHA 5IYZF 4ZAYA 3BULA 3FIJA 3F46A 1OWOA 1UDXA 3GOHA 3H65A 4UDYX 4MV5A 3E8XA 4KMOA 3BH7A 2OFOA 4AB1A 5LXTA 2LZ0A 3AF4A 3AKZA 1XD2A 1O6GA 3LPMA 2DHEA 3QM1A 2B4TO 2P6MA 2YWEA 1OJ7A 4HLUA 5E6UB 5JO9A 3FM9A 5IEJA 1OXXK 2ACEA 1DXOA 3QRWA 1N2SA 3E84A 1LSSA 4IOMA 4NCIA 2ZSEA 2PUEA 1NTRA 2JZCA 3L1JA 3CWQA 3M3PA 4PCLA 5BWOA 3IE1A 3F8TA 5AW0A 4U7GA 3QU5A 2CMKA 4F60A 1K6JA 2MHCA 5C7LO 2MOKA 3N6VA 2Z4TA 1BVUA 1EGQA 1FRZA 1GZ4A 1QORA 1THMA 1V39A 1JMYA 2RC6A 1EDBA 1WR8A 2QJRA 3BB4A 5B37A 3TMKA 3QW4B 1ZCFA 1P3DA 3H5NA 4LXIA 3R2JA 1NHGA 5LA6A 1Z15A 2Q2OA 4B3CA 1B73A 3EOZA 4QGAA 4C08A 1HL7A 3GLFA 3FCSB 3SZOA 2HQRA 4OQMA 4RQTA 1BVHA 3DMGA 3RLIA 1GTG1 1B76A 4HQRA 1AMOA 3WAJA 1HG0A 1HDIA 4M89A 2R5WA 5FBQB 3E15A 2JJ2A 1XHFA 2NTJA 2OCGA 4EI9A 1E1CB 5T67A 1AN9A 1XQ1A 1ZZGA 2RHLA 5C1OA 3DLPX 4UBJA 1TO2E 1UJ5A 1ULBA 2V6MA 3CJTA 1IZ7A 3FHJA 4IHJB 5F3RA 5LNK1 1FL9A 3UAVA 1A7UA 1BN7A 5D3KA 2QD1A 1C9JA 1QVZA 4B47A 2R4UA 3DTTA 4A03A 2VTDA 2NUPA 2ECPA 2MSNA 2VAWA 2XEDA 3AY6A 3L7JA 1U3GA 3BXZA 3OEYA 3KYCB 4KACA 1XZQA 4NJEB 4D9JA 1HRDA 2VBFA 4FJ0A 4MYSA 1UJ4A 1CIPA 3RWBA 1ESCA 5I9BA 5T6BA 2GJ8A 3D6MA 1EP1B 4OGGA 3W1VA 5DSTA 1YS6A 3ENVA 3U19A 1L4UA 2ZUEA 1GNPA 1I1HA 2XGSA 4PXSA 5JSHA 1NY6A 3WTBA 3B3FA 2CV1A 1TF2A 1ZVKA 3NIWA 3DE2X 4KPUA 4XQ0A 221PA 4JJ4A 3ZGZA 4FYVA 4MKXA 3WLOA 1SKBA 1XZAA 2N1BA 5ANRB 4R69A 4UDNA 1HPLA 1I24A 3HABA 5EJFA 3B48A 1VYVA 3P9IA 2WZCA 2V7EA 2JEYA 3E7XA 4TTPA 1TYBE 4DJAA 1C4KA 1OH8A 4XR4A 4LJ9A 4D6XA 4QFBA 3LYUA 1DQYA 2MSCB 3ETJA 4NRDA 3HPQA 2XUFA 1Z0JA 3BHJA 4B3HA 3B9BA 4BIMA 1NVAA 2XYGA 3MERA 3NM5A 1EWRA 4LWPA 2B98A 2R2AA 2F8SA 2ZKLA 5JXGA 3UTDA 4WCFC 1DMRA 3NB0A 2WG2A 2BD0A 2CLCX 4C6SA 4E5PA 1ILWA 3QUSA 1MMFB 4C4AA 3P26A 4DG5A 4YXFA 1F38A 4ZYLA 3ER8A 4AJJA 2Z58A 2I4RA 2JHAA 4O2LA 1S0UA 3A1CA 2DBVO 4B43A 1FTNA 3TB4A 1U0OC 4U2FA 1RKBA 1T5SA 1QQAA 2OUKA 4Y1FA 4COKA 3ZWBA 4RA9B 4GYWA 3QU4A 5M2QA 2X15A 1N57A 4X85A 1P0PA 3R5HA 3O3CA 3P2JA 3G9ZA 5L4NA 3QBJA 5LMUB 1O9GA 5JTUA 1BGWA 3T9DA 5AKKA 4CL8A 1S89A 1WW8A 1PJ8A 2FG5A 2NQ8A 5FAXA 2JG3A 2JAWA 1JW9B 2CT8A 2WC1A 1E1NA 3ZZ1A 3OKPA 1J24A 1Y4SA 3SLGA 3K2IA 4WFQA 1K3TA 3SK0A 4QELA 1JPNA 1QGAA 4LHZA 3ZD7A 2ZSFA 4LYEA 2EG9A 1E4EA 1WDMA 4BCBA 3G9XA 3GRKA 1KVRA 1MO5A 4IQFA 4C0BA 5C52B 3KXLA 3EG9A 1N5DA 1IH8A 3STHA 1IJFA 4QNNA 4XFKA 5K8IA 1ZH8A 1SUWA 1Y3HA 2AQIA 3R0JA 2NU7A 4CIBA 2FEWB 1U3DA 3SLKA 3O3NB 2JBAA 2AFIB 2QVLA 1R0KA 4A7PA 2XQGA 1SJ9A 1NLMA 2NN3C 3KOMA 4PX3A 5FJIA 3K0BA 2E5WA 3EVFA 3H97A 1IZYA 2DCUA 2EZUA 3MRTA 3TFQA 1B43A 3FPLA 2GCOB 3RUAA 2W8ZA 2XSZA 1IEWA 3OTOB 2FSUA 3D3WB 2R2GA 1KSFX 2Z04A 4QYWA 4WZBE 4CCSA 4YV2A 3UHAA 4QOIA 3QOYA 1S1MA 2WF5A 3I5XA 4BLSA 2CHUA 3T7CA 2AW5A 3R3JA 3I3SR 2ZB7A 1M0WA 3BN3A 5TMDA 2JBHA 3WYAA 2HCBA 4CF3A 4KAAA 3DCNA 4YRJA 5MN6A 3CA8A 1JN0A 1Z6XA 4PC7A 3IT2A 3DPSA 2AC2A 5KDOA 4J0FA 3PTLA 4QO7A 4GXRA 3IUBA 4ZCIA 2PH1A 4OX9Y 4G37A 1DVRA 3R9IA 1MW9X 4YJ3B 4E5KA 4BMOB 1VKJA 1UKVY 1FUIA 4IF4A 5K09A 5IBQA 1JHRA 2A9OA 2DUJA 2P8SA 2VT7A 3DCIA 1LA2A 4GOMD 5DU2A 4GLLA 4BX8A 1TZMA 4ZKDA 2QTAA 1D04A 1RI4A 3ZW8A 1HETA 4QHYA 1KO4A 4ZGGA 1WBJB 3IQWA 3SQMA 5E3HA 3CKMA 4Q05A 1E63A 1N4DA 3QE3A 5IX8A 3WL3A 1ABBA 1V71A 3STUA 5IT4A 4L78A 5K0BA 1RYZA 2OBMA 1N4AA 1NPTO 3NTXA 5GGXA 4Q37A 1T2AA 1G4AE 5DSZA 2VUSA 2VBGA 4OQNA 5BWNA 3R1IA 1RADA 3M8KA 3AT1A 2BBOA 4ZVQA 3VHXA 3LUCA 5HJ5A 1NF8A 2I78A 2QUZA 2REBA 1EVQA 5FA5A 2ZM5A 2YX1A 1SBQA 1KZ6A 4QNRA 4HX2A 3FDZB 5AJYA 3QU7A 1OX4B 3PC2A 3B6EA 2QP4A 3LUFA 1ZN7A 2Y8EA 3NTVA 3EIEA 1YO6A 4Q3KA 4NI5A 2LR0A 4JI1B 1T4BA 1WB4A 2KHZA 3A0UA 1AZWA 3PPWA 2HYDA 3OBIA 3ESAA 4UU7A 5HEKA 1PDVA 3UHFA 4H0CA 1H2EA 4RK1A 1Y8QB 3R8XA 1N8TA 4PG5A 1EFAA 1CR2A 4I5FA 3JARB 5H83A 2HSWA 5AM4A 5LXTF 4A23A 2GEDA 3ZE8A 2ACKA 3E8SA 4RV5A 2FNAA 2R1VB 4OH7A 3RH0A 1QE0A 1IBMB 3I2YX 4KR2A 2VT3A 3UICA 2WSBA 4IDFA 5GVSA 2XDQA 4LJAA 2BEUA 4HNAB 5FXMA 5G0WA 1ZJWA 3AF2A 5PGMA 1R6BX 1YKSA 3S2EA 1T2FA 2D6FA 4E12A 3PHBE 3L40A 3ZE2B 3TOSA 1H94A 4EAAA 2ZPAA 3BXGA 5KJ1A 1PT5A 3C3MA 1HKUA 1R0LA 1QWSA 2VA9A 1KIMA 3A0RB 3EZNA 3F6EX 5DYWA 1HORA 2RH4A 3VX3A 5BW4A 1HFJA 5IFLA 1BDHA 3I2HA 5T4HA 3Q6NA 2X13A 4MPDA 3T1YB 3E3LA 1RYEA 2C5FA 3STXA 5T41A 4OBEA 2IZOA 3VR3A 3AL3A 4PV7A 1KYTA 3BQNB 1Y0BA 4ZK2A 1W0KA 4QVGA 4WZAE 1G20E 2PLRA 4RESA 5DWVA 4QPPA 2AFIA 2QGNA 1DOAA 3QXXA 4NS4A 3BFPA 4Q9IA 4MPTA 4ZRDA 4YP7A 3V7FA 3W6NA 1G5HA 2YN4A 2XQFA 3CINA 3R5TA 1YCFA 4FGSA 4LWZA 4OD0A 5TJHA 5CFNA 3W5BA 3FBTA 5IANA 4FFBA 2AFIE 3TZKA 4LZAA 3MLEA 3OCUA 3SE7A 3SFVA 5KTMA 3PHHA 5CNIA 2DR0A 1CQIB 1EHCA 2F9LA 2QPTA 3GLQA 4OP2A 5CH5A 4MWOA 4B31A 3T0FA 1G8PA 2YZ7A 2C2ZA 3QMPA 4G5GA 4WCDA 4JOCA 4Z7QB 3PHGA 1J1IA 4MH0R 4AUEA 5EGNA 3R7FA 4M53A 5LJLA 2JK0A 3DVQX 3ZVNA 4A0HA 1IRIA 1EUCB 2WWYA 4MLCA 4WZZA 2R5NA 3JQAA 4XUCA 3P1JA 1JXAA 4PM4A 4Q6BA 4LRTB 4OY3A 5KIAA 4RA9A 2FOXA 4FT4A 2DTDA 2FG6C 4W5QA 3W7VA 4RORA 3DLHA 3SF8B 3DBOB 4XQGA 1Q44A 4EJSA 2YZGA 3HJAA 4PYIA 4CG2A 1EWTA 3C98A 3FLMA 3NU1A 2O52A 4D8WA 4X9XA 1W6RA 1DCKA 1BA2A 5C3UA 4RAQA 1PFWA 1OWMA 2LKDA 3COPA 5KWJA 3T7RA 1WY7A 3ETDA 5H3HA 3BXEA 3SEQA 3PYMA 1R3UA 2YN2A 2HLDD 4KCGA 4U9UA 2IHYA 2B7BA 1GSOA 3FF4A 4Q6WA 2R44A 3WRWA 5TQ2A 2H3EA 2NVWA 3FWNA 4W5NA 2HHCA 5K2OA 1Y6ZA 2H4FA 3NC1C 5AIBA 1FSFA 4H4CA 4M1KA 1TZCA 5EMNA 1O9HA 3ONFA 5SYMA 1Z18A 1P0MA 3MCZA 3A26A 4HGRA 4C4YA 2HRQA 3LWNA 2FMFA 3CTPA 2G82A 1LS6A 5DNVA 2CZQA 1R4MA 3TKYA 3ULKA 5F33A 2MSLA 5BQ5A 4IJMA 3C85A 3DGFC 2D0PB 4EG3A 1M6VB 1Q7TA 3GX1A 5MFZA 4ALLA 1RPTA 3BDVA 5E0OA 4UUAA 3AINA 3FE2A 1UKAA 4XGNA 7GPBA 4TYNA 4TN1A 4YR9A 3KP1A 4LZWA 3P9YA 3EH1A 3RC7A 3AI3A 4Q16A 3H8VA 4BNXA 2X5JO 3I1IA 3OQ1A 2NWQA 3DJYA 1MENA 2C5HA 1S02A 2XCQA 4KV7A 1LB1B 2L69A 4XARA 4NOLA 4DC0A 1S3FA 2JZNA 3PQ2A 2FVXA 4ID3A 2AEMA 4LV6A 4YP9A 5DHSA 1I0LA 3AEKB 4PFSA 1I51A 4D99A 4AZ3A 1X70A 1CP3A 2DWCA 4HB3A 5KYVA 5ICGA 5K6AA 5FBKA 1U0BB 3Q0TA 1UFRA 3RD5A 3MGKA 2ES4A 4P34A 3WGJA 2GILA 2WUVA 2AE2A 5F1OA 1YZLA 3ZU5A 4P7JA 1VKRA 1XUOA 1QTQA 3R0QA 4ER5A 4YQZA 4A15A 3D81A 1B2RA 1E7MA 1QHIA 4YMIA 2IWHA 1R4ZA 1WMFA 4EYOA 2YICA 4B71A 4FS8A 2Z2IA 3HY3A 4P92A 3U60B 3BZUA 4GP6A 4DIBA 5IM4A 3KZCA 1BDBA 4G09A 4G4IA 3GLFB 2A1IA 4N3AA 1OIVA 3Q40A 4KAJA 3CO5A 1GGHA 3EDOA 1TJNA 4XB1A 4YDRA 1N1DA 3OJLA 2EJCA 4KC0A 4CUKA 4QQNA 2FMHA 1XCGB 1XTTA 3AIIA 3CRNA 3EQ9A 1GZVA 3GK3A 3OT5A 4LKRA 1L8QA 4Y2VA 5JAIA 3NVAA 3Q6MA 3GIWA 4YMHA 4LN1A 4UNQA 3U5TA 3H83A 3L6RA 3OX4A 3FYUB 2WMYA 4YQEA 3M6XA 1XEWX 1XMPA 4FX5A 4YALA 2HU7A 4A0FA 4MRAA 2CEKA 1ECFA 1T9GR 2WUGA 3P9KA 4ZI7A 2Q3CA 1JQKA 1AOXA 3NKFA 4LJ5A 4NMXB 4LGVA 4NCHA 4XE5A 3RSSA 2FMKA 5C5IA 4ARIA 2VHCA 2QDXA 1OLSB 4GDMA 4ISBA 1H4VB 1RHUA 2QXUA 4EPXA 3EFEA 5FWXB 1U8YA 1UR5A 2ECKA 1MQSA 1NF3A 521PA 3V1MA 4M7PA 2IJGX 2X1HA 3MVEA 5HM8A 4ADSG 3PEFA 5FYQA 4EI2A 2OR3A 3WQQA 4DSUA 4CFYA 1CR6A 2V6FA 1KAQA 3I04A 5EQFA 2RGDA 4MVJG 5H7XA 4EVIA 4RGYA 4EA8A 3L4SO 2QKYA 4H7IA 1A9QA 2XVAA 3KPJA 1W1UA 5BO5A 1MGPA 4L5IA 4CKYA 3RUHA 4M1TA 5AKYA 1TTPB 4B7CA 1NUUA 3RYCB 2ISQA 2Y1GA 4L02A 4NMMA 4UVDA 4TTQA 4KN9S 3P2MA 4TKZA 4W5JA 4ZV7A 3MJHA 3B52X 1M6YA 4BC1A 2QRLA 4OLFA 2IV7A 2J3IA 2QU8A 1XMSA 1NL3A 2YL2A 3BJEA 3QVJA 4WBNF 1T91A 2D7DA 4UNPA 4L74A 4BFVA 3ZD9A 1H85A 3ND5A 1F2TA 2QS9A 2Z43A 5LPNA 5E9AA 2SCUA 1MO4A 2D2IA 3JALB 3LUKA 5GY7A 4WEOA 5CIWA 1CRLA 1VFPA 1FQJA 1PTJC 2VDQB 3JX9A 1NJ6A 4IXNA 1K8XB 3T5BA 3GMIA 5J4HA 4H6WA 3ECCA 3OZFA 1I94B 1FMFA 1R0RE 2B7CA 2WYWA 4CM4B 5H4GA 1ESEA 5KYXB 2OCLA 4I7EA 5U9CA 1BE1A 4YPOA 4LF4B 4Y6SA 2N9UA 2ZYTX 1B8PA 1YR7A 2IE8A 4PS0A 4G4SP 1M67A 4QTYA 4HF7A 2Q2VA 2HCJB 2BSQA 3JVEA 4TKVA 2HX1A 3A2LA 3R40A 4AURA 3FIUA 3DKRA 2UXDB 3GPCA 1FDIA 2GLUA 3GN2A 4LRSB 5LZ5A 4KE8A 1YI8A 3N2ZB 1XR3A 1CIVA 2J1LA 3C6QA 3EBLA 2QTGA 3GMTA 4UBLA 5FT9A 3CEAA 4DFDA 1WNTA 2C29D 3OLVA 3EVTA 1YQGA 2PUHA 5F4ZA 1XU9A 2YNMD 5A03A 2BAGA 3UKOA 3OZEA 1XCOA 2OGWA 4R2WA 1UEXC 3GHHA 4AULA 1EFLA 2E3JA 2HJHA 3GG9A 4LFAB 3O84A 2AI3A 4OU5A 1YVPA 4QYSA 1EQUA 2BP7A 3LY7A 4HRXA 4BLUA 2OHVA 3O4JA 3THRA 1U2PA 1Z12A 4GC5A 5KNBA 1H1TA 4Y2SA 3ROFA 1E9RA 3ERCA 1YTUA 2BZGA 4TKVB 2QLJA 2XJ4A 1G66A 3CE9A 1SUSA 2D8AA 3IA7A 4JR2A 1Y3BE 1E77A 1GQYA 4PXAA 1NBOA 1VB5A 2FR0A 4FFOA 4LC1A 5JV5A 2R25B 4OIMA 3RU7A 3SGLA 5AM1A 4HT3B 5M04A 3Q3CA 5CB8A 2X2OA 3LXXA 3ZJYA 3PV0A 3SHFA 5DOVA 1V5FA 1NW9B 1TJ3A 1U11A 2IYUA 1OT3A 2XNKA 3GQVA 3ZOKA 4A0RA 2EHDA 2GKOA 3H1GA 1YC5A 3LCUA 3OE4A 3AI2A 4KMRA 4C7VA 5HKKA 3D1JA 3A6DA 5B36A 3PUVA 4ETWA 3CVYA 5FUVA 2AD1A 2FY8A 2O2XA 2V0GA 3WC4A 2SCUB 5EKTA 1QCZA 2Y9PB 4WDQA 2V54A 2VNHA 5JCOC 3DW1X 4HNHA 1M6EX 4ZCRA 2AH5A 2X0DA 3B7WA 2FRXA 3VTFA 1Z8FA 3HR8A 4TRNA 2R8PA 1VPTA 4DMLA 4IVPA 1TLFA 2I76A 3GJ4A 1L5WA 2YTZA 4HCJA 3VNBA 5L7YA 3ZH2A 1XTUA 3RVLA 3M6VA 4V0KA 5F7OA 1EVEA 4OHZA 2AQ8A 4ACAA 1TZBA 2IVZA 1W2WB 4ZO8A 5CX1A 3TOXA 4DJTA 2R6FA 4DMKA 2GN2A 3VR5D 2QN3A 3OLQA 1LW7A 4X7RA 3AP1A 4ZA2A 2EP8A 3QPVA 2HGSA 2PMCA 1DC4A 1GOTA 1B6RA 4LMBA 4BVJA 3GFSA 4JWTA 3EK2A 1IBKB 1LQTA 2WM2A 3VVMA 2Q5QA 2PXXA 4HHEA 4Y7DA 3U1VA 1OYWA 4D1YA 1A8IA 1FUKA 1YJ8A 3C6XA 5ER6A 4DTCA 2AOUA 4WJKB 4BPBA 3K7EA 1JG3A 4HH4A 1WPQA 5FL3A 2M6LA 4F5DA 1Y33E 4RO0A 2V1UA 1KJNA 1OLSA 1EFVA 3SIRA 4WX2B 2JAHA 3TR6A 3VNAA 2ANBA 1TM7E 2DT5A 5K4AA 5AESA 4FZ5A 3KSRA 5DULA 1ZQ1A 3VZBA 1RAAA 3PL1A 3CZCA 4TS9A 1KDRA 2C8VA 1AZTA 3TVTA 2XGJA 4MVJH 3ROEA 1ZA1A 4N8EA 1KNXA 1KQGA 2N1MA 4UARA 2X0FA 5GJVC 1VLLA 4MZDA 4B09A 3QHQA 1H2YA 1E3EA 4G0WA 1L5HB 1F7VA 3RUIA 3MCVA 2WMDA 3I9OA 4QHSA 2Q8NA 3IAHA 2POCA 3N2NA 3DC7A 4N18A 2YIMA 4XIYA 3WLFA 2CV0A 2JB9A 4EDHA 3QJYA 3S1AA 2AOUB 4ID9A 4BLTA 1M2OB 4LDJA 3BQMB 2Y1OA 4J0KA 4L9WA 4NULA 1ZH6A 1GU7A 1SO8A 3MMNA 3P4UA 3W4IA 1FSZA 3AB3A 1EA7A 1XTSA 3MQ2A 2A86A 1J2YA 5FPKA 4L76A 5FA6A 8MHTA 2WWXA 4FOSA 3DWEX 1PX2A 1ISPA 4Q4JB 4M0FA 4YC7A 3UK2A 2FDRA 1AK9A 5AOAA 3ZQUA 4PGGA 3IOMA 5ALSA 5CX1B 1HZJA 1JX6A 1U8CB 2W6MA 2PVPA 1SQGA 3D0KA 4JB2A 4KHZA 4WNYA 3UJPA 1KARA 2Z98A 3ZE6A 2AZXA 4HDNB 1T4CA 3TRFA 5A3SA 2CCKA 3TR5A 3WLRA 4BVHA 4F56A 3NDBB 1JNXX 5DHPA 4DRXB 1ZIPA 3O3MB 1VLHA 5F35A 3M9WA 4URWR 2XUQA 3I6MA 1I4OA 3AERA 3R5KA 3UQYS 1JR2A 2X7JA 3C5CA 3CTMA 4Z3DA 5CH3A 3ZX4A 1Q57A 5KVQA 2NO1A 2LVBA 4LXHA 2YY7A 1ABFA 3PIRA 5AHKA 3DD1A 1PHRA 3G68A 1NW3A 2J7KA 2JFPA 2Y0PA 3E8MA 4CM7A 4DUPA 4EW6A 2YXNA 3PWKA 5TQ0B 5BYAA 3O38A 5FULA 3WGLA 5CW2A 2R8YA 2PR2A 3K9CA 4GKBA 1WZ2A 4Y2XA 5ER9A 5CK5A 1X8JA 1IEQA 3PX2A 4DIKA 4LZZA 3BH6A 3AUSA 3FX2A 4Z8XA 1IXKA 1UMBA 4KQFA 5IYZB 4YNBA 5FBZA 1GD1O 1GYQA 1NFRA 4PO3X 4JJEA 3IYLW 1HDRA 2B5OA 2CLEB 1P1HA 2JJ1D 4YJ3F 1JTFA 3PFKA 4EPWA 4N3NA 5L9AA 4MYCA 3SX2A 5KPDA 2OORA 4BLRA 1L5ZA 3DV0B 2WKRA 1G9TA 5ALQA 2BGGA 3L0CA 3B5IA 3MGBA 5FHRA 1WM1A 5EVCA 1Y4ZA 2O0HA 4C3OB 1NQOA 3VDRA 4G1EB 2EATA 4FILA 5LP6A 3HG7A 1L7RA 4OKSA 4DKXA 3KQHA 1GILA 1P19A 4HQ6A 3GNLA 1CD5A 1RQPA 4TXLA 3U62A 3AR8A 4QARA 2V9PA 3DV9A 4X90A 3WJ1A 4J1QA 4DQ0A 1PDWA 5L4LA 3HXQA 3AL0C 4F9TA 3KHSA 5FPYA 1ZN8A 1DEOA 2BBTA 1J06A 1Z38A 2IXTA 4CF4A 1U9YA 4RPLA 5B2EA 3BMOB 3IR5A 2J3EA 2TS1A 5E7JA 4D8XA 1N5LA 4ZYXA 5TRTA 2AG0A 4URZR 3VR4A 4KDEA 4OMFG 3A1NA 1A9SA 3QOFA 3IP6A 4HWPA 3S55A 1CVLA 3ZWAA 3EDMA 3PPIA 4J0HA 1IHPA 2C99A 5JLJA 3IBFA 1Y4UA 4FMCB 3QKRB 4FFBB 1TL7C 2Z8XA 2CB0A 3H5LA 3HKDB 2XDAA 3JQQA 3JU3A 3DPIA 3L01A 3MCAA 3UC9A 4AG5A 1GR0A 2P5YA 3OZ7A 4Q9HA 5SYNA 4FOLA 4YMSA 1XTBA 1XC7A 5JARA 3IT3A 1RT9A 3NNDA 3Q98A 4UUQA 2CV2A 4EY4A 1O0BA 5B58C 3P4XA 4JT4A 2WT4A 3FDJA 2BGMA 2PKEA 1I1NA 5A6SA 4BU1A 1FBTA 5DTMA 1QDUA 2J3DA 4OFXA 2CJWB 3HU2A 2DZDA 4DARA 1T9AA 1ZVMA 3JD2A 2Z83A 3NHUA 3CF0A 3CIFA 3GNSA 3CURA 4YXWA 3TJZA 4YS6A 4WV3A 4RTJA 1IM5A 1Z33A 4HS9A 4ETMA 5CT6A 1XU7A 3KKMA 4TRRA 2XXJA 3GPLA 4P81A 5C51B 2B8JA 1DKNA 4KRGA 2BZ1A 4OX9B 3C8ZA 4FONA 4FHZA 4IXTA 2CUTA 1IIBA 4F3NA 4EMBA 2LCIA 3DE0X 1XG5A 2FN3A 4FLEA 3FYTA 4I2VA 4DM7A 1E2UA 5LIPA 2NAPA 2PJUA 2IPAB 3HVIA 3PDIB 2OCAA 1FF9A 1RQXA 1Y1KE 2BKEA 2W22A 4ZI7F 3IL2A 3MMXA 3HBLA 3MCTA 3LIPA 1EK5A 2O57A 1NR7A 2PWAA 5JMWA 2JJ1A 2C9DA 2VZLA 5AUPB 4UTNA 1SB8A 1Q7EA 2O2ZA 1NPYA 3O0TA 1UBSB 2E21A 1N3LA 1Q6YA 3EW7A 1T5TA 1G3QA 1CP2A 1WCWA 4RANA 3X2EA 1L9KA 4M1WA 2NZYA 3VR6H 3HJTA 4COOA 3UW3A 1OX4A 1SA0A 5HJEA 1U31A 3FDZA 4NEGA 4DBZA 2WEKA 5KYNA 2X9VA 3UKJA 2PE5A 4MJLA 1PLJA 3LVBA 4BVLA 1K4YA 1U8EA 3UBTA 4TV9A 5CYGA 5MHTA 4D0SA 2F1KA 1VG1A 1Z6TA 1EVLA 2V74B 2BFCA 1T10A 2DF8A 2W11A 3BFXA 4LXGA 4PO1A 4C14A 3MJCA 4UNSA 1CQJB 1WCV1 2H65A 5B2FA 2I3GA 5DGTA 2H9IA 4FSDA 2EFDB 4S3MA 4IJUA 1XTJA 1XP5A 2EZ9A 1CJTC 5HM6A 3KTAA 3CW8X 3WHPA 4K0KB 4S2EA 4ND8B 4CKEA 4L1KA 4WBNA 3CLRC 2ZJFA 3Q9SA 5JZMA 1OWLA 1P1JA 3HI4A 4GLBA 3DZIA 5HP4A 5CFQA 2C42A 1CLEA 1EB8A 2VSNA 3PD7A 4IHJF 1VE5A 4RZHA 1XA0A 4MW5A 3WIBA 3NT2A 5ENVA 4BLPA 1FP7A 2YVUA 3CNLA 2C78A 4YJ3A 4Y98A 1JHPA 1QIHA 3CWCA 5KKAA 5C8YB 3BL5A 3V8VA 1PD1A 2QY9A 5EXPA 5KQLA 1JIIA 1E9DA 2YYZA 3AUYA 3PNSA 1BDJA 2XWQA 4IJQA 3SEZA 1ANKA 3G2MA 4ZU6X 5GJBA 1OXMA 3R7SA 3VV2A 5JJKA 4BKRA 1WE2A 1QHFA 2VYNA 2Y76A 3LTEA 3LTNC 4BO8A 2GARA 2IZ7A 3ACCA 1F20A 4YRFA 1KI6A 4FVTA 1ULUA 2MTBA 3VR0A 2D1YA 1CXZA 1J70A 1TVMA 4AICA 2O8CA 3VAAA 2QN7A 2NV0A 2YWBA 5KBYA 3OEWA 3VDNB 4G4JA 1RRFA 5F2EA 1UXHA 1TADA 5D6OA 3WOHA 3SWWA 1NVBA 1TQ8A 2HRZA 2IEDA 1RC0A 3FOBA 2G77B 2ID8A 3CVJA 4Y7CA 1TDJA 4I8DA 4MR7B 1SXJD 5TF0A 4GW3A 1CUUA 4S04A 4BPRA 4HQLA 1U2ZA 2H1IA 3IP7A 1B8VA 1NLYA 3ZHSA 2WYUA 3ZD6A 3M5CA 1DAIA 1JTVA 1TYDE 2GWHA 2A33A 4LJ6A 1P2UA 1ND5A 4MS1A 1C8VB 3OZSA 3JQ6A 4GOOD 1J0AA 2BUBA 3IAFA 3K2BA 3F5QA 3VR6A 2HNAA 2B2NA 2J6BA 4U6NA 2BRUA 1QZXA 2Y77A 3FGZA 3QV1A 1GA6A 4QOSA 4J7XA 4X44A 3ESBA 1AV7A 1IUOA 2J07A 3I5AA 1VQ1A 2IP2A 4RGBA 3UWSA 3QEBZ 2JGLA 2YMPA 1OOEA 3KUCA 4Z3OA 3VNQA 1ZY2A 2WSSA 1C3OA 4QEZA 3RKUA 1WF3A 3OPXA 4UZEA 3ET5A 2ZZMA 4PG6A 1QFMA 2GPBA 3NZEA 3K1TA 4UFNA 4PG8A 4OK6A 3CLVA 1C8KA 1T1JA 2GGSA 2IXBA 3JZMA 4R0VA 4DC1A 1XF9A 3IR6A 4LNHA 2B3DA 4KDCA 1NYLA 3VPCA 4HBZA 2IW3A 3W5AA 1N2BA 3KUXA 1HNNA 3HJNA 4BV9A 2UUBB 4QXRA 3UUFA 4AS1A 1TEZA 3UFBA 1MPXA 4KOAA 2MJLA 3Q8WA 2V59A 3NRJA 4MHSA 1MO3A 3HJUA 1AE1A 4JJFA 5IBRA 5HIAA 3I1JA 3W1EA 1GAQA 4LI0A 1IC6A 2RHRA 3JAKA 5CDGA 1DJQA 1ZJYA 3H4MA 4R6WA 1PGQA 2Q1XA 1KJ8A 3G5MA 2OYSA 3GIDA 5I9IA 2XBMA 5SZKB 3NIGB 1O8BA 3AHFA 5JYCA 3UTCA 4O8CA 1NWHA 2WILA 4JOSA 4JJ6A 1BCSB 2OESA 2OP0A 3TQCA 1NLFA 4AN4A 4NNOA 1U7DA 1JE0A 4B8WA 3VFDA 1GA4A 4J76A 1TTTA 3AM4A 1SK9A 3N2YA 4KLRA 4HDQB 3KZNA 2FCAA 3OQPA 4KPUB 5SICE 3KFVA 2Y27A 4TXNA 4RKFA 3ZHVA 1WZIA 1BDIA 2P0EA 5KYUB 3UCEA 4YRKA 1QO0A 4P86A 1X15A 3P52A 4NZ9A 2P9GA 3U39A 5EHNA 1TKRA 1E6LA 4X61A 2Q62A 2H6EA 5DSXA 2JCVA 2WMOB 3WICA 4CRWB 2YWXA 3DZKA 4RVHA 3C6YA 3BRSA 4AKEA 1Z0SA 5IMSA 5FORA 3L7LA 3PJFA 2BOVA 1DAPA 2IY9A 4Q3NA 3JARA 4N0DA 1PG0A 1ZIXA 2WOOA 1G8YA 2O5CA 1KI7A 1NJGA 4WWHA 3IOCA 3SXUA 3HZHA 5TPWA 4C7JA 1ULAA 5DIFA 4ENQA 1V1RA 4X1OA 2ZUBA 1YZ3A 4J9UE 1L7AA 4H60A 2VDMB 1DRVA 4BTEA 3SQWA 3R44A 4LSMA 1YJXA 5BVHA 4AP5A 5L3QB 3LP6A 3O83A 2PKQO 3PI6A 1M33A 1P33A 2ZR0A 5FBRB 3WHKA 2W37A 1NE7A 3NM4A 3OOSA 4LK2A 5ALLA 4C89A 2DY0A 2OD7A 1P5JA 2JIPA 1V3QE 1E2KA 2FEMA 2I3DA 1N6IA 3PQ7A 5J47A 1ID8A 1IVYA 5LA6B 5A6VA 4IL5A 1O4VA 3Q8MA 1N77A 1Y9AA 3A9SA 4G5QA 4JVSB 5D8DA 2NYUA 1M73E 5E38A 1L4FA 1ZWKA 4A1FA 4ALNA 2BMWA 3PYLA 1D0SA 3QF4A 3T94A 4FUTA 2O1EA 4RSMA 4WDRA 5AI9A 4CMEC 3DCYA 3QIVA 5TQJA 1XPUA 4ZYYA 4DSOA 2ZJ3A 3H5TA 4BZXA 1C29B 2ZJAA 5KVAA 4M1YA 2QJFA 2PR7A 3H75A 1E0JA 4JU9A 3EF3A 4JXJA 1YMVA 3SSAA 4EPYA 1BTOA 5CVUA 1TM5E 1E62A 4JKIA 4DBLE 3KVYA 2AIRA 5EHGA 5KDDA 4OMCA 3O4GA 3TVYA 1DXQA 1ZRHA 2ZDGA 1DUIA 4EOGA 4UVHA 5F73A 4U0KA 3NOOA 3JR3A 1NXVA 1X1SA 2WVHA 3OZTA 5A06A 2CBZA 1MCZA 1M34A 1UDAA 2ST1A 1VL6A 3DHNA 1OH6A 1IU9A 3DDWA 2YMMA 3EDCA 3KLBA 4N0MA 1HL3A 2YWHA 4L6IA 3RRZA 2WJJA 4MCAA 1K89A 3HADA 4EEZA 1D7OA 1TUBA 4L5AA 4WCFA 3K1ZA 3PQ4A 1ZICA 3IIJA 3HP7A 3JASA 2WD9A 3CEPB 5LUBA 1VHJA 5JSQA 3E2PA 1XSEA 4K87A 3D3WA 2TMKA 2XODA 1QNFA 1DPFA 4NG5A 4Q24A 4URXR 4PS1A 4ZYUA 5JASA 2B20A 4XRGA 2Z56A 5EWMA 5KYYB 3CN9A 4KJZA 5ARCA 4E46A 3S81A 4GBED 2BLNA 2J5KA 421PA 1N9KA 1P0IA 1XRPA 2RIPA 2XQVA 3D6VA 5DYTA 3UUWA 5TV2A 2K87A 3F9IA 3VO2A 1FRQA 2PL9A 4EKIA 3PGXA 5SZJA 5LN1A 1MOPA 3HZOA 3L4BC 1XK7A 4IWXA 3UYKA 4BL5A 1DUVG 3KXKA 3E6AA 3NIFB 4JHXA 1ZESA 2Z5LA 3UB2A 3U7IA 1U2TA 4KEAA 3GQBA 4EDFA 5BXQC 3CG4A 3E48A 1GV0A 2D1QA 2VH2A 1HBJA 3WGGA 5KB3A 2I4IA 1Z83A 2PT9A 2ZR9A 3EWNA 3IPCA 3UG7A 4ZTUB 5GVRA 2OV6A 5L51A 1BU5A 3K8QA 5HJ7A 4H1HA 4FXPA 4EUHA 3DFIA 4BZWA 4UDXX 3O0DA 3WE7A 1DTSA 1OU0A 1Z5PA 4TWJA 4GYYA 5JZSA 4PLTA 1G0NA 2WFZA 1XNHA 5EHZA 1G38A 1ZMOA 4J43A 2IEZA 1KK3A 2FETA 4JJIA 4LZPA 1DBRA 1QQBA 1QU3A 5I48A 4QPCA 4Y1EA 4NBTA 2XYPA 4BAGA 4F38A 3ICWA 4OUDB 1UBLS 4GM1A 5ALWA 3AETB 4KTTE 3RTCA 4YRRA 2RGBA 1I5RA 2P9BA 4EJ2A 3F8WA 4K03A 4PGFA 4Z9FA 4MUAA 1RXUA 1PQYA 3IQXA 3GR6A 1DIGA 1VB3A 1TO1E 5EMKA 3UWMA 2QVGA 3BCRA 3WZMA 2UZ1B 4RYLA 4H7DA 1I7SB 2XR1A 3AZQA 3GUHA 1FZTA 1WW2A 1TCBA 1TUIA 5JRJA 2VKQA 4IKPA 1E1RD 4O2RA 5C81A 4LE2A 3RS2A 1R0BA 1Z4JA 5JDIC 2HBZA 1W0JD 4C7OB 2UZ0A 1E3IA 3DXZA 3E3AA 4OEHA 2NOAA 1D8TA 3NJ4A 5EMLA 2NUTA 4DN6A 2FPMA 2C94A 3RRNA 4ZREA 3LWZA 1PEKE 3KQMA 3PD1A 3PC8C 3PRHA 4W5HA 3PHLA 2IP4A 1HR0B 1MVOA 2IOYA 3PDHA 4XLTA 2ZIAA 5H16A 1RACA 1QK4A 1ZGCA 3R6DA 4K6HA 1XD8A 4TL9A 4WKGA 4UTZA 2M9MA 4D0LB 3D1VA 1VE3A 4B8ZA 3A58B 3FLEA 5J4LA 2AMLA 5TJ9A 4DV5B 1Z9BA 3BILA 3CSSA 5B1YA 2AOVA 3GGPA 4DIUA 3DO6A 2W58A 3OEEA 5B7NA 3LCCA 3N86A 4HO1X 1RJ9A 3M6FA 2GBFA 1ORIA 4MA4A 4M0LA 4F6RB 1EAMA 1Y7LA 4OMUA 3L77A 2WAXA 4LPKA 3WQBA 1ZGZA 3ZV5A 2ZSJA 1Q19A 3ON5A 3HSKA 5I8WA 2HWKA 2G06A 3DNFA 1X7XB 5ALIA 4J0IA 5GOTA 4GZ3A 4O4HF 4M7WA 4RELA 2RBEA 4YHHB 4KSBA 4CLDA 1FQKA 1GSHA 1XZCA 4GGMX 4M0KA 1X7ZB 5C7OO 2NP6A 2OZPA 2FK8A 4QBGB 2WU8A 1K3FA 2ZI4A 2BF7A 3EZ2A 1MAWA 4KN8A 3ZWCA 3DA8A 3QHPA 4BP9A 4CM8B 4DQXA 2P6UA 4JY7A 1K6XA 1GL7A 3OFVA 1JP7A 4DXDA 4IS3A 2R00A 4GGPA 3H7AA 5ICEA 3AM1A 2FPUA 4C78A 4X84A 5FQOA 1FYWA 3FFAA 3ITKA 5CT9A 1Y9JA 3O95A 4PLGA 1K5DA 2I2DA 3RV3A 2RCNA 4KLNA 1DJMA 3TCNA 2WDZA 1RWNA 2GBLC 2NM0A 5BOVA 1E2GA 1HF3A 4RKWA 1V3VA 4AMUA 5CDSA 2NO4A 4IDGA 2XZPA 4ZVNA 3ZN2A 2XMBA 4JGGA 4OFBA 1TCVA 2FMXA 3OM8A 5FBWB 5HCIA 1CB0A 3SX4A 2AUTA 4V1CB 3KPWA 2EWVA 3AR5A 5BWBA 2QZPA 1Z5OA 1KGDA 2HZ7A 2P62A 1QHHA 4I5DA 4XPIA 3RR2A 3VYSB 4P0TA 1XD2B 1Q22A 2ERYA 2QQ0A 3C7CB 1DAMA 3WGYA 3VO9A 3DBHB 2EFHB 3N5CA 3Q12A 2VHVA 2HU5A 4MCJA 3R3WA 4IDPA 3LS2A 3G8YA 3NASA 4HSGA 1YVUA 5DF1A 3T52A 5JAOA 3IQZA 3EQZA 1E9AA 4Z0PA 3FW1A 3FNIA 4HXFB 1JXMA 1G6HA 1U0JA 1C7QA 5IDWA 1NF9A 2XY4A 1N8KA 3DKVA 5A0VA 4KIJA 1JHOA 1GFSA 2B5VA 1QH1A 1RWXA 3FVQA 4JBNA 5KKCA 2C84A 3L7IA 3ELUA 2I8LA 3LHFA 3RLFA 4WIAA 1OMOA 1KSGA 2JEOA 4WLOA 4EKNB 4Y2TA 2PUWA 2WINI 2J6HA 1U80A 4O4JB 4BBZA 5K0SA 4HB4A 3O4VA 3OWHA 4W4TA 2R1UA 1DWQA 2HJVA 3K9NA 4A73A 1I3OA 5H5JA 1YKGA 2I2XB 1NBEA 2VK2A 4I9NA 4IX9A 5DBIA 2C4HA 4Y30A 3V8EA 4E2FA 5BN5A 5DISB 3R3XA 2P3LA 2RHCA 1N7JA 3GJQA 4RPJA 5DP1A 1Q0HA 3K8OE 1FQOA 1ADBA 1E3DA 1IXZA 1WXDA 1YSCA 5UKDA 3T4PA 5ELXA 4MGIR 1EWQA 5T8KA 4BUCA 4EUFA 4G23A 2GAAA 3JYQA 4XDGA 2VK1A 1QB7A 2ODAA 4TTJA 4JEHA 4WGGA 3TDKA 4P3YA 2CYBA 4BNZA 1LI4A 1MB3A 1F3OA 3OIYA 4OXYA 1MUUA 1JR3E 1DT3A 1KZ1A 2N0SA 3LI2A 4P3OA 3UFXB 4DMGA 4Q4CA 3SXJA 4QG3A 4BGDA 3J7AC 1UWCA 4IIXA 4G8CA 3ZHOA 1OH7A 5L45A 3UEOA 3HB1A 1EMDA 1APBA 3GROA 5J23A 1C3XA 1R10A 1WXXA 2XBUA 5IVPA 2JJ8A 3JR7A 3LT5A 3AY7A 4IVNA 2IDZA 1FDOA 3LY5A 2A0KA 1FRFS 5TSDA 3Q2KA 2WAAA 1YR6A 3AFGA 1MEEA 3CR7A 1T6ZA 2B4KA 1G4UR 1JDBC 4MW9A 1H23A 4WKPA 1YZQA 5ESWA 2WSSD 3RUCA 2ZAGA 2GERA 1PSDA 4RXTA 1E1MA 5BSGA 3BSWA 1Y63A 2V5VA 4BTVA 1J9EA 4FDAA 4PZUA 1E2FA 2WZDA 4PLZA 4ZK6A 1FTQA 1MF7A 1M9NA 1SELA 1Z62A 2F90A 2Y1XA 5FL7D 1IG3A 4MWCA 3RF6A 1PJTA 4E30A 1JWBB 3P20A 1S4MA 2C3UA 4ENUA 4MCHA 3WK6A 1FB5A 4EABA 5ISMA 1XDDA 1YHNA 3GMSA 3TWOA 1OGYA 5KSWB 1DAGA 2X8AA 3OCWA 4P4SA 4IR7A 4X97A 1GQ2A 1GL6A 1I10A 1Z0AA 2ZFUA 4GEKA 3NV9A 4LNUB 1GUBA 3PXDA 1NIJA 1VDMA 3V7UA 3BS4A 4M38A 3V4SA 5BQ3A 2B2XA 3WBFA 4TPKA 3ZNOA 2C77A 1PNOA 4MUXA 1DINA 1YB4A 3QEKA 4Q3EA 4BGVA 2D2FA 3DE5X 3RYIB 1N3BA 2DERA 4IEFB 4JQYA 2CDRA 1T5IA 2VC2B 1XQWA 1G8FA 3FOAA 1OFTA 4JUDX 3BE6A 4OXIA 2PGDA 2HKIA 3DT8A 4KXYA 1F48A 2J0VA 2IYSA 4RA6A 4AJKA 4MDEA 4KHPB 1BEUB 3JTEA 3R0ZA 4LG1A 1MT0A 5A71A 5HTOA 2X9NA 4MOWA 3NR2A 4FD3A 2E55A 1WS6A 3WQHA 5AI0A 1PR1A 4YJ2A 2X40A 2BHNA 1E3WA 1D9XA 2DC1A 4BNKA 4FNAA 1DS6A 2VWPA 2IH5A 3B82A 2ZIVB 1VYUA 2E4VA 1D5WA 3CUEF 1MC8A 3OJEA 5F52A 3S2YA 4TWBA 1K98A 2R60A 2NUAB 2FPIB 5JYBA 4P0QB 1T0BA 2C4WA 1I2CA 1EM8A 3HCCA 4EUKA 1ISGA 4BY9E 1CNMA 3BMCB 4CCYA 4EIWA 2IHVA 2W6ZA 1YF3A 2RK6A 5C5CA 2JGJA 3KB1A 2C2XA 2PVSA 2BMEA 1RC1A 4FJ1A 3UCXA 4OB7A 4RMGA 4E2WA 5F5LA 2GKSA 3ASVA 3OJWA 5BUZA 5CD1A 4EY5A 1HMPA 1HT1E 3O8RA 4XYEA 2HNKA 2Q41A 2VJYA 3I05A 2X3UA 1W76A 4IY1A 5AH0A 4J2HA 4JN6B 2C8LA 3CX6A 4IZOA 1A9ZA 2UVDA 1SHUX 2CUNA 2YNMA 1LI5A 4K81B 2G80A 2FHPA 4ATNA 1FU4A 1N92A 2B37A 1QOQB 4RAOA 1ZJ5A 1LGYA 1XCJA 2XMRA 3IEIA 3L4BA 5LB2A 4B3GA 1PJZA 4MLZA 2C04A 4HRAA 2R66A 1WHTA 2GFIA 1TYEB 4JJAA 1RQNA 1Q2UA 5D5QA 2GTIA 4Z0HO 3EXHC 3U4CA 2RHBA 4ZQFA 1UT8A 1K8QA 4LQDA 2EYUA 5D1HA 2Y93A 3ZGOA 4U2EA 4YT2A 4KQ6A 1J0CA 2UXBB 1LZLA 2OFXA 4B0OA 2YZNA 5DM60 4HGNA 5GZ6A 2GJ4A 3E82A 2CHVA 3TTWA 4WKNA 2QZJA 3N07A 4F6RA 3BWBA 2IXDA 1PK8A 2W6JA 2VP5A 2XQJA 1GUAA 4LC9A 5JSYA 5TNXA 4UHBA 2AG5A 3CUYA 3LW8A 1IWOA 1YULA 1MX9A 1A7JA 4JQSA 3TN7A 4PYKA 3VSEA 4LGMA 2YJ5A 4ABYA 1WRBA 4CT0A 2C31A 2BTEA 1BSVA 4Q1VA 5FI0B 3UJ8A 3GCGA 4X5OA 2EBHX 5IKPA 1BO6A 3MJRA 1ZOOA 1VC2A 3AEXA 1AXRA 3TD2A 2F17A 3CZPA 3IQEA 1AKTA 2DFPA 1A9RA 1ESMA 1A71A 1PQUA 3M49A 3IPYA 5BUQA 5FFFA 3K4QA 4NFYA 4QWWA 4N5DA 4HAZA 3S7ZA 2BKUA 3V42A 3JZIA 3QFHA 4F4HA 3TJMA 3I01A 4L0DA 1GZDA 2NZ2A 4LY3A 2J67A 3H5RA 4C7OA 2NU9B 4ZVSA 3R7DA 2HN9A 3WNQA 2CNWD 1KI4A 5JOQA 1K68A 1KC1A 3OQBA 1N9GB 2TRSB 4NZZA 4EH1A 1QV7A 2C2BA 3BMNB 3EOAI 3I9LA 5DBGA 2B35A 5F1PA 2CLLB 1I2AA 2XUIA 3KB2A 1RAIA 1EDZA 1IBSA 4Y6PA 2X7HA 1U9ZA 3FPJA 4G4SO 1KTIA 2VZ0A 3KSMA 4GUDA 2FFQA 5U4QA 3CX4A 2Q28A 1LDNA 1T29A 3WV4A 1NM5C 2OC9A 4M22A 3RT7A 4AZVA 1KFKB 4RMIA 1JKFA 3JRXA 2H5IA 1EU1A 4IOLA 4DS3A 5JEDA 3FUXA 1U8XX 2BRUC 1U6JA 1XKQA 3EXIB 3M82A 3A6EA 5CVEA 2XTAA 3QLJA 1MHTA 1TAUA 2JGRA 3E9QA 2P9CA 4J3JA 4HSEA 4Q1EA 2AVNA 4U39A 4BO2A 4M99A 1WQ1R 1BYIA 1PJ3A 1M8PA 2XGMA 1MDBA 4TKUB 4RKQA 3SG0A 2I34A 4C5AA 1ISSA 4C2BA 1IBRA 4DZZA 1GU0A 4IHQA 1DAFA 4FSXA 2ID4A 1GCUA 3BH0A 2G9QA 3W9SA 4G36A 3THSA 5KTKA 1KDTA 1BJKA 4LHXA 1G7SA 3V4OA 1JAYA 2WJ3A 3EFOA 4PQGA 3NAMA 1RW4A 6CHYA 1AURA 1CWUA 5EIOA 2BMJA 2R00C 1AD2A 1D4OA 1JXQA 2W2LA 4IKOA 4RWEA 5AW7A 1UC5B 2WNIA 4ASUD 2E18A 4YJ2F 1Y3AA 1MORA 4LBYA 2D5BA 2DPHA 5BN3B 5JATA 3DG9A 5KNCA 2C9OA 3ASUA 3WJAA 3GP5A 3WGQA 2FUKA 2I1QA 2WIGA 3NEJA 5DI9A 4YRMA 1SVIA 1MDFA 4DR4B 1COWD 3EA0A 3BF7A 3FTCA 4G1VA 2C00A 4URUR 2PX4A 5K3CA 5LB4A 2ZTSA 3OOHA 1LPPA 4PIVA 3T12A 3V9AA 3LP8A 4X45A 5JJIA 2JRCA 3H86A 4JLPA 2ZIWB 5BPHA 1QHGA 2BTOA 3NHKA 2ON6A 4FCTA 1TK3A 3PEUA 4U02A 5C5EA 1NW6A 1EHIA 2VHZA 2X0KA 1SCUA 2CDCA 3UUGA 3C3EA 1C3JA 2RK3A 3CWZA 4D3SA 2KSQA 1OU4A 1OTXA 5JXHA 1RKXA 5AICA 4ZFNA 4J29A 1VA5A 2DP4E 2GO1A 2GK7A 1FPQA 3GJSA 3NHRA 3OLCX 4UXHA 5KQGA 1U9CA 1L7DA 2A7QA 2DJIA 3DEFA 4RLFA 5ALNA 4JI8B 3O31A 2ZWAA 5K0NA 3TO5A 3EODA 1PX0A 2XOKD 4CIXA 1YA6A 3ZIAD 1P0FA 3AEQA 2YVAA 4M49A 4NMLA 1PFYA 3K15A 4R8VA 4WTOA 3VGJA 3W04A 3GLGA 2XQKA 4IGEA 1ZI6A 1M3SA 3MJ4A 1SUAA 4BQRA 2OBLA 2OEPA 3G13A 4ME6A 3AY0A 5JSKA 5IZCC 4ZOLB 3O8QB 4BBPA