2VJPA

Formyl-coa transferase mutant variant w48f
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGFLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGDSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential Substrate Specificity and Kinetic Behavior of Escherichia Coli Yfdw and Oxalobacter Formigenes Formyl Coenzyme a Transferase.
pubmed doi rcsb
source organism Oxalobacter formigenes
molecule tags Transferase
molecule keywords FORMYL-COENZYME A TRANSFERASE
total genus 143
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 2vjpA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 2vjpA01
1T4CA 1T3ZA 2VJOA 1Q6YA 2VJMA 2YIMA 2VJNA 1XA4A 2GCIA 2GCEA 1XVTA 2VJMB 1P5RA 1X74A 2GD2A 1Q7EA 1PQYA 2VJKA 1T4CB 1VGQA 1XA3A 2VJQA 3UBMA 2GD0A 1PT8A 1XVUA 2VJLA 1P5HA 1PT7A 2GD6A 2VJPA 1XK6A 4HL6A 1VGRA 1XK7A 2G04A 1PT5A 4ED9A 1XVVA
chains in the Genus database with same CATH superfamily
1NZJA 3E22B 1T3ZA 1PJLA 1U9YA 3NHZA 4DHWA 1DHTA 3IUQA 5LMCA 1I0IA 3D6MA 3LQKA 2PN1A 3K32A 2MINA 1RXUA 1SOUA 2Y6VA 3F3YA 4Q16A 5JRZA 1EVYA 2QN3A 2V7UA 2JIZA 2QXYA 3HZRA 4LBYA 4ZVUA 3CY6A 2DJIA 4AMGA 3RFFA 5HE9A 1E3EA 1R6VA 1U1IA 2WDZA 5IKXA 1T3TA 5IVDA 3BUSA 4MJ3A 4IEFB 3CVWA 4HQNA 5B6PA 4PYJA 1RTKA 5F7ZA 2V0NA 3W5VA 1F6DA 2AX3A 5AOAA 4D0RA 4IIDA 4M1OA 1UBFA 4QYSA 4HRVA 4TM7A 3I2HA 4KEAA 3E4CA 1UWVA 4R3UC 1YQQA 3A1WA 4EPYA 4X7MA 1WB9A 2DFNA 4FXPA 4BGDA 1IBKB 3E9YA 1X3SA 4MLCA 3I3SR 5CYPA 1DCTA 5E6SB 1FDWA 2NV6A 2PCLA 3ADPA 2I4TA 3IMGA 3OC0A 1ZESA 2HQOA 4QHTA 1GPKA 4ACBA 4E5PA 1RNLA 1ZUHA 3IVGA 3DXFA 1TQ8A 1X9GA 4U3JB 3TLCA 4PGHA 3WBFA 3PFKA 3ZXXA 2JGJA 1AX9A 2BKLA 4CEJB 4FNOA 3JD4A 3ETHA 1FP4B 2CJYA 3K35A 4URWR 1G20B 5KWSA 1S4MA 2I7DA 4HWOA 1G41A 3T3OA 4DJTA 2Y1FA 1AKNA 2I7CA 1KK3A 4ZI7F 4KNYA 2XJ4A 4Q18A 4IEEA 1K2VN 3I30X 4D57A 5C4MA 3B2NA 5JNTA 2OO5A 4Q4JA 3AVQA 4NNPA 4O63O 1NKSA 4E09A 1ZSNA 1AD2A 1PZGA 1Q6YA 2CE2X 3DMTA 3G8CA 4QPPA 3V8RA 3L6UA 5IVHA 1NIJA 4M89A 1EQAA 3ZE7A 5B37A 5LOVF 4MRMB 4OHUA 4R2KA 1BCRB 1JHXA 1Z4IA 4ZOQI 4FWTA 3ZHZA 3TB6A 2VRCD 5LQDA 1WIWA 5HKKA 3WYGA 1KOFA 4ARZB 1CKEA 1NAIA 3MTGA 1VG1A 1Z6XA 4OF4A 2HU2A 4DC0A 1HXHA 4B9AA 4JL6A 2WW8A 2NXWA 3TVTA 1UZUA 3NRCA 3MAJA 3MCTA 2A1UB 4WVLA 4AXBA 2YWHA 2A0WA 4L74A 5D3ZA 3SSOA 4AZ3B 5JWRA 2AX4A 5D87A 1D03A 2G9VA 1WV1A 5EQTA 1G8SA 2YXBA 1K3FA 2PFGA 4B3FX 3IE1A 2O2YA 5FAXA 2UZ3A 2RGNC 2D1FA 2EVWX 4GU5A 2R5NA 1HYBA 3ZDCA 1N8TA 3TOSA 5ALVA 1LLQA 1O3YA 1HRDA 2DPHA 2HPZA 3O3NB 3QPUA 2VF5X 3G5LA 4YGYA 1TUBB 1NASA 2WWTA 4RTPA 2DULA 1BVRA 2DU8A 4BVAA 5AM1A 2NT3A 3LYAA 2AF3C 3RFXA 1Q0SA 1TZCA 1B93A 2VDUE 4QTZA 4QKQA 1N77A 1FTQA 2VAVA 1G1AA 2VP4A 4ZI7B 1JG4A 1Q1NA 3L8CA 4HY3A 5BT8A 1P3DA 1W75A 4ZYXA 1XX6A 3PGKA 4XSVA 5BQOA 4F3KA 2ONCA 4W7SA 3QF4B 1YL6A 2J9XB 1LSSA 1EVLA 2IHVA 4X1YA 5E38A 5CCEA 5DI3B 5K0FA 5IBRA 1VRWA 4ZK2A 1TAHA 2P4EA 4U02A 2C82A 2R7KA 3PHLA 3VNVA 1OIWA 2YJZA 4C2UA 5EWJB 3K8QA 3MUFA 3KSBC 3FNBA 2HIGA 1JKIA 4YLEA 2X9VA 3KXPA 4OQMA 4AP5A 4YEDA 3SYLA 3W5JA 4I1IA 1JFSA 1W9HA 3HEBA 5DN9A 1CDOA 1L9KA 2VRCA 3HU2A 1AC5A 2ONKA 3AFHA 5DHSA 2YQ5A 1ZINA 4IDQA 5IDWA 1A9ZA 1QO0D 2JFFA 3DUFA 1AUQA 4Q3LA 3HN2A 4ZYTA 5B3JC 2LR0A 4CTJA 1JNYA 4CM4B 2F59A 3P4YA 1UP4A 3DVSX 2WD7B 1CVLA 3F3MA 4YCSA 4BNDA 1LQTA 2QG6A 2RJOA 3EIHA 1SMKA 3OIYA 2BR5A 5DGDA 3TDKA 2ZJ5A 5A04A 2ORIA 1N5JA 2PSDA 2Y8EA 1MIOA 5LB4A 5HKAA 2W6IA 5LD2C 1XWWA 2Z3WA 2FF7A 3PRKE 3IOYA 3CZRA 4A03A 5LNK6 5LR6A 5HNKA 2GM3A 2OGTA 4NARA 2Q5LA 1VCNA 1U3UA 2P9QA 4H7PA 4IQ4A 1ZOIA 2LIPA 1IG3A 6YASA 5EJFA 1DNPA 2E21A 4EEKA 3MK31 3NAMA 1N7IA 4D4MA 2COKA 1VDMA 3OZGA 1Z8FA 1X7ZA 3VR6H 4AY4A 4BFYA 4NL4H 4BLRA 4X91A 1FL9A 5AM2A 5LU9A 2I78A 3KSZO 3P1JA 3KEOA 5K0EA 5GINE 3OCWA 5ALRA 4FX2A 2H57A 5FUYA 1H9AA 3WL7A 4RW0A 1JTEA 1DQSA 3KEFA 3PX3A 1UDXA 2YWJA 2NWQA 2H7XA 4WWHA 1FLDA 2OFXA 4JB0A 3D7KA 4JB3A 5DHTA 3U1TA 2IYEA 5EXSA 2QRNA 5G3ZA 2X8LA 4UUAA 2ZS9A 5IW8A 3CMMA 3TZ6A 4S1VA 1XR3A 4BJ6A 1CE8B 4PRKA 3JS5A 2O8DB 1AUVA 3TMYA 4TSFA 3AL3A 3NAZA 3R0ZA 4MIKA 3I5UA 4C0AC 2B3TA 2NZXA 1W19A 4MS1B 4M49A 3A6EA 4KYTA 2R2GA 2YQZA 4BL5A 3I9NA 3JATA 2HMTA 1DTEA 1T4GA 3HYLA 4KIWA 3IUNA 4MQFB 3KBBA 4GSYA 4QICA 4MS3B 3ZE8A 4B6QA 4W6QA 1DBSA 1JLKA 2E7ZA 3U3OA 1SBQA 4Y2HA 3N3AC 1OJLA 4HUQB 3TQQA 5ABPA 4AN4A 5CLJA 4H15A 7GPBA 4EUSA 3A6HA 1XD2A 4I36A 4JJ6A 1CFZA 2AHOA 4KE6A 2JJYA 2OWEA 1E1QD 5B64A 1FYWA 2CXPA 4J7UA 3C87A 4PO9A 1ZSVA 4YTEA 3TDNA 1I6LA 3AINA 3D6UA 4RPIA 1A3CA 1OA1A 3SQWA 4YA6A 4U3JA 2XF8A 4QDOA 2BAGA 1RJFA 3Q9UA 4TSRA 2I66A 1EX1A 3SJAA 4BP3A 2PUBA 2VJPA 5ICMA 2ENWA 3IHLA 2P3OA 5ED0A 1TQHA 2RK3A 2B4QA 2LIVA 3H65A 1VPTA 1WHSA 3DMPA 4FDLA 5CVDA 1QHHA 1SG0A 2ZUSA 3QPDA 4GNRA 4H27A 5HFJA 2P7HA 3BT7A 3PYXA 4GBJA 5C35A 5DCLA 4L0CA 1G8HA 5LQNA 1S2IA 2F8SA 1O94D 1WM1A 3O8QA 4MP6A 3S1AA 1DT5A 5JR3A 4DLZA 2R8ZA 1E7QA 2FP4A 2GD1O 5LD2B 1K9VF 5BV7A 3PD7A 5JUWA 3K05A 1AGXA 3BMOB 2GD2A 1KMHB 2H16A 5DSTA 5ER6A 3TW0A 4N12A 5B1YA 1CUVA 5EUQB 3IESA 1GTMA 2PKXA 3B1XA 1LPPA 4CN8A 1E6MA 3U6KA 4OU5A 3EEFA 1OU0A 5HJ2A 1KRXA 2R6AA 2JJ8A 4JP3A 3KDAA 4GYYA 2H2IA 4LZZA 4Y2PA 3RVDA 2IEBA 3FLMA 5EMHA 4G8DA 4ZP1A 3VR1A 3ZDAA 1WSAA 2WD8A 1ISSA 3FPAA 2KJQA 1YZKA 3KWMA 1VHQA 3KQYA 1RXWA 1TQDA 4WLVA 4XVCA 2IJGX 3S2ZA 2OCLA 3ZCRA 4B83A 2CKDA 4K6FA 4C89A 5AVKA 2IU4A 3BRWA 5DE3A 1XNJA 3PLRA 1WXQA 3LVQE 1YF3A 1H0SA 2ZSUA 1HKHA 1SJ9A 4PEVA 4L4YA 4QQFA 3DL4A 2NTNA 4QGHA 1ZLYA 4JKIA 1R64A 4MV1A 1FFYA 1UZLA 2DR3A 2NLOA 3JX9A 3NX4A 4NHEA 2PAFA 3ZWCA 4AMYA 1MZPA 2HTEA 1UXOA 2B5WA 4FGLA 4YAFA 4DCOA 3MOIA 2FGJA 2JFUA 5B3KA 2O19A 4HLUC 1KFCB 1J49A 4H7IA 2FEWB 1ZQ1A 2VSOA 3I8SA 3KVYA 2VHJA 2FPPA 4BMDA 1XEFA 3EF1A 3L84A 3V7WA 1ULSA 3E84A 4J0CA 1U9CA 1Q0LA 2I55A 3C16C 3JASA 3LYUA 4UVDA 1YE5A 1T2EA 2X42A 3IULA 2M1XA 3QWBA 4L2IA 4MQMA 4KXMA 2VAMA 2YCBA 3HSSA 1VB5A 3IJPA 4V3CA 5AI9A 3VU9B 4HLUA 4DR2B 3GJQA 2Z98A 3KT8A 3W6PA 4EJ6A 3BHNA 4DQXA 7REQB 1E6LA 1NM5C 5A3SA 3VNRA 1GR1A 1RPJA 4BQEA 4WLOA 5BNIA 1E9DA 5C5IA 4J0IA 5AK3A 3N86A 4ZCPA 4G5XA 1K5HA 1NT2A 3KCNA 4DA0A 5A3QA 1AT1A 1YZFA 2RE8A 4NYJR 1FDVA 2R9VA 4YX9A 5BN1A 4REMA 2FEKA 1XTRA 1X1TA 3D02A 1E2HA 3Q7TA 3TTUA 1TX4B 1EVZA 2CHVA 3SXJA 1WOMA 3NR2A 3OCZA 1VGVA 3CT4A 2CY0A 4JBLA 1SQGA 2J7PD 3C5WP 4DW8A 2QI9C 3VVMA 2YFHA 1XD9A 2JIOA 2Z56A 4CLHA 4EKIA 1N2EA 4MV9A 2Z95A 4EDFA 2X9NA 3C7TA 5NLLA 2JI9A 1YVRA 4DV4B 2F9LA 3EZ2A 3IS3A 4ZV9A 1NBOA 1OXXK 3FPFA 4BKPA 2EZ8A 1N2SA 3WFIA 4IXTA 4QPZA 4YIHA 1VSBA 2ETVA 1JQAA 4LBVA 1SWVA 2GHQA 3KLBA 4X84A 3RABA 1GPLA 2FPUA 2IYSA 4N5LA 4KO2S 4FEYA 4PQGA 3F6YA 1NNI1 1VZ2A 2Y4OA 3TUJC 4FZVA 1YKGA 1Y9DA 4CLRA 3QPVA 3H0CA 5AVSA 4DN6A 2WUVA 3ZI4A 1NOJA 2W8ZA 3E3NA 2BR3A 3L0CA 4JBYA 4PHCA 3HWWA 3I04M 5CTAA 5ALKA 3C70A 4Q3CA 2ZUWA 4UD6A 4G0ZA 5CHYA 3K70C 3LZDA 2XW6A 3F9CA 1VCIA 3Q10A 1CJCA 1EXMA 3A37A 3KQPA 1Q0RA 3PUHA 3F0TA 3SVTA 2H59A 5GONA 1J1UA 2MMCA 3JWJA 3OZTA 1CXZA 1HWYA 4D8TA 4N03A 1P7ZA 1V6CA 2AQIA 4UOEA 3I2FA 2P67A 1WB5A 3D6FA 2ATIA 3UWDA 3V4OA 4GDFA 4EJSC 3IVMA 1NIPA 4US2R 3JAWA 3GAAA 4ADSG 4CL0A 4BVFA 4DR4B 2PUCA 2Q2QA 3ORRA 2A5FA 2P0YA 2P8SA 2GA9A 2LWIA 3QUCA 4FYVA 4KSBA 4H77A 1H2FA 3UANA 4C88A 1ECFA 2IYPA 2XCOA 3A4LA 3CPSA 3LOPA 4BB5A 4QSMA 3FYUB 3U1BA 1EBFA 4HPJB 1IBRA 1IZ9A 1NKTA 1ULBA 3R0QA 3EJ6A 5AXBA 3C43A 1IUNA 4M76B 4PO1A 1HE1C 2C2YA 5KOHB 3NASA 2W6PA 2H18A 3E3AA 4G5FA 4W63A 3DHYA 3ZNNA 5JCZA 3GPBA 3LFUA 1ZJZA 4AY3A 5AVTA 5H5JA 2X0JA 4L27A 3IA7A 4MO2A 5DNYB 1DCKA 2HA4A 1VHDA 2QMYA 3PGXA 4DF3A 1XWFA 4HKTA 2LCQA 1Z17A 2XXJA 2G8LA 4HXGA 4LIPD 1S2NA 1PR0A 1E94E 5LDGA 4RTSA 2Z6UA 2ZE6A 1G19A 3EZYA 3G8AA 4R31A 4Q9IA 1YR9A 4R9NA 4H7HA 1JHRA 3TM4A 3W9SA 5KYNA 3AHEA 1Z33A 1ZH4A 2BOVA 3WYBA 1EX9A 1U2DC 3EVTA 4BV9A 3PS9A 5AVYA 1O7JA 1WABA 3FZEA 1YBFA 4DMGA 4KNVA 3MYRA 4RTJA 4BGUA 4C4RA 1BXGA 1DG3A 1ZUWA 3DD1A 4JU8A 2AYXA 3EVGA 4CL3A 2FPKA 1BDBA 3WYAA 5EMNA 4LZPA 1K7XB 1AGNA 2VPXA 4YFYA 3HB4X 4K9KA 3RSOA 3U7QA 2HUPA 2GQ0A 4MDFA 1MJGA 2C20A 2W6OA 3LMKA 1AXGA 1UMCA 4P4NA 4QVIA 1Z68A 4O2BA 3UPTA 1ISPA 1JUDA 1YMUA 2VEOA 3IQWA 1M9NA 2OSBA 3OPQA 1ZWLA 1VCMA 3H75A 3P2OA 4KB5A 2PV0A 3GC6A 3V1NA 1FTSA 2QGNA 2OQIA 2XMZA 3H1FA 3K53A 4KPUB 1VBKA 4Q15A 1KZHA 3VTZA 3W3AA 4QM6A 4QELA 2Q5FA 2B0JA 3FDIA 5JCOA 3A4IA 1P6XA 2HV8A 1UADA 4CW7A 3KEQA 1TW2A 3OCCA 1ZC4A 4Z9YA 5BRJA 4QUHA 4AWXA 5KNDD 3OHSX 5LXTB 3IOBA 2WSBA 3G9ZA 3S27A 2QTAA 4RHTA 1UZMA 2R6ZA 4TKLA 4IHJA 1P7VA 2J9ZB 3IGFA 3ZNQA 1GRVA 4MDEA 2O2XA 2Z58A 3R6WA 1CVIA 2C2ZA 2P4HX 5LNK1 3A6PC 4XI9A 4O3FA 1Z7BA 4D4LA 5LKRA 5D5HA 5JFGA 2G5PA 2I5PO 2QZPA 3KQOA 1DO8A 4QA9A 4RMHA 1RRVA 4ZOEA 5TT0A 3TOCA 3MMPA 4P53A 2OK8A 1M0WA 3TFWA 4B73A 3S1SA 1NZDA 3QBEA 5IMBA 2IXEA 2KI5A 4R2LA 4TXHA 3DCIA 4RXMA 4RA9A 2OE2A 1CRLA 4WV3A 4Z4HA 3EQ6A 3D0KA 1ISFA 1TCBA 2O2DA 1T4CA 3FR8A 3HCCA 1I36A 4IDCA 2QP3A 3ENKA 3ND8A 3TEFA 1LDYA 1K8YB 3GVHA 3OD1A 5EZ6B 3UWPA 2NZ8A 4DC1A 4EYGA 3V34A 3TINA 5LU8A 1QH8B 1JT9A 2VXBA 1G7TA 1YULA 4PS1A 1I3NA 2XDWA 2XMQA 3AEUA 3QLVC 5DNAA 4ZJYA 3DOEA 1DGQA 4ID3A 1GNQA 4QUAA 4GPTA 3VR4A 2H9YA 2G1UA 4X7PA 2VYQA 2V4ZA 6NULA 4A3SA 1M7GA 5KWVA 5JJKA 3A4TA 4IG9A 1G8PA 2PXHA 1U8UA 4FFRA 4EK9A 4K87A 2W2XA 2I71A 3EWAA 4DWVA 4Y9UA 3HE3A 1CS0B 3GT3A 1J2TA 3N2YA 4YJGB 4P3NA 1FRZA 3BGIA 4KXUA 1XPJA 2IEZA 2CXHA 2BM8A 4PG7A 1UPBA 1KYIA 3ISJA 3M6VA 4N49A 2G1JA 5LZ7A 3A6GA 3GLHA 2FAXA 5A9RA 1VI6A 5EQFA 4OXIA 1RWPA 4WJKB 4WFKA 4L8GA 4X54A 3UK1A 2QUJA 3ZBTA 1DADA 4L08A 4PPGA 4D44A 5KHLB 1LRKA 1SUEA 3ETLA 4FW9A 2EW1A 3Q8KA 2GSDA 4JJ4A 5KVVA 2D4HA 2RHGB 4WK6A 3ZDYB 4L0MA 4OKSA 3QK7A 3UF0A 1L1QA 1Y63A 1Q50A 3TNFA 3HQ4O 3O1LA 2BBWA 1GKUB 2H1CA 3E9DA 1TYZA 3NNNA 3QXSA 721PA 1EE1A 1O94A 3IMEA 3PRHA 1AUOA 2ZB3A 3RRXA 4UTPA 1SOAA 2JGLA 1UINA 1M54A 2DJ5A 2JGFA 4CV1A 1WF3A 4JNCA 4XWGA 2EX4A 1OW3B 1PSDA 3SICE 3VHXA 4W9NA 3LOQA 3FZQA 3L7AA 3TTTA 2SNIE 1WDTA 2YV1A 1K68A 4Q3BA 3K1JA 4I7EA 3ST7A 3N0VA 4F06A 4UVIA 1GT6A 3U4HA 1XTVA 4X20B 1U8XX 2H0AA 3EQ2A 1ZS9A 1HORA 3GEBA 1TM4E 4H1VA 3ZQ6A 4DVJA 4AQ7A 1XHLA 5DCUA 3WXMA 4DSNA 1XLVA 4E2ZA 2JFNA 1ZISA 1E3WA 1GGHA 5IZ4A 2PBRA 1CPYA 5A2QA 3FLEA 3GP3A 4A0QA 1ISMA 5L51A 5F2NA 2D3TA 1PGQA 5T3UA 5KTMA 1ZOLA 3QKIA 3AJDA 4KUEA 4ENSA 2NUPB 2KHZA 2YH2A 3NLLA 3ZWAA 5HM6A 4OCZA 2O05A 3FBTA 3SHTA 5K8JB 2IPAB 1QE0A 2H3HA 4C0SA 1DQRA 1TJPB 3F7MA 1TUGA 1Z29A 3NETA 5C80A 1GR0A 4NWIA 4JKYA 5TDHA 3KV1A 3H7AA 1BEUB 4AWBA 1O5IA 5AM3A 3SYTA 5CDYA 5AR1A 1IEWA 2IRWA 3QU4A 5IABA 5H82A 1LI4A 2GN1A 4ZCLA 3EDOA 4F04A 1NDUA 4RTQA 2GEFA 5D3MA 1NLZA 1MJNA 2FP4B 1WW8A 3BCSA 2OHXA 3RF6A 1V71A 3AFOA 2F9FA 3JRNA 1NF2A 3TLMA 1Q20A 5CPBA 3BA1A 1SHLA 2HB6A 3R5KA 2C5BA 3BICA 4NEQA 1WJGA 4HZIA 3MTJA 2JHGA 4PZ9A 3B48A 4MNTA 5A7FA 4JYPA 3EPHA 1OLOA 1G6Q1 4TYYA 4POAA 4UXHA 5IC4A 4ZHSA 4TVOA 4I55A 1RAIA 1U3VA 2V7XA 1GGNA 2ZRPA 4MYHA 2NU8B 3AXTA 4B74A 4OK3A 5DN6A 5A02A 3ANNA 2XZLA 1XSEA 1AQYA 2ZRIA 3HI4A 1JIUA 4YCLA 1R2QA 1AGYA 5DIZA 4AW9A 4XVUA 1OGYA 4A1OA 8MHTA 3E81A 2C5AA 3RS9A 4O2AB 4L6IA 4LZJA 4MR7A 2O52A 4FOSA 4ENQA 3RB8A 3KTOA 2Z1NA 1EP3B 4M21A 4DM4A 4G56A 5H16A 4ZDJA 4QFCA 4MWOA 1JQBA 5DWDA 3ETDA 5J9FA 4ETIA 3G9QA 3HTXA 1WQ3A 1E1CB 4N5HX 1YTUA 3TS1A 1EYZA 3MJSA 4GVXA 1U6KA 4EO9A 1QTRA 4E07A 3MCAA 1W5BA 4M87A 3LBNA 1UL1X 2JA1A 3VOBA 1B42A 4YBZA 4EPXA 4LOLA 3VU8A 6CHYA 1GZSA 3GLIE 4DUZB 2PWPA 1V5IA 1MR3F 4WAUA 2Y93A 1TD1A 1MEJA 1TAQA 1MF7A 2DUMA 2HRZA 2XNSA 2B1QA 1ICEA 2B8TA 3T99A 2QN2A 1TM2A 1KK1A 3LDGA 3LF2A 4RIHA 4UUQA 3ZCTA 3L07A 1SVSA 2NQTA 1UZAA 2IE8A 1B76A 3ZDZB 2DVMA 3DBLA 3WIOA 4ROSA 3U7FB 1L6IA 4XH9B 1WNFA 4DY4A 3SQXA 1UK7A 1OAOA 1PHRA 5K8VA 2X4DA 3PXBA 4GKBA 5CJPA 1GCAA 2VK2A 4MRAA 3FETA 4K26A 4EFMA 4WXRA 1ESDA 2X8JB 3T9AA 4BX0A 1KWKA 3TUZC 4OGWA 1OV4A 4DV1B 3AG5A 1XG5A 3IUSA 2UYGA 4DA7A 1XA0A 3B82A 2A7QA 3BZWA 3HGQA 3FUVA 2ZI7A 3D2LA 3Q7SA 3WDMA 2O50A 3DWGA 4ENWA 4Z1MA 1A8PA 3UMCA 4Q4CA 3R7FA 1BW9B 1MPXA 3Q3CA 4K1XA 3ROEA 4XM0A 1SHTX 1V5WA 4L3WA 4DILA 1RR6A 4J90A 3V4PB 2C9CA 3LUCA 3MYYA 2FWIA 3WO0A 1CQXA 2H0RA 3A25A 3H2SA 4I5DA 1T9GR 3T8YA 3FOWA 5AVOA 3WHIA 2DWOA 1P5JA 2BI7A 3KXLA 4X9XA 2W71A 5F51A 1XZJA 3I76A 4OQEA 1E3DA 1MZVA 1NLUA 3H3FA 2C1ZA 4JQSA 4W5WA 3IVAA 4FN4A 1UMCB 4Y18A 3T5BA 3HCBA 4AWAA 1GXSA 2WJ6A 4G26A 3BD9A 5IJZA 3TR0A 3JWGA 1LQ2A 1Z07A 2HLDD 2G40A 4L72A 1KI8A 5FO1A 3QOFA 4ZVPA 4XPIB 1ESMA 3ZWWA 4Q39A 3WLMA 8LDHA 4R84A 4LF7B 1XK6A 2XZTA 2Y67A 4DS3A 1XJ0A 4U2FA 3SS9X 3PICA 2I6FA 3AI2A 4CL8A 4DJAA 5JMWA 1UJCA 4RM3A 5K3FA 4H7FA 3M6FA 4MLDA 2WSYB 2ZU6A 3R23A 1OWOA 1VKZA 5F77A 4IIFA 4BPBA 1RZVA 3ZUGA 4XUCA 3LQ2A 1AQLA 1ZXLA 4L5YA 1TFRA 4BXOB 1BVHA 1QGOA 4YROA 2PS9A 1P5ZB 4KUHA 5IU6A 1MOPA 3OWXA 1H8HA 2C9YA 1KO8A 3BORA 3D6AA 3WNBA 2VO1A 4URFA 2QE7D 4YJ3B 1NHGA 4BLWA 3GFRA 4O33A 3LT2A 1Q1BA 1GGVA 2YHAA 2YFYA 1WUJS 2WSIA 4Q3OA 3CSUA 1I9CA 3K9FC 5AW2A 3H5IA 2IT1A 5CDTA 4E51A 2E48A 4DM7A 1V8OA 1NPYA 3FHCB 4NU6A 2IUSA 2FPOA 1SC6A 3ESDA 4QBGB 4JCCA 5D5QA 3WGOA 3AY6A 1A5ZA 1TA9A 3BWBA 3BXZA 2I2BA 4MTCA 1P80A 4WNIA 1BA2A 4FHEA 5LM3A 2OCAA 4JUFA 1IH8A 2X5KO 3Q2OA 2O1EA 2FSVC 4MPTA 2I2FA 4BO7A 2CN1A 2C8KA 3O2JA 4QASA 2RHMA 4MQFA 1DCMA 1ZMOA 4BHTA 4C20A 4XGKA 1SBYA 4E6PA 3T0IA 1QHNA 5LXTF 5EKSA 1PK8A 2OXEA 1WXHA 3KDSE 3BE5A 4IF4A 3PKIA 1OFIA 2ANCA 5F1OA 5C46F 4AJPA 1LBSA 2NZWA 4UTNA 1L5OA 1UBNA 5D00A 1WL8A 4QPJC 1ZI6A 3SR0A 3L7BA 1KE1A 3TSOA 4D98A 2HLDA 1VLHA 2GMWA 1E2IA 1OTYA 1O97C 4CXMA 4GQAA 4ZODA 3RUHA 4N8SA 3K15A 5BMOA 2FLWA 1JIXA 5HUQA 3L7CA 3H17A 4P58A 2DBYA 2O2ZA 2OHIA 2YY5A 4IOKA 2ISCA 5GM1A 4UU7A 1S8OA 1CEQA 3OT1B 1QHIA 3LAWA 2JCGA 3VSCA 1DOHA 2FMKA 5JJLA 3ZLTA 1BGVA 3UV3A 1KYVA 1N2ZA 1M6YA 3CURA 4DIEA 5C7YA 2FSFA 3RYCB 2QBYB 1MA3A 1KXJA 2HXYA 3K1TA 4MPPA 5KNDH 1T5IA 2B1IA 3PWZA 4FCCA 1UOPA 3EVBA 2E3JA 3ZLVA 5JXJA 2ZUUA 3OTIA 4IFBA 1W4RA 2ZG6A 3G8BA 3KJQA 2ET6A 3C74A 1WP4A 1Z7GA 4AZSA 3U0BA 3KXIA 3HEMA 1SVWA 2XGJA 3KHKA 4TKVB 4B32A 5AVUA 1FRQA 4GGMX 3PDHA 1EUCB 1KZYC 3AHCA 4GFDA 3IVXA 3T9DA 4KR0A 2WSLA 3IAAA 3F73A 3CH7A 1ND5A 1JDSA 5AK4A 2BM9A 3USZA 5ESXA 3BK1A 4TS1A 3GJ7A 1N2BA 1YHYA 4P38A 2VZ9A 5KKAA 3LBYA 3HCNA 5JMTA 1A4RA 3DWFA 4JX8A 4ZC1A 2A7XA 5C5CA 1MJHA 3SKYA 1YHNA 2HK7A 5TMPA 3WGVA 1GQRA 4NG4A 4LKOA 2WU8A 3FSGA 1UKAA 5JD3A 1YBMA 3GCWA 4QVKA 3GRYA 4F4UA 4NPHA 2PL1A 4BCBA 2HLNA 4DHEA 3G2OA 3QPCA 3PBKA 2EERA 2JAXA 2ZSKA 5BWBA 1QF6A 3AUXA 2Y0PA 2AEEA 2X0RA 3A9UA 3TIXB 3AWIA 1FFCA 5SY6A 4E4YA 1LSJA 3GNSA 3DT9A 2A5GA 2QX4A 3I34X 1XYGA 2EJCA 2P9GA 1K7YA 4LOJA 1G8JA 1BD3A 1P1CA 1Q2XA 2ERCA 1S02A 5LPNA 2PDAA 4IKPA 4JODA 3EC2A 2HN9A 5FBVB 1RPZA 1DIHA 4MQUA 3R3JA 3RVOA 1PGNA 1G5HA 1VKHA 4MEAA 1UXJA 3N2KA 1JPUA 2XOKD 3DE5X 3GDGA 3V2IA 4UNRA 2QAIA 3QE0A 4I5IA 1Y1RA 4JVNA 5IUKC 1XALA 2YZ2A 2I4RA 3U9LA 3BXFA 3I9V6 4HQRA 2QVYX 5KSOA 2AWNA 1QK3A 3K6KA 3OCYA 3G3EA 4EL5A 3VKHA 1TT5B 4PFJA 4Q48A 1H2WA 5G1NA 4EFLA 1NC3A 2OR3A 1CEXA 1I3OA 1NDQA 1RM0A 3SIPA 3EA5A 1WXIA 4UNQA 4F4JA 1KAHA 5BQ3A 3QYAA 4YRBA 3R3WA 1UP6A 4H3KB 5CGQB 4Q3AA 3A04A 3KQTA 1TYAE 4IGEA 4LXYA 1N8SA 3I3OA 1XZHA 3OE1A 3TVYA 2D6FA 3H8JA 2NUTA 1MAWA 1C8LA 3E7WA 4EB3A 1PF7E 4HAXA 3T06B 5JJIA 2HY7A 5I5GA 1VZ3A 2QWXA 4V0NA 3FCXA 2CHEA 2FX5A 4R8MA 4MRRA 3E9RA 2HOQA 1HYQA 1QP8A 4RTLA 3NYIA 1HDIA 2NOAA 1ORRA 3QU7A 3MTEA 1NUPA 2PUEA 3ADDA 3UBMA 4F6RB 1XYYA 3PQDA 3IKLA 3D1JA 5P8WA 1M10A 4IMPA 1TPYA 3VJLA 1EFPB 1KQ3A 5GADl 4QXAA 2VK1A 5CEEA 1FB5A 3H9JA 2I4IA 3DE3X 2WTUA 3MT8A 3ILXA 5DJ5A 2XUOA 2NSYA 3I52A 2PYDA 4KO4S 1R7RA 1HE3A 2FZWA 1J2JA 1K5GA 2ORWA 2PT7A 4EFNA 2JCYA 2P2GA 4EB6A 1XTBA 4Q21A 2B92A 4B76A 4OHYA 4DDKA 2YQ4A 2NTVA 3KD2A 2JH8A 2MHCA 1QFXA 2FFRA 2IZ6A 3CPJB 5JS1A 3LVRE 5A71A 1P0CA 2YMLA 5DBHX 1TFUA 3PVZA 5TC4A 1EBBA 3HVIA 2X1VA 5JCJA 2CNKA 3KVRA 4ESVA 1Z7EA 4C0QC 1NP6A 3KD3A 1QZ3A 3GA5A 1OXBB 1UK9A 3OSUA 1BU5A 4NAUA 1JWBB 1X1QA 1EJ6A 1USIA 3E4DA 1OB5A 1RTTA 3O2SB 1VTKA 1D1TA 4BU0A 4BEWA 3AVUA 3E9QA 3DTVB 3STXA 3G68A 3SYMA 2ROQA 3LUPA 5D86A 1GTL1 4L50A 4UTVA 3JWEA 3GW8A 1ZUIA 2JFZA 5B2FA 3TAUA 2NU9A 2DB3A 1SVLA 2MR6A 5IBQA 3ZI0A 4AC9A 1QVZA 1SUBA 1WR8A 4FYWA 4XD7A 5KVCA 2WYOA 2WF8A 4OQFA 4LZWA 4C30A 4D3SA 3DFKA 5ALHA 4A36A 3W2FA 4UEKA 2HBQA 4YBRA 1G6HA 3OM9A 4F4HA 1I01A 2RGGA 3HCEA 2H2WA 4MUIA 2R0QC 1GZ6A 5BN3B 4DOMA 2ZJOA 5KINB 5ALPA 1ONSA 3DLTA 2WNSA 5LLTA 1IM8A 5IAJA 2I6UA 5DSXA 1SNYA 3SFTA 2GCGA 2FWBA 3QU2A 1RAGA 2BIFA 1MB2A 3PXUA 4YRDA 4Z0TA 5BUSA 5IS2A 3W6ZA 2HW8A 3IAS6 5E6UB 2PMEA 1YQTA 1MDBA 5CT5A 2OLEA 1YZLA 3DCYA 3TTWA 3V8PA 3PIDA 3TTYA 4KODA 4J4BA 3FNHA 3K0AB 5BP7A 4O2BF 2XSZD 3AB7A 4RHYA 1XDSA 4U6NA 1FSZA 2C04A 4DQVA 3UHJA 4E5KA 3TFQA 1G98A 2DY1A 4LUCA 3BFJA 3BGDA 3DBVO 2K7FA 3NHRA 1VOTA 1P62B 3PUVA 4DDWA 4LF6B 2EX1A 2J07A 4UBJA 5IKMA 4JFAA 2BP7A 3A6LA 4LSMA 4P7GA 4D3FA 1OJ7A 1Q12A 3C8MA 4WZAB 4DBLE 1BTOA 3KXKA 2W22A 1NRWA 2HNBA 2VQDA 1C50A 2YXLA 2CK3A 2ZJ4A 3EIXA 3FUXA 3LZCA 4OLJA 3UMGA 3MT7A 3VKVA 5B7GA 2OZLB 4UNPA 5DYTA 3GG2A 3NBQA 5FB3A 1ECJA 2BMFA 3ANMA 2I8LA 3AX6A 4OIFA 5FRDA 4BNMA 4CKEA 4ETNA 2ES4A 3QVOA 4JI0B 4DR6B 2ADMA 4GM4A 3ED1A 4RY2A 3WQQA 4BIIA 4L4UA 4OBWA 3G5MA 4PG5A 4I99A 5BW8A 3OETA 3RARA 2DKFA 1A72A 1H2BA 3VM6A 3MCVA 1O8BA 1Z6ZA 3CB2A 3N0TA 2RH5A 3DJYA 1K4KA 1Z63A 5ECGC 2O3RA 2V6GA 3GGGA 2LVBA 6AT1A 2XCRB 4JXXA 3O0TA 2IYFA 4XTRA 3R5FA 5FTMA 3TW4A 2Z9DA 5I3CA 3KTAB 4PRZA 4IJKA 4IDDA 5KIAA 1WB6A 1VE6A 2P9FA 5GOTA 1BU8A 4X85A 2G28A 3UT0A 4EENA 1Y5IA 2W0MA 1PWZA 3F7TA 3UJ6A 2EFJA 2IX3A 4LVOA 1U1EA 3B3JA 4P4SB 1IM2A 1M2GA 3ABSB 5JW6A 4RGQA 4MV3A 5JPCA 4WA8A 2YZGA 1E3IA 2GN0A 3NHJA 5JZBA 1W49A 1CIJA 3BGOS 3COZA 3W90A 3GWGA 1AK2A 1QB8A 3FOBA 3UT5B 4ONEA 2WUGA 4NEGA 4QIHA 5L7WA 3ICWA 1TC1A 3CLRD 1C1XB 3QNMA 3RS3A 3INYA 4AXXA 4HJXA 2MT9A 3D5QA 2YVUA 2CNLA 2YWRA 4NLLA 5FHQA 3RI3A 3ZW7A 1F60A 3Q72A 1QKIA 3M89A 4PSDA 1QH1A 2OGUA 1TLFA 4WXHA 5BVHA 2QK4A 4RJ2A 1UXHA 3GUVA 4IWNA 1KI9A 1NVEA 3ITNA 2O1SA 4O4JB 4KI7A 3ADOA 5EJ7A 4CYMA 3DOHA 2ZKIA 3Q15C 2YWXA 3SFVA 4HDRB 3W1VA 1G7RA 2AOWA 5A1TA 1SIUA 2Z9BA 1UP7A 4NBNA 1QQBA 4TTTS 4FFLA 2CYAA 4HDMA 4U9UA 4B79A 4BB9A 1NONA 3V1TC 4IILA 3DL0A 1K92A 5EJMA 5DF1A 3MQFA 2BELA 5BV2P 2PJRA 1H5NA 4UJ5A 1GTG1 2A58A 1OX5A 4OXKA 3E0QA 5HG0A 3EQZA 2ADOA 3QFHA 5E9AA 1C3LA 3TOZA 1TTQB 2EGGA 3TDMA 2YVQA 1ZSYA 4OJTA 3OM0A 2FMHA 1KSFX 1L5FA 4AJIA 2BI8A 1L8AA 4IJWA 1U9IC 1KEVA 3H9UA 4WZZA 3MQ4A 3AKZA 2WHRA 1ZGCA 4YQEA 1NGSA 1XKTA 3OIFA 2OLKA 4FDAA 4YCAA 2FWJA 1MDFA 2EP8A 2RGXA 3L9XA 2WAOA 3IKTA 1Z4KA 1UDRA 1N2CB 5AW4A 3G0OA 2PLWA 3HR4A 2YMQA 3KB2A 4LX0A 1JPVA 2O7NA 2WG0A 2J59A 4IGIA 4M8LA 3KYIB 1V9SA 3CR7A 3A9TA 4BO8A 1EHCA 4OHBA 4LI3X 2CUZA 4XYMA 4PF1A 4WKOA 1DTSA 4EQ6A 4XVRA 5M34A 4K6GA 4PBRA 5FYQA 2AXQA 4BNIA 1M7HA 5F35A 4IY1A 5REQA 3DVAB 2WQ7A 2ZT8A 1VMKA 2LCFA 1U0EA 2BJWA 3MBIA 1ONBA 1JJVA 2QMQA 2VJDA 3I37X 1WEKA 3M6MD 5AIBA 1CTQA 1OROA 2HSZA 5KSYA 5AVQA 2JGAA 5AKJA 1J8DA 3G9UA 1W35A 4II7A 2LKDA 4ZXFA 2DQYA 3WWYA 2EJBA 5DP2A 1OREA 1JU3A 1PR3A 3EIWA 5ICCA 1CQIA 4R2IA 3LUDA 1I24A 3RVKA 3I5YA 1V35A 1P60A 2FZLA 1C2TA 3MGCA 4TLBA 1Z36A 2APJA 2C7GA 3MWDA 3QXXA 3ER6A 3SHOA 1W76A 4XM2A 4N7JA 2RK6A 2XRYA 3SU8A 3ZJYA 3EHEA 4GKAA 1XZGA 5BSUA 2AJDA 5BUQA 5IASA 3ASVA 3IAEA 2E4VA 2G4CA 2PGJA 4Z53A 1IPEA 2VHYA 3CX6A 8ATCA 4EECA 5HIAA 2V8OA 2D7JA 4LOAA 3T35A 2NXEA 3RHSA 2Y1LA 4PN3A 2GFHA 1MT3A 2SKDA 3EGOA 5A6SB 3PT5A 1GTRA 4BECA 3R1IA 2GCOB 4KN5A 1PFWA 1VPWA 1DQZA 1PTKA 1U2PA 2BH9A 4G63A 4Q6BA 5DRYA 2QMUA 2QMOA 4NYMQ 2XVMA 2PTGA 3W5DA 5BXYA 1ACJA 4IOJA 2VF7A 4LY3A 4EA8A 2WFLA 1JZQA 2H1HA 1JRLA 2VRNA 4EW3A 2JATA 4CF7A 4QD3A 4ZZ0A 5HZMA 4Y9DA 1KBQA 3O8OA 1WHSB 3LTNC 4E4TA 3V6LA 4MKZA 1Q1QA 3PTLA 4GM1A 4IMJB 2E4WA 1BOOA 1XB2A 2LE0A 3STUA 3R4CA 2M1ZA 4HPXB 1ZU5A 4DQ0A 3N07A 1F2DA 3FKQA 2E5FA 3JARB 2VYVA 4P5EA 3TXAA 4F4CA 5GZ6A 4HG2A 3DBIA 4NAHA 2H65A 5IWAB 2Z30A 4B7CA 1KRWA 1G16A 3ZGXA 3TW8A 2WABA 5E0KB 4E2FA 2EXXA 3JD3A 2AMLA 1BE8A 2IPMA 1E89A 2R4TA 3BMOA 1ZH6A 3QA3E 2MSCB 3VPCA 4LF4B 4RCZA 4RNDB 4RHEA 3GJTA 2WK1A 1T9HA 4G9GA 1P4HA 3R75A 4J07A 4NMLA 5ALLA 4BQSA 1JXOA 2XR1A 5KHOC 3IPAA 4ZEOA 1RD4A 3ZWMA 4PSVA 4HAUA 1PEAA 1PWYE 2FFJA 2ZKLA 3WGUA 2SICE 4YRIA 1IUKA 2PZBA 2FXVA 4WE3A 2XCTB 2H1VA 3HADA 3QQ5A 4BIMA 3UAXA 1N5OX 3QLJA 2W83A 4UHCA 1YCHA 1O89A 3FH0A 4BFSA 3CEPB 1QQ5A 2CVOA 1JEYA 1GNLA 3LQ1A 121PA 2XXBA 1QKKA 2VHQA 3FJ1A 3G9XA 3H9GA 4GS5A 5AYVA 2Y27A 3OZRA 2QT0A 1N0VC 3K9BA 4NYIQ 3B3FA 4URUR 1YIDA 5AIAA 4C0WA 2PLRA 1Y4SA 1GDTA 4LKRA 5GWXA 3ERCA 3QUQA 3GO4A 2OGWA 3GRRA 4Y6RA 2X1HA 2G1KA 4TL8A 5TQ2A 4WZ6A 4C4OA 2V5UA 3M70A 3P2JA 3BJZA 2CV1A 1FP6A 3TGWA 3ZVMA 3TOVA 5JZSA 5KKNB 5IEJA 1NN1A 3VYSB 3NM6B 3F5SA 1R3DA 1JHAA 4IX1A 2HEGA 4EY7A 1I4DD 4GBGA 2WHXA 2P1RA 1PZNA 3T7SA 4MQEA 3W9UA 4A92A 1V1RA 5IPFA 3LX5A 4HC4A 4FCWA 3T3MB 5LOVA 1VE3A 4H2DA 3JW8A 3NNSA 3UFXB 2VDWA 3ZS8A 4LF5B 1O58A 1Z16A 5EWLB 3ANLA 2RJNA 4PLYA 5EHGA 4Q05A 3F5MA 3FUCA 1VL0A 2J3KA 5CVEA 5IG2A 1OT5A 4EB6B 1APBA 1NW5A 5HCIA 5BSKA 1T4CB 1C4XA 1NVMB 1Z0DA 1II0A 2VAWA 4C6RA 1KC3A 2VP6A 3SAJA 1DCFA 3PK0A 3ZDFA 3ROZA 3LUJA 1JKJA 1YAHA 3ZW8A 1G8GA 2C4KA 3D1LA 1DFHA 5LBTA 4ZHQB 3EPKA 3MSXA 1ZYUA 1C30A 3QLTA 4BV3A 4DJEC 2JG3A 1PT6A 1J9EA 1JHPA 4EUNA 2PX2A 3AR7A 2Q0HA 3U13A 5I3ZA 1XTPA 1GJRA 1HGXA 1V7CA 3MJEA 5DO9A 1E9AA 1MIHA 3D4BA 5BN5A 4ILEA 3W5SA 4DCCA 2VF4X 1ZPDA 3UA4A 3IBYA 1C8KA 3EZXA 1E7YA 3PVSA 4UUOA 4W7IA 4I9NA 2A0YA 1NVWQ 4RCVA 3VSEA 2YV4A 1H1LB 2PT6A 1N7HA 4AP6A 4B6JA 4DV7B 2QV0A 3X1DA 2G80A 3ZHBA 1N2CA 4OH7A 1DMRA 3PEWA 2HEIA 4L8YA 5IJXA 4W7HA 1J0BA 2HU7A 1KBZA 1OIVA 1RI4A 3DUWA 3JYQA 1I5OA 4GW3A 4DIKA 1J0CA 1FS5A 2HRBA 4B82A 3PFNA 1TK9A 4UASA 3V2GA 4JL8A 3X43A 3QWAA 3W4KA 3GUZA 2R87A 4D9KA 1D6JA 4WESB 4IV0A 3NTUA 4A2CA 2CWWA 3K9GA 3HEAA 1SQ0A 1T2CA 3IBCA 4HWKA 1SVOA 2VHWA 3CH6A 3ZBUA 4D42A 1GIAA 4YXFA 2YV5A 1U3CA 4KGVA 3KOUA 5EUCA 2PUTA 1G8YA 3K9LA 4J03A 1NURA 4ON9A 5DK4A 1GGMA 3OAAD 4PZAA 1L1RA 1TD9A 4UAGA 5EXXA 5LUBA 1FW6A 4BO0A 4BMXA 3Q8WA 5KVQA 3LLVA 3M8KA 5I8WA 2JHPA 4S2UA 5CR9A 2PGLA 2SKCA 1QVVA 3JQAB 3LV8A 3GUYA 4KRYA 4N54A 1Y4DE 2D1SA 2IGTA 2YC4C 3NWJA 3O4IA 4HXFB 4R7TA 1CP3A 1NBAA 3BERA 4RQUA 1XAGA 3MNFA 5C8YF 5FEMA 5CB0A 4XWAA 1NSFA 2G6BA 4MA0A 4TKZA 4YI3A 3MJFA 5JLAA 3GEEA 1A7JA 3RRBA 2JH9A 4O59O 1N25A 2OEPA 3TTXA 5EZYF 4EG1A 1P2DA 1QWSA 3IJRA 1FYXA 1XOIA 3VR6A 2Z2XA 2IW3A 4AIRA 1KAQA 4CIDA 2EW2A 2ZQZA 2ZIFA 2ZR9A 4NOMA 1DEOA 2Y92A 2F43A 2EL7A 4U7GA 1E6EA 1GG2A 2XUPA 5C1IA 4TTIA 4B3BA 3H5RA 1UT5A 2O8DA 1F8YA 4PNEA 1W0JD 1JFVA 3TBFA 3WIVA 1JEOA 4CKWB 1XQWA 1ZIPA 2UUOA 3B6EA 4M88A 3PHJA 3UB2A 2FEXA 3TEMA 3ZD9A 1PLLA 2OAEA 4AG3A 1RQNA 5I7WA 1QBKC 5K6AA 1CF2O 2CJFA 2R60A 5CDFE 2CMFA 1BVYF 2J0QA 3MJHA 4I1YA 3FPGA 1H2ZA 5GONB 1LDEA 2AYZA 3B6ZA 4BAZA 4X8LA 1V4BA 3E3MA 4FLEA 4BFLA 4LFBB 2AW5A 3KG2A 4WL0A 1QRSA 1MNQA 3LUHA 1MH9A 1VJTA 2M9MA 1YH3A 4O25A 2F3RA 1JLMA 2ADFA 4Y7DA 1C8VB 3EW7A 2IQIA 1SCKA 1BJKA 1H2XA 3E7XA 5B1IA 4CUZA 3BZUA 3DLCA 3HL4A 3DYIA 3H86A 3UN1A 4CIAA 3MJ4A 1RQRA 3GROA 2ZROA 1NMXA 2Q3HA 3D4PA 4MI9A 4RMIA 3BGWA 3U2QA 4KPEC 1A1VA 2V55B 3UZUA 4BNHA 2YHBA 5DI9A 3FTPA 4OQZA 3IA2A 2FPWA 1ZNQO 3OMLA 1NMZA 1DBIA 1KIAA 3IEXA 4E5DA 1LLFA 2A5LA 2Y9MB 4LC9A 4GVLA 3KWLA 2C03A 1KE2A 1QOZA 1CBUA 3S2IA 2IYQA 4BUCA 1SC3A 3ZGYA 2FW8A 2OB2A 4CF6A 2G4VA 3LHIA 3X2EA 4TMVA 4A8JB 2RMKA 1BGWA 1L2TA 1B0UA 1Z5NA 1ZD5A 1GFWA 2JC3A 2P5SA 3AH8A 3Q41A 3QYFA 4WADA 4ZO6A 2OXRA 5E6SA 2CB0A 2C42A 4ZCQA 1M66A 4CKCA 1XRRA 1MB0A 5FJJA 2G0NA 4INOA 2E18A 3FNGA 4KFTA 4UMFA 3PKZA 1GHTA 4B09A 3C6MA 3A1FA 3QXJA 4DMKA 4PC3A 2EG9A 5HGXA 5MGNA 3F47A 2QN1A 3I42A 3WADA 5IDQA 1QH8A 1SBCA 3T1TA 3FPKA 1CNEA 3JSAA 1FVOA 1KO1A 1F3OA 2Y99A 1IUPA 3ODPA 2YS7A 5DFAA 1HL3A 4FE7A 3C6QA 4C08A 2ETXA 5B5SA 1OGJA 1UEIA 3A2MA 1GYQA 4EIWA 1XA4A 3WGKA 2FVYA 2IYZA 3OZBA 2XTAA 4IVPA 3JWIA 4GZMA 3PEEA 4W82A 4EI7A 5IXJA 3E9NA 1W94A 3QU9A 4I19A 3ULKA 1LWNA 1RHJA 3LECA 4HGQA 4MW2A 4MP8A 5EZYB 1NBMD 3KPUA 3V4LA 1QV9A 3EVDA 4ARCA 2NSJA 5IAGA 2QSYA 1X7GA 4Z0PA 2H1FA 4KBGA 1YCGA 5I48A 5K3DA 2XRZA 1N1GA 4YNBA 1L8LA 4DLXA 1ANKA 1EVEA 1UEXC 1I5RA 2CMKA 4AJ2A 4OYLA 2QZZA 5E1MA 4ZCRA 2J0SA 4LGVA 2G1PA 1B73A 2W2OA 2AFIE 4A91A 1G55A 2ZSBA 4QJ5A 1Y1KE 1QP0A 2GK7A 2QLTA 4I8XA 1DPFA 1JDTA 1TM5E 1VKNA 4L5JA 1ILWA 1POWA 3QX3A 3RC7A 2OBLA 5KNBD 1TU0A 1NUTA 1XDUA 2HPVA 3F49S 5HF5A 2A57A 4LJSA 4GAEA 4CF3A 4FBLA 3R5HA 1W5EA 4ER6A 2NXNA 2PR7A 3P0JA 3COWA 3OFVA 1UBLS 2BCEA 1QVRA 4KV7A 1QTIA 3WGLA 2YN4A 4Q9KA 3H16A 3RQSA 1Q7RA 3L7JA 4RZSA 3T1OA 3ZGOA 5EJAA 4V2IA 4OI2A 1F1JA 5AVJA 3CNLA 1GRCA 2ZPUA 2GJ8A 3GEGA 3N2EA 1ZI8A 5CFRA 5KTOA 1P3JA 1WZEA 1Y80A 3PFHA 5EMKA 4BLTA 5JROA 1UJ5A 2BEUA 3WLQA 5SZKB 1YGYA 4DCGA 4F96A 1YRQA 3RYIB 3SQOA 4OA8A 4H4CA 2BYTA 3DKPA 1UBTS 4ME6A 4RHFA 2ODQA 1CF9A 4HMPA 5E7JA 3BRSA 4YCMA 1D4OA 4H17A 1JG1A 4GP7A 2UUPA 1R16A 3UW1A 3VR3D 1YR7A 5FHRA 2AR7A 3L43A 1X2EA 2GILA 1UT8A 3GXOA 1KYQA 3NFRA 4B0PA 4HNTA 1FTYA 2UYHA 2RD2A 3MJVA 3UAGA 1YE8A 2Z0MA 3NUQA 5H3LA 4B8YA 3WICA 1BKDR 4ANFA 1U2DA 3EVCA 3WLLA 4GZ6A 1T2NA 2O57A 2Q4BA 2Q3EA 3JQBA 5E0OA 3OI7A 4XAQA 4NS4A 2D2IA 2B8EA 3ETEA 2XDYA 1WMEA 4L9AA 2VAXA 4M6WA 1I7LA 1RYZA 1WV0A 4V24A 2CHUA 3MUEA 5LB2A 4DQKA 2W2PA 4TT8A 3AMVA 5LMNB 4F9FA 1IL0A 4BRUA 3QFFA 4QU9A 1E5XA 1MABA 4L0DA 5IAAA 3A1UA 2JJ1A 3C2QA 4MVJE 3MTAA 1QLJA 1XZDA 3WGTA 3TZKA 1E3QA 1GPMA 4D9EA 2WIDA 1JLLA 3NWOA 4N48A 3GFSA 3EDQA 3S8MA 4GH5A 3G2IA 2NSLA 4HTFB 4EAAA 4ARSA 3UMYA 3ETGA 1GZ4A 3TYXA 3L8MA 1Y81A 1FYDA 1XN1A 2P1DA 2QTBA 3IBSA 4HDKB 2AI1A 4C4SA 3DEKA 5MFZA 1OFHA 1IN5A 4FUQA 1F51E 4PY2A 3U4DA 3ZHTA 1Z2AA 1YDMA 4US1R 1BHQ1 4LNHA 1IPFA 1JHQA 1C9EA 2Q5QA 2CNNA 4R1UA 5D3KA 4D5GA 4ZN6A 3UY4A 2CL6X 4OHFA 1A96A 4IHJF 2PH7A 2VH1A 5JDCC 3G2KA 2CB9A 1QHEA 1IQRA 5JQWA 2D00A 4MZDA 3H3XA 3VPAA 1KXZA 1M2VB 2YW2A 2QX6A 3IKJA 3LX8A 2RHTA 4MCJA 1OR8A 5CA0F 3UAVA 4RD4A 3OESA 5DNCA 4GVPA 2PBLA 4LSWA 3AYXB 5A05A 3TZCA 4BYGA 2BMAA 4YP5A 5KQPA 1X42A 1JLLB 2ZSDA 1L4KA 3IAHA 1P18A 1KP9A 1IMJA 4C5CA 3N58A 1YS4A 1RAHA 2ZUDA 2O3JA 4MOWA 3GRFA 5IDYA 2W2LA 1X3LA 4BNKA 4EX6A 1JKMA 3CZ5A 1JQJC 4GLFA 4LGCA 1STOA 2GXSA 4PNPA 1VBFA 2BBSA 4EHNA 2Q2WA 1JILA 3PRYA 1UBGA 1U8TA 4EZBA 3P9SA 3QVTA 3THYB 3OZIA 5LMZA 1M2JA 4NOKA 5LDDC 2J67A 1DS6A 1JG2A 3LUBA 5JSQA 4HX5A 5AH0A 2Q99A 3FZGA 2IHYA 3IIEA 5MF6A 1H4SA 2OG2A 2P5TB 4R2MA 1XZNA 3NHPA 4M53A 2NU8A 4I6GA 3OTWA 3E1SA 4CTOA 3KYCB 3TI7A 2V0GA 3GLKA 3IKVA 1RRFA 1E5TA 2BR4A 3W1WA 3QVLA 1NMYA 1GKKA 4X8HA 3DE6X 3ESXA 1DPGA 1QQ6A 1PDOA 1YHZA 3E35A 3KZCA 5G2OA 3PDIA 3C7AA 2RH8A 4TLLB 1SIOA 4JXJA 5GONF 3VSDA 2XMDA 4K9DA 4HFRA 4RDIA 1VRVA 4XEUA 1L5VA 2QUZA 1XQ6A 2N3ZA 4LZOA 4DWOA 2BTQB 4NBKA 3PXEA 1U8FO 1RACA 4R51A 1N9GA 4MR8B 1XZKA 1HFKA 1VJ1A 3Q7QA 3WRYA 5ELMA 3IDAA 4LRUA 2GKSA 1RKVA 3D4LA 5EJ2A 3IV6A 4ZTBA 4TUYF 2ZS8A 3JPYA 4YV2A 2OV4A 3AXSA 4I50A 3TQOA 1FLVA 4CLEA 3ID6C 1B0PA 1EWKA 4MGYR 4XOIA 3VMMA 1PDVA 1BX0A 2HWWA 4K7JA 3HKEB 4YJ2F 5BYKA 1E2NA 2E5WA 3NBYC 2A92A 3GZNA 2CF6A 3W6NA 4CPDA 4EF4A 1V43A 1TTTA 3EB9A 1W0JA 4Q19A 1UJ4A 2DUJA 4HTFA 5JZVA 5CNMA 5CNJA 1OY1A 1JWLA 1E2DA 2G3YA 5SICE 4PLPA 2JI7A 4V2UA 2QMEA 3E9MA 4AZTA 4HGZA 3IEIA 1CERA 1F7VA 2WI8A 2GDJA 2OAQ1 1I10A 1T0HB 1U7TA 1Z4LA 3RO7A 3B1WA 5JI3E 2RBGA 1ID8A 1UBMS 4KRFA 3J81k 4FC6A 4QYIA 3BH0A 2Y1CA 3KQMA 1L7DA 2CL5A 4DSTA 2ZRNA 3NCHA 4KYVA 4ND8A 3ZZ1A 2C96A 5HFAA 5KYXA 3FYTA 3SY8A 2HM7A 3OFSA 1NI4A 3BGVA 3PXDA 4ZKDA 4YACA 1KTVA 2GNAA 3CW9A 3UYLA 4ARZA 1I3CA 4UBLA 1NBIA 2DBVO 3BFPA 5DM2A 2ECPA 3EW9A 4HWRA 3OJEA 1PQPA 2JHFA 3EOBI 1G42A 3H5LA 5JU6A 3ESBA 3K92A 4HUJA 3ZKWB 3UFBA 1ZK4A 2IUYA 5CNIA 3OQPA 2VWQA 4M36A 5K3OA 2XWQA 2J31A 3MTIA 1K7CA 3DPIA 1UKBA 4IDFA 1MFPA 3AHJA 5I9BA 4JQZA 2FR0A 1UFRA 5C8VA 3UW3A 3ZXYA 4FJ1A 4QL3A 1PT9A 1JDBB 2PUHA 4J9VA 4J16A 2PSSA 3G0CA 3T7KA 1AKUA 1MC1A 4HEJA 1C1DB 3DHVA 4HXEB 4W1PA 4ARUA 3PE6A 3DAHA 1TMOA 4F3YA 1JR3D 1PL8A 1A76A 3C4QA 2UVPB 3INGA 3SC6A 2A8YA 1LNZA 1B43A 2CLFB 3C48A 4O4JF 4XPIA 3RRMA 1GN9A 1XAHA 2P41A 3CONA 3D4OA 2XUHA 2O3UA 2FPSA 4NZNA 4LV6A 3JQAA 4RYLA 3CMCO 2Q4OA 1U2GA 4JSTA 3N5CA 3SZ3A 4CU5A 1AA9A 3AEUB 4MUKA 3UH1A 5DEIA 1U80A 3OKCA 3P9CA 1CU1A 1FFEA 2BZ0A 3PA8A 4G1EB 3QVKA 2MJLA 4GMHA 3WC4A 2Q5IA 5JSHA 1OZ0A 1P1KA 3IKMB 1U7ZA 3C45A 5BQPA 4H3VA 3ZJ4A 3I9MA 3QMMA 1P9OA 3DDHA 3SPXA 5JFTA 4BXOA 1TO6A 2PZJA 4M1MA 4WBSA 3GLFE 2I33A 4RA6A 3M4YA 4AJOA 4EYOA 4FBGA 5HUJA 3DKVA 4ASUD 2J9FB 2OV1A 1T3SA 1K6IA 4MICA 3AJ8A 3O1IC 2NVOA 5ALXA 4KR9A 2AD1A 2ZRQA 4KJXA 5C34B 4OLAA 3KQHA 2C7RA 1TOAA 1Y3AA 1AY0A 3BD6A 3EAFA 4JV5B 4EARA 4IO1A 4MIEA 4IFIA 4L16A 3WMWA 3ZHSA 4R2XA 1WW2A 3NIGB 5J2TA 4MPRA 2RGWA 2BHNA 5JO9A 5CFOA 4CKCB 2GXQA 3BXPA 4XFJA 2H7CA 4A0GA 5EE0A 2ATXA 3EAQA 5FTWA 2WU0A 2VF8A 3OZSA 3WJ1A 4JLJA 1M2NA 2OTCA 3VC1A 2JEYA 2ZDHA 1EM8A 3H2KA 3Q3HA 1UKCA 4RPKA 5JAZA 3FOFC 1YB1A 1HDEA 1GNTA 1AZTA 1XAIA 4FFSA 1H1DA 4L15A 4OMCA 3M4NA 4X6XA 1YXMA 3ECSA 1KZ1A 2QTVB 2WE8A 4WX2B 3WBBA 2AV6A 5AOCA 1U0GA 2FWAA 3LPAA 3WTCA 4GX5A 4HZUA 4ZYWA 1EQ2A 5EVJA 1VFNA 3ENZA 2G9UA 2QLJA 1T8UA 1Y8QA 3I2IA 4XM1A 3UPDA 2EEPA 1EE2A 2W90A 2I54A 5AI4A 5FLEX 4ND2A 4A5OA 4DUYB 1KTIA 2R85A 2G7MC 3FMIA 3MMZA 4MB2A 4P34A 2WUDA 4PQRA 3WB0A 1G8AA 1SH7A 1SZDA 4R16A 3AF0A 1YB2A 5DX8A 3BSWA 1NW7A 2E55A 2JF0A 4ZU3A 5H4GA 2J3HA 3JQCA 4UMVA 2F64A 4KQEA 4RUKA 4TMYA 2EYUA 3OC6A 4C07A 4I1VA 5TJ9A 3B7PA 4WI1A 1NT4A 5EJGA 4HFNA 3R8XA 4N65A 1EK2A 3LFTA 4G84A 1M72A 2AE1A 2ZRGA 3HYSA 4H3HB 2QRPA 2HZ7A 2FDXA 4IIVA 5GTDA 5HXAA 1NQOA 3GLVA 3QKTA 1KY4A 1TF7A 1PT5A 4YRLA 1RQLA 4ALJA 5KX5A 1BZYA 2VAPA 3QHPA 3SHQA 5AKLA 5E7MA 2W2KA 3SXUB 1O87A 1JJBA 1VMEA 1EWRA 1YDGA 3P9NA 3AQ4A 4OGKA 4AKEA 4B3XA 5BWCA 5IUJC 1S7GA 1LPAB 4KC0A 4BE7B 5KNCA 4CU2A 1DKOA 3FVVA 3ZVNA 3V2UA 2W6CX 3ZVRA 3B7GA 2JLZA 3I1JA 4D9CA 1QZXA 2A59A 1U0OC 2YMPA 4QOGA 3X1JA 4DL9A 2AMFA 3RKRA 5C7OO 2FSGA 3NXSA 2GM5A 3L8FA 5JG7A 3RRYA 4OI0A 2DTEA 3GL9A 5EE1A 3BN3A 1EB8A 2B2XA 4WIAA 5CB4A 4GYJA 1BD4A 2EG5A 2FVXA 2O5RA 3X1XA 4YT2A 2XE7A 4NCHA 3TSWA 2EFYA 4G89A 2ANBA 1FUYB 1WDKA 4E94A 3NMUF 2VDOB 3QIVA 3VKUA 2OYCA 1XXHE 2GZSA 4FZ3A 3DQQA 4JGGA 4EB0A 1FMTA 5FTNA 1BW9A 1EZZA 3PXCX 4A0RA 4HK4A 1CX9B 4B6RA 5IT5A 5IT0A 2FW0A 1XN4A 3ZQJA 1CUWA 3O1HB 2YXEA 2BGMA 2VG8A 2Y0DA 4TPKA 3EVEA 3U6BA 5AJYA 1YQXA 2QUIA 2VPZA 4HQ0A 5F1KA 4B6SA 2C7OA 4B85A 1KPGA 4UE2A 5IM4F 2H51A 4W5NA 1BH6A 4IOMA 1R88A 3AFGA 2DYKA 1FOEB 3QSGA 1AURA 4PGGA 4MP3A 3QQPA 5AVRA 4J1TA 5LWQA 4RFSA 1BKSB 1U9JA 1QG6A 1K7FB 2RGYA 1R5BA 1ZICA 3OQ6A 4YYEA 2FFHA 4EG5A 3IIKA 2W2LD 3LUGA 3HNPA 2ZRLA 2FN4A 1JJIA 3CF4A 1GRNA 4HTAA 3OVMA 4YRPA 2XYGA 1VL5A 3D0RA 2HSWA 1ULHA 1GL7A 2VA9A 3KQVA 4LTDA 1QZUA 2FSSA 2EJWA 1QSGA 1RJWA 1XUOA 2GBPA 4RSMA 3W8NA 3FYDA 2BC9A 2EGHA 1D1SA 1A9TA 4NDAA 1USKA 4LK3A 2W9XA 1HO3A 4E21A 3EHDA 2REQB 5A9TA 3NRJA 2VKQA 3FCOA 1PS9A 3SE7A 2BFEA 4FMPA 2GTIA 5CXXA 3LA6A 1G3QA 2XE4A 4TQUS 4Y1GA 2JFGA 4OM7A 2JZCA 3WJ7A 4XB1A 3NOVA 5HSGA 1PX2A 4EITA 5FL7A 1NJ2A 4NFSA 3GQVA 3N87A 2NSDA 3OUUA 4I4TF 4P93A 2VP0A 4FINA 4LJ8A 4GKVA 2J0VA 1S3IA 1RE0A 1ZHFA 5DTJA 2VSYA 3TEJA 5BOSA 5B6JA 3BTOA 3VJRA 1CQIB 1LLCA 3EF3A 1KZ6A 1BIFA 4N6OA 2VP3A 3EFHA 3WLJA 2OC4A 4Z9FA 4AMBA 3FBWA 2H4HA 4BWGA 3WA7A 1KNXA 3HLKA 1WEHA 1E5QA 3MXTA 1MTOA 3U7RA 3TL3A 5JQGB 1W87A 2J0UA 3MELA 2IV2X 2P6OA 4D9IA 4ZQCB 2NP6A 2JBAB 1DJLA 3Q9NA 4WINA 1I7DA 2XMPA 1CEYA 1F0PA 1CJBA 2WAYA 2AL7A 2WR8A 4RMJA 1QPZA 3M4ZA 4NMWA 1KWGA 1U8EA 1XXLA 2GB4A 4UHKA 3DZBA 2FE4A 1J22A 4HQ6A 5BSRA 4I08A 3ZUPA 4MYTA 2PCJA 1R6AA 4ICIA 3FD8A 4FFDA 4LOHA 4BFUA 1NY5A 4KDRA 1XPUA 1BXRB 1IATA 4K9MA 2ZDGA 1XL1A 1VMIA 2AJLI 3HR8A 4P31A 3RHZA 4ZAXA 1KETA 1RWKA 2KPOA 5C31A 3UC9A 1I7QB 3TE7A 1OFTA 3LC7O 3LE8A 3AVPA 4WOJA 2MR5A 4RY0A 2F7SA 3IV7A 4RO0A 2FGKA 3F1LA 3T12A 4O6VA 1JMVA 1QQ7A 1AKWA 4BUZA 2P3LA 2FG6C 3JQGB 4OPMA 1R1DA 1XRMA 2A1TS 1YQWA 4LE1A 3PPXA 2C2WA 1L4LA 3L0PA 5FUQA 1VQ1A 3FMFA 1GSIA 1RC1A 1HQDA 1SQFA 2ZRFA 1NSTA 1PV2A 1Z4NA 2W37A 4AG5A 4G8CA 2AG1A 3DBLB 4PANA 2J5KA 2XCQA 3L1UA 4RGBA 1VXOA 2Q9BA 2WM8A 4YRZA 5A3JA 3RWMB 3AW8A 1DBWA 1IAVA 1JP7A 4TKVA 5T57A 1W46A 4Y2JA 3TK1A 2A0XA 5F5LA 1V7ZA 3P9RA 4X97A 5IT4A 4QPDA 3CBQA 3PGVA 1QF7A 2UYQA 5JAHA 2IEIA 4MAMA 1DAIA 1ND6A 3IR6A 3NM5A 3EWNA 1JTVA 3U4IA 2GX6A 4NZ9A 4XFKA 3G6WA 1M6EX 2H1RA 2Y0CA 3NBKA 3OU2A 3PIRA 1EXWA 4HEQA 4HAIA 4P80A 5HQJA 3DOFA 3JVIA 4CQMD 5CDGA 4ZO9A 2XMSA 4ID9A 4AJKA 3U19A 4NRDA 2HXGA 2AI3A 2YW9A 3UK2A 2VQEB 4MKIA 3CG0A 1BMTA 4NBVA 3GVPA 2G76A 4D9GA 1K8XB 1C3EA 1FFDA 1XBTA 5BR7A 5BN4A 1ZH0A 4TV8B 2JZOA 2XWJI 2VA8A 4IUBS 3ZWQA 1F17A 1E8DA 4C87A 3PTZA 2UZ0A 2OM2A 4MO9A 1JU9A 1Z5GA 5DHAA 1OLXA 1S0UA 3PHGA 4FN5A 3RAJA 1NVUQ 3AEQA 4FIDA 3U4QA 2F4NA 5ALQA 1K88A 4QDKA 2Q8PA 3UFXA 1HYHA 1WUYA 3G85A 2BHRA 1JFFA 4YMWA 2BUBA 1ISHA 4QGFA 4OATA 3GZJA 4RULA 1VM6A 3ICVA 4Q1EA 3BHIA 3GWZA 4QGGA 3WLNA 4E22A 4XCVA 4YAKA 2Q41A 1KQGA 4ND5A 1SB8A 3SZUA 4U39A 2ZIXB 2R1VB 3EZNA 2VT7A 3HFGA 4CLRB 2DUNA 1YS6A 2Q07A 1FQOA 3M5CA 2OFFA 1H3NA 1Y6RA 1BGXT 1NP7A 1OBOA 1U1CA 3MINB 4JLMA 4NE7A 1OZFA 4R5HA 4CFZA 4D4JA 5EJ5A 5I7HA 1DRVA 1XFAA 3NU1A 4JHXA 4JLWA 4MWSA 1H1TA 5IEBA 3ICEA 1FF9A 1SXPA 4GZ3A 5REQB 1CUIA 3VOTA 5KOJB 4FOOA 1XTZA 2DQ4A 2HLHA 5CLGA 2H52A 4O08A 1UK6A 5J47A 3UK7A 10MHA 2H6EA 1CJKC 3IQXA 3L6RA 1L5RA 3DHEA 4XQEA 1FYEA 4G8JA 1PJ2A 4FHDA 4NJEB 3LY7A 4E2WA 5CITA 1LDGA 1UKZA 3RK1A 4P2GA 4PHHA 1P73A 4YP7A 4YHHB 3DP7A 1QFJA 2QAGA 2WD7A 3KELA 5ITSA 4IDAA 4MUBA 4HLDA 1NW6A 4IV8A 3NWPA 1VI2A 1Y6JA 1ZLXA 2EZ4A 1E63A 2QV7A 1Z26A 2XNKA 3DDWA 4MUFA 2IWRA 3SQMA 2L82A 1LDMA 4C4XA 4WK2B 2F48A 1DWPA 3RYHB 4KVGA 4FGUA 4KE7A 3U7HB 3PLAE 3WQSB 2VF2A 2UXDB 2WWIA 5IH3A 1R0BA 1TT5A 1GPH1 1L7VC 1NN3A 3MF4A 4IIUA 1U0BB 2J9FA 2YHIA 3R09A 4JXKA 2DHRA 2NAPA 5B4TA 3I1YA 4ZEWA 2SECE 5FV4A 1XT6A 2HKIA 2BFEB 4YRGA 1OYYA 1Y8CA 3GJ0A 3JYLA 2R7AA 4R5MA 4DBZA 2C92A 3JR7A 5E2BA 1OX4B 5GIPE 2VHEA 4Z1MD 1T8RA 1Y37A 2CXOA 1JPNA 2WYIA 3ZWDA 1BWPA 3WDSA 4G4SO 2DFLA 2QX8A 4KWHA 4FSXA 4G5HA 4TYMA 2QR2A 3Q7EA 4C3ZA 1SM4A 1MAAA 3KP1A 3FFAA 3PKJA 4R69A 2I1VB 1BS1A 3DS8A 3QP9A 3Q7IA 3U40A 4BNWA 4Z7NB 4IHKA 1J97A 2D8AA 2PS1A 5AM5A 2D62A 2X4GA 3CGWA 1E2GA 1P1JA 2R5FA 5CMLA 4C01A 1KS9A 2IZ0A 1HLPA 4QTUB 2ZI9A 1Y3BE 5K0CA 4GI1A 1WMBA 2QNRA 4HWPA 3W6OA 3ROMA 1XD8A 4FHGA 2XQFA 4DB2A 3GNLA 4GOND 1YB7A 4P5PA 4EWLA 2YWDA 3CKMA 2GH1A 4RH1A 1YQDA 4TVBA 1KJJA 1TEXA 1VL6A 9ABPA 2DR0A 1I7NA 2JLUA 2FDCA 1MTZA 3MFQA 2AJCA 2UU9B 1D1QA 2DSTA 1R9MA 4N47A 3RSGA 3C6ZA 4O5AA 2WSMA 3KSRA 2BFBA 5F4BA 4XIGS 3STTA 2Z8YM 3CNEA 4WNAA 4BNTA 2DERA 1RRGA 4W9NC 2BFDA 3ROGA 2A1UA 3NXKA 3K71B 1OTXA 1MLDA 1PFUA 1F8XA 1KOJA 1H42A 2J5QA 1C8BA 1S1CA 2GEUA 3LX6A 1MRSA 4IIXA 2O54A 3ND7A 3NUZA 1OV6A 2ZVJA 4QHYA 4H4DA 1VSVA 2ZXEA 3T15A 3DB2A 5NULA 4F56A 1EWQA 4X61A 1X0VA 3WB1A 4QVGA 2QM7A 2CC2A 1A50B 3HU1A 3FNFA 1TE2A 1YOBA 1QK5A 4PCVA 1FMJA 1Y1LA 2C9BA 2HJHA 3TLJA 3DOJA 5A6SA 2BKUA 4C4TA 3QGMA 3KSAC 3FVRA 1V5EA 1MRNA 3CWQA 3FCCA 1J8VA 5FWXA 4JI5B 3GJ6A 2FEAA 1ZN7A 1YRAA 4ENPA 5HQ3A 4GRAA 4K9LA 2E0IA 3QSYA 5DLQC 2VYNA 1PQ4A 3MGKA 2WPNA 3WFJA 3SZGA 1E96A 2VDRB 3DB1A 3EXAA 1G9XA 2M6KA 1XZFA 2AC7A 3V1MA 5H80A 4CT5A 2A4KA 3LPMA 1U81A 1PNVA 2JCSA 2PFSA 1TYEB 2ZXFA 1DQNA 3OPNA 1ABFA 5JYEA 1IY1A 3FR7A 5F76A 2YUTA 3FTNA 4GP6A 4YRAA 1B2LA 1ADCA 1A88A 2OZPA 1P75A 3T61A 2BHSA 4AM8A 1GA1A 2JGDB 3UXMA 2OYRA 1CLEA 3HUUA 4WOBA 4LYJA 1V11B 1MC8A 4RK5A 3EVFA 1XKXA 1ZG3A 1DEXA 5HKBA 1QXSA 4KFUA 5LJIA 3EFEA 4RV5A 2X4IA 2O0HA 1V1JA 3I83A 3IE0A 4J2HA 1AQ6A 1ES9A 4OK6A 1AO3A 4UW9A 1WXWA 3SC2A 1DG1G 2J4FA 3BF7A 3JQ9A 4TYWA 2FUCA 4DLTA 5ITWA 3BWXA 3FFTA 2ZI5A 3B9PA 1HLDA 1H8ED 2R11A 5DB4A 3B13B 2YR0A 3Q3GE 2I3ZA 3ZG6A 4RJIA 2WHPB 1RRMA 2DOKA 3RFCA 3Q6IA 3L41A 3KFVA 2BKXA 2P2YA 1EGMB 1L7NA 4NOJA 5D85A 3REQA 5I47A 2FPGA 2G5GX 2Y2UA 3HN7A 4Y2VA 2X0EA 4QXMA 4EABA 1RP1A 1YBVA 2IP4A 1Z4OA 1C41A 1LVUA 3CH5A 3D5TA 3NKLA 3K96A 1G5FA 2ARKA 4ECEA 3JVEA 4K46A 2GJAA 2GLTA 4R8KA 1P5FA 2J3DA 5BOVA 1CUUA 5GJCA 4JBWA 5B58C 2NYAA 2R8XA 1VLZA 5E2AA 1V3VA 4O2RA 1NXPA 4V0ME 5HDQA 2ACVA 3GLSA 3O82A 1N2GA 2JB9A 5CA1A 1D2EA 1J00A 1UC9A 2OV8A 1G63A 1RFLA 1ONOA 2HA0A 3DDNA 3E05A 2J5RA 3G02A 3IP7A 4LWQA 4PNZA 4G36A 4R1LA 3T5DA 5HJ7A 4Q1BA 2PSEA 1WKBA 4B34A 1GXSB 1R4ZA 1U2EA 5JT1A 4MWTA 3OIUA 1YR8A 2DPMA 1ZD3A 5AUQA 2H07A 4H7KA 3QOYA 3H6GA 3ZCQA 5LUAA 1RMTA 3HJAA 4RVUA 3A6JA 4RPGA 3OTGA 1ID1A 2FPLA 1ZGHA 1NJSA 4BFTA 1X38A 3M9WA 1QDEA 2YFQA 3CISA 2GAOA 2P9HA 3KOZA 3K70B 5LYYA 1R0SA 4G37A 1DKMA 1RW4A 2CGEA 1KVQA 2GVDC 4BKUA 2IVFA 3HVRA 2IC5A 2AZXA 2ACKA 3LPCA 1JG7A 4GP9A 3W3AH 3SZRA 4NESA 5EHQA 4GPZA 2XQGA 3EUWA 3HC7A 4DJJA 1U5BB 4RPCA 5EHZA 1P2BA 5IHPA 1ZJYA 1JMKC 1WXFA 3RM3A 3TI9A 2XZPA 1QPGA 1GPUA 3EGDB 1E9SA 2V9PA 1E61A 2DZDA 3IR7A 2G8NA 2NUAA 3EGXA 3VAYA 2CDCA 1SG9A 3UJDA 4S35A 4BNJA 4EG7A 3H4MA 1QK4A 3DO8A 1S2OA 2Z4RA 5DYGA 1KARA 3OQBA 2IOFK 3NORA 1FZTA 1M5UA 2QNIA 2QD4A 3AM3A 3NHKA 3A27A 3D4NA 2PH5A 3RVPA 2B8JA 2QENA 2Z83A 4AY6A 3STWA 1ZVQA 4JVLA 1JIKA 2O2EA 2O1XA 1PT7A 4YC7A 5C1OA 3TCNA 3I1FA 5CDFA 4BB0A 5K5EA 2JVJA 4LZLA 1I80A 1Z9BA 2CHQA 3WK6A 4LN1A 4JIGA 1FMLA 2XLCA 4D3DA 1T35A 2PSJA 2ZUEA 4TUYA 1LNQA 1RIFA 1GA6A 1Z6GA 2LCIA 2R47A 4ARVA 1NE7A 1Z2PX 3NYWA 3U4CA 3T5GA 2HSDA 2XGGA 1JF8A 3WL3A 3D9QX 1JT2A 3TD6A 4B6EA 1OLUB 4YJ2A 5DLEA 3P0FA 1GGFA 3HJBA 5EFZA 1FFXB 3GGJA 5ERXA 3WAGA 1J9ZA 4HDKA 1CUSA 3NTRA 3U4AA 1T25A 1W6RA 3F1KA 4R0MA 2W7TA 2IU3A 3DFFA 3F8TA 1PK9A 1NMEA 5EP3A 3GLUA 3NHUA 1ODSA 5DHFA 3W7AA 4RV4A 4I66A 1AB6A 2G0AA 4DIBA 3IPRA 4IIJA 3SIXA 3GU3A 1YRHA 4Q9JA 3GELA 1LBIA 2BE7A 3FW1A 3MB8A 4GUDA 4NH4A 1K6JA 4I6EA 1H69A 4FEGA 1Z6TA 1FIUA 1KEKA 1IDN1 3F4KA 3CKYA 2IXGA 2OPHA 3JARA 1L3CA 4PR3A 5H59A 1XRQA 3RG8A 4EW1A 3ZTTA 1IHDA 1E9CA 1U2SA 4C29A 3N59A 2QVCA 5LQUA 1EK1A 3AEKA 1KJYA 1XHFA 4Q3EA 5A4FS 3COJA 1O08A 4MLPA 2CXRA 1H65A 1CZKA 1GNVA 5JXWA 2X2EA 4E5YA 3QJ5A 3VU0A 421PA 1A7UA 2AVNA 1UM9B 4EKDA 3BIOA 2A33A 4OM8A 3BL8A 1I2DA 4NCBA 1NP3A 1WD7A 1KDOA 2V7TA 2C7QA 4WZAA 2P91A 1QHHB 1SUIA 1FJHA 2X7XA 2FE1A 2BMVA 2GVZC 1OA0A 3CLHA 4BLVA 4YT8A 2WICA 5EIHA 1MXFA 4UTRA 1FFSA 2QKYA 3DCNA 1D0IA 1T1RA 3H2YA 5KQGA 1IONA 3JQPA 4FC7A 4RGVA 1B14A 1BCSA 3SBEA 4IIGA 4EI8A 1Z18A 1LD3A 1KVUA 3UWMA 4XWKA 4P82A 2NU6B 1MX1A 2FKNA 2GAFA 3I53A 4A0FA 1KJNA 3VC2A 3WLRA 2WT8A 1K86A 4JT9A 4GLJA 1K7SN 1OFGA 3LL7A 3H2BA 1H93A 4MWGA 2OO3A 3JQQA 1D5CA 3NIBA 3GJZA 5G53C 3ESZA 3FLAA 4BTLA 4Z9XA 4A6XA 4YFVA 3UK6A 1C1HA 1U0LA 3LCUA 3LC1O 3MFYA 3OIVA 4QJ3A 4FGZA 5JVDA 4IIJF 1VI5A 4QRHA 2XZDA 3OT4A 3LS2A 1KI6B 1A9QA 4HN9A 2EFEB 2E5LB 1WMAA 3AT1A 4HB4A 3IODA 3HJUA 5KYTA 4UCWA 3IBGA 4IXDA 1ZD2P 4YCBA 3RUIA 1THZA 3AF5A 2P4QA 4HH4A 1TL7C 4UDXX 3RUCA 2AK2A 3BIFA 3HA7A 4OI1A 4ZO4A 5DVZA 2GNPA 5CPFA 4AX4A 1M0EA 2EIXA 4LXXA 5C8YA 5EPEA 3WA6A 4PZCA 1B3RA 4MUYA 4PRLA 4G0WA 2VL7A 1EZ1A 1IJFA 2RBKA 3M0EA 3OFNA 1DAFA 1AKQA 3PUJA 4M0KA 2Q21A 4RANA 2O8EB 2J08A 2JAHA 5B58T 1D4AA 2JIQA 3PDUA 3ZZMA 1C2YA 3P0EA 5AVXA 2IBSA 1J4AA 1WMSA 2VP9A 3PGA1 3TIFA 3GBPA 5HCNA 1AU9A 3PFBA 1TVKB 1C9KA 4PZ0A 5I7AA 4I50B 4LBWA 1YB4A 4MUGA 5CVJA 5DM70 5I4CA 3CW8X 1E2QA 1EK5A 3AO0B 3A9WA 3QBDA 1U8CB 1UJ6A 3OIWA 4MMZB 2GYYA 1FX0B 5AD1A 1OBHA 5DM4A 4M98A 1NRIA 1DAPA 1JSRA 1XRLA 3ROKA 3OY7A 4QXQA 4IINA 4HDRA 3P9QA 4J7AA 4IV5A 4FFVA 4OH1A 3N7UA 4EGQA 2QU8A 4HHEA 5JLJA 2JLQA 2O8EA 1UIRA 3PFCA 1Z56C 3DE1X 2XYPA 3P4UA 1VJ5A 1U5BA 1WZUA 5IJWA 4BLPA 3N74A 3SYRA 3CRNA 3KB8A 1HRKA 2J45A 2TMYA 1IFXA 4FGSA 5EZ5A 1VE9A 2N75A 3WK7A 1RPNA 4OSOA 1KDTA 4ALMA 4EO7A 2EEZA 1UK8A 3UGKA 1J33A 1R4NB 2EKDA 3ORQA 3OX3A 3R3HA 1A7KA 4ILKA 1X1RA 5KYXB 3U5TA 1X39A 3ZHOA 4DMLA 1FVXA 3IQGX 3O4VA 3R7WB 3KTDA 4AUKA 5EERA 2X8BA 3RD5A 2PL5A 2KMLA 4EUKA 5DI3A 3TPZA 2VK8A 2FK8A 5B53A 3T41A 3H13A 2CMHA 1N2CE 1CR6A 3AL2A 3PEFA 3KHTA 3L06A 4AZ0B 1G7SA 2K87A 1OAAA 5A9SA 1G3IA 1EM8B 2N1MA 4JJAA 3CVJA 3GPIA 3EEIA 2PX0A 4EBFA 5CCBA 1VCOA 2POCA 3ASUA 2Y4NA 3KSUA 4NBWA 4BNLA 2PMDA 4UNNA 4EY8A 2UV8A 1WD5A 3LI2A 3VOAA 3EWSA 1DOAA 2CYCA 1WCXA 1AKMA 5K1ZA 3DYBA 3NHYA 2HWKA 2AW3A 4XASA 3IP3A 3RGGA 3FN4A 3AUUA 3CEJA 4DTIA 2HO5A 1P0FA 1JAZA 2PD4A 2G4LA 3AFIA 3ODGA 3C3CA 1A2KC 1ENYA 1HMYA 2FJPA 2YHIB 3DMYA 3O8BA 3OJOA 5H3HA 1CZOA 1I8TA 1VBMA 2OHVA 2BJVA 2HHJA 3L1KA 4YECA 1RRKA 5GY7A 3M81A 1YDWA 3QHAA 3LQ4A 4RHUA 5EYPA 3ZIAD 1IRXA 4JFRA 4E5MA 6GPBA 1S2LA 2OG1A 3L49A 2Q1TA 1SVMA 1FP2A 3B12A 2Z09A 2CV0A 3MJRA 4YWHA 1K27A 4R9SA 3EA0A 3ENVA 1RHMA 2YVLA 3N2NA 1R9GA 4HYEA 3I73A 1GUFA 4OHMA 5DP1A 1FNMA 4KXQA 3UB4A 2F3TA 3GZ4A 3Q88A 4F9TA 3IEVA 2QM3A 1Q7CA 4JD5A 3QFCA 3TG2A 1A4XA 4V0KA 1WE2A 5FA8A 1BX1A 3P97A 4HDSA 3F2VA 2PKCA 2YWCA 4FE3A 1T3HA 2J5XA 2QSUA 1CZLA 3LWNA 5KCMA 4HNSA 1XP8A 1YVPA 4J3NA 1IHYA 2LUOA 2C88A 2ZREA 3R9WA 1ORWA 2B2CA 1ST3A 3EIFA 1EUYA 4DA8A 1MEOA 2GYWA 1Q11A 2C58A 2R00A 2ZWVA 3DAOA 3NGXA 1L5QA 3EXHA 5D2CA 3QVGA 4OHXA 1BEZA 4MGKR 5CFMA 1D4ZA 3VR5H 3OIGA 3WP1B 1BDIA 2IPNA 4EDHA 1TAUA 4GF5A 1NATA 4MS4A 2HO4A 2PS0A 2AOXA 4Q1VA 4W1QA 5ALUA 1CDZA 4O29A 2ZIUB 3VR3A 1CZNA 1OE0A 1DG9A 1HTTA 2UVQA 4JKOA 1DI0A 1T8TA 2ZBQA 3D7LA 2FKAA 3KSMA 4K9PA 2O8CA 2PUAA 1XJQA 2OM6A 2HA2A 3B36A 4PLCA 5CD9A 3E58A 4MW7A 5CP8A 2EQAA 3VNUA 3I39X 4EYQA 1ENZA 2YXDA