2VJVA

Crystal structure of the is608 transposase in complex with left end 26-mer dna hairpin and a 6-mer dna representing the left end cleavage site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
LYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVEIIEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKLPTLWTNSCFISTVGGAPLNVVKQYIEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of is200/is605 Family DNA Transposases: Activation and Transposon-Directed Target Site Selection.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Dna binding protein
molecule keywords TRANSPOSASE ORFA
total genus 36
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2vjvA00
2F4FA 2VICA 2XMAA 2VJVA 2EC2A 2XM3A 2A6MA 2VHGA 2XO6A 2FYXA 2A6OA 2XQCA 4ER8A 2F5GA 2VJUA 2VIHA
chains in the Genus database with same CATH superfamily
4IQMA 3GTYX 4LVNP 4C11A 4BC7A 5C24B 3UI3A 2B6AA 3UR0A 2XWXA 2HFSA 1X31C 2RVJA 4CO4A 4A8XA 2MEWA 5J2NB 2XGPA 1UA1A 5I4MA 2KHDA 1CJKA 3KUHA 1A6LA 3N79A 4E2FB 5C25A 1P6TA 2XG8A 5IT9U 1CVJA 3HHNB 2CRLA 5GADU 1SJ3P 1R3NA 2UU9J 2YH0A 2CNLB 3C15B 3R7SB 2EFPA 2VICA 2I0XA 4WKRA 4KO0A 3TX8A 3CDWA 1VHFA 2Y8WA 4A4JA 1VRTB 3EZOA 4CWBA 1ZTWA 3HO1A 1XR5A 3HHLA 2DNKA 3CCUS 2HAFA 3BO3A 4IDKA 5E3RA 2MSSA 1T94A 3M6WA 1UPMB 2EPIA 2QN6B 3MM5A 4QW8A 2L08A 1JJCB 1NPPA 1S6QB 2F4FA 5FLXU 3QJPA 3PFEA 1HW8A 1NCLA 1SL1A 1UETA 5U47A 4PAAA 1FTRA 3KLHB 2M4MA 2MZQA 3IRXA 3VWSA 1K8AT 1N33J 2WSEC 5HROB 1T7PA 5A0YA 3OXGA 1DARA 3BGLA 2EFVA 3IMQJ 4QR1A 3G86A 5KFCA 2E5JA 4J9LA 2HMIB 4H4KC 1S72S 3A8JA 4JI4F 2YNHA 5F9LA 2DNPA 2WZ1A 2X51A 4M8LA 4ZPTR 2HHTA 1RT1B 4DL2A 2N4DA 1CQNA 2LEBA 3T1YJ 4YHHJ 2WSCC 1RCOB 1FFGB 3S01A 3QYYA 4UY8T 1XNRJ 3CCJS 4X4PA 2GX8A 5E3CA 3K57A 1D1UA 3KK3A 1X4BA 2BJDA 1ZYQA 1BQXA 3VGTA 1SJFA 3RBZA 1FDNA 4Q2LA 4OFZA 2ZHOA 3ZZZA 4B9UA 2DRBA 4DR6J 4DL0C 2BOAA 1T0TV 3MCMA 4RR5A 4J9OA 1H73A 1KOHA 3FNNA 1FFWB 3WDOA 4DR3J 3KLIB 3IBCB 2J7KA 2KHCA 4Q0BA 3LP0B 2FDNA 3MR5A 2C3MA 2CJ9A 3A3PB 3MMCB 3Q22A 1S0MA 4I6WA 2QSWA 2QZ8A 2ZH4A 5D0EA 5HLFB 2QJ3A 2PI5A 1S1XB 2OH2A 1SJ4P 1YZ7A 2RQMA 4PWUA 2XSJB 4J9QA 1S49A 1B0TA 3C6TA 3MMBB 2B9XA 4L3KA 4CLYA 3W9IA 5IT0A 4KFBB 2XZWA 3TUJC 4DV2F 3CO0P 1BC6A 3HSZA 2ZJRQ 3R2DJ 4YEAA 1SPBP 2JVRA 3ZZYA 4X4TA 2J5AA 4DV7F 1D0EA 3S6EA 4IH5A 2FIUA 3J7ZT 1GT8A 2VPXB 3B6BA 1RTJB 4WPAA 5AXLA 3CF5Q 3NRBA 1ZOTA 3FBCA 3DLBA 5M2PA 5C2CA 3CVKA 4LJMA 3PR5B 1AYEA 2UXCJ 5L8RC 2IC3B 1NKEA 1AFIA 2IJNA 3PR4A 2GIFA 3O8WA 5DDOC 5L1IA 4RWWA 2BQUA 5HBMB 3OSNA 1RT7A 4CM2A 1B7YB 1QJHA 2MZJA 4HTIA 3G96A 4S0MA 1RT6A 4F0MA 4OYMA 1YKWA 2FZGB 2BE2B 1NAQA 3BH7B 2XB2D 5LM7E 2M70A 2ZBIA 3T1YF 2IBKA 2ZZMA 1ZM3A 1TZ0A 4Z2XA 4ECRA 2E1RA 3L09A 3M32A 3NCQA 3T1HF 2RRAA 1JJ2R 4RU2A 4MK8A 2OHDA 5FIIA 1TKXA 1PBUA 2KTQA 4NMXA 2V68A 1VR6A 2XZDB 1HR0F 4NLGA 1JK9B 3AOCA 2X7IA 3U1LA 4QQBA 2ZH5A 1YWXA 5IM0A 1HBMB 3SIPB 3PX4A 1HWLA 1MN9A 4B3MF 1X4CA 1RTZA 2AJ2A 1TKDA 3EXYA 3SV3A 1CJUB 1KNZA 1VQSA 2V6AA 2B4UA 3FFIB 4KV8A 3PW2A 3H5SA 1ZM9A 2V0NA 4RNNA 1E6VB 5KG5A 2H5JB 3SCKE 3QGIA 3Q83A 4Y65A 3ONQA 3PZPA 1L3SA 1FKPA 4K7QA 2G2ZA 1OPZA 3GCXP 3H8YA 5HL7Q 1J5OA 5CXTA 5G4DA 4RKUC 3SCIE 2F8MA 3HSDA 3OJSA 2K7JA 3S1TA 4YN3B 2MKIA 3MUMP 2OD6A 1RT3B 4M5LA 2V67A 4DV7J 2UUAJ 1V3ZA 3D7SB 2JEIA 3M8WA 2ZNZA 1RT2B 4FN5A 3JQKA 3OVAA 5C25B 5B0AA 1FRXA 4DV4F 1G3OA 3ICLA 5EWGA 5DG8A 2R2TA 1M90T 3JYTB 3DMJB 4KY3A 3C15A 3W1YC 2KFZA 1S4EA 1YBAA 1HNXJ 1S6PA 2VOOA 2VOPA 1VQ7S 2PFFB 4UQTA 3TA2A 3JAMY 5K8MA 1KTVA 3ZZUA 3C2PA 3HVWA 1RWXB 2Q1LA 4IG0A 5DQGA 1YJNS 4F4AA 2F63A 1OSDA 1T9WA 2GW8A 2YX7A 3BBBA 2P6TA 3H98A 3HULA 3IBWA 3MMJA 1N5VA 4ZPWR 4M95A 3TP2A 3M2RA 1VBKA 2Y1JA 1JIHA 2OTLS 4I4BA 3TYTA 3TVKA 2DR8A 5IWAF 4X62F 5JVGQ 3I0SB 2LFVA 1B0PA 3BYRA 5F41A 3LAMA 1WC3A 3O5TB 2BANA 3IR7B 5I42B 4DSEA 3X1LB 1YTYA 1R31A 4ZN3A 2XWYA 2U1AA 4BDPA 4K5RA 2MGZA 2FC8A 4I2QB 4OX9J 2LQ9A 4F4XA 2RKIB 2CQ1A 3ILIA 5DDQC 2NPIA 4Y6IA 2W1BA 5GMKa 3DHWC 2AEJA 1W26A 1IKWB 2KVIA 4DF4A 1NJZA 2BVZA 1GK8A 1SH0A 2ZH7A 3PW0A 2EFNA 1LWCB 3AT1B 4O44B 2J0QD 1RTHB 1RAIB 4UOCA 5A8WB 2IVMA 2ADBA 4TNOA 2GQCA 1VQ9S 5AXNA 2ZUAA 3LALA 4YB5A 1VK8A 2NZCA 2V50A 3SDEB 1AZSA 1HWJA 3QT6A 4LSNA 1IBMJ 5L38A 2W2MP 2HIQA 5JXSA 1OYEA 2EXUA 1W2IA 1WEYA 3CJKB 3ZC4A 2R2UA 2LQJA 2JEGA 4I56A 3DI6A 4DQPA 2NLWA 4DR7F 4UUWA 1N88A 3ETOA 1TUGB 3CJTA 3FSXA 4M5HA 5C24A 2F40A 2GJIA 2B6AB 1KR4A 2AGOA 2UUBJ 4FF4A 4Q2MA 2BW7A 2HQCA 3G8QA 4OI3A 4XPEA 3PYGA 3MURP 4CLFA 6AT1B 2FYXA 3P8BB 1HNWF 3LWMA 4C8ZA 4FNHA 2GHVC 4QWAA 1H7XA 1WOOA 3EDRB 4ZP8A 1TU0B 2ILYA 3U1MA 5H9FJ 2HQGA 1AW0A 3GJTB 3BBCA 1JLCB 3FSIA 2VBYA 2ZOMA 1SV5B 2AZ1A 3LA0A 3N28A 4Q44A 3JTPA 5J2MA 1NBEB 3I4PA 1YVFA 2OMOA 3G9CA 4XK8C 2J6SA 1GX6A 3F56A 4P71A 5KTQA 3IO1A 3HVTB 2YWHA 3HCXA 2DB1A 5KFIA 1PIEA 1KFDA 4LIRA 4DI6A 1HQEA 2H3EB 4GMKA 1B70B 4B9VA 2W4PA 3VAJA 2MKHA 1HARA 1Z1ZA 2WHOA 4J9UE 1S9FA 1FEEA 2EC2A 5M2UA 5LXRA 2XTJP 3VVUA 4G1QB 1WKJA 5D6GA 4L76A 2HGNA 3WQPA 2LEPA 2C2RA 5IQ6A 4FBTA 2J76E 2X1FA 2OEMA 1Q7LB 2NYIA 3G8TA 2R8KA 4WK3A 5KFQA 1OSCA 1I6JA 2LXUA 4TY8A 1LWFB 2DCUB 2GCFA 1VBYA 2FQQB 2CG4A 4LF1A 4YP3A 4X4QA 2XS5A 3OR1B 3TWZA 4K4WA 1O5JA 2DTJA 4JI6J 4ILRA 1YJUA 3IWNC 4F8RA 1WHYA 4LIWA 3M8PA 2YKOA 1F3FA 2ROEA 1S5ZA 1H72C 3UNYA 3PEHA 4YS2A 3MR2A 2BE9B 5BYQA 1YJ7A 1HBMA 2J9EA 2DRAA 4YB6A 3M8SA 2MDAA 4Q0BB 3OHBA 5KT4A 1Y5NB 3KG4A 4UTGA 3LAKA 4DV3F 3HK2A 2ALYB 3B4MA 3OVBA 4GC7A 3FRYA 2VPYB 3DKDA 3H2LA 2LVWA 1I94J 5H1SV 3BKFA 3QSYB 4FYVB 5D4OA 2EVZA 4ITSA 2VC1A 1FNXH 5DETA 4J37A 3M6XA 5DRKA 3U02A 1C1CB 3VAIA 3VQSA 3OL9A 1NHVA 3W61A 2AX1A 3LPYA 2R9LA 4ECVA 4ED7A 2P9GA 2I5JB 5CH7B 5A8KA 3WX8A 1XTZA 4OZ3A 1RT2A 1HR0J 1KDNA 4NASA 3FK4A 4CLKA 3Q8YA 3PG9A 4CYUB 3HMJG 1Y0HA 2W7PA 4KFBA 3GIKA 4KR0B 3JSMB 3D3CJ 4FDFA 4DG1B 4DOZA 2QSFA 3SYZA 1NSKL 5J1NA 2C42A 3FDSA 4BLGA 2HHVA 1FJCA 1TV6A 2DNRA 3VGVA 2GIRA 2GO9A 4W4MA 1IBCB 1FRKA 2V4QA 4JI1F 4TLQA 4MKYA 4NRUA 1UW9A 1VYAA 1Y11A 2A6MA 1LFWA 2ZBRA 3PYEA 4USJC 4B17A 2MQQA 3HKWA 3PV8A 3PIOQ 2MQLA 4LRBA 4OI0A 3TAPA 3LGMA 3NY0A 4OYWA 4U95A 3DOKB 2CDRB 2XNRA 4AXJA 2MHEA 4C8YA 4F50A 3DGPA 3CPWR 1ACMB 3HVRA 4ED2A 3T1HJ 2CNNB 2CPYA 4IG3B 5C42B 2FLPA 1BWVA 2VH7A 4A46A 2O1PA 1SQGA 1RT6B 2A0FB 2YKMA 5GAHU 3OL8A 4ED5A 1KVIA 1FE4A 4C8KA 1H0HB 4ZVFA 2CXEA 4K5SA 3PKMA 1WI6A 3D0IE 4DSFA 1BD6A 4LF8J 4M63A 1KHVA 4RUAA 2FVSA 2HZAA 2OI2A 1E6VA 4QPXA 3JQMA 4Q45A 1EP4B 1RHJB 2DIVA 2A6OA 4HTJA 3UO0A 1UVLA 4ECUA 4C8MA 1TL3B 1F2GA 1V3SA 1CJUA 1LFPA 2LU2A 1U09A 5KFGA 3MM6A 4PKDB 2IIHA 2PE8A 3TZXA 1R8PA 2HNYB 3F44A 1XC9A 1RUSA 1RAAB 2E1MC 3DLEA 1N4LA 3NAHA 5CYMB 5KFHA 1WEXA 2QIFA 2GNKA 4OZJA 3M6VA 4FF1A 4UOHA 1SC3B 2XLKA 3H2UB 4RBTA 3GQCA 4KH0B 3GIMA 5HVGA 3WC0A 5F0UA 4DUYJ 3H5XA 1RP5A 1RWVB 4DBQA 5T41A 4CZCA 1FWPA 1Q8LA 1SC6A 2MKSA 1UA0A 1S6OA 2J9DE 4ALZA 1F5CA 1D09B 4CT9A 2PD1A 3JQJA 3QMQA 3HXMA 4RUBA 3LO3A 2VONA 4B9MA 3M6UA 2KT2A 4DCOB 4W90B 3WX4A 1KHWA 3W66A 1ZAXA 2IAJB 1ZM4A 3FMBA 4WXWA 2MJNA 3PVXA 2J6TA 4WU3A 3VVTA 4DS5A 3MM7B 3UDVA 1HWIA 2G1HA 3HI9A 3HP6A 1O0PA 2AW0A 1FFSB 3OW2R 4MIAA 4OV6A 3T19A 2W2OP 4LBHA 3UN2A 1S1WA 2FC9A 2KG0A 1TMMA 2NXNA 4NZ0A 4IYQA 1NDPA 1H98A 3UD3P 2HLUA 1J5OB 4HHJA 2N4CA 1FX2A 1Q1KA 3EZ5A 3UCUP 4DPTA 2NXJA 3VGSA 1MN7A 3M8QB 5ITHA 1CJTB 3AXKA 2YX4A 3CJ5A 3ISZA 1GMWD 4DS4A 5FJ4A 4ED4A 2CYYA 2ABYA 1RJJA 2G0JA 3UDCA 2ZE2B 3GJSB 3AD8C 3R1HA 3MGJA 2ACYA 2E1CA 2JX2A 3DM2A 3Q89A 2LDIA 4PG6A 3A8EA 4CH1A 3OFHA 4DX5A 4GVLA 3DI6B 4KH1B 3NS7B 2P2CB 4QIWD 3IR6B 3SV4A 2QL9B 1NKBA 2FTRA 2IFXA 3NG8A 2IVYA 3J80Y 2XO7A 5B08A 1LWEB 3BR8A 1GXUA 2PMWA 3LOUA 3SDEA 3ZXWA 2W9AA 4LSNB 4WCEQ 1Q53A 3MR3A 1QAXA 1M5PC 2FLNA 4HI2A 2QE5A 3BKTA 3D1QA 4PXBA 2ZC4A 2KU7A 2VBXA 3DXSX 3QAUA 2Z58B 3BQ0A 4QBUA 4QU6A 4F36A 1TL5A 2KRRA 3VR1A 5D4NA 2W2PP 3KYLA 2DY1A 3FUYA 4TYAA 2AYGA 2OEJA 1RBAA 5K8PA 1XMBA 4KGVB 3OTEA 3PIPQ 1LOUA 1UFLA 4DR1F 1CSJA 5B0CA 5E0OA 2UV8G 4OHYA 1Q82T 3C14A 1KQKA 2NR0A 1B64A 3R8YA 1NPKA 1T03B 1S59A 2MLZA 2HNDA 4CO2A 5LJ5Y 1NKCA 4PEOA 2OLWA 2BE7D 3LP1A 2UVUA 3OL7A 3MPWA 4PUOA 2E9TA 3T5KA 2M0GB 2PN6A 3I96A 2CPEA 3I87A 3KLEB 1WG1A 2FLOA 5CYQA 2BXJA 2DGWA 3I0RA 3JSBA 5IWAJ 1U49A 1UEVA 2UUCF 2FJDB 5LSRA 3IWLA 4M5MA 4OHVA 4FPIA 3UVJA 8RUCA 3DOMB 1JJHA 2Y1RI 3GP9A 3KLVA 5E3QA 1FJGF 3RYLA 4BC9A 4F25A 2DD8S 3DRYA 3DOKA 2FHKA 1VQ5S 4NXMF 2DT9A 4QYZJ 4IFVB 1YRXA 2B5JA 5ETMA 4GKJF 1U0HB 3QIPB 4DR2J 4QZVB 3CCVS 3PACA 1R89A 2MB0B 3RAQA 3X3UA 1LKZA 2CPFA 2OPSA 3ILOA 4C6AA 4IKAA 2NYHA 4GO7X 3IFEA 4CLLA 2KJWA 3B78A 3HZEA 2RS2A 1JLBB 1AB8A 3PO5A 3K17A 2JLGA 2DGVA 1YBUA 3CJSA 2ZH3A 2C2EA 3K0JA 1WTFA 3HLUA 2UUBF 3NXZA 4WF9Q 2DNGA 3C19A 1VRUA 3BEGB 3MEKA 2JFKA 1WOSA 1HYSB 4USWA 4KKOA 2OPPA 1ZTTA 1NUEA 1FKOB 4FZVA 3OUYB 2DR7A 1LWXA 2E5LJ 1WHWA 2CZ9A 2RF2A 3TEHB 3Q0AA 2FJXA 2V34A 3BO2A 4LF5F 2VQEF 1KBRA 3AHPA 3BPDA 3MM8A 4DN0A 2WB1D 3BN7A 4PABA 5G0RA 5DLGA 5J2PB 2WW8A 5LMNF 3CD0A 4M5DA 2ZHBA 1IUJA 4RNOA 4DV5J 4ZOSA 1CQMA 1MW7A 5ETSA 1TKTB 1TKZA 1FTCA 4X84A 3IN5A 3CXCR 3MEGB 1B7FA 1KVJA 1NHUA 4UT4A 3Q8RB 2GQQA 1VQYA 3UN3A 3MFHA 1IBLF 3OFGA 3NS5A 3M8YA 2O01C 5DO2A 3K89A 1Q81T 3MPVA 5HQMA 4V19J 2G4BA 4ZVQB 3NBPA 1N34F 5CCLA 2L9WA 2C2MB 2EI5A 2H5EA 2V2VA 2VBZA 2NPFA 3US5A 1R0AB 2UXBJ 3JYTA 4KHPJ 2DGSA 3EGNA 3FCVA 3MCNA 4ZS6A 1TV6B 4OJ3A 3CD7A 2DXDA 4ZCKA 3SSRA 3GPAA 1T9YA 1KKHA 4K2JA 3V81A 1APSA 1C4AA 4PPDA 1TL1B 4QYRA 1PJ5A 2MZ1A 2OTJS 3DGPB 5ETVA 1RABB 2KXFA 3UQSA 2OD4A 1FWLA 2H9ZA 4IG3A 1JLAB 2OFHX 3U1NA 3H2VE 2HFNA 3QWPA 1RBLA 4P7TA 4KB7A 4FYXB 3R7NB 1TVRB 1ZAVA 2PMZD 1AROP 2FY8A 1T11A 3LPEA 3N5BA 4ZVUB 2OKQA 1VC5A 2QMUB 2IJFA 4WP3A 3THPA 2LDYA 3H25A 4RNHA 5ETNA 1RHKB 5CZVA 1SC1B 3MD1A 4CI0B 3OD2A 2CQGA 1S6UA 4NWBA 1HPZA 1IKYA 3DYAB 1WEZA 2D9PA 5M2RA 1C1BA 4ATNA 4B3TF 3KJVB 4JV5J 1CC8A 1X4HA 2MQMA 1F0XA 5IC4B 4PRFA 2HK3A 4YY3F 1OYDA 2G2YA 2VUGA 2G0CA 2HWIA 2CQDA 3IA0A 1R0BG 1YZ6A 2AJ0A 2K7KA 3FBFA 1IKVA 4TU8A 1U26A 3K5PA 1B99A 4YDXA 2AIRB 1TL3A 4TQRA 1SKSA 1F3VA 1YIJS 2VJVA 2YQ1A 2XLIA 4DZ6A 1D8YA 3GJRB 2OEKA 1FVQA 5HATA 5KFSA 3NMRA 2VQFJ 2XI3A 1VQOS 4OHWA 2VL1A 5BYSA 1N0VC 4RX6A 4B3MJ 4ANCA 1X4AA 4RW8B 2NSBA 3OTCA 5B0DA 2VG6A 1IBLJ 5CYMA 3CNQP 3IG1A 2HGMA 4DV1J 2UU9F 4K4VA 1UEKA 2QL7B 2WSFC 3NGKA 4X4RA 4K59A 1DQAA 2XBPA 1MU2A 4OYAA 1X9WA 2BUNA 2CQ3A 3HM9A 1VIOA 1PILA 1F9FA 2XZTB 1DLOA 3ZO7A 2VPWB 1RWKB 1BE4A 2YNGB 4RW6A 4EI2A 2H48B 3OL6A 2HKEA 3HHDA 5KFFA 1HQ2A 2YVSA 3BBFA 1PSDA 3H5UA 4ID8A 2DK2A 3CJRA 5E3AA 4ANEA 3BQ2A 3FGVA 5EWFA 3SQGA 3QZ7A 3MM5B 4UOGA 3QPIA 1N5QA 3H0PA 2RRNA 3W7BA 3G71S 4URQU 4NL5A 2M5YA 2ZWOA 1VBXA 1NK5A 4LBIA 5DLFA 4F4KA 4NLSA 3R5AA 3MF5A 2XC9A 1JXVA 3DDKA 3OR2B 1PAUB 1QTMA 1W7WA 4I6YA 4KBIA 1KN6A 2HURA 1GH8A 4ZVRB 3PYFA 2VZ9A 4IH6A 4ED1A 4N77A 2YX1A 3HZGA 5K9FA 5D0HA 4C3LA 2ATCB 3CDUA 4IFVA 4DFPA 4JV0A 1VRQC 4MFBA 4Q7AA 4N56A 4DR1J 1HFEL 1KLMB 3SZ2A 1S57A 1H38A 1EKSA 1RTDB 4I67A 2ACMA 3IM8A 1QM9A 4TN2A 4DQSA 1N8RT 3GMGA 2R7XA 2H4YB 3CMES 3DRXA 3J7Z5 1TMJA 3PW4A 2PO4A 1X4EA 2Z56B 2HWHA 3WC2A 1FJ7A 2JEFA 2CPIA 2FY1A 2QEXS 4LFAF 5F3ZA 3R3TA 1JKHB 1ZZNA 2ZZNA 4CO5A 1Q5YA 1T05B 2RAQA 4TY9A 2WTFA 3DOLB 1G2EA 1FRHA 5IT4A 3M8PB 1C4CA 1WG5A 3MD3A 4GRSA 2CQBA 4RWXA 1W25A 1FERA 4ZPDA 3DLGA 5FDLB 3W9HA 2PSZA 3NMAA 5KFUA 1WSRA 2PGCA 3R5GA 1FRIA 2EC0A 2MKKA 1M5KC 2DHHA 1N52B 4M1KA 1RADB 3G6YA 1EAYC 2F3JA 2Z2MA 1RYSA 1T9UA 2GS8A 2V8GA 4G1PA 1TK0A 4NXNF 4X2BA 5MAOA 5HJXA 1TELA 1QY7A 2CPJA 3HHLD 3A3NB 4B02A 2HBQB 3CWJA 2ZH6A 3C14B 3HSJA 4H4KA 5MLCV 5GVQA 1IQTA 4FNIA 1X5SA 4L6V3 3L95X 2CNKB 2UVRA 4LREA 3BGFA 3CIMA 1SI9A 5AJ3J 1UZDA 2C22A 2ZH2A 3PRVA 1SJQA 4JI5F 1QDUB 2FHOB 2LU1A 1RAEB 4OI4A 4QIVA 4CDIA 2PI4A 2CPZA 2Q6BA 3R97A 3W64A 1HNWJ 3MM9A 2IC3A 2HS0A 1ZA1B 4TLRA 4V19X 2Y8YA 4P72A 2F9DA 3SEOA 4ZKAA 1K1SA 2OIHA 4B9SA 4YB7A 2EFQA 4TKTA 2VF3A 2LEAA 3I0RB 3VGUA 4P2MA 2PEBA 4URSA 1RBOB 4CLPA 3MUTP 1PCAA 4HACB 2CQPA 5JVHQ 3JB9k 3PTWA 4DUZF 3O6QA 3SQOP 2KJVA 3DNCA 4EFAC 2DNLA 3L9ZA 4U8VA 2GV1A 4P10A 5J1PA 2ZNYA 1PG5B 2RRBA 1UAWA 4ZJLA 2QRRA 5HO4A 2LKZA 2FGOA 4PG8A 4LMZA 4RBVA 3EGWB 4LSZB 3UWTA 3MTKA 3OFFA 5F0WA 4X66J 4QWEA 1WSVA 4HT5A 1MNEA 3O2IA 4A47A 2YY3A 3GV8B 5EX3A 3UFCX 4F4YA 1X9SA 5K8NA 3TQEA 2DHAA 3WIVA 1YDLA 2B8PA 4YR0A 4URGA 4NLTA 2E7WA 2RS8A 4IFYB 1WF0A 2GFFA 2YKMB 5KG3A 5F8IA 2MKYA 2WW4A 2ZM6F 5HP1A 1T8EA 3CULA 4ZLLA 1HYSA 3QFWA 3P6YC 2AJ1A 4UZBA 1FXRA 1UJ4A 4CO3A 3BGUA 3EVWA 2J0WA 4CQ1A 4DWIA 2AEMA 4DHVA 4WFNQ 2JRSA 2ZDPA 2XHCA 3PRDA 5A76A 4C2MA 3CJ4A 4HT7A 4J9KA 1M5SA 4Y2MA 3KJFB 4QWBA 1RAJA 1XNQJ 3VALA 3QATA 2GIQA 4DPUA 1DTQA 3AD7C 4HYKA 1EX8A 2LQBA 2QGFB 3W65A 5KOXA 4WWSA 4M94A 4BWJA 2DNZA 3BS9A 2YBVA 2HFUA 4NA1A 1BQMB 1FEHA 1RA7A 4A8YA 2BW2A 1TKZB 2MTLA 4WU2A 2YNGA 2WVCA 5GAGI 1BQNB 1JLEA 3MR6A 5AE1A 2KI2A 3DRRB 5E7OB 1UJ6A 1RLDA 5KT3A 2OGUA 5HSPA 4K4ZA 3RTVA 3TQ1A 1IXKA 2V8DA 2V9KA 3D6HB 1VRTA 4IG0B 4CO1A 3FMWA 4LRDA 4A8OA 2CQCA 2F9JA 3B4DA 5L9NA 2V4RA 1Q0NA 5ETQA 1R6VA 4DV0F 4E8UA 1WC6A 8AT1B 2YKNB 4LR7A 1FT8A 1S0VA 3EGZA 2FUG9 3QFHA 4OX7A 2XMAA 1XMOJ 4WZQA 4X4VA 1DJ0A 3SSQA 1YI2S 2HVHA 4R25A 5ETTA 3F0NA 5T7LB 2C3UA 4ILLA 3J7A1 5GAEI 4UZCA 3WZ0A 2B9YA 1KSPA 2W2NP 1ICEB 3UDEA 2F8EX 5HROA 3C16A 3QJJA 2X1AA 2HVIA 3TA0A 3NP5A 2ZD1A 4Y0FA 1ZPWX 4DUYF 1PGZA 2IDEA 4OHZA 1U4BA 1RLCL 5HMWA 7FD1A 2BX6A 4R5PA 5DG7A 4L75A 1JX4A 2EK6A 2XCAA 4IUFA 2HQ3A 3MAQA 3MAAB 1T95A 4DX7A 4J9MA 1XBWA 1U24A 2P8IA 2UUAF 2I2YA 3M8QA 5KFZA 2HW3A 2HMIA 5ADZA 4KHMA 5LSOA 2CIMA 1N36F 4TU9A 3KJVA 1C2PA 1YJ9S 2NXUA 2KZMA 1N5SA 1JWWA 3I82A 4OYZA 1F9HA 5ETLA 4QR0A 4YDDB 3KK2B 3DM2B 2QLJB 2N7YA 3DU5A 3MMAA 3I32A 2QV6A 2NCKL 1ULRA 2P9CA 2DNOA 4N7TA 4NLXA 3DC2A 3ZTPA 2R7WA 4A8WA 2FJWA 4ZP6A 1EQ0A 2IBOA 4USUA 3RU0A 4EMDA 2IMOA 3D6FB 1S97A 4NLQA 2UV8A 2GGPB 4C8LA 1SJ1A 5IZHA 1G4CA 3R5JB 4ED6A 3DGVA 4NLOA 1D3WA 2B43A 4IR9A 5B0GA 2UXBF 2V8HA 1PBAA 2FZCB 4YB1P 4DF8A 3BDEA 2O67A 1XJWB 1LK7A 3KK1B 2ZKTA 3IG1B 5DQIA 3DLHA 3KLIA 1B0VA 1O51A 3VZIA 2FVCA 2CQ2A 5SUHA 3CMQA 5L1LA 5IT9Y 3K7RA 4WP8A 4IOCQ 4ZLPA 1RE1B 2HWTA 2JSXA 2H4WB 1QUVA 2HK2A 5BR8F 3N0VA 3EYZA 1NJYA 2XMUA 1V9OA 2KN4A 3E2EA 4X4UA 1KONA 1S1XA 3M9MB 1NK8A 5D77A 3MPYA 1XMQF 1XERA 1KOOA 2HBZB 1S1VB 2AKWB 1TAQA 3CJ0A 1YQHA 4IO1A 5LT5A 1AUDA 1MROA 4MT1A 2RQCA 3TW0A 2IHR1 4I1TA 4RW7A 2CQIA 4PG5A 2D74B 3AD9C 3T1AA 2KL8A 3EUNA 5A6WA 4DQRA 2M8DB 3WIUA 4JV1A 1NK4A 2W9CB 2Z4PA 5L46A 1RU1A 1OY9A 1RTJA 1ZA2B 2HQFA 3VQTA 2VPZB 3NS6A 1X5TA 1WF1A 2J0XA 3HVAA 3MFIA 2MPUA 3CCWA 2CJBA 2YNIA 3IS9A 2MQPA 4X4OA 3IRWP 1WHXA 2N7CA 4WFXA 1SB6A 2CPXA 4LR8A 2OSRA 4PCQA 1UVIA 3CEDA 2JLFA 2KDOA 3P49B 2KT3A 1YX2A 3NCRA 3PDNA 1AXQA 4KSEB 1U1OA 1RT1A 1XNRF 2B9EA 1TFYA 3GJQB 2UVWA 3M7VA 2QL5B 3PX0A 1URNA 4G65A 4USIA 1KC8T 1JMTA 2DNNA 1JKHA 5D3GB 2KFNA 1XR6A 1K0VA 1PYTA 3M32B 2VD3A 1YG0A 2IM1A 5HQ8A 4I68A 2R2SA 1XMOF 1TK8A 4FVMA 5FDLA 1MG7A 3VAHA 2DNMA 2D1CA 3DLGB 2ASLA 2VQFF 1HNZF 2W7AA 2GC8A 5DZ7A 2WBRA 1IWGA 2MQ8A 3TANA 4IQXA 4DPXA 3TO8A 4LVOP 3Q2TC 3KHLA 1A7GE 3I4HX 2DGUA 2IY5B 4W92B 2XSFA 3MMCA 3KTQA 2CQ0A 4A8QA 2AX0A 3A1YG 4B3SF 3MUVP 3A4TA 2XSJA 4FP9A 3SCLE 4KTQA 4DR4J 4NCAA 2APOA 1HWUA 1X60A 2ZUGA 4CH0S 4DX8H 2KXHA 4K4XA 2DPJA 3DMJA 2QYGA 3THTA 2G13A 4N47A 4WXOA 1BGXT 1R8HA 1VS3A 3V5RA 4C0BA 5KFMA 1TTHB 3UN5A 3F73A 1GEHA 2R2RA 2VHGA 1RACB 4HKQA 3MTJA 4OJGA 4NLUA 1NRKA 1HHTP 2UVVA 3IP0A 2FD2A 4DR2F 1O8BA 1HLWA 1OQ3A 2YKNA 1U25A 1Y4ZB 3FC9A 4JI3J 2H65B 1QAYA 2K06A 3MHYA 4CCHA 1R0AA 4DZDA 4G3IA 4B3OA 1TL7B 2BZ2A 2BJ3A 3ZNJ1 3UW1A 3ZTSA 2D3O1 1KQSR 4DSLA 1JNZB 2E7VA 1I94F 3BSCA 3T6BA 2HVEA 3GILA 4ID5A 3TZZA 3DLLQ 2XHWA 2LQ5A 1Q8IA 3BSAA 4LF6F 4DV3J 3VAKA 3RBDA 2UUCJ 1UFWA 1P9QC 1X4FA 4Y28C 1AFJA 2BEFA 1FX4A 4NEYA 3RGIA 3J7YI 1JXLA 2J6UA 4USVA 1FI4A 5EN1A 4J9VA 3G6ES 2ZD1B 4MKAA 2DR6A 1S9EB 2MZTA 1XQIA 1HD0A 3DLKB 4IFYA 5EWEA 2VBWA 3BV8A 4C0HA 2BE2A 4YMEA 4AL5A 2IDLA 4JI6F 1B3TA 1REVA 5KFAA 1QSLA 2KM8B 4O3QA 4H4MA 5E33A 4CT8A 2I38A 3PM9A 4ES2A 3R7BB 3K8WA 1JLGA 1UL3A 5KFVA 1RKJA 2JJ4D 2BKOA 2B4PA 2X1BA 2DISA 1LWCA 4O44A 5DDPC 2DHSA 3V6HA 4ELUA 2AHOB 3T5JA 3J81j 1HI1A 4NI2B 1KWMA 2ZH8A 1HPZB 1IKYB 1IKWA 3A8KA 3DYAA 1CS4A 4J90A 5L9XA 4MKVA 4WE1A 5IQQA 1BLUA 5KFYA 4G6VB 3KLFA 2FHJA 2JFDA 3M9NB 3KHGA 3KXDA 2MYFA 5AXKA 2C2OB 4NYZA 4EU0A 3MXHP 5HVHA 2J9DA 2YNFA 3QGGA 3K59A 2AGPA 4N8NA 3RR8A 1U8SA 2IM0A 3CB4A 3NNHA 2D69A 5IOLA 3QSIA 2GVZA 3BB5A 2QA4S 3D1OA 4JI5J 2VB6A 3WHIA 1RAHB 1U1LA 3FVYA 3GSIA 2V63A 3V6JA 2XMVA 1YITS 2XYHB 3HX9A 2AMCB 4J5OA 2W7OA 1PC5A 2KT5A 7AT1B 2CJAA 4RU9A 4PXEA 3PKYA 2EG2A 1A9NB 2ADCA 2ZJPQ 4JB8B 1GMWA 1Q95G 2CQ4A 1RT4B 2WRMA 3P96A 2R7OA 3MPDA 2G9OA 4HDGA 1NJIT 3MOJB 1F5BA 1N54B 2OUGA 2Z8QA 2CNOB 1H2TZ 4CRJA 3EXCX 2Q79A 1DLOB 4PXCA 4DJBA 2HFZA 4PWDA 2OAUA 2CVIA 5HI7A 5D4LA 1PAEX 4LT6A 5EDWA 1HBOB 2MMYA 5T7LA 4QIGA 1YLXA 2G0IA 3HJVA 4HH0A 3QT5A 1Q7YT 3L7PA 1L3KA 1FA0A 1U7LA 4DUZJ 1NDKA 1IR2A 3BPSP 4ZN1A 4F3OA 2P6SA 2W9CA 4NMLA 1KQFB 3H4BA 3KDOA 4ZVSB 1EZZB 4JI3F 2GVDB 1NJXA 1M5VC 1G7CB 3NGSA 5F8NA 2HRUA 4Q8EA 4PWWA 1UVMA 2B51A 4KAIA 3AQPA 3JTNA 3V4MA 3BDPA 1WORA 2HG4A 3ETMA 3ZZPA 1N6QB 4WFAQ 1WG4A 2GAHC 3DRPA 4NLYA 2ZE2A 4OI6A 1LWFA 3LF0A 3WBZA 4CH7A 4EYHB 1SKRA 2ZOFA 2EKNA 3NOGA 3OV7A 2XGQA 1OIAA 4L3NA 1FK9A 1HNVB 1NSQA 1IM6A 1H3DA 2NXEA 1W2BR 2CDQA 1NK9A 3HD2A 3KK2A 1IBKJ 1RTDA 4B3SJ 4ELTA 3EJMA 1I3OB 4QJVA 4TY8B 2XO6A 1NK6A 1RZMA 3ZZRA 1TP7A 4RPFA 4LSLA 4ZITA 4Z7YA 1C0TB 1PKUA 2GHPA 3KKFA 5KG2A 3NGDA 2BOPA 4B9TA 4NXNJ 1CEZA 1S0NA 1Q79A 2VDHA 3M05A 3MMAB 2K3IA 2RUGA 3LQVA 3TRGA 3EDQB 4CTAB 5KG7A 4EBCA 5H9EK 4CLZA 3H42A 5KFRA 1I5OB 2OO4A 4JBCA 4ZDNA 1QE1A 5KFKA 2R8JA 3KHRA 1KD1T 1EETA 5E41A 3AJDA 5L39A 3D6TB 3MCOA 3ZTQA 1N36J 3PNIA 2CQHA 1J27A 1WELA 2DEIA 5CCMA 3V2UC 4YY3J 2L41A 3KK1A 1HMVA 3MEEA 3Q24A 4USMA 1IKXA 1X7VA 1R43A 1U2CA 2DRDA 2YQ3A 2ZZTA 1UWBB 3TR5A 2DXFA 2DIUA 4AYBD 5JUMA 4LF8F 1VMBA 1G1XA 1C1CA 3IBFB 4OYXA 2J7UA 1JLCA 1SKUB 3B82A 4LF2A 3K5LA 1N56A 3QO9B 4RUCA 1WDTA 2RHQB 2HLTA 2I5JA 4HI1A 4I64A 4K4SA 1XEZA 2RNEA 3K5MA 1PJ6A 2DITA 2KM8C 2NQPA 3KMQA 1DZ5A 3OXLA 2WAQD 2UXCF 5HAOA 4YUDA 4HH1A 3UVJB 1CC7A 2RJZA 2IJRA 2UUTA 4DXLA 3CC7S 2QFJA 1ITPA 1GTHA 3H4DA 1XIQA 4NZ6A 1HNZJ 3MOZA 4O3NA 5EGYA 3R2CJ 3HF5A 1C0UA 3RR7A 1N5TA 1UJ5A 1TAUA 3R9LA 1OY8A 1PYSB 2L48A 3EICA 3CCQS 2OPRB 2DJWA 4FKXA 3IS9B 2YNIB 3VV2B 4KC5A 4CNZA 5J2QA 4KHPF 1PJ7A 1VJWA 2VFRA 4M5IA 1JLQA 5D15A 2W25A 2DNQA 4ZHRB 1KFSA 2K1RB 1YJTA 1SQFA 4GC6A 1REVB 4YR2A 3K5NA 1JNRB 3GG0A 1CULA 3OR1A 2HRTA 1K73T 4H4OB 3POTB 1NZAA 5HBMA 2VU5A 1YJRA 3FEYB 3SMZA 2D3OR 4JYAF 1VRUB 1L5UA 2WBMA 2EWHA 5KFBA 2B8QA 5DM6Q 1WDDA 4J9NA 4X4NA 1FRJA 4P6QA 5LMNJ 4DR3F 1IQZA 4JI7F 4W98A 4C97A 2C2ZB 4WYWA 4B9LA 1Y10A 4ECZA 1WKKA 3PO4A 3ILLA 5CD4H 5EX0A 3CCSS 4ZVOB 3L3CA 2MQOA 4K0KF 1H2VZ 4BHQA 2HBRB 2BBEA 1J2VA 2L9NA 3GFHA 2D7SA 3D4JA 3SFUA 2B4OA 3OTOF 1HBUA 1EP4A 4WBFA 4ZCMA 3J81Y 1SL0A 4BWMA 2HSEB 1UEUA 3HDSA 3PXGa 1IR0A 1N0UA 5KT5A 1LW2A 1S7HA 4KGZB 2FPHX 4F0KA 4FS1A 3K5OA 2ZM6J 1NXIA 3FBBA 2V2QA 3OBIA 1RWOB 1D8ZA 5KFLA 4J9RA 3PW5A 1U6BA 3ITHB 5THWA 2NSCA 3N01A 3AJ2A 2YQ0A 4USKA 3VAGA 5GAEU 2F4VF 4CYUA 2WOMB 4OIXA 3VAFA 1FJEB 1BUXA 2IM2A 4ELVA 4LRCA 5BR8J 4ANDA 4XDDA 3PHEA 1D9AA 2OPQB 4GVBB 4O4GA 3Q8PB 1RCXB 2PT0A 5F8LA 3D5MA 2XMMA 1P1TA 1YJVA 3MAHA 4QWCA 2YWEA 3QRQA 1H74A 2RMLA 3RAXA 3C6UB 1JLAA 2CPHA 4DSJA 2WVDA 5LOQA 4WFYA 3ISND 6FDRA 4P2SA 3NWGA 4E0DA 3BGOP 3IAS9 1NEEA 1KP6A 2LYVA 1TVRA 1JXEA 2Z0GA 3A3OB 4UUXA 2BACA 3DLKA 2XCPA 2YH1A 2K3KA 1RYRA 1WF2A 4B9NA 2GHWA 2DNHA 3LW5C 3MEDB 3ELHA 4RZRA 2JLEA 1EKRA 2RD5C 2W9BA 2HYIB 3ENAA 4DL6A 1CBKA 1SL2A 4NLDA 3R6GB 4EBDA 3NL0A 3FRZA 4L74A 3IAM9 5A2QU 2RU9A 4YHHF 3RRGA 4Q5VA 5KFPA 4DCPB 1R27B 4IRCA 3MCSA 1EB0A 4O3PA 7FDRA 3P3DA 4WE1B 3BN4A 4USHA 1NB7A 3H5YA 1CJTA 4O3OA 1SXLA 2W4CA 3OLAA 4NA2A 4ZIVA 4EO8A 4X66F 1HNIB 3N6MA 3KLHA 2P9EA 4OL8A 3KLFB 4E98A 1RT5A 1WC1A 1YBTA 2E7XA 2RT3A 5KFEA 1Z2LA 3QGPA 2E44A 2UP1A 4DUTA 3PJXA 4LF5J 2HQDA 4HVZA 1OWXA 4L73A 4U9RA 4CTAA 2VASA 4ZMMA 4DLGA 4KGMA 2ZWPA 4MJKA 4D3HA 2CJKA 4KGKA 1PYOB 1S1TA 2O3DA 1WC0A 1DTTA 3Q8QB 2ASJA 2XS7A 4K50A 1CJKB 2ROPA 1Y5LB 5HK4A 3GIRA 4NCGA 1IBMF 2C1EB 1EETB 1RSCA 1VOMA 4O0NA 2LECA 3UCGA 4ZP7A 3ZTRA 3ULHA 2WK4A 1TQLA 2JC0A 1HBNA 3M2VA 2QA2A 4RL1A 2A10A 2KH9A 3BSNA 1HA1A 1RA6A 4PQUA 1U8WA 2MY8A 3G6VA 4EO6A 1FD2A 3GFZA 2F8HA 3ENQA 4WIQA 4OLOA 1WWHA 2R42A 3ILJA 3P45B 3CD6S 5B0EA 1RAFB 4MK7A 3RRHA 4KJIA 2HNDB 4GKJJ 5CABA 3CJQA 2HHUA 1MSWD 4PUOB 2MZSA 1UFKA 3O1LA 3T5HA 4ZVPB 3OR2A 3HHLB 1OY6A 2GVDA 2RDJA 1WNEA 2WVBA 3PYDA 1LNQA 2IAJA 4KYZA 4B3RF 2ZC3A 3C66A 3CDAA 4ZJOA 3B54A 1S6QA 1SUQA 2E1AA 2E5HA 3FZ2A 1EJ7L 2PIIA 3MM7A 3HT3A 4U7CA 1FO1A 1HKAA 3V4IA 3A13A 3RB3A 1B4SA 2GAGC 4AL7A 3V6KA 2XQCA 2VG7B 1ZPVA 2Z2LA 2ILZA 4FXVA 2IRXA 1YHQS 1GAOA 3MZIA 5BYRA 3G6XA 5KFWA 1ZZFA 3DOMA 2N3OA 1Q5VA 1PC4A 1VBZA 2C2DA 3VCDA 1HHSA 2FVQA 1EARA 2MKCA 2Y1IA 2YNHB 1NH7A 5HVFA 4U7UK 3AB4B 2AV5A 1RTIA 3HKZD 1U48A 4H4OA 2QO3A 1RHUB 3BYPA 1UZHA 2XMTA 4NZ7A 4JV2A 5J2MB 1Z4UA 3Q8SB 2MHNA 1ZETA 2F1FA 2F65A 2X1GA 2XEXA 2AJQA 2FHMA 5F8GA 2HHHJ 3KK3B 2HQIA 4LFBF 4LR9A 5I3UA 4JP8A 1Y7PA 2CJXB 3QGHA 5K5MA 5LJ3Y 1JLBA 4PYAA 5EHHA 2R7VA 2HBYB 3O44A 4RO0A 4ZVGA 1FD8A 1VLYA 3J80U 4DFMA 3W8PA 3QLHA 1KTQA 1F6TA 2QLXA 1U1MA 1S1UB 3BR9A 4I69A 5A8RB 4FXWA 4KKOB 3W3SA 1P8GA 2HHXA 3FCHA 2BKPA 1SQEA 2EBEA 3RBXA 3BSOA 4AQYF 4DL4A 1NDLA 3RBEA 5DS7A 1KLNA 1UMJA 3QO9A 3W2VB 1FWKA 3Q8VA 2KG1A 4DL7A 4FVCA 3HHLC 4HHHA 1ZS6A 4ZK7M 1OJ4A 3CDEA 3CCRS 2ZOGA 1U1QA 2ATLA 2WOMA 1N32J 2HGLA 2YKQA 4U6PA 5KFTA 2QX0A 1VQ4S 3PEJA 3C3LA 5J1EA 3JAMU 1NLKL 2O66A 1FHTA 1AA1B 2DR5A 1E6YB 2DH9A 3LP1B 3IWXA 1F1BB 3FBEA 4NEZA 5KOWA 4DV6J 3LH2S 1QVGR 4DV1F 1RK8A 4ILMA 5AE3A 2PMHA 2EW9A 4OHXA 4Y3CA 3G87A 2IPOB 4LUBA 4ZVHA 1VI7A 4A8KA 3V6DB 4V1Ak 3FEZA 3RRKA 3UCZP 4C9DA 2ASYA 1K47A 4B3OB 2MKJA 2E9RX 1JLQB 2J8SA 2MJUA 3W2WA 1SIWB 2DR9A 3H59A 2MY7A 1VQLS 3V81B 3ZZOA 4DLEA 1A0OB 2VFVA 4OZ2A 5GADI 3GFYA 5DZ6A 3D0HE 5KFJA 1CULB 3LWLA 1JQGA 2AF6A 4MMOA 2R4FA 1YK9A 1WC4A 3ENWA 4A48A 2M3DA 5JMNA 2V2KA 3TX0A 5D3GA 2A1BA 2MLXA 1SKWA 4FS2A 4L72B 2RU3A 2A2CA 3QIDA 3W5ZA 2VV5A 2Z57B 4ZHRA 1S99A 2EBGA 1NPRA 1GFWB 2FB0A 3G82A 3HFKA 3KG1A 4O0IA 4JI4J 1WHVA 2DEJA 4FKYA 4HDHA 4DQIA 4AUKA 3P5TL 2YTCA 3PY8A 1K0TA 3GSDA 1XNQF 5C2GA 1TKXB 2R7SA 2I6WA 1P9YA 1V5VA 2BKNA 5ETPA 2MSTA 3RB0A 2JC1A 3FQKA 4ED8A 5D8HB 4LRFA 2VQEJ 3RAMA 3CO9A 4EYIB 1FJGJ 1S9GB 1QAJA 4IOBA 3GG1A 3HFVA 3Q8UA 2JHEA 1AT1B 1C1BB 3IR5B 3W8GA 2BQRA 1AZSB 2QYCA 3TUIC 5DGBA 1R8AA 1N48A 3D1HA 3FFIA 1S12A 4KV8B 3MPUB 4XPCA 2V4JB 1CS4B 1DHMA 1FNMA 1IWAA 1RXOB 3ITHA 4OX6A 4OZ0A 2VFUA 1IKVB 3AODA 4RW8A 5G0RB 1H6KX 3F41A 1LW2B 1RHQB 4OI2A 1DURA 9ATCB 3JS9A 5H9EJ 1OS5A 2D3UA 2Y1LB 1BQNA 1JLEB 2AWZA 2CVEA 3D54A 4M5JA 3DRRA 2FGCA 3LGHA 4F04B 4KIAA 2DHGA 2ZVIA 3GLJA 1U1NA 4BS2A 3ET6B 3GR0A 2RB7A 3NAIA 1IJFB 2R8GA 3FZBA 4DDFA 5CYJA 1RWMB 4C4WA 2F7VA 4AQYJ 1LEOA 1IJEB 2FJAB 2FJEB 2GMJA 2EFOA 2Y0BB 3I55S 4C8OA 1MU2B 2XMJA 3I5BA 2KYZA 4ECSA 4TVAB 1MLAA 4EBEA 2OPQA 4GVBA 4O4GB 3VTIA 2VG5A 4USTA 5AE2A 2HHWA 1U02A 4P75A 2RSQA 3NWRA 3QRRA 1T3OA 3OSPA 2A2DA 4PG4A 4U8YA 2OJ3A 1R0CB 2CA9A 4NLVA 3AQOA 2B7CB 2H5IB 5KG0A 1UP1A 2QMWA 4LFBJ 1LK5A 1HWKA 3M2RB 4OQJA 1S0OA 4OMFG 2IA6A 4F4ZA 3RZAA 3SFGA 4LQ3A 3KLGA 1KS2A 2DNYA 1K9MT 1QAIA 5AJ3F 4NLPA 4TXSA 3IGNA 4TYBA 4R5PB 1EQMA 3MEDA 4BCAA 4MFBB 2VG7A 1RI7A 2DO0A 2W9BB 5I42A 2BABA 1WTBA 2XYPB 1U47A 1DFDA 1H7WA 5DQHA 2DCLA 3W60A 4IR1A 1N32F 2POKA 5HN0A 2LMIA 1LV5A 1RTIB 4F4WA 3QT8A 5F8HA 1Y9OA 1G6BA 2FZKB 2W24A 4RJVA 4YQWA 4CLWA 3LP2B 3CD5A 2HRYA 4OYPA 4CNYA 1YRUA 1NU4A 1EHWA 4IO9Q 1S1TB 1WOPA 4XDCA 5A8WA 3CW2C 2GGPA 1U2RA 1HI0P 4B3RJ 1GQEA 2R7TA 3NKYA 3QBCA 3UDLA 4OLPA 1Y3JA 2W4DA 2B3TB 1FDDA 1C0TA 4X64F 4F3QA 1X4DA 1L3UA 3BKUA 3CC4S 2UXDF 2VA3A 4JI0J 2EK1A 4XTTA 5F3TA 2C3PA 3O3LA 4Q8FA 1GXLA 4P7VA 3TJAA 4ED3A 1RWPB 2N82B 2L9DA 2VKRA 4F7VA 2PFDA 3RB4A 1QE1B 3SBMA 1FKAF 2SXLA 5E2QA 2BJEA 5K20B 3TA1A 3CMAS 3CGIA 3TUPA 2J9CA 2M2BA 4U7UD 1T9VA 4C0OC 5B09A 1X8DA 3AOAA 4ERDA 1MROB 4R0JA 3N9UC 3NNCA 4ICLB 1Y00A 1X4GA 3MMBA 1NSPA 3D0GE 2C3YA 1Y5IB 4ECTA 3U27A 2GO8A 1DAXA 2RE1A 2V5HG 2I8EA 2LCWA 2DH8A 1ZH5A 1R6YA 1NNDA 1LW0B 3AY0A 2NREA 2PEHA 1J5EF 2WVFA 3DLJA 4DEZA 1IR1A 1MWZA 2BJ1A 4ZLNA 5KFOA 1L3TA 3TZWA 4DU8A 1SUQB 3HPOA 1NZ8A 1H2UX 1ELOA 2HFVA 1URRA 2C2KB 2P5VA 2IA0A 3KFWX 1OQ6A 3V4IB 4X64J 3KOAA 1DQ9A 1Q8BA 1SBRA 4TQSA 2NXCA 1MWYA 1TK5A 4JYAJ 2ZDOA 4NOHA 5HANA 2KXNB 2V2ZA 4HACA 3TAQA 3N6LA 4F67A 4ZVEA 3CSKA 2XULA 3A12A 3LGNA 4KQZA 5KFXA 4A8SA 1FDBA 2MZRA 1F60B 1U45A 1VK3A 2LQ8A 4LF4F 2VODA 3G82B 1QTNB 5CAAA 3DU6A 2HHSA 5D78A 2W8KA 5KFNA 4N41A 1DBDA 1FDAA 3H7HB 3KJNB 2IMWP 1M0SA 2MQNA 5CQGA 3CTRA 3DHXA 4U96A 4RNMA 5GAHI 1T05A 5HJYA 1U1PA 2YPZA 3UPFA 3LTOA 3RB6A 3H90A 4LF9F 2ZH9A 3N4WA 3QLHB 4H54A 4J9SA 2ASDA 2WCXA 1S1UA 1UCNA 3R5BA 2NS1B 4KHRA 4C3KA 1HI8A 4C3MA 3BZQA 2ZITA 4D3GA 1QVFR 4F02A 2V94A 4ZCIA 1OPIA 3T6JA 1SVDA 2EEYA 1S48A 4Y2CA 4LF7F 1Y3KA 3GR1A 4ZJQA 1R7IA 4R8UA 4CIOA 2DY9A 5L1JA 3DFEA 4RLEA 2YKAA 4PPZA 1Z2ZA 3M8RA 3DDIA 3C8YA 2C28A 4XO0A 1EIYB 2Y3YA 4XAKA 3JSMA 1GMUA 2K8GA 2OELA 3BGRB 4F2SA 2E9ZA 3TARA 1F5AA 2I1RA 3Q2SC 1M5HA 3QNWB 4DR4F 3Q23A 1X5OA 2XS2A 1LXNA 4ZIWA 4P2XA 4Y34A 1IVZA 4KRWA 4EZ9A 3T3FA 1VCTA 2ZKUA 4Y2IA 3UNGC 2FJVA 5LSLA 1J5EJ 3T9NA 5J1EB 1TL7A 4IRKA 4LBPA 1IN0A 1WACA 2VG5B 1E6YA 4DR5J 2YKPA 4LQ9A 3EM1A 6FD1A 4K0KJ 4HEA9 5ETOA 3W2WB 2N3LA 4C8NA 5BJRA 1MMDA 2V8PA 2R7QA 4K8RA 3HFZB 3CT9A 4U67Q 3NNAA 2HFOA 1YGYA 2FLLA 2PA3A 4OI1A 3VAMA 3V6DA 2BM0A 5LMUJ 1SH2A 2BV3A 5C42A 9RUBA 2B7BB 1N6QA 2WVEA 1S9EA 3M2UB 1RB0A 3B8HA 2RH3A 4JUZA 4DCJB 3KLGB 4K4UA 4JI2F 2PA8D 1RWWB 1S1WB 5CD4A 2A3JA 3BJYA 3BO4A 3T5LA 2QT7A 4WFBQ 1P27B 5GMDA 3T9ZA 4CLSA 1JLGB 2IYIA 2LP4A 3QWUA 2PDAA 2QA1A 3PJWA 2HNZB 2ZBCA 2Y0SD 2CKWA 3AXMA 1BXNA 3PCOB 1CJVA 5GMEA 4DFJA 1TR0A 1VQNS 4WTYA 1NJWA 3DRSB 4N5SA 2MGZB 4I2QA 3M4XA 2HVDA 2IYGA 3R1LA 5A2QY 1KRPA 2M7SA 4AL6A 4LF7J 1VGYA 3M30B 2ZEJA 2HNYA 3HT0A 3K2YA 4OZ1A 4P9SA 3TEGA 2V4JA 1UTAA 5K14A 4DPYA 4DL5A 1RAGB 4I2PA 1VQPS 5DGAA 3RW6A 5AT1B 3UD4P 2XMKA 5DM7Q 2DXEA 1CLFA 2KFYA 1LWEA 1TUVA 3ENVA 5F8JA 2NUHA 4P74A 2Q66A 2RIJA 3JXOA 2QTWA 3MM6B 2IVFB 3SXLA 2LA4A 3GE9A 3JSRA 3TI0A 1SCJB 2QLWA 3BH6B 3KNAA 1M1HA 3ET6A 3TVYA 2Z2ZA 4O3SA 1TUWA 4X65J 2AU0A 1UVJA 1GX5A 3QQCD 2AJ4A 5FD1A 4JI1J 3OHAA 2RILA 1DTTB 1S77D 1M5OC 1LXJA 3BM7A 2BDPA 4ZCLA 4FF3A 1N34J 3U7JA 2ALZA 3CC2S 4KE5A 3D3BJ 2X3DA 2E29A 4KO0B 4EWTA 2W8LA 2WB4A 2MXYA 1S76D 2C2NA 1UVNA 3D66A 2UZAA 3QT7A 1FXLA 2IRUA 1FNOA 1RWUA 1S1VA 1VC0A 3I6PA 4NYOA 3OVSA 1GXTA 2QLBB 3OTBA 4ER8A 1HL6A 3D6MB 3KUGA 3TOQA 4JI8J 2QMXA 2LXIA 3E8OA 5CA5A 1HHQA 4OYIA 4PQAA 3EPGA 1VJQA 1M1GA 5CYQB 3BQ1A 1RHMB 3FJ2A 2AP6A 4PR6A 3ZNUA 3TVZA 3NGTA 4OYOA 3HVTA 2R7RA 2UUWA 4QIEA 2HPUA 4DR5F 4RBUA 4DV6F 1HQEB 3DRPB 3OPKA 4Q43A 4DPWA 4DQQA 2KVQE 4F2RA 4OYBA 2D41A 3C16B 2BR0A 1IBKF 4UF4A 2YPYA 2JOQA 4QCLA 2ZBPA 2Z30B 1SC4B 5D4PA 1YJWS 1X0PA 1X0FA 2HHHF 1Q8KA 1RGVA 4Y2KA 3CJ3A 5JJBA 5IC6B 2OPSB 1DRZA 4FF2A 1HW9A 3G4SS 2XYGB 3MAAA 4OZ5A 4IRDA 4WK1A 1FE0A 1N33F 4AFFA 5IV3A 3MDFA 2XNQA 2K2PA 1RWNB 4EK2A 4F3MA 2H51B 3BF4A 3GYXB 4YR3A 4DSKA 4LF6J 3KMSA 4N76A 1BHNA 2U2FA 1X5PA 3AA9A 4MTPA 4WTOB 3QZ8A 2UXDJ 2WONB 4NLWA 4C7QA 3IGVA 3RG6A 4JI2J 4M5GA 5D0RA 5KT6A 3TAMB 2VA2A 2I9SA 2LXFA 1LQ9A 4A8FA 2NZ4A 2DHXA 3DDNA 3JSYA 4KT0C 1RISA 2F5GA 4QOTA 4RW4A 1V3RA 3D67A 4ETXA 4FYWB 3CJ8A 5I3UB 4LF9J 2RF2B 4DR6F 1JLFB 4K2XA 4MYTA 3HJFA 3HHEA 1HMVB 1BY9A 1VLOA 3MEEB 4P2FA 3HSGA 5HMXA 1GNKA 4DMZA 2E5GA 2Q43A 2LLZA 4RW9A 3D2WA 2RUSA 5J2PA 2Y9HA 1QSSA 1TFWA 1FCAA 1S79A 3S8SA 2GJFA 2HEKA 3MWBA 4MYUA 2Q6CA 4OJHA 5A8RA 4X4SA 1Q86T 5AXMA 2XI2A 4PZVA 2MLYA 4AE5A 2QC3A 3EGVA 2EG1A 3NGUA 3GIIA 4BBYA 2HS4A 3W2VA 1NMEB 4PG7A 1LW0A 1QSYA 4PYDA 3EX7B 2BM1A 1I51B 2XM3A 2VC0A 3NOCA 3OT9A 3AJ1A 5KT7A 4ECYA 4RW7B 3OQ2A 4DG1A 2EFGA 3J7AN 1S10A 1C0UB 4YOEA 4ECXA 5ETRA 3EMTA 2CZVC 4HHUA 1GTEA 5B0BA 1JJ4A 1TL1A 2VKZG 4HLBA 4LRAA 4TU7A 3E01B 1KQGB 4RNFA 2B5JB 2CZ4A 2B4VA 3I5AA 3W5XA 1U0HA 3AAWB 3QIPA 3W5YA 3H40A 2J7WA 4ZPBA 3EVMA 2A18A 2ZH1A 3OTDA 4NX9A 1CG2A 2J0SD 1BMQB 3NCPA 3GU0A 1WI8A 3EWGA 3MECA 2AYMA 2KZZA 4EUVA 4H4MB 2KO1A 4N8OA 1JB0C 3OJUA 5F9NA 4JOUA 1M1KT 4CLTA 3DRSA 2B9WA 2JDJA 4FYYB 3PHTA 4QU7A 1FXDA 1L3VA 2D9OA 2BJ8A 4ZPAA 3FSYA 2CFXA 3SSSA 3FKBA 3TZYA 2R8IA 2OSQA 3BREA 1T3NA 4GKKJ 1FF2A 3E51A 3M30A 4NI2A 2XLJA 2C3OA 1U0SA 1P1LA 2ZJQQ 3CCLS 2VJUA 3PFOA 4ECWA 1N5YB 2HZVA 3A8IA 1VIXA 1NH8A 1HBUB 4AD6A 2DGTA 4P73A 1UWAA 3RUBL 1FKPB 4DU7A 5HMYA 4QIFA 2M8HA 5KG6A 5SZTA 1AUSL 2GMLA 2AYEA 1SIZA 2OPPB 2ZVSA 3AH6A 3M1VA 4CO0A 1FKOA 3HHKA 3OUYA 5CZXA 2AT1B 5KT2A 3BGRA 1Q4RA 5F8MA 4LFCF 2QLFB 1NSAA 3GWCA 4J91A 3G8SA 2ZHAA 2QG9B 2M52A 3MM8B 3PJ9A 3CCMS 2HZCA 2KB2A 2VG6B 1NO8A 5KAKA 3TJ9A 5L1KA 3J7YU 1F2HA 2R3VA 3QRPA 4PXDA 3DLEB 2GVZB 2CWXA 4C11B 1TL4A 1X9MA 1Q16B 1VQKS 2RHSB 2PC6A 1IM4A 1HQUA 2CAJA 1CPZA 3PX6A 4K4TA 1QD1A 5J2NA 3L4BC 4DV4J 4GO5X 4UQGA 3CJ2A 1U6ZA 4I7FB 2RDIA 3NBPB 4OX8A 5B7WA 1VISA 1RQ0A 2E66A 5DJBA 1XWLA 2AZ3A 1UVKA 2AEFA 1FRMA 3M2UA 2JNJA 2DO4A 2RDDA 3I0SA 1BWEA 4QWDA 1HD1A 2RQKA 4M5KA 4KGXB 5K8OA 1YSJA 2FHJD 4O23A 4ID5B 4ZVTB 4IDKB 3OTOJ 1ROFA 2CWKA 4KPCA 3GZ7A 3ZTOA 3IRXB 1RHRB 2E1PA 4F26A 3R5CA 5A0YB 3CUNA 4XIUA 1OMSA 3HD1A 3TNVA 2V9WA 2Q3PA 3OFEA 4OZNA 4DPOA 1UKUA 2HAIA 4B3TJ 2W01A 4Y00A 1I1GA 1QUPA 2M88A 4CLUA 3KHHA 1XN9A 4EEYA 2BQ3A 2IM3A 4ES3A 3PW7A 1K44A 2GJ2A 1FK9B 1HNVA 2VDIA 2CJQA 1D9FA 1V6HA 2F4VJ 1CJVB 4I2PB 1SH3A 4IH7A 4NPOA 1U1KA 4OJ1A 1T9XA 2JEJA 3GFXA 4NLRA 3THVA 2RQ4A 3EVOA 2CPDA 2G1DA 2DYAA 5ETKA 3UD5A 2OFGX 4LSLB 4OX9F 2G2OA 2DH7A 2DKOB 2HVZA 3ZZTA 2YWWA 1D9DA 1SJRA 3IXQA 3VZHA 1WUUA 2OMLA 2XMWA 3LP2A 1DY3A 5KG1A 4B08A 4RUHA 3K58A 2YXLA 3G2XA 4X65F 3GV5B 4RW4B 3KDNA 3W9JA 2CG8A 1U2FA 2YNFB 1U6FA 4AT1B 4X62J 5I3QA 5EUHA 5RUBA 3ISNC 2VIHA 4DV0J 3P4UB 4CP5A 1HBNB 1R8BA 2JZ5A 3M2VB 2YWFA 4NE9C 4R0EA 4J9PA 2GA7A 1XMQJ 3KNGA 2H54B 4PQUB 3GYNA 5A6PA 3GCWP 2AQ4A 3CCTA 5BXIA 3EPIA 5HLFA 2HHQA 2CADA 1T9TA 3LP0A 3SQGB 1SV5A 3C6TB 4ZP9A 3Q86A 3I5CA 5C7PA 3D9BA 3S7RA 4ZLJA 5IXUA 3H20A 3K8VA 1RDRA 2DPIA 4DN9A 1RT4A 5LXYA 1HNXF 4RW6B 2GMHA 1NB2A 4DV5F 1VQMS 2AJFE 3EZUA 3ZFVA 4Z7CA 4DV2J 1MWQA 1V5IB 1PO6A 1WC5A 2AGQA 4OZLA 4PWDB 1VC6A 4WJBA 5C5JA 1R8CA 3AB2B 3QAEA 2FVPA 4LFCJ 2V69A 5KG4A 4ES1A 4IOAQ 1FESA 4O3RA 1HBOA 2L3MA 4ICLA 2BRLA 3UR3C 2VFTA 4WP9A 2E5IA 1XK8A 2ZBQA 4J7CA 4O4RA 1T03A 1WD6A 2R8HA 3CDBA 4G1QA 2O5DA 1S4FA 5E5NA 1U1RA 1FVSA 1RKIA 4QR2A 8ATCB 3IM9A 1KEKA 2QA4G 4K4YA 4EZ6A 4JI7J 1MMLA 3GYGA 1VQ8S 1KLMA 1OO0B 4NRTA 4DX6A 3OLBA 2BJ7A 4Z37A 5IS2A 3KLEA 2OPRA 5LMUF 4GKKF 3LANA 3L7UA 1RT7B 1WKLA 2AD9A 4UY85 4P52A 3GV7B 4ED0A 5J2QB 3NLCA 2CJYB 3FQLA 2Z2YB 4MIWA 1HIYA 2KRBA 3SCJE 3VF0B 2D3ZA 3ADAC 3CCES 4JI8F 2DVIA 4FYDA 3N6NA 2K1RA 3UE2A 2JWNA 4ZPCA 2BMBA 1NM2A 4NA3A 4QPTA 3POTA 2WONA 1YRTA 3RW7A 2B0GA 3IC1A 2BJ9A 2DBBA 3GB0A 3T41A 4C48A 4ZA1A 4WKYA 3P5BP 4MH8A 3KJQB 5T14A 2W2QP 1K1QA 5I3PA 4NXMJ 4DR7J 1ZM2A 2DGOA 2KKHA 2VFSA 2BA9A 5DG9A 1N5YA 1JLFA 3DOLA 3CCZA 4FBUA 4FPRA 2XY5A 1GMVA 3LUYA 3TAMA 4F0HA 3NGRA 4DSIA 4KPYA 2B56A 3I9V9 3GONA 2KYXA 5D0GA 1VDHA 2JL9A 2QFIA 1VFJA 3D68A 4M5NA 5CHCB 4G1IA 5E3PA 4QW9A 5A8KB 2BRKA 3KUEA 4I6AA 1DTQB 5H9FK 3R5DA 2YWKA 4RW9B 3J81U 3D28A 4HR2A 3DXBA 3EE3A 1NDCA 4R8UB 2J8AA 4DL3A 3C46A 1O6XA 4AXIA 4FXDA 1IKXB 3FEXB 4JV5F 1UWBA 3JTOA 3VHQA 2FJBB 2CUYA 1HQUB 4ENOA 3MM9B 2HHPA 4M5DB 3SI8A 2XY7A 1RT3A 3AA8A 3AFGA 1TKTA 3CIZA 3I9ZA 3MEGA 4LF4J 4I7FA 4YFUA 4WIIA 5DDRC 5IFMA 4MK9A 2DGXA 3ZZ0A 3E3XA 3TUZC 1NHKL 4JI0F 4Y2AA 3NEKA 4WYLA 2M9KA 1S6PB 1ZAWA 4DFKA 2ZFHA 2X3GA 2NUUG 5FLXY 3M9OB 1QLNA 3MR7A 3E01A 1F9EB 2YWGA 3R27A 5B0FA 3MECB 1ZBTA 2FVRA 1RAOA 4LFAJ 2GQ2A 2JH3A 3C6UA 3KG0A 4I0WA 1VQ6S 4HL9A 4UW2A 3M8ZA 2BANB 4WZMA 3I31A 3I56S 3L7OA 4WFZA 3GIJA 3W63A 1WJ9A 3PRBA 4CM0A 1KVKA 5LL6d 2LA6A 5GAGU 2HS3A 3RJMB 3KWMA 5HP1B 3DN9A 3MI7X 1Q78A 3FCWA 3AOBA 3N5FA 4QYZK 2GZOA 2JVOA 4MIBA 5IV4A 4A8MP 3DCAA 2BYCA 4UOFA 1T02A 1NK0A 4ETZA 1NK7A 4NCBA 1FRLA 2ROGA 4C98A 1S9GA 2OP5A 2HNZA 4OV1A 5HQLA 5KFDA 4ECQA 3QJLA 1S7IA 1UPPA 2RKIA 2V8VA 1HNIA 2EKYA 1RTHA 4NYPA 4EGLA 5IM0B 1REGX 2DGQA 4MKBA 3OXFA 3TJ8A 2XY6A 4MAKA 2ERRA 1DQ8A 2IRYA 2HIYA 1VHIA 5HMZA 4ZPVR 3CE8A 1MMNA 2COLA 3CJKA 3W62A 2AYBA 3M1VB 5K14B 2R7UA 1UW4A 1XR7A 2H1YA 2E5LF 1RT5B 1RU2A 1BQMA 4NCGB 3R6LB
chains in the Genus database with same CATH topology
2F4FA 2VICA 2XMAA 2VJVA 2EC2A 2XM3A 2A6MA 2VHGA 2XO6A 2FYXA 2A6OA 2XQCA 4ER8A 2F5GA 2VJUA 2VIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4F A;  2VIC A;  2XMA A;  2VJV A;  2EC2 A;  2XM3 A;  2A6M A;  2VHG A;  2XO6 A;  2FYX A;  2A6O A;  2XQC A;  4ER8 A;  2F5G A;  2VJU A;  2VIH A; 
#chains in the Genus database with same CATH topology
 4IQM A;  3GTY X;  4LVN P;  4C11 A;  4BC7 A;  5C24 B;  3UI3 A;  2B6A A;  3UR0 A;  2XWX A;  2HFS A;  1X31 C;  2RVJ A;  4CO4 A;  4A8X A;  2MEW A;  5J2N B;  2XGP A;  1UA1 A;  5I4M A;  2KHD A;  1CJK A;  3KUH A;  1A6L A;  3N79 A;  4E2F B;  5C25 A;  1P6T A;  2XG8 A;  5IT9 U;  1CVJ A;  3HHN B;  2CRL A;  5GAD U;  1SJ3 P;  1R3N A;  2UU9 J;  2YH0 A;  2CNL B;  3C15 B;  3R7S B;  2EFP A;  2VIC A;  2I0X A;  4WKR A;  4KO0 A;  3TX8 A;  3CDW A;  1VHF A;  2Y8W A;  4A4J A;  1VRT B;  3EZO A;  4CWB A;  1ZTW A;  3HO1 A;  1XR5 A;  3HHL A;  2DNK A;  3CCU S;  2HAF A;  3BO3 A;  4IDK A;  5E3R A;  2MSS A;  1T94 A;  3M6W A;  1UPM B;  2EPI A;  2QN6 B;  3MM5 A;  4QW8 A;  2L08 A;  1JJC B;  1NPP A;  1S6Q B;  2F4F A;  5FLX U;  3QJP A;  3PFE A;  1HW8 A;  1NCL A;  1SL1 A;  1UET A;  5U47 A;  4PAA A;  1FTR A;  3KLH B;  2M4M A;  2MZQ A;  3IRX A;  3VWS A;  1K8A T;  1N33 J;  2WSE C;  5HRO B;  1T7P A;  5A0Y A;  3OXG A;  1DAR A;  3BGL A;  2EFV A;  3IMQ J;  4QR1 A;  3G86 A;  5KFC A;  2E5J A;  4J9L A;  2HMI B;  4H4K C;  1S72 S;  3A8J A;  4JI4 F;  2YNH A;  5F9L A;  2DNP A;  2WZ1 A;  2X51 A;  4M8L A;  4ZPT R;  2HHT A;  1RT1 B;  4DL2 A;  2N4D A;  1CQN A;  2LEB A;  3T1Y J;  4YHH J;  2WSC C;  1RCO B;  1FFG B;  3S01 A;  3QYY A;  4UY8 T;  1XNR J;  3CCJ S;  4X4P A;  2GX8 A;  5E3C A;  3K57 A;  1D1U A;  3KK3 A;  1X4B A;  2BJD A;  1ZYQ A;  1BQX A;  3VGT A;  1SJF A;  3RBZ A;  1FDN A;  4Q2L A;  4OFZ A;  2ZHO A;  3ZZZ A;  4B9U A;  2DRB A;  4DR6 J;  4DL0 C;  2BOA A;  1T0T V;  3MCM A;  4RR5 A;  4J9O A;  1H73 A;  1KOH A;  3FNN A;  1FFW B;  3WDO A;  4DR3 J;  3KLI B;  3IBC B;  2J7K A;  2KHC A;  4Q0B A;  3LP0 B;  2FDN A;  3MR5 A;  2C3M A;  2CJ9 A;  3A3P B;  3MMC B;  3Q22 A;  1S0M A;  4I6W A;  2QSW A;  2QZ8 A;  2ZH4 A;  5D0E A;  5HLF B;  2QJ3 A;  2PI5 A;  1S1X B;  2OH2 A;  1SJ4 P;  1YZ7 A;  2RQM A;  4PWU A;  2XSJ B;  4J9Q A;  1S49 A;  1B0T A;  3C6T A;  3MMB B;  2B9X A;  4L3K A;  4CLY A;  3W9I A;  5IT0 A;  4KFB B;  2XZW A;  3TUJ C;  4DV2 F;  3CO0 P;  1BC6 A;  3HSZ A;  2ZJR Q;  3R2D J;  4YEA A;  1SPB P;  2JVR A;  3ZZY A;  4X4T A;  2J5A A;  4DV7 F;  1D0E A;  3S6E A;  4IH5 A;  2FIU A;  3J7Z T;  1GT8 A;  2VPX B;  3B6B A;  1RTJ B;  4WPA A;  5AXL A;  3CF5 Q;  3NRB A;  1ZOT A;  3FBC A;  3DLB A;  5M2P A;  5C2C A;  3CVK A;  4LJM A;  3PR5 B;  1AYE A;  2UXC J;  5L8R C;  2IC3 B;  1NKE A;  1AFI A;  2IJN A;  3PR4 A;  2GIF A;  3O8W A;  5DDO C;  5L1I A;  4RWW A;  2BQU A;  5HBM B;  3OSN A;  1RT7 A;  4CM2 A;  1B7Y B;  1QJH A;  2MZJ A;  4HTI A;  3G96 A;  4S0M A;  1RT6 A;  4F0M A;  4OYM A;  1YKW A;  2FZG B;  2BE2 B;  1NAQ A;  3BH7 B;  2XB2 D;  5LM7 E;  2M70 A;  2ZBI A;  3T1Y F;  2IBK A;  2ZZM A;  1ZM3 A;  1TZ0 A;  4Z2X A;  4ECR A;  2E1R A;  3L09 A;  3M32 A;  3NCQ A;  3T1H F;  2RRA A;  1JJ2 R;  4RU2 A;  4MK8 A;  2OHD A;  5FII A;  1TKX A;  1PBU A;  2KTQ A;  4NMX A;  2V68 A;  1VR6 A;  2XZD B;  1HR0 F;  4NLG A;  1JK9 B;  3AOC A;  2X7I A;  3U1L A;  4QQB A;  2ZH5 A;  1YWX A;  5IM0 A;  1HBM B;  3SIP B;  3PX4 A;  1HWL A;  1MN9 A;  4B3M F;  1X4C A;  1RTZ A;  2AJ2 A;  1TKD A;  3EXY A;  3SV3 A;  1CJU B;  1KNZ A;  1VQS A;  2V6A A;  2B4U A;  3FFI B;  4KV8 A;  3PW2 A;  3H5S A;  1ZM9 A;  2V0N A;  4RNN A;  1E6V B;  5KG5 A;  2H5J B;  3SCK E;  3QGI A;  3Q83 A;  4Y65 A;  3ONQ A;  3PZP A;  1L3S A;  1FKP A;  4K7Q A;  2G2Z A;  1OPZ A;  3GCX P;  3H8Y A;  5HL7 Q;  1J5O A;  5CXT A;  5G4D A;  4RKU C;  3SCI E;  2F8M A;  3HSD A;  3OJS A;  2K7J A;  3S1T A;  4YN3 B;  2MKI A;  3MUM P;  2OD6 A;  1RT3 B;  4M5L A;  2V67 A;  4DV7 J;  2UUA J;  1V3Z A;  3D7S B;  2JEI A;  3M8W A;  2ZNZ A;  1RT2 B;  4FN5 A;  3JQK A;  3OVA A;  5C25 B;  5B0A A;  1FRX A;  4DV4 F;  1G3O A;  3ICL A;  5EWG A;  5DG8 A;  2R2T A;  1M90 T;  3JYT B;  3DMJ B;  4KY3 A;  3C15 A;  3W1Y C;  2KFZ A;  1S4E A;  1YBA A;  1HNX J;  1S6P A;  2VOO A;  2VOP A;  1VQ7 S;  2PFF B;  4UQT A;  3TA2 A;  3JAM Y;  5K8M A;  1KTV A;  3ZZU A;  3C2P A;  3HVW A;  1RWX B;  2Q1L A;  4IG0 A;  5DQG A;  1YJN S;  4F4A A;  2F63 A;  1OSD A;  1T9W A;  2GW8 A;  2YX7 A;  3BBB A;  2P6T A;  3H98 A;  3HUL A;  3IBW A;  3MMJ A;  1N5V A;  4ZPW R;  4M95 A;  3TP2 A;  3M2R A;  1VBK A;  2Y1J A;  1JIH A;  2OTL S;  4I4B A;  3TYT A;  3TVK A;  2DR8 A;  5IWA F;  4X62 F;  5JVG Q;  3I0S B;  2LFV A;  1B0P A;  3BYR A;  5F41 A;  3LAM A;  1WC3 A;  3O5T B;  2BAN A;  3IR7 B;  5I42 B;  4DSE A;  3X1L B;  1YTY A;  1R31 A;  4ZN3 A;  2XWY A;  2U1A A;  4BDP A;  4K5R A;  2MGZ A;  2FC8 A;  4I2Q B;  4OX9 J;  2LQ9 A;  4F4X A;  2RKI B;  2CQ1 A;  3ILI A;  5DDQ C;  2NPI A;  4Y6I A;  2W1B A;  5GMK a;  3DHW C;  2AEJ A;  1W26 A;  1IKW B;  2KVI A;  4DF4 A;  1NJZ A;  2BVZ A;  1GK8 A;  1SH0 A;  2ZH7 A;  3PW0 A;  2EFN A;  1LWC B;  3AT1 B;  4O44 B;  2J0Q D;  1RTH B;  1RAI B;  4UOC A;  5A8W B;  2IVM A;  2ADB A;  4TNO A;  2GQC A;  1VQ9 S;  5AXN A;  2ZUA A;  3LAL A;  4YB5 A;  1VK8 A;  2NZC A;  2V50 A;  3SDE B;  1AZS A;  1HWJ A;  3QT6 A;  4LSN A;  1IBM J;  5L38 A;  2W2M P;  2HIQ A;  5JXS A;  1OYE A;  2EXU A;  1W2I A;  1WEY A;  3CJK B;  3ZC4 A;  2R2U A;  2LQJ A;  2JEG A;  4I56 A;  3DI6 A;  4DQP A;  2NLW A;  4DR7 F;  4UUW A;  1N88 A;  3ETO A;  1TUG B;  3CJT A;  3FSX A;  4M5H A;  5C24 A;  2F40 A;  2GJI A;  2B6A B;  1KR4 A;  2AGO A;  2UUB J;  4FF4 A;  4Q2M A;  2BW7 A;  2HQC A;  3G8Q A;  4OI3 A;  4XPE A;  3PYG A;  3MUR P;  4CLF A;  6AT1 B;  2FYX A;  3P8B B;  1HNW F;  3LWM A;  4C8Z A;  4FNH A;  2GHV C;  4QWA A;  1H7X A;  1WOO A;  3EDR B;  4ZP8 A;  1TU0 B;  2ILY A;  3U1M A;  5H9F J;  2HQG A;  1AW0 A;  3GJT B;  3BBC A;  1JLC B;  3FSI A;  2VBY A;  2ZOM A;  1SV5 B;  2AZ1 A;  3LA0 A;  3N28 A;  4Q44 A;  3JTP A;  5J2M A;  1NBE B;  3I4P A;  1YVF A;  2OMO A;  3G9C A;  4XK8 C;  2J6S A;  1GX6 A;  3F56 A;  4P71 A;  5KTQ A;  3IO1 A;  3HVT B;  2YWH A;  3HCX A;  2DB1 A;  5KFI A;  1PIE A;  1KFD A;  4LIR A;  4DI6 A;  1HQE A;  2H3E B;  4GMK A;  1B70 B;  4B9V A;  2W4P A;  3VAJ A;  2MKH A;  1HAR A;  1Z1Z A;  2WHO A;  4J9U E;  1S9F A;  1FEE A;  2EC2 A;  5M2U A;  5LXR A;  2XTJ P;  3VVU A;  4G1Q B;  1WKJ A;  5D6G A;  4L76 A;  2HGN A;  3WQP A;  2LEP A;  2C2R A;  5IQ6 A;  4FBT A;  2J76 E;  2X1F A;  2OEM A;  1Q7L B;  2NYI A;  3G8T A;  2R8K A;  4WK3 A;  5KFQ A;  1OSC A;  1I6J A;  2LXU A;  4TY8 A;  1LWF B;  2DCU B;  2GCF A;  1VBY A;  2FQQ B;  2CG4 A;  4LF1 A;  4YP3 A;  4X4Q A;  2XS5 A;  3OR1 B;  3TWZ A;  4K4W A;  1O5J A;  2DTJ A;  4JI6 J;  4ILR A;  1YJU A;  3IWN C;  4F8R A;  1WHY A;  4LIW A;  3M8P A;  2YKO A;  1F3F A;  2ROE A;  1S5Z A;  1H72 C;  3UNY A;  3PEH A;  4YS2 A;  3MR2 A;  2BE9 B;  5BYQ A;  1YJ7 A;  1HBM A;  2J9E A;  2DRA A;  4YB6 A;  3M8S A;  2MDA A;  4Q0B B;  3OHB A;  5KT4 A;  1Y5N B;  3KG4 A;  4UTG A;  3LAK A;  4DV3 F;  3HK2 A;  2ALY B;  3B4M A;  3OVB A;  4GC7 A;  3FRY A;  2VPY B;  3DKD A;  3H2L A;  2LVW A;  1I94 J;  5H1S V;  3BKF A;  3QSY B;  4FYV B;  5D4O A;  2EVZ A;  4ITS A;  2VC1 A;  1FNX H;  5DET A;  4J37 A;  3M6X A;  5DRK A;  3U02 A;  1C1C B;  3VAI A;  3VQS A;  3OL9 A;  1NHV A;  3W61 A;  2AX1 A;  3LPY A;  2R9L A;  4ECV A;  4ED7 A;  2P9G A;  2I5J B;  5CH7 B;  5A8K A;  3WX8 A;  1XTZ A;  4OZ3 A;  1RT2 A;  1HR0 J;  1KDN A;  4NAS A;  3FK4 A;  4CLK A;  3Q8Y A;  3PG9 A;  4CYU B;  3HMJ G;  1Y0H A;  2W7P A;  4KFB A;  3GIK A;  4KR0 B;  3JSM B;  3D3C J;  4FDF A;  4DG1 B;  4DOZ A;  2QSF A;  3SYZ A;  1NSK L;  5J1N A;  2C42 A;  3FDS A;  4BLG A;  2HHV A;  1FJC A;  1TV6 A;  2DNR A;  3VGV A;  2GIR A;  2GO9 A;  4W4M A;  1IBC B;  1FRK A;  2V4Q A;  4JI1 F;  4TLQ A;  4MKY A;  4NRU A;  1UW9 A;  1VYA A;  1Y11 A;  2A6M A;  1LFW A;  2ZBR A;  3PYE A;  4USJ C;  4B17 A;  2MQQ A;  3HKW A;  3PV8 A;  3PIO Q;  2MQL A;  4LRB A;  4OI0 A;  3TAP A;  3LGM A;  3NY0 A;  4OYW A;  4U95 A;  3DOK B;  2CDR B;  2XNR A;  4AXJ A;  2MHE A;  4C8Y A;  4F50 A;  3DGP A;  3CPW R;  1ACM B;  3HVR A;  4ED2 A;  3T1H J;  2CNN B;  2CPY A;  4IG3 B;  5C42 B;  2FLP A;  1BWV A;  2VH7 A;  4A46 A;  2O1P A;  1SQG A;  1RT6 B;  2A0F B;  2YKM A;  5GAH U;  3OL8 A;  4ED5 A;  1KVI A;  1FE4 A;  4C8K A;  1H0H B;  4ZVF A;  2CXE A;  4K5S A;  3PKM A;  1WI6 A;  3D0I E;  4DSF A;  1BD6 A;  4LF8 J;  4M63 A;  1KHV A;  4RUA A;  2FVS A;  2HZA A;  2OI2 A;  1E6V A;  4QPX A;  3JQM A;  4Q45 A;  1EP4 B;  1RHJ B;  2DIV A;  2A6O A;  4HTJ A;  3UO0 A;  1UVL A;  4ECU A;  4C8M A;  1TL3 B;  1F2G A;  1V3S A;  1CJU A;  1LFP A;  2LU2 A;  1U09 A;  5KFG A;  3MM6 A;  4PKD B;  2IIH A;  2PE8 A;  3TZX A;  1R8P A;  2HNY B;  3F44 A;  1XC9 A;  1RUS A;  1RAA B;  2E1M C;  3DLE A;  1N4L A;  3NAH A;  5CYM B;  5KFH A;  1WEX A;  2QIF A;  2GNK A;  4OZJ A;  3M6V A;  4FF1 A;  4UOH A;  1SC3 B;  2XLK A;  3H2U B;  4RBT A;  3GQC A;  4KH0 B;  3GIM A;  5HVG A;  3WC0 A;  5F0U A;  4DUY J;  3H5X A;  1RP5 A;  1RWV B;  4DBQ A;  5T41 A;  4CZC A;  1FWP A;  1Q8L A;  1SC6 A;  2MKS A;  1UA0 A;  1S6O A;  2J9D E;  4ALZ A;  1F5C A;  1D09 B;  4CT9 A;  2PD1 A;  3JQJ A;  3QMQ A;  3HXM A;  4RUB A;  3LO3 A;  2VON A;  4B9M A;  3M6U A;  2KT2 A;  4DCO B;  4W90 B;  3WX4 A;  1KHW A;  3W66 A;  1ZAX A;  2IAJ B;  1ZM4 A;  3FMB A;  4WXW A;  2MJN A;  3PVX A;  2J6T A;  4WU3 A;  3VVT A;  4DS5 A;  3MM7 B;  3UDV A;  1HWI A;  2G1H A;  3HI9 A;  3HP6 A;  1O0P A;  2AW0 A;  1FFS B;  3OW2 R;  4MIA A;  4OV6 A;  3T19 A;  2W2O P;  4LBH A;  3UN2 A;  1S1W A;  2FC9 A;  2KG0 A;  1TMM A;  2NXN A;  4NZ0 A;  4IYQ A;  1NDP A;  1H98 A;  3UD3 P;  2HLU A;  1J5O B;  4HHJ A;  2N4C A;  1FX2 A;  1Q1K A;  3EZ5 A;  3UCU P;  4DPT A;  2NXJ A;  3VGS A;  1MN7 A;  3M8Q B;  5ITH A;  1CJT B;  3AXK A;  2YX4 A;  3CJ5 A;  3ISZ A;  1GMW D;  4DS4 A;  5FJ4 A;  4ED4 A;  2CYY A;  2ABY A;  1RJJ A;  2G0J A;  3UDC A;  2ZE2 B;  3GJS B;  3AD8 C;  3R1H A;  3MGJ A;  2ACY A;  2E1C A;  2JX2 A;  3DM2 A;  3Q89 A;  2LDI A;  4PG6 A;  3A8E A;  4CH1 A;  3OFH A;  4DX5 A;  4GVL A;  3DI6 B;  4KH1 B;  3NS7 B;  2P2C B;  4QIW D;  3IR6 B;  3SV4 A;  2QL9 B;  1NKB A;  2FTR A;  2IFX A;  3NG8 A;  2IVY A;  3J80 Y;  2XO7 A;  5B08 A;  1LWE B;  3BR8 A;  1GXU A;  2PMW A;  3LOU A;  3SDE A;  3ZXW A;  2W9A A;  4LSN B;  4WCE Q;  1Q53 A;  3MR3 A;  1QAX A;  1M5P C;  2FLN A;  4HI2 A;  2QE5 A;  3BKT A;  3D1Q A;  4PXB A;  2ZC4 A;  2KU7 A;  2VBX A;  3DXS X;  3QAU A;  2Z58 B;  3BQ0 A;  4QBU A;  4QU6 A;  4F36 A;  1TL5 A;  2KRR A;  3VR1 A;  5D4N A;  2W2P P;  3KYL A;  2DY1 A;  3FUY A;  4TYA A;  2AYG A;  2OEJ A;  1RBA A;  5K8P A;  1XMB A;  4KGV B;  3OTE A;  3PIP Q;  1LOU A;  1UFL A;  4DR1 F;  1CSJ A;  5B0C A;  5E0O A;  2UV8 G;  4OHY A;  1Q82 T;  3C14 A;  1KQK A;  2NR0 A;  1B64 A;  3R8Y A;  1NPK A;  1T03 B;  1S59 A;  2MLZ A;  2HND A;  4CO2 A;  5LJ5 Y;  1NKC A;  4PEO A;  2OLW A;  2BE7 D;  3LP1 A;  2UVU A;  3OL7 A;  3MPW A;  4PUO A;  2E9T A;  3T5K A;  2M0G B;  2PN6 A;  3I96 A;  2CPE A;  3I87 A;  3KLE B;  1WG1 A;  2FLO A;  5CYQ A;  2BXJ A;  2DGW A;  3I0R A;  3JSB A;  5IWA J;  1U49 A;  1UEV A;  2UUC F;  2FJD B;  5LSR A;  3IWL A;  4M5M A;  4OHV A;  4FPI A;  3UVJ A;  8RUC A;  3DOM B;  1JJH A;  2Y1R I;  3GP9 A;  3KLV A;  5E3Q A;  1FJG F;  3RYL A;  4BC9 A;  4F25 A;  2DD8 S;  3DRY A;  3DOK A;  2FHK A;  1VQ5 S;  4NXM F;  2DT9 A;  4QYZ J;  4IFV B;  1YRX A;  2B5J A;  5ETM A;  4GKJ F;  1U0H B;  3QIP B;  4DR2 J;  4QZV B;  3CCV S;  3PAC A;  1R89 A;  2MB0 B;  3RAQ A;  3X3U A;  1LKZ A;  2CPF A;  2OPS A;  3ILO A;  4C6A A;  4IKA A;  2NYH A;  4GO7 X;  3IFE A;  4CLL A;  2KJW A;  3B78 A;  3HZE A;  2RS2 A;  1JLB B;  1AB8 A;  3PO5 A;  3K17 A;  2JLG A;  2DGV A;  1YBU A;  3CJS A;  2ZH3 A;  2C2E A;  3K0J A;  1WTF A;  3HLU A;  2UUB F;  3NXZ A;  4WF9 Q;  2DNG A;  3C19 A;  1VRU A;  3BEG B;  3MEK A;  2JFK A;  1WOS A;  1HYS B;  4USW A;  4KKO A;  2OPP A;  1ZTT A;  1NUE A;  1FKO B;  4FZV A;  3OUY B;  2DR7 A;  1LWX A;  2E5L J;  1WHW A;  2CZ9 A;  2RF2 A;  3TEH B;  3Q0A A;  2FJX A;  2V34 A;  3BO2 A;  4LF5 F;  2VQE F;  1KBR A;  3AHP A;  3BPD A;  3MM8 A;  4DN0 A;  2WB1 D;  3BN7 A;  4PAB A;  5G0R A;  5DLG A;  5J2P B;  2WW8 A;  5LMN F;  3CD0 A;  4M5D A;  2ZHB A;  1IUJ A;  4RNO A;  4DV5 J;  4ZOS A;  1CQM A;  1MW7 A;  5ETS A;  1TKT B;  1TKZ A;  1FTC A;  4X84 A;  3IN5 A;  3CXC R;  3MEG B;  1B7F A;  1KVJ A;  1NHU A;  4UT4 A;  3Q8R B;  2GQQ A;  1VQY A;  3UN3 A;  3MFH A;  1IBL F;  3OFG A;  3NS5 A;  3M8Y A;  2O01 C;  5DO2 A;  3K89 A;  1Q81 T;  3MPV A;  5HQM A;  4V19 J;  2G4B A;  4ZVQ B;  3NBP A;  1N34 F;  5CCL A;  2L9W A;  2C2M B;  2EI5 A;  2H5E A;  2V2V A;  2VBZ A;  2NPF A;  3US5 A;  1R0A B;  2UXB J;  3JYT A;  4KHP J;  2DGS A;  3EGN A;  3FCV A;  3MCN A;  4ZS6 A;  1TV6 B;  4OJ3 A;  3CD7 A;  2DXD A;  4ZCK A;  3SSR A;  3GPA A;  1T9Y A;  1KKH A;  4K2J A;  3V81 A;  1APS A;  1C4A A;  4PPD A;  1TL1 B;  4QYR A;  1PJ5 A;  2MZ1 A;  2OTJ S;  3DGP B;  5ETV A;  1RAB B;  2KXF A;  3UQS A;  2OD4 A;  1FWL A;  2H9Z A;  4IG3 A;  1JLA B;  2OFH X;  3U1N A;  3H2V E;  2HFN A;  3QWP A;  1RBL A;  4P7T A;  4KB7 A;  4FYX B;  3R7N B;  1TVR B;  1ZAV A;  2PMZ D;  1ARO P;  2FY8 A;  1T11 A;  3LPE A;  3N5B A;  4ZVU B;  2OKQ A;  1VC5 A;  2QMU B;  2IJF A;  4WP3 A;  3THP A;  2LDY A;  3H25 A;  4RNH A;  5ETN A;  1RHK B;  5CZV A;  1SC1 B;  3MD1 A;  4CI0 B;  3OD2 A;  2CQG A;  1S6U A;  4NWB A;  1HPZ A;  1IKY A;  3DYA B;  1WEZ A;  2D9P A;  5M2R A;  1C1B A;  4ATN A;  4B3T F;  3KJV B;  4JV5 J;  1CC8 A;  1X4H A;  2MQM A;  1F0X A;  5IC4 B;  4PRF A;  2HK3 A;  4YY3 F;  1OYD A;  2G2Y A;  2VUG A;  2G0C A;  2HWI A;  2CQD A;  3IA0 A;  1R0B G;  1YZ6 A;  2AJ0 A;  2K7K A;  3FBF A;  1IKV A;  4TU8 A;  1U26 A;  3K5P A;  1B99 A;  4YDX A;  2AIR B;  1TL3 A;  4TQR A;  1SKS A;  1F3V A;  1YIJ S;  2VJV A;  2YQ1 A;  2XLI A;  4DZ6 A;  1D8Y A;  3GJR B;  2OEK A;  1FVQ A;  5HAT A;  5KFS A;  3NMR A;  2VQF J;  2XI3 A;  1VQO S;  4OHW A;  2VL1 A;  5BYS A;  1N0V C;  4RX6 A;  4B3M J;  4ANC A;  1X4A A;  4RW8 B;  2NSB A;  3OTC A;  5B0D A;  2VG6 A;  1IBL J;  5CYM A;  3CNQ P;  3IG1 A;  2HGM A;  4DV1 J;  2UU9 F;  4K4V A;  1UEK A;  2QL7 B;  2WSF C;  3NGK A;  4X4R A;  4K59 A;  1DQA A;  2XBP A;  1MU2 A;  4OYA A;  1X9W A;  2BUN A;  2CQ3 A;  3HM9 A;  1VIO A;  1PIL A;  1F9F A;  2XZT B;  1DLO A;  3ZO7 A;  2VPW B;  1RWK B;  1BE4 A;  2YNG B;  4RW6 A;  4EI2 A;  2H48 B;  3OL6 A;  2HKE A;  3HHD A;  5KFF A;  1HQ2 A;  2YVS A;  3BBF A;  1PSD A;  3H5U A;  4ID8 A;  2DK2 A;  3CJR A;  5E3A A;  4ANE A;  3BQ2 A;  3FGV A;  5EWF A;  3SQG A;  3QZ7 A;  3MM5 B;  4UOG A;  3QPI A;  1N5Q A;  3H0P A;  2RRN A;  3W7B A;  3G71 S;  4URQ U;  4NL5 A;  2M5Y A;  2ZWO A;  1VBX A;  1NK5 A;  4LBI A;  5DLF A;  4F4K A;  4NLS A;  3R5A A;  3MF5 A;  2XC9 A;  1JXV A;  3DDK A;  3OR2 B;  1PAU B;  1QTM A;  1W7W A;  4I6Y A;  4KBI A;  1KN6 A;  2HUR A;  1GH8 A;  4ZVR B;  3PYF A;  2VZ9 A;  4IH6 A;  4ED1 A;  4N77 A;  2YX1 A;  3HZG A;  5K9F A;  5D0H A;  4C3L A;  2ATC B;  3CDU A;  4IFV A;  4DFP A;  4JV0 A;  1VRQ C;  4MFB A;  4Q7A A;  4N56 A;  4DR1 J;  1HFE L;  1KLM B;  3SZ2 A;  1S57 A;  1H38 A;  1EKS A;  1RTD B;  4I67 A;  2ACM A;  3IM8 A;  1QM9 A;  4TN2 A;  4DQS A;  1N8R T;  3GMG A;  2R7X A;  2H4Y B;  3CME S;  3DRX A;  3J7Z 5;  1TMJ A;  3PW4 A;  2PO4 A;  1X4E A;  2Z56 B;  2HWH A;  3WC2 A;  1FJ7 A;  2JEF A;  2CPI A;  2FY1 A;  2QEX S;  4LFA F;  5F3Z A;  3R3T A;  1JKH B;  1ZZN A;  2ZZN A;  4CO5 A;  1Q5Y A;  1T05 B;  2RAQ A;  4TY9 A;  2WTF A;  3DOL B;  1G2E A;  1FRH A;  5IT4 A;  3M8P B;  1C4C A;  1WG5 A;  3MD3 A;  4GRS A;  2CQB A;  4RWX A;  1W25 A;  1FER A;  4ZPD A;  3DLG A;  5FDL B;  3W9H A;  2PSZ A;  3NMA A;  5KFU A;  1WSR A;  2PGC A;  3R5G A;  1FRI A;  2EC0 A;  2MKK A;  1M5K C;  2DHH A;  1N52 B;  4M1K A;  1RAD B;  3G6Y A;  1EAY C;  2F3J A;  2Z2M A;  1RYS A;  1T9U A;  2GS8 A;  2V8G A;  4G1P A;  1TK0 A;  4NXN F;  4X2B A;  5MAO A;  5HJX A;  1TEL A;  1QY7 A;  2CPJ A;  3HHL D;  3A3N B;  4B02 A;  2HBQ B;  3CWJ A;  2ZH6 A;  3C14 B;  3HSJ A;  4H4K A;  5MLC V;  5GVQ A;  1IQT A;  4FNI A;  1X5S A;  4L6V 3;  3L95 X;  2CNK B;  2UVR A;  4LRE A;  3BGF A;  3CIM A;  1SI9 A;  5AJ3 J;  1UZD A;  2C22 A;  2ZH2 A;  3PRV A;  1SJQ A;  4JI5 F;  1QDU B;  2FHO B;  2LU1 A;  1RAE B;  4OI4 A;  4QIV A;  4CDI A;  2PI4 A;  2CPZ A;  2Q6B A;  3R97 A;  3W64 A;  1HNW J;  3MM9 A;  2IC3 A;  2HS0 A;  1ZA1 B;  4TLR A;  4V19 X;  2Y8Y A;  4P72 A;  2F9D A;  3SEO A;  4ZKA A;  1K1S A;  2OIH A;  4B9S A;  4YB7 A;  2EFQ A;  4TKT A;  2VF3 A;  2LEA A;  3I0R B;  3VGU A;  4P2M A;  2PEB A;  4URS A;  1RBO B;  4CLP A;  3MUT P;  1PCA A;  4HAC B;  2CQP A;  5JVH Q;  3JB9 k;  3PTW A;  4DUZ F;  3O6Q A;  3SQO P;  2KJV A;  3DNC A;  4EFA C;  2DNL A;  3L9Z A;  4U8V A;  2GV1 A;  4P10 A;  5J1P A;  2ZNY A;  1PG5 B;  2RRB A;  1UAW A;  4ZJL A;  2QRR A;  5HO4 A;  2LKZ A;  2FGO A;  4PG8 A;  4LMZ A;  4RBV A;  3EGW B;  4LSZ B;  3UWT A;  3MTK A;  3OFF A;  5F0W A;  4X66 J;  4QWE A;  1WSV A;  4HT5 A;  1MNE A;  3O2I A;  4A47 A;  2YY3 A;  3GV8 B;  5EX3 A;  3UFC X;  4F4Y A;  1X9S A;  5K8N A;  3TQE A;  2DHA A;  3WIV A;  1YDL A;  2B8P A;  4YR0 A;  4URG A;  4NLT A;  2E7W A;  2RS8 A;  4IFY B;  1WF0 A;  2GFF A;  2YKM B;  5KG3 A;  5F8I A;  2MKY A;  2WW4 A;  2ZM6 F;  5HP1 A;  1T8E A;  3CUL A;  4ZLL A;  1HYS A;  3QFW A;  3P6Y C;  2AJ1 A;  4UZB A;  1FXR A;  1UJ4 A;  4CO3 A;  3BGU A;  3EVW A;  2J0W A;  4CQ1 A;  4DWI A;  2AEM A;  4DHV A;  4WFN Q;  2JRS A;  2ZDP A;  2XHC A;  3PRD A;  5A76 A;  4C2M A;  3CJ4 A;  4HT7 A;  4J9K A;  1M5S A;  4Y2M A;  3KJF B;  4QWB A;  1RAJ A;  1XNQ J;  3VAL A;  3QAT A;  2GIQ A;  4DPU A;  1DTQ A;  3AD7 C;  4HYK A;  1EX8 A;  2LQB A;  2QGF B;  3W65 A;  5KOX A;  4WWS A;  4M94 A;  4BWJ A;  2DNZ A;  3BS9 A;  2YBV A;  2HFU A;  4NA1 A;  1BQM B;  1FEH A;  1RA7 A;  4A8Y A;  2BW2 A;  1TKZ B;  2MTL A;  4WU2 A;  2YNG A;  2WVC A;  5GAG I;  1BQN B;  1JLE A;  3MR6 A;  5AE1 A;  2KI2 A;  3DRR B;  5E7O B;  1UJ6 A;  1RLD A;  5KT3 A;  2OGU A;  5HSP A;  4K4Z A;  3RTV A;  3TQ1 A;  1IXK A;  2V8D A;  2V9K A;  3D6H B;  1VRT A;  4IG0 B;  4CO1 A;  3FMW A;  4LRD A;  4A8O A;  2CQC A;  2F9J A;  3B4D A;  5L9N A;  2V4R A;  1Q0N A;  5ETQ A;  1R6V A;  4DV0 F;  4E8U A;  1WC6 A;  8AT1 B;  2YKN B;  4LR7 A;  1FT8 A;  1S0V A;  3EGZ A;  2FUG 9;  3QFH A;  4OX7 A;  2XMA A;  1XMO J;  4WZQ A;  4X4V A;  1DJ0 A;  3SSQ A;  1YI2 S;  2HVH A;  4R25 A;  5ETT A;  3F0N A;  5T7L B;  2C3U A;  4ILL A;  3J7A 1;  5GAE I;  4UZC A;  3WZ0 A;  2B9Y A;  1KSP A;  2W2N P;  1ICE B;  3UDE A;  2F8E X;  5HRO A;  3C16 A;  3QJJ A;  2X1A A;  2HVI A;  3TA0 A;  3NP5 A;  2ZD1 A;  4Y0F A;  1ZPW X;  4DUY F;  1PGZ A;  2IDE A;  4OHZ A;  1U4B A;  1RLC L;  5HMW A;  7FD1 A;  2BX6 A;  4R5P A;  5DG7 A;  4L75 A;  1JX4 A;  2EK6 A;  2XCA A;  4IUF A;  2HQ3 A;  3MAQ A;  3MAA B;  1T95 A;  4DX7 A;  4J9M A;  1XBW A;  1U24 A;  2P8I A;  2UUA F;  2I2Y A;  3M8Q A;  5KFZ A;  2HW3 A;  2HMI A;  5ADZ A;  4KHM A;  5LSO A;  2CIM A;  1N36 F;  4TU9 A;  3KJV A;  1C2P A;  1YJ9 S;  2NXU A;  2KZM A;  1N5S A;  1JWW A;  3I82 A;  4OYZ A;  1F9H A;  5ETL A;  4QR0 A;  4YDD B;  3KK2 B;  3DM2 B;  2QLJ B;  2N7Y A;  3DU5 A;  3MMA A;  3I32 A;  2QV6 A;  2NCK L;  1ULR A;  2P9C A;  2DNO A;  4N7T A;  4NLX A;  3DC2 A;  3ZTP A;  2R7W A;  4A8W A;  2FJW A;  4ZP6 A;  1EQ0 A;  2IBO A;  4USU A;  3RU0 A;  4EMD A;  2IMO A;  3D6F B;  1S97 A;  4NLQ A;  2UV8 A;  2GGP B;  4C8L A;  1SJ1 A;  5IZH A;  1G4C A;  3R5J B;  4ED6 A;  3DGV A;  4NLO A;  1D3W A;  2B43 A;  4IR9 A;  5B0G A;  2UXB F;  2V8H A;  1PBA A;  2FZC B;  4YB1 P;  4DF8 A;  3BDE A;  2O67 A;  1XJW B;  1LK7 A;  3KK1 B;  2ZKT A;  3IG1 B;  5DQI A;  3DLH A;  3KLI A;  1B0V A;  1O51 A;  3VZI A;  2FVC A;  2CQ2 A;  5SUH A;  3CMQ A;  5L1L A;  5IT9 Y;  3K7R A;  4WP8 A;  4IOC Q;  4ZLP A;  1RE1 B;  2HWT A;  2JSX A;  2H4W B;  1QUV A;  2HK2 A;  5BR8 F;  3N0V A;  3EYZ A;  1NJY A;  2XMU A;  1V9O A;  2KN4 A;  3E2E A;  4X4U A;  1KON A;  1S1X A;  3M9M B;  1NK8 A;  5D77 A;  3MPY A;  1XMQ F;  1XER A;  1KOO A;  2HBZ B;  1S1V B;  2AKW B;  1TAQ A;  3CJ0 A;  1YQH A;  4IO1 A;  5LT5 A;  1AUD A;  1MRO A;  4MT1 A;  2RQC A;  3TW0 A;  2IHR 1;  4I1T A;  4RW7 A;  2CQI A;  4PG5 A;  2D74 B;  3AD9 C;  3T1A A;  2KL8 A;  3EUN A;  5A6W A;  4DQR A;  2M8D B;  3WIU A;  4JV1 A;  1NK4 A;  2W9C B;  2Z4P A;  5L46 A;  1RU1 A;  1OY9 A;  1RTJ A;  1ZA2 B;  2HQF A;  3VQT A;  2VPZ B;  3NS6 A;  1X5T A;  1WF1 A;  2J0X A;  3HVA A;  3MFI A;  2MPU A;  3CCW A;  2CJB A;  2YNI A;  3IS9 A;  2MQP A;  4X4O A;  3IRW P;  1WHX A;  2N7C A;  4WFX A;  1SB6 A;  2CPX A;  4LR8 A;  2OSR A;  4PCQ A;  1UVI A;  3CED A;  2JLF A;  2KDO A;  3P49 B;  2KT3 A;  1YX2 A;  3NCR A;  3PDN A;  1AXQ A;  4KSE B;  1U1O A;  1RT1 A;  1XNR F;  2B9E A;  1TFY A;  3GJQ B;  2UVW A;  3M7V A;  2QL5 B;  3PX0 A;  1URN A;  4G65 A;  4USI A;  1KC8 T;  1JMT A;  2DNN A;  1JKH A;  5D3G B;  2KFN A;  1XR6 A;  1K0V A;  1PYT A;  3M32 B;  2VD3 A;  1YG0 A;  2IM1 A;  5HQ8 A;  4I68 A;  2R2S A;  1XMO F;  1TK8 A;  4FVM A;  5FDL A;  1MG7 A;  3VAH A;  2DNM A;  2D1C A;  3DLG B;  2ASL A;  2VQF F;  1HNZ F;  2W7A A;  2GC8 A;  5DZ7 A;  2WBR A;  1IWG A;  2MQ8 A;  3TAN A;  4IQX A;  4DPX A;  3TO8 A;  4LVO P;  3Q2T C;  3KHL A;  1A7G E;  3I4H X;  2DGU A;  2IY5 B;  4W92 B;  2XSF A;  3MMC A;  3KTQ A;  2CQ0 A;  4A8Q A;  2AX0 A;  3A1Y G;  4B3S F;  3MUV P;  3A4T A;  2XSJ A;  4FP9 A;  3SCL E;  4KTQ A;  4DR4 J;  4NCA A;  2APO A;  1HWU A;  1X60 A;  2ZUG A;  4CH0 S;  4DX8 H;  2KXH A;  4K4X A;  2DPJ A;  3DMJ A;  2QYG A;  3THT A;  2G13 A;  4N47 A;  4WXO A;  1BGX T;  1R8H A;  1VS3 A;  3V5R A;  4C0B A;  5KFM A;  1TTH B;  3UN5 A;  3F73 A;  1GEH A;  2R2R A;  2VHG A;  1RAC B;  4HKQ A;  3MTJ A;  4OJG A;  4NLU A;  1NRK A;  1HHT P;  2UVV A;  3IP0 A;  2FD2 A;  4DR2 F;  1O8B A;  1HLW A;  1OQ3 A;  2YKN A;  1U25 A;  1Y4Z B;  3FC9 A;  4JI3 J;  2H65 B;  1QAY A;  2K06 A;  3MHY A;  4CCH A;  1R0A A;  4DZD A;  4G3I A;  4B3O A;  1TL7 B;  2BZ2 A;  2BJ3 A;  3ZNJ 1;  3UW1 A;  3ZTS A;  2D3O 1;  1KQS R;  4DSL A;  1JNZ B;  2E7V A;  1I94 F;  3BSC A;  3T6B A;  2HVE A;  3GIL A;  4ID5 A;  3TZZ A;  3DLL Q;  2XHW A;  2LQ5 A;  1Q8I A;  3BSA A;  4LF6 F;  4DV3 J;  3VAK A;  3RBD A;  2UUC J;  1UFW A;  1P9Q C;  1X4F A;  4Y28 C;  1AFJ A;  2BEF A;  1FX4 A;  4NEY A;  3RGI A;  3J7Y I;  1JXL A;  2J6U A;  4USV A;  1FI4 A;  5EN1 A;  4J9V A;  3G6E S;  2ZD1 B;  4MKA A;  2DR6 A;  1S9E B;  2MZT A;  1XQI A;  1HD0 A;  3DLK B;  4IFY A;  5EWE A;  2VBW A;  3BV8 A;  4C0H A;  2BE2 A;  4YME A;  4AL5 A;  2IDL A;  4JI6 F;  1B3T A;  1REV A;  5KFA A;  1QSL A;  2KM8 B;  4O3Q A;  4H4M A;  5E33 A;  4CT8 A;  2I38 A;  3PM9 A;  4ES2 A;  3R7B B;  3K8W A;  1JLG A;  1UL3 A;  5KFV A;  1RKJ A;  2JJ4 D;  2BKO A;  2B4P A;  2X1B A;  2DIS A;  1LWC A;  4O44 A;  5DDP C;  2DHS A;  3V6H A;  4ELU A;  2AHO B;  3T5J A;  3J81 j;  1HI1 A;  4NI2 B;  1KWM A;  2ZH8 A;  1HPZ B;  1IKY B;  1IKW A;  3A8K A;  3DYA A;  1CS4 A;  4J90 A;  5L9X A;  4MKV A;  4WE1 A;  5IQQ A;  1BLU A;  5KFY A;  4G6V B;  3KLF A;  2FHJ A;  2JFD A;  3M9N B;  3KHG A;  3KXD A;  2MYF A;  5AXK A;  2C2O B;  4NYZ A;  4EU0 A;  3MXH P;  5HVH A;  2J9D A;  2YNF A;  3QGG A;  3K59 A;  2AGP A;  4N8N A;  3RR8 A;  1U8S A;  2IM0 A;  3CB4 A;  3NNH A;  2D69 A;  5IOL A;  3QSI A;  2GVZ A;  3BB5 A;  2QA4 S;  3D1O A;  4JI5 J;  2VB6 A;  3WHI A;  1RAH B;  1U1L A;  3FVY A;  3GSI A;  2V63 A;  3V6J A;  2XMV A;  1YIT S;  2XYH B;  3HX9 A;  2AMC B;  4J5O A;  2W7O A;  1PC5 A;  2KT5 A;  7AT1 B;  2CJA A;  4RU9 A;  4PXE A;  3PKY A;  2EG2 A;  1A9N B;  2ADC A;  2ZJP Q;  4JB8 B;  1GMW A;  1Q95 G;  2CQ4 A;  1RT4 B;  2WRM A;  3P96 A;  2R7O A;  3MPD A;  2G9O A;  4HDG A;  1NJI T;  3MOJ B;  1F5B A;  1N54 B;  2OUG A;  2Z8Q A;  2CNO B;  1H2T Z;  4CRJ A;  3EXC X;  2Q79 A;  1DLO B;  4PXC A;  4DJB A;  2HFZ A;  4PWD A;  2OAU A;  2CVI A;  5HI7 A;  5D4L A;  1PAE X;  4LT6 A;  5EDW A;  1HBO B;  2MMY A;  5T7L A;  4QIG A;  1YLX A;  2G0I A;  3HJV A;  4HH0 A;  3QT5 A;  1Q7Y T;  3L7P A;  1L3K A;  1FA0 A;  1U7L A;  4DUZ J;  1NDK A;  1IR2 A;  3BPS P;  4ZN1 A;  4F3O A;  2P6S A;  2W9C A;  4NML A;  1KQF B;  3H4B A;  3KDO A;  4ZVS B;  1EZZ B;  4JI3 F;  2GVD B;  1NJX A;  1M5V C;  1G7C B;  3NGS A;  5F8N A;  2HRU A;  4Q8E A;  4PWW A;  1UVM A;  2B51 A;  4KAI A;  3AQP A;  3JTN A;  3V4M A;  3BDP A;  1WOR A;  2HG4 A;  3ETM A;  3ZZP A;  1N6Q B;  4WFA Q;  1WG4 A;  2GAH C;  3DRP A;  4NLY A;  2ZE2 A;  4OI6 A;  1LWF A;  3LF0 A;  3WBZ A;  4CH7 A;  4EYH B;  1SKR A;  2ZOF A;  2EKN A;  3NOG A;  3OV7 A;  2XGQ A;  1OIA A;  4L3N A;  1FK9 A;  1HNV B;  1NSQ A;  1IM6 A;  1H3D A;  2NXE A;  1W2B R;  2CDQ A;  1NK9 A;  3HD2 A;  3KK2 A;  1IBK J;  1RTD A;  4B3S J;  4ELT A;  3EJM A;  1I3O B;  4QJV A;  4TY8 B;  2XO6 A;  1NK6 A;  1RZM A;  3ZZR A;  1TP7 A;  4RPF A;  4LSL A;  4ZIT A;  4Z7Y A;  1C0T B;  1PKU A;  2GHP A;  3KKF A;  5KG2 A;  3NGD A;  2BOP A;  4B9T A;  4NXN J;  1CEZ A;  1S0N A;  1Q79 A;  2VDH A;  3M05 A;  3MMA B;  2K3I A;  2RUG A;  3LQV A;  3TRG A;  3EDQ B;  4CTA B;  5KG7 A;  4EBC A;  5H9E K;  4CLZ A;  3H42 A;  5KFR A;  1I5O B;  2OO4 A;  4JBC A;  4ZDN A;  1QE1 A;  5KFK A;  2R8J A;  3KHR A;  1KD1 T;  1EET A;  5E41 A;  3AJD A;  5L39 A;  3D6T B;  3MCO A;  3ZTQ A;  1N36 J;  3PNI A;  2CQH A;  1J27 A;  1WEL A;  2DEI A;  5CCM A;  3V2U C;  4YY3 J;  2L41 A;  3KK1 A;  1HMV A;  3MEE A;  3Q24 A;  4USM A;  1IKX A;  1X7V A;  1R43 A;  1U2C A;  2DRD A;  2YQ3 A;  2ZZT A;  1UWB B;  3TR5 A;  2DXF A;  2DIU A;  4AYB D;  5JUM A;  4LF8 F;  1VMB A;  1G1X A;  1C1C A;  3IBF B;  4OYX A;  2J7U A;  1JLC A;  1SKU B;  3B82 A;  4LF2 A;  3K5L A;  1N56 A;  3QO9 B;  4RUC A;  1WDT A;  2RHQ B;  2HLT A;  2I5J A;  4HI1 A;  4I64 A;  4K4S A;  1XEZ A;  2RNE A;  3K5M A;  1PJ6 A;  2DIT A;  2KM8 C;  2NQP A;  3KMQ A;  1DZ5 A;  3OXL A;  2WAQ D;  2UXC F;  5HAO A;  4YUD A;  4HH1 A;  3UVJ B;  1CC7 A;  2RJZ A;  2IJR A;  2UUT A;  4DXL A;  3CC7 S;  2QFJ A;  1ITP A;  1GTH A;  3H4D A;  1XIQ A;  4NZ6 A;  1HNZ J;  3MOZ A;  4O3N A;  5EGY A;  3R2C J;  3HF5 A;  1C0U A;  3RR7 A;  1N5T A;  1UJ5 A;  1TAU A;  3R9L A;  1OY8 A;  1PYS B;  2L48 A;  3EIC A;  3CCQ S;  2OPR B;  2DJW A;  4FKX A;  3IS9 B;  2YNI B;  3VV2 B;  4KC5 A;  4CNZ A;  5J2Q A;  4KHP F;  1PJ7 A;  1VJW A;  2VFR A;  4M5I A;  1JLQ A;  5D15 A;  2W25 A;  2DNQ A;  4ZHR B;  1KFS A;  2K1R B;  1YJT A;  1SQF A;  4GC6 A;  1REV B;  4YR2 A;  3K5N A;  1JNR B;  3GG0 A;  1CUL A;  3OR1 A;  2HRT A;  1K73 T;  4H4O B;  3POT B;  1NZA A;  5HBM A;  2VU5 A;  1YJR A;  3FEY B;  3SMZ A;  2D3O R;  4JYA F;  1VRU B;  1L5U A;  2WBM A;  2EWH A;  5KFB A;  2B8Q A;  5DM6 Q;  1WDD A;  4J9N A;  4X4N A;  1FRJ A;  4P6Q A;  5LMN J;  4DR3 F;  1IQZ A;  4JI7 F;  4W98 A;  4C97 A;  2C2Z B;  4WYW A;  4B9L A;  1Y10 A;  4ECZ A;  1WKK A;  3PO4 A;  3ILL A;  5CD4 H;  5EX0 A;  3CCS S;  4ZVO B;  3L3C A;  2MQO A;  4K0K F;  1H2V Z;  4BHQ A;  2HBR B;  2BBE A;  1J2V A;  2L9N A;  3GFH A;  2D7S A;  3D4J A;  3SFU A;  2B4O A;  3OTO F;  1HBU A;  1EP4 A;  4WBF A;  4ZCM A;  3J81 Y;  1SL0 A;  4BWM A;  2HSE B;  1UEU A;  3HDS A;  3PXG a;  1IR0 A;  1N0U A;  5KT5 A;  1LW2 A;  1S7H A;  4KGZ B;  2FPH X;  4F0K A;  4FS1 A;  3K5O A;  2ZM6 J;  1NXI A;  3FBB A;  2V2Q A;  3OBI A;  1RWO B;  1D8Z A;  5KFL A;  4J9R A;  3PW5 A;  1U6B A;  3ITH B;  5THW A;  2NSC A;  3N01 A;  3AJ2 A;  2YQ0 A;  4USK A;  3VAG A;  5GAE U;  2F4V F;  4CYU A;  2WOM B;  4OIX A;  3VAF A;  1FJE B;  1BUX A;  2IM2 A;  4ELV A;  4LRC A;  5BR8 J;  4AND A;  4XDD A;  3PHE A;  1D9A A;  2OPQ B;  4GVB B;  4O4G A;  3Q8P B;  1RCX B;  2PT0 A;  5F8L A;  3D5M A;  2XMM A;  1P1T A;  1YJV A;  3MAH A;  4QWC A;  2YWE A;  3QRQ A;  1H74 A;  2RML A;  3RAX A;  3C6U B;  1JLA A;  2CPH A;  4DSJ A;  2WVD A;  5LOQ A;  4WFY A;  3ISN D;  6FDR A;  4P2S A;  3NWG A;  4E0D A;  3BGO P;  3IAS 9;  1NEE A;  1KP6 A;  2LYV A;  1TVR A;  1JXE A;  2Z0G A;  3A3O B;  4UUX A;  2BAC A;  3DLK A;  2XCP A;  2YH1 A;  2K3K A;  1RYR A;  1WF2 A;  4B9N A;  2GHW A;  2DNH A;  3LW5 C;  3MED B;  3ELH A;  4RZR A;  2JLE A;  1EKR A;  2RD5 C;  2W9B A;  2HYI B;  3ENA A;  4DL6 A;  1CBK A;  1SL2 A;  4NLD A;  3R6G B;  4EBD A;  3NL0 A;  3FRZ A;  4L74 A;  3IAM 9;  5A2Q U;  2RU9 A;  4YHH F;  3RRG A;  4Q5V A;  5KFP A;  4DCP B;  1R27 B;  4IRC A;  3MCS A;  1EB0 A;  4O3P A;  7FDR A;  3P3D A;  4WE1 B;  3BN4 A;  4USH A;  1NB7 A;  3H5Y A;  1CJT A;  4O3O A;  1SXL A;  2W4C A;  3OLA A;  4NA2 A;  4ZIV A;  4EO8 A;  4X66 F;  1HNI B;  3N6M A;  3KLH A;  2P9E A;  4OL8 A;  3KLF B;  4E98 A;  1RT5 A;  1WC1 A;  1YBT A;  2E7X A;  2RT3 A;  5KFE A;  1Z2L A;  3QGP A;  2E44 A;  2UP1 A;  4DUT A;  3PJX A;  4LF5 J;  2HQD A;  4HVZ A;  1OWX A;  4L73 A;  4U9R A;  4CTA A;  2VAS A;  4ZMM A;  4DLG A;  4KGM A;  2ZWP A;  4MJK A;  4D3H A;  2CJK A;  4KGK A;  1PYO B;  1S1T A;  2O3D A;  1WC0 A;  1DTT A;  3Q8Q B;  2ASJ A;  2XS7 A;  4K50 A;  1CJK B;  2ROP A;  1Y5L B;  5HK4 A;  3GIR A;  4NCG A;  1IBM F;  2C1E B;  1EET B;  1RSC A;  1VOM A;  4O0N A;  2LEC A;  3UCG A;  4ZP7 A;  3ZTR A;  3ULH A;  2WK4 A;  1TQL A;  2JC0 A;  1HBN A;  3M2V A;  2QA2 A;  4RL1 A;  2A10 A;  2KH9 A;  3BSN A;  1HA1 A;  1RA6 A;  4PQU A;  1U8W A;  2MY8 A;  3G6V A;  4EO6 A;  1FD2 A;  3GFZ A;  2F8H A;  3ENQ A;  4WIQ A;  4OLO A;  1WWH A;  2R42 A;  3ILJ A;  3P45 B;  3CD6 S;  5B0E A;  1RAF B;  4MK7 A;  3RRH A;  4KJI A;  2HND B;  4GKJ J;  5CAB A;  3CJQ A;  2HHU A;  1MSW D;  4PUO B;  2MZS A;  1UFK A;  3O1L A;  3T5H A;  4ZVP B;  3OR2 A;  3HHL B;  1OY6 A;  2GVD A;  2RDJ A;  1WNE A;  2WVB A;  3PYD A;  1LNQ A;  2IAJ A;  4KYZ A;  4B3R F;  2ZC3 A;  3C66 A;  3CDA A;  4ZJO A;  3B54 A;  1S6Q A;  1SUQ A;  2E1A A;  2E5H A;  3FZ2 A;  1EJ7 L;  2PII A;  3MM7 A;  3HT3 A;  4U7C A;  1FO1 A;  1HKA A;  3V4I A;  3A13 A;  3RB3 A;  1B4S A;  2GAG C;  4AL7 A;  3V6K A;  2XQC A;  2VG7 B;  1ZPV A;  2Z2L A;  2ILZ A;  4FXV A;  2IRX A;  1YHQ S;  1GAO A;  3MZI A;  5BYR A;  3G6X A;  5KFW A;  1ZZF A;  3DOM A;  2N3O A;  1Q5V A;  1PC4 A;  1VBZ A;  2C2D A;  3VCD A;  1HHS A;  2FVQ A;  1EAR A;  2MKC A;  2Y1I A;  2YNH B;  1NH7 A;  5HVF A;  4U7U K;  3AB4 B;  2AV5 A;  1RTI A;  3HKZ D;  1U48 A;  4H4O A;  2QO3 A;  1RHU B;  3BYP A;  1UZH A;  2XMT A;  4NZ7 A;  4JV2 A;  5J2M B;  1Z4U A;  3Q8S B;  2MHN A;  1ZET A;  2F1F A;  2F65 A;  2X1G A;  2XEX A;  2AJQ A;  2FHM A;  5F8G A;  2HHH J;  3KK3 B;  2HQI A;  4LFB F;  4LR9 A;  5I3U A;  4JP8 A;  1Y7P A;  2CJX B;  3QGH A;  5K5M A;  5LJ3 Y;  1JLB A;  4PYA A;  5EHH A;  2R7V A;  2HBY B;  3O44 A;  4RO0 A;  4ZVG A;  1FD8 A;  1VLY A;  3J80 U;  4DFM A;  3W8P A;  3QLH A;  1KTQ A;  1F6T A;  2QLX A;  1U1M A;  1S1U B;  3BR9 A;  4I69 A;  5A8R B;  4FXW A;  4KKO B;  3W3S A;  1P8G A;  2HHX A;  3FCH A;  2BKP A;  1SQE A;  2EBE A;  3RBX A;  3BSO A;  4AQY F;  4DL4 A;  1NDL A;  3RBE A;  5DS7 A;  1KLN A;  1UMJ A;  3QO9 A;  3W2V B;  1FWK A;  3Q8V A;  2KG1 A;  4DL7 A;  4FVC A;  3HHL C;  4HHH A;  1ZS6 A;  4ZK7 M;  1OJ4 A;  3CDE A;  3CCR S;  2ZOG A;  1U1Q A;  2ATL A;  2WOM A;  1N32 J;  2HGL A;  2YKQ A;  4U6P A;  5KFT A;  2QX0 A;  1VQ4 S;  3PEJ A;  3C3L A;  5J1E A;  3JAM U;  1NLK L;  2O66 A;  1FHT A;  1AA1 B;  2DR5 A;  1E6Y B;  2DH9 A;  3LP1 B;  3IWX A;  1F1B B;  3FBE A;  4NEZ A;  5KOW A;  4DV6 J;  3LH2 S;  1QVG R;  4DV1 F;  1RK8 A;  4ILM A;  5AE3 A;  2PMH A;  2EW9 A;  4OHX A;  4Y3C A;  3G87 A;  2IPO B;  4LUB A;  4ZVH A;  1VI7 A;  4A8K A;  3V6D B;  4V1A k;  3FEZ A;  3RRK A;  3UCZ P;  4C9D A;  2ASY A;  1K47 A;  4B3O B;  2MKJ A;  2E9R X;  1JLQ B;  2J8S A;  2MJU A;  3W2W A;  1SIW B;  2DR9 A;  3H59 A;  2MY7 A;  1VQL S;  3V81 B;  3ZZO A;  4DLE A;  1A0O B;  2VFV A;  4OZ2 A;  5GAD I;  3GFY A;  5DZ6 A;  3D0H E;  5KFJ A;  1CUL B;  3LWL A;  1JQG A;  2AF6 A;  4MMO A;  2R4F A;  1YK9 A;  1WC4 A;  3ENW A;  4A48 A;  2M3D A;  5JMN A;  2V2K A;  3TX0 A;  5D3G A;  2A1B A;  2MLX A;  1SKW A;  4FS2 A;  4L72 B;  2RU3 A;  2A2C A;  3QID A;  3W5Z A;  2VV5 A;  2Z57 B;  4ZHR A;  1S99 A;  2EBG A;  1NPR A;  1GFW B;  2FB0 A;  3G82 A;  3HFK A;  3KG1 A;  4O0I A;  4JI4 J;  1WHV A;  2DEJ A;  4FKY A;  4HDH A;  4DQI A;  4AUK A;  3P5T L;  2YTC A;  3PY8 A;  1K0T A;  3GSD A;  1XNQ F;  5C2G A;  1TKX B;  2R7S A;  2I6W A;  1P9Y A;  1V5V A;  2BKN A;  5ETP A;  2MST A;  3RB0 A;  2JC1 A;  3FQK A;  4ED8 A;  5D8H B;  4LRF A;  2VQE J;  3RAM A;  3CO9 A;  4EYI B;  1FJG J;  1S9G B;  1QAJ A;  4IOB A;  3GG1 A;  3HFV A;  3Q8U A;  2JHE A;  1AT1 B;  1C1B B;  3IR5 B;  3W8G A;  2BQR A;  1AZS B;  2QYC A;  3TUI C;  5DGB A;  1R8A A;  1N48 A;  3D1H A;  3FFI A;  1S12 A;  4KV8 B;  3MPU B;  4XPC A;  2V4J B;  1CS4 B;  1DHM A;  1FNM A;  1IWA A;  1RXO B;  3ITH A;  4OX6 A;  4OZ0 A;  2VFU A;  1IKV B;  3AOD A;  4RW8 A;  5G0R B;  1H6K X;  3F41 A;  1LW2 B;  1RHQ B;  4OI2 A;  1DUR A;  9ATC B;  3JS9 A;  5H9E J;  1OS5 A;  2D3U A;  2Y1L B;  1BQN A;  1JLE B;  2AWZ A;  2CVE A;  3D54 A;  4M5J A;  3DRR A;  2FGC A;  3LGH A;  4F04 B;  4KIA A;  2DHG A;  2ZVI A;  3GLJ A;  1U1N A;  4BS2 A;  3ET6 B;  3GR0 A;  2RB7 A;  3NAI A;  1IJF B;  2R8G A;  3FZB A;  4DDF A;  5CYJ A;  1RWM B;  4C4W A;  2F7V A;  4AQY J;  1LEO A;  1IJE B;  2FJA B;  2FJE B;  2GMJ A;  2EFO A;  2Y0B B;  3I55 S;  4C8O A;  1MU2 B;  2XMJ A;  3I5B A;  2KYZ A;  4ECS A;  4TVA B;  1MLA A;  4EBE A;  2OPQ A;  4GVB A;  4O4G B;  3VTI A;  2VG5 A;  4UST A;  5AE2 A;  2HHW A;  1U02 A;  4P75 A;  2RSQ A;  3NWR A;  3QRR A;  1T3O A;  3OSP A;  2A2D A;  4PG4 A;  4U8Y A;  2OJ3 A;  1R0C B;  2CA9 A;  4NLV A;  3AQO A;  2B7C B;  2H5I B;  5KG0 A;  1UP1 A;  2QMW A;  4LFB J;  1LK5 A;  1HWK A;  3M2R B;  4OQJ A;  1S0O A;  4OMF G;  2IA6 A;  4F4Z A;  3RZA A;  3SFG A;  4LQ3 A;  3KLG A;  1KS2 A;  2DNY A;  1K9M T;  1QAI A;  5AJ3 F;  4NLP A;  4TXS A;  3IGN A;  4TYB A;  4R5P B;  1EQM A;  3MED A;  4BCA A;  4MFB B;  2VG7 A;  1RI7 A;  2DO0 A;  2W9B B;  5I42 A;  2BAB A;  1WTB A;  2XYP B;  1U47 A;  1DFD A;  1H7W A;  5DQH A;  2DCL A;  3W60 A;  4IR1 A;  1N32 F;  2POK A;  5HN0 A;  2LMI A;  1LV5 A;  1RTI B;  4F4W A;  3QT8 A;  5F8H A;  1Y9O A;  1G6B A;  2FZK B;  2W24 A;  4RJV A;  4YQW A;  4CLW A;  3LP2 B;  3CD5 A;  2HRY A;  4OYP A;  4CNY A;  1YRU A;  1NU4 A;  1EHW A;  4IO9 Q;  1S1T B;  1WOP A;  4XDC A;  5A8W A;  3CW2 C;  2GGP A;  1U2R A;  1HI0 P;  4B3R J;  1GQE A;  2R7T A;  3NKY A;  3QBC A;  3UDL A;  4OLP A;  1Y3J A;  2W4D A;  2B3T B;  1FDD A;  1C0T A;  4X64 F;  4F3Q A;  1X4D A;  1L3U A;  3BKU A;  3CC4 S;  2UXD F;  2VA3 A;  4JI0 J;  2EK1 A;  4XTT A;  5F3T A;  2C3P A;  3O3L A;  4Q8F A;  1GXL A;  4P7V A;  3TJA A;  4ED3 A;  1RWP B;  2N82 B;  2L9D A;  2VKR A;  4F7V A;  2PFD A;  3RB4 A;  1QE1 B;  3SBM A;  1FKA F;  2SXL A;  5E2Q A;  2BJE A;  5K20 B;  3TA1 A;  3CMA S;  3CGI A;  3TUP A;  2J9C A;  2M2B A;  4U7U D;  1T9V A;  4C0O C;  5B09 A;  1X8D A;  3AOA A;  4ERD A;  1MRO B;  4R0J A;  3N9U C;  3NNC A;  4ICL B;  1Y00 A;  1X4G A;  3MMB A;  1NSP A;  3D0G E;  2C3Y A;  1Y5I B;  4ECT A;  3U27 A;  2GO8 A;  1DAX A;  2RE1 A;  2V5H G;  2I8E A;  2LCW A;  2DH8 A;  1ZH5 A;  1R6Y A;  1NND A;  1LW0 B;  3AY0 A;  2NRE A;  2PEH A;  1J5E F;  2WVF A;  3DLJ A;  4DEZ A;  1IR1 A;  1MWZ A;  2BJ1 A;  4ZLN A;  5KFO A;  1L3T A;  3TZW A;  4DU8 A;  1SUQ B;  3HPO A;  1NZ8 A;  1H2U X;  1ELO A;  2HFV A;  1URR A;  2C2K B;  2P5V A;  2IA0 A;  3KFW X;  1OQ6 A;  3V4I B;  4X64 J;  3KOA A;  1DQ9 A;  1Q8B A;  1SBR A;  4TQS A;  2NXC A;  1MWY A;  1TK5 A;  4JYA J;  2ZDO A;  4NOH A;  5HAN A;  2KXN B;  2V2Z A;  4HAC A;  3TAQ A;  3N6L A;  4F67 A;  4ZVE A;  3CSK A;  2XUL A;  3A12 A;  3LGN A;  4KQZ A;  5KFX A;  4A8S A;  1FDB A;  2MZR A;  1F60 B;  1U45 A;  1VK3 A;  2LQ8 A;  4LF4 F;  2VOD A;  3G82 B;  1QTN B;  5CAA A;  3DU6 A;  2HHS A;  5D78 A;  2W8K A;  5KFN A;  4N41 A;  1DBD A;  1FDA A;  3H7H B;  3KJN B;  2IMW P;  1M0S A;  2MQN A;  5CQG A;  3CTR A;  3DHX A;  4U96 A;  4RNM A;  5GAH I;  1T05 A;  5HJY A;  1U1P A;  2YPZ A;  3UPF A;  3LTO A;  3RB6 A;  3H90 A;  4LF9 F;  2ZH9 A;  3N4W A;  3QLH B;  4H54 A;  4J9S A;  2ASD A;  2WCX A;  1S1U A;  1UCN A;  3R5B A;  2NS1 B;  4KHR A;  4C3K A;  1HI8 A;  4C3M A;  3BZQ A;  2ZIT A;  4D3G A;  1QVF R;  4F02 A;  2V94 A;  4ZCI A;  1OPI A;  3T6J A;  1SVD A;  2EEY A;  1S48 A;  4Y2C A;  4LF7 F;  1Y3K A;  3GR1 A;  4ZJQ A;  1R7I A;  4R8U A;  4CIO A;  2DY9 A;  5L1J A;  3DFE A;  4RLE A;  2YKA A;  4PPZ A;  1Z2Z A;  3M8R A;  3DDI A;  3C8Y A;  2C28 A;  4XO0 A;  1EIY B;  2Y3Y A;  4XAK A;  3JSM A;  1GMU A;  2K8G A;  2OEL A;  3BGR B;  4F2S A;  2E9Z A;  3TAR A;  1F5A A;  2I1R A;  3Q2S C;  1M5H A;  3QNW B;  4DR4 F;  3Q23 A;  1X5O A;  2XS2 A;  1LXN A;  4ZIW A;  4P2X A;  4Y34 A;  1IVZ A;  4KRW A;  4EZ9 A;  3T3F A;  1VCT A;  2ZKU A;  4Y2I A;  3UNG C;  2FJV A;  5LSL A;  1J5E J;  3T9N A;  5J1E B;  1TL7 A;  4IRK A;  4LBP A;  1IN0 A;  1WAC A;  2VG5 B;  1E6Y A;  4DR5 J;  2YKP A;  4LQ9 A;  3EM1 A;  6FD1 A;  4K0K J;  4HEA 9;  5ETO A;  3W2W B;  2N3L A;  4C8N A;  5BJR A;  1MMD A;  2V8P A;  2R7Q A;  4K8R A;  3HFZ B;  3CT9 A;  4U67 Q;  3NNA A;  2HFO A;  1YGY A;  2FLL A;  2PA3 A;  4OI1 A;  3VAM A;  3V6D A;  2BM0 A;  5LMU J;  1SH2 A;  2BV3 A;  5C42 A;  9RUB A;  2B7B B;  1N6Q A;  2WVE A;  1S9E A;  3M2U B;  1RB0 A;  3B8H A;  2RH3 A;  4JUZ A;  4DCJ B;  3KLG B;  4K4U A;  4JI2 F;  2PA8 D;  1RWW B;  1S1W B;  5CD4 A;  2A3J A;  3BJY A;  3BO4 A;  3T5L A;  2QT7 A;  4WFB Q;  1P27 B;  5GMD A;  3T9Z A;  4CLS A;  1JLG B;  2IYI A;  2LP4 A;  3QWU A;  2PDA A;  2QA1 A;  3PJW A;  2HNZ B;  2ZBC A;  2Y0S D;  2CKW A;  3AXM A;  1BXN A;  3PCO B;  1CJV A;  5GME A;  4DFJ A;  1TR0 A;  1VQN S;  4WTY A;  1NJW A;  3DRS B;  4N5S A;  2MGZ B;  4I2Q A;  3M4X A;  2HVD A;  2IYG A;  3R1L A;  5A2Q Y;  1KRP A;  2M7S A;  4AL6 A;  4LF7 J;  1VGY A;  3M30 B;  2ZEJ A;  2HNY A;  3HT0 A;  3K2Y A;  4OZ1 A;  4P9S A;  3TEG A;  2V4J A;  1UTA A;  5K14 A;  4DPY A;  4DL5 A;  1RAG B;  4I2P A;  1VQP S;  5DGA A;  3RW6 A;  5AT1 B;  3UD4 P;  2XMK A;  5DM7 Q;  2DXE A;  1CLF A;  2KFY A;  1LWE A;  1TUV A;  3ENV A;  5F8J A;  2NUH A;  4P74 A;  2Q66 A;  2RIJ A;  3JXO A;  2QTW A;  3MM6 B;  2IVF B;  3SXL A;  2LA4 A;  3GE9 A;  3JSR A;  3TI0 A;  1SCJ B;  2QLW A;  3BH6 B;  3KNA A;  1M1H A;  3ET6 A;  3TVY A;  2Z2Z A;  4O3S A;  1TUW A;  4X65 J;  2AU0 A;  1UVJ A;  1GX5 A;  3QQC D;  2AJ4 A;  5FD1 A;  4JI1 J;  3OHA A;  2RIL A;  1DTT B;  1S77 D;  1M5O C;  1LXJ A;  3BM7 A;  2BDP A;  4ZCL A;  4FF3 A;  1N34 J;  3U7J A;  2ALZ A;  3CC2 S;  4KE5 A;  3D3B J;  2X3D A;  2E29 A;  4KO0 B;  4EWT A;  2W8L A;  2WB4 A;  2MXY A;  1S76 D;  2C2N A;  1UVN A;  3D66 A;  2UZA A;  3QT7 A;  1FXL A;  2IRU A;  1FNO A;  1RWU A;  1S1V A;  1VC0 A;  3I6P A;  4NYO A;  3OVS A;  1GXT A;  2QLB B;  3OTB A;  4ER8 A;  1HL6 A;  3D6M B;  3KUG A;  3TOQ A;  4JI8 J;  2QMX A;  2LXI A;  3E8O A;  5CA5 A;  1HHQ A;  4OYI A;  4PQA A;  3EPG A;  1VJQ A;  1M1G A;  5CYQ B;  3BQ1 A;  1RHM B;  3FJ2 A;  2AP6 A;  4PR6 A;  3ZNU A;  3TVZ A;  3NGT A;  4OYO A;  3HVT A;  2R7R A;  2UUW A;  4QIE A;  2HPU A;  4DR5 F;  4RBU A;  4DV6 F;  1HQE B;  3DRP B;  3OPK A;  4Q43 A;  4DPW A;  4DQQ A;  2KVQ E;  4F2R A;  4OYB A;  2D41 A;  3C16 B;  2BR0 A;  1IBK F;  4UF4 A;  2YPY A;  2JOQ A;  4QCL A;  2ZBP A;  2Z30 B;  1SC4 B;  5D4P A;  1YJW S;  1X0P A;  1X0F A;  2HHH F;  1Q8K A;  1RGV A;  4Y2K A;  3CJ3 A;  5JJB A;  5IC6 B;  2OPS B;  1DRZ A;  4FF2 A;  1HW9 A;  3G4S S;  2XYG B;  3MAA A;  4OZ5 A;  4IRD A;  4WK1 A;  1FE0 A;  1N33 F;  4AFF A;  5IV3 A;  3MDF A;  2XNQ A;  2K2P A;  1RWN B;  4EK2 A;  4F3M A;  2H51 B;  3BF4 A;  3GYX B;  4YR3 A;  4DSK A;  4LF6 J;  3KMS A;  4N76 A;  1BHN A;  2U2F A;  1X5P A;  3AA9 A;  4MTP A;  4WTO B;  3QZ8 A;  2UXD J;  2WON B;  4NLW A;  4C7Q A;  3IGV A;  3RG6 A;  4JI2 J;  4M5G A;  5D0R A;  5KT6 A;  3TAM B;  2VA2 A;  2I9S A;  2LXF A;  1LQ9 A;  4A8F A;  2NZ4 A;  2DHX A;  3DDN A;  3JSY A;  4KT0 C;  1RIS A;  2F5G A;  4QOT A;  4RW4 A;  1V3R A;  3D67 A;  4ETX A;  4FYW B;  3CJ8 A;  5I3U B;  4LF9 J;  2RF2 B;  4DR6 F;  1JLF B;  4K2X A;  4MYT A;  3HJF A;  3HHE A;  1HMV B;  1BY9 A;  1VLO A;  3MEE B;  4P2F A;  3HSG A;  5HMX A;  1GNK A;  4DMZ A;  2E5G A;  2Q43 A;  2LLZ A;  4RW9 A;  3D2W A;  2RUS A;  5J2P A;  2Y9H A;  1QSS A;  1TFW A;  1FCA A;  1S79 A;  3S8S A;  2GJF A;  2HEK A;  3MWB A;  4MYU A;  2Q6C A;  4OJH A;  5A8R A;  4X4S A;  1Q86 T;  5AXM A;  2XI2 A;  4PZV A;  2MLY A;  4AE5 A;  2QC3 A;  3EGV A;  2EG1 A;  3NGU A;  3GII A;  4BBY A;  2HS4 A;  3W2V A;  1NME B;  4PG7 A;  1LW0 A;  1QSY A;  4PYD A;  3EX7 B;  2BM1 A;  1I51 B;  2XM3 A;  2VC0 A;  3NOC A;  3OT9 A;  3AJ1 A;  5KT7 A;  4ECY A;  4RW7 B;  3OQ2 A;  4DG1 A;  2EFG A;  3J7A N;  1S10 A;  1C0U B;  4YOE A;  4ECX A;  5ETR A;  3EMT A;  2CZV C;  4HHU A;  1GTE A;  5B0B A;  1JJ4 A;  1TL1 A;  2VKZ G;  4HLB A;  4LRA A;  4TU7 A;  3E01 B;  1KQG B;  4RNF A;  2B5J B;  2CZ4 A;  2B4V A;  3I5A A;  3W5X A;  1U0H A;  3AAW B;  3QIP A;  3W5Y A;  3H40 A;  2J7W A;  4ZPB A;  3EVM A;  2A18 A;  2ZH1 A;  3OTD A;  4NX9 A;  1CG2 A;  2J0S D;  1BMQ B;  3NCP A;  3GU0 A;  1WI8 A;  3EWG A;  3MEC A;  2AYM A;  2KZZ A;  4EUV A;  4H4M B;  2KO1 A;  4N8O A;  1JB0 C;  3OJU A;  5F9N A;  4JOU A;  1M1K T;  4CLT A;  3DRS A;  2B9W A;  2JDJ A;  4FYY B;  3PHT A;  4QU7 A;  1FXD A;  1L3V A;  2D9O A;  2BJ8 A;  4ZPA A;  3FSY A;  2CFX A;  3SSS A;  3FKB A;  3TZY A;  2R8I A;  2OSQ A;  3BRE A;  1T3N A;  4GKK J;  1FF2 A;  3E51 A;  3M30 A;  4NI2 A;  2XLJ A;  2C3O A;  1U0S A;  1P1L A;  2ZJQ Q;  3CCL S;  2VJU A;  3PFO A;  4ECW A;  1N5Y B;  2HZV A;  3A8I A;  1VIX A;  1NH8 A;  1HBU B;  4AD6 A;  2DGT A;  4P73 A;  1UWA A;  3RUB L;  1FKP B;  4DU7 A;  5HMY A;  4QIF A;  2M8H A;  5KG6 A;  5SZT A;  1AUS L;  2GML A;  2AYE A;  1SIZ A;  2OPP B;  2ZVS A;  3AH6 A;  3M1V A;  4CO0 A;  1FKO A;  3HHK A;  3OUY A;  5CZX A;  2AT1 B;  5KT2 A;  3BGR A;  1Q4R A;  5F8M A;  4LFC F;  2QLF B;  1NSA A;  3GWC A;  4J91 A;  3G8S A;  2ZHA A;  2QG9 B;  2M52 A;  3MM8 B;  3PJ9 A;  3CCM S;  2HZC A;  2KB2 A;  2VG6 B;  1NO8 A;  5KAK A;  3TJ9 A;  5L1K A;  3J7Y U;  1F2H A;  2R3V A;  3QRP A;  4PXD A;  3DLE B;  2GVZ B;  2CWX A;  4C11 B;  1TL4 A;  1X9M A;  1Q16 B;  1VQK S;  2RHS B;  2PC6 A;  1IM4 A;  1HQU A;  2CAJ A;  1CPZ A;  3PX6 A;  4K4T A;  1QD1 A;  5J2N A;  3L4B C;  4DV4 J;  4GO5 X;  4UQG A;  3CJ2 A;  1U6Z A;  4I7F B;  2RDI A;  3NBP B;  4OX8 A;  5B7W A;  1VIS A;  1RQ0 A;  2E66 A;  5DJB A;  1XWL A;  2AZ3 A;  1UVK A;  2AEF A;  1FRM A;  3M2U A;  2JNJ A;  2DO4 A;  2RDD A;  3I0S A;  1BWE A;  4QWD A;  1HD1 A;  2RQK A;  4M5K A;  4KGX B;  5K8O A;  1YSJ A;  2FHJ D;  4O23 A;  4ID5 B;  4ZVT B;  4IDK B;  3OTO J;  1ROF A;  2CWK A;  4KPC A;  3GZ7 A;  3ZTO A;  3IRX B;  1RHR B;  2E1P A;  4F26 A;  3R5C A;  5A0Y B;  3CUN A;  4XIU A;  1OMS A;  3HD1 A;  3TNV A;  2V9W A;  2Q3P A;  3OFE A;  4OZN A;  4DPO A;  1UKU A;  2HAI A;  4B3T J;  2W01 A;  4Y00 A;  1I1G A;  1QUP A;  2M88 A;  4CLU A;  3KHH A;  1XN9 A;  4EEY A;  2BQ3 A;  2IM3 A;  4ES3 A;  3PW7 A;  1K44 A;  2GJ2 A;  1FK9 B;  1HNV A;  2VDI A;  2CJQ A;  1D9F A;  1V6H A;  2F4V J;  1CJV B;  4I2P B;  1SH3 A;  4IH7 A;  4NPO A;  1U1K A;  4OJ1 A;  1T9X A;  2JEJ A;  3GFX A;  4NLR A;  3THV A;  2RQ4 A;  3EVO A;  2CPD A;  2G1D A;  2DYA A;  5ETK A;  3UD5 A;  2OFG X;  4LSL B;  4OX9 F;  2G2O A;  2DH7 A;  2DKO B;  2HVZ A;  3ZZT A;  2YWW A;  1D9D A;  1SJR A;  3IXQ A;  3VZH A;  1WUU A;  2OML A;  2XMW A;  3LP2 A;  1DY3 A;  5KG1 A;  4B08 A;  4RUH A;  3K58 A;  2YXL A;  3G2X A;  4X65 F;  3GV5 B;  4RW4 B;  3KDN A;  3W9J A;  2CG8 A;  1U2F A;  2YNF B;  1U6F A;  4AT1 B;  4X62 J;  5I3Q A;  5EUH A;  5RUB A;  3ISN C;  2VIH A;  4DV0 J;  3P4U B;  4CP5 A;  1HBN B;  1R8B A;  2JZ5 A;  3M2V B;  2YWF A;  4NE9 C;  4R0E A;  4J9P A;  2GA7 A;  1XMQ J;  3KNG A;  2H54 B;  4PQU B;  3GYN A;  5A6P A;  3GCW P;  2AQ4 A;  3CCT A;  5BXI A;  3EPI A;  5HLF A;  2HHQ A;  2CAD A;  1T9T A;  3LP0 A;  3SQG B;  1SV5 A;  3C6T B;  4ZP9 A;  3Q86 A;  3I5C A;  5C7P A;  3D9B A;  3S7R A;  4ZLJ A;  5IXU A;  3H20 A;  3K8V A;  1RDR A;  2DPI A;  4DN9 A;  1RT4 A;  5LXY A;  1HNX F;  4RW6 B;  2GMH A;  1NB2 A;  4DV5 F;  1VQM S;  2AJF E;  3EZU A;  3ZFV A;  4Z7C A;  4DV2 J;  1MWQ A;  1V5I B;  1PO6 A;  1WC5 A;  2AGQ A;  4OZL A;  4PWD B;  1VC6 A;  4WJB A;  5C5J A;  1R8C A;  3AB2 B;  3QAE A;  2FVP A;  4LFC J;  2V69 A;  5KG4 A;  4ES1 A;  4IOA Q;  1FES A;  4O3R A;  1HBO A;  2L3M A;  4ICL A;  2BRL A;  3UR3 C;  2VFT A;  4WP9 A;  2E5I A;  1XK8 A;  2ZBQ A;  4J7C A;  4O4R A;  1T03 A;  1WD6 A;  2R8H A;  3CDB A;  4G1Q A;  2O5D A;  1S4F A;  5E5N A;  1U1R A;  1FVS A;  1RKI A;  4QR2 A;  8ATC B;  3IM9 A;  1KEK A;  2QA4 G;  4K4Y A;  4EZ6 A;  4JI7 J;  1MML A;  3GYG A;  1VQ8 S;  1KLM A;  1OO0 B;  4NRT A;  4DX6 A;  3OLB A;  2BJ7 A;  4Z37 A;  5IS2 A;  3KLE A;  2OPR A;  5LMU F;  4GKK F;  3LAN A;  3L7U A;  1RT7 B;  1WKL A;  2AD9 A;  4UY8 5;  4P52 A;  3GV7 B;  4ED0 A;  5J2Q B;  3NLC A;  2CJY B;  3FQL A;  2Z2Y B;  4MIW A;  1HIY A;  2KRB A;  3SCJ E;  3VF0 B;  2D3Z A;  3ADA C;  3CCE S;  4JI8 F;  2DVI A;  4FYD A;  3N6N A;  2K1R A;  3UE2 A;  2JWN A;  4ZPC A;  2BMB A;  1NM2 A;  4NA3 A;  4QPT A;  3POT A;  2WON A;  1YRT A;  3RW7 A;  2B0G A;  3IC1 A;  2BJ9 A;  2DBB A;  3GB0 A;  3T41 A;  4C48 A;  4ZA1 A;  4WKY A;  3P5B P;  4MH8 A;  3KJQ B;  5T14 A;  2W2Q P;  1K1Q A;  5I3P A;  4NXM J;  4DR7 J;  1ZM2 A;  2DGO A;  2KKH A;  2VFS A;  2BA9 A;  5DG9 A;  1N5Y A;  1JLF A;  3DOL A;  3CCZ A;  4FBU A;  4FPR A;  2XY5 A;  1GMV A;  3LUY A;  3TAM A;  4F0H A;  3NGR A;  4DSI A;  4KPY A;  2B56 A;  3I9V 9;  3GON A;  2KYX A;  5D0G A;  1VDH A;  2JL9 A;  2QFI A;  1VFJ A;  3D68 A;  4M5N A;  5CHC B;  4G1I A;  5E3P A;  4QW9 A;  5A8K B;  2BRK A;  3KUE A;  4I6A A;  1DTQ B;  5H9F K;  3R5D A;  2YWK A;  4RW9 B;  3J81 U;  3D28 A;  4HR2 A;  3DXB A;  3EE3 A;  1NDC A;  4R8U B;  2J8A A;  4DL3 A;  3C46 A;  1O6X A;  4AXI A;  4FXD A;  1IKX B;  3FEX B;  4JV5 F;  1UWB A;  3JTO A;  3VHQ A;  2FJB B;  2CUY A;  1HQU B;  4ENO A;  3MM9 B;  2HHP A;  4M5D B;  3SI8 A;  2XY7 A;  1RT3 A;  3AA8 A;  3AFG A;  1TKT A;  3CIZ A;  3I9Z A;  3MEG A;  4LF4 J;  4I7F A;  4YFU A;  4WII A;  5DDR C;  5IFM A;  4MK9 A;  2DGX A;  3ZZ0 A;  3E3X A;  3TUZ C;  1NHK L;  4JI0 F;  4Y2A A;  3NEK A;  4WYL A;  2M9K A;  1S6P B;  1ZAW A;  4DFK A;  2ZFH A;  2X3G A;  2NUU G;  5FLX Y;  3M9O B;  1QLN A;  3MR7 A;  3E01 A;  1F9E B;  2YWG A;  3R27 A;  5B0F A;  3MEC B;  1ZBT A;  2FVR A;  1RAO A;  4LFA J;  2GQ2 A;  2JH3 A;  3C6U A;  3KG0 A;  4I0W A;  1VQ6 S;  4HL9 A;  4UW2 A;  3M8Z A;  2BAN B;  4WZM A;  3I31 A;  3I56 S;  3L7O A;  4WFZ A;  3GIJ A;  3W63 A;  1WJ9 A;  3PRB A;  4CM0 A;  1KVK A;  5LL6 d;  2LA6 A;  5GAG U;  2HS3 A;  3RJM B;  3KWM A;  5HP1 B;  3DN9 A;  3MI7 X;  1Q78 A;  3FCW A;  3AOB A;  3N5F A;  4QYZ K;  2GZO A;  2JVO A;  4MIB A;  5IV4 A;  4A8M P;  3DCA A;  2BYC A;  4UOF A;  1T02 A;  1NK0 A;  4ETZ A;  1NK7 A;  4NCB A;  1FRL A;  2ROG A;  4C98 A;  1S9G A;  2OP5 A;  2HNZ A;  4OV1 A;  5HQL A;  5KFD A;  4ECQ A;  3QJL A;  1S7I A;  1UPP A;  2RKI A;  2V8V A;  1HNI A;  2EKY A;  1RTH A;  4NYP A;  4EGL A;  5IM0 B;  1REG X;  2DGQ A;  4MKB A;  3OXF A;  3TJ8 A;  2XY6 A;  4MAK A;  2ERR A;  1DQ8 A;  2IRY A;  2HIY A;  1VHI A;  5HMZ A;  4ZPV R;  3CE8 A;  1MMN A;  2COL A;  3CJK A;  3W62 A;  2AYB A;  3M1V B;  5K14 B;  2R7U A;  1UW4 A;  1XR7 A;  2H1Y A;  2E5L F;  1RT5 B;  1RU2 A;  1BQM A;  4NCG B;  3R6L B; 
#chains in the Genus database with same CATH homology
 2F4F A;  2VIC A;  2XMA A;  2VJV A;  2EC2 A;  2XM3 A;  2A6M A;  2VHG A;  2XO6 A;  2FYX A;  2A6O A;  2XQC A;  4ER8 A;  2F5G A;  2VJU A;  2VIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...