2VJVA

Crystal structure of the is608 transposase in complex with left end 26-mer dna hairpin and a 6-mer dna representing the left end cleavage site
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
b'LYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVEIIEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKLPTLWTNSCFISTVGGAPLNVVKQYIEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSASE ORFA
publication title Mechanism of is200/is605 Family DNA Transposases: Activation and Transposon-Directed Target Site Selection.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Dna binding protein
total genus 36
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2vjvA00
2FYXA 2XM3A 2XQCA 2A6OA 2XO6A 2VHGA 2VICA 2EC2A 2VIHA 2VJVA 2F4FA 2A6MA 2VJUA 2XMAA 2F5GA 4ER8A
chains in the Genus database with same CATH superfamily
3OSPA 1Q16B 2XY6A 2J0SD 1R8CA 2E5HA 3M32A 3HM9A 1U8SA 2ZZTA 3NRBA 2DH9A 3CUNA 2V8DA 3ZO7A 1KVJA 1QAIA 2HGMA 1D3WA 3N28A 4PRFA 1EQMA 1KP6A 3HULA 3OR2B 1F0XA 4G1QA 1RACB 1KOHA 2QFIA 4Z37A 5DZ7A 3UR0A 1MMNA 2HWTA 2D9PA 1S4FA 1C4AA 1RHJB 3OTOF 4DOZA 4B3TJ 2XMMA 1RT4B 2GIQA 2J7WA 5F8NA 2CDQA 3U1MA 3HK2A 4G65A 4P10A 5KFWA 4RBTA 1OWXA 4ELUA 3NS5A 2FJDB 1X9WA 2MZSA 3LUYA 4RW9B 2YNGA 4X66F 4ANCA 1SKRA 3KJQB 3UNYA 4OYZA 1IR1A 1RT2B 1U0SA 1HPZB 3MR7A 2BJ7A 2I0XA 1YKWA 1OSCA 5KT7A 2ZM6J 3LP2A 1TL5A 1H3DA 1SC4B 3LPEA 1N36J 3QGPA 2KU7A 2PI5A 1WF1A 3D54A 4IRDA 1S1XA 3HHLB 3CJ4A 2ZH6A 1PYSB 4C0OC 2R7SA 3KHGA 4M8LA 2D9OA 4RO0A 5HAOA 2FZKB 3KNGA 2MYFA 4C8LA 4Q45A 3HKZD 4I2PA 4Y34A 3WX4A 2V34A 3CCVS 3W8GA 2J9DA 4KC5A 4YY3F 3KK1A 3C15B 3AD8C 1VRUA 2K7JA 1WSRA 3AD9C 1YHQS 3CE8A 3M7VA 4CI0B 5U47A 2HFNA 4LSLA 4FF4A 1LNQA 4WKRA 3L09A 1TL4A 5EUHA 3RAQA 4LFBF 1X4CA 5FD1A 5B0FA 5IWAF 3T3FA 1VJWA 1FJ7A 1TUGB 1VJQA 3N6LA 3BO4A 1D8ZA 1D9FA 1M1GA 3SFGA 2JC0A 2B4VA 3T6JA 1TKXB 3MURP 4NCAA 2VFSA 1S1UA 4HI1A 5DLFA 2L48A 2VC1A 1Q8IA 3MM8B 2WK4A 4A8SA 1X8DA 4UQTA 1FFWB 3GG1A 4NCBA 1ZTWA 2UXBF 4C48A 4DBQA 1FDDA 1RT3A 4WYWA 4RKUC 1FRLA 3IS9B 1PC5A 4LF8J 2YWKA 1I6JA 5DZ6A 3CW2C 4USUA 3G8QA 5GAEI 2ZD1B 1U48A 2WONA 4B3MF 2DEIA 1E6YB 3LP1A 2E9TA 2DTJA 1I94F 4M63A 4LFCF 3BGRB 3QZ7A 4YMEA 1RYSA 4K0KF 2UXDF 2ZWPA 2WCXA 2L08A 3BN4A 1OIAA 3GIMA 3OHAA 1H7WA 2YKMB 3I5CA 2QLWA 1RT6A 2ZC3A 3PR5B 1SKUB 3RRGA 3DGVA 1HD0A 1TTHB 3MEKA 4DV7F 2W25A 3CJKB 4DCOB 1LFPA 4KPCA 3CCRS 2X1FA 2MQ8A 2BQUA 1M5OC 3MUMP 3TP2A 5JUMA 1VK3A 4ZP6A 1JB0C 2DGOA 3UN3A 2XYGB 3MM5B 2ZJPQ 1S99A 3AA8A 2BXJA 1URNA 3MCMA 1E6VB 2ZBQA 3IR6B 2DT9A 4B08A 2XC9A 4Z2XA 5K9FA 2G4BA 1YK9A 4LR9A 1JK9B 2XY7A 3DNCA 1UW9A 3CD0A 2OEMA 2NR0A 1KQKA 4WTOB 4A8OA 2YH0A 3MEDB 3MEEB 4PQUA 3CCUS 4KGVB 2B7CB 4WXOA 2NZCA 5M2RA 3OHBA 3TZYA 4B3OB 1RI7A 4G3IA 3GV7B 2RU9A 1FJCA 2DHAA 2VA3A 1AROP 2OPPA 1UZHA 3CD6S 3CCTA 3QYYA 4LR8A 5J1PA 3HX9A 1N56A 5J2NA 4ES3A 3G71S 2YWGA 4M5NA 3H4BA 4G1QB 3UDVA 2H5JB 1VR6A 1PJ5A 1DQAA 1ROFA 1RHUB 4LF4J 4CO3A 1X9MA 2VONA 3IGVA 4J9NA 4ZVTB 1SCJB 4OYMA 2ZUAA 4OJGA 2X3GA 2O67A 1JKHA 1AZSB 3Q83A 3FNNA 1J2VA 3ULHA 1JXVA 3KUEA 2A10A 1F2HA 2F8EX 2XBPA 1X4GA 3QSIA 4JI6F 3U1LA 2ZUGA 2Q3PA 2BANA 1ZH5A 3H40A 3TAPA 4KY3A 1FE4A 1FVSA 3ZZYA 5KFZA 1UJ4A 4NYZA 2HWHA 4B9VA 3CCLS 2DO4A 1RBOB 1RAFB 3CMQA 3UD5A 2NPIA 4F4YA 3RB3A 5DM7Q 5E3CA 1RLDA 2WVDA 2AX1A 4DLGA 1CLFA 2VD3A 1WACA 3TEHB 3H5YA 2MY8A 5AJ3F 2I6WA 1X5PA 4IDKA 3NS7B 1M1KT 1VRUB 3KXDA 3NMRA 1H0HB 3M8QA 4I6WA 4Q44A 1HMVB 5LSRA 1HQEA 3V81A 1Q53A 3LAKA 5IT4A 2NREA 3MMJA 3G8TA 2HNZA 4M5DA 1N0VC 3OVSA 2Z58B 3RBEA 3EPIA 3VVUA 1IN0A 1JNZB 3I56S 4QIGA 3W9JA 3L3CA 3K58A 4O4RA 2MDAA 1SQEA 2FLPA 1QUPA 2CNKB 1EAYC 1NHVA 2OJ3A 1HNVA 4F50A 4NMLA 1RAEB 3CDEA 2JEGA 5KFVA 3DLKA 1FK9B 3IAS9 4L6V3 3ZTQA 3D5MA 2KDOA 4FXWA 2HBYB 2W7PA 4AUKA 2R42A 3H20A 2ZHBA 2VG6B 3VQSA 5KFBA 3CCJS 4YFUA 5ETPA 2VBYA 1FCAA 1S48A 3WIUA 4BHQA 4CZCA 2XQCA 1GH8A 1ULRA 1TKDA 3DRPB 3OL8A 2X1GA 2ZH8A 3TZWA 4YQWA 1OYEA 4IRCA 1J5OA 3M8PB 3SBMA 1GMUA 1WI6A 5B08A 4WP9A 1LWXA 3G82A 4LF9J 1RB0A 1RT6B 3SSQA 3JSMA 1XTZA 4DR6F 3IA0A 4IH5A 2BDPA 1JLFA 4ZVOB 3ZC4A 2BE7D 4A8YA 4OLPA 4C8NA 1UEKA 2MLXA 1P6TA 4ZPVR 2QSWA 4G1IA 4XK8C 4TYBA 3GONA 5GMDA 3N9UC 3T1YJ 2L9WA 4DSLA 2K06A 5B0AA 4Q7AA 3HP6A 1RADB 2FHJA 2G1HA 4OHZA 4M5GA 4YDXA 3HT0A 3IWNC 1C0TB 1GQEA 1U47A 3HD2A 1U8WA 2BQ3A 3PG9A 1F1BB 1RTJA 2ILYA 3KUHA 3HO1A 2CQ1A 1TL1B 2NLWA 2DHSA 4DPTA 3PKYA 5E3QA 3UCZP 2HHPA 3FQKA 1ZYQA 3Q2TC 3HFVA 4ZP9A 4ZLLA 4PQUB 1FWPA 4WFXA 2UU9F 2Y1IA 1ZM9A 4DR1J 3VAFA 2E5IA 2OIHA 3GV8B 1X0FA 2PGCA 4W98A 3DLJA 3K5PA 2OPPB 1R8HA 1GMWA 3O8WA 2ATCB 2J0XA 5K8PA 4CO4A 4OI3A 2YVSA 2BRKA 3JQJA 2Y9HA 1RXOB 3SZ2A 3G6XA 3M2UA 2FQQB 2V9KA 3G9CA 1XNRJ 4CTAA 2CZ4A 1HYSA 4Y2AA 4KHPJ 5KG3A 2Z4PA 1HW9A 4WU3A 1RU2A 2XS7A 1CS4B 3MOJB 3C14A 2JL9A 4WIIA 4CRJA 5KOXA 1UFKA 3T6BA 2B0GA 4B9MA 5HJYA 2ZBPA 3CPWR 1KLNA 4ZOSA 2CRLA 2DO0A 5DRKA 4PG6A 1Z4UA 3Q22A 3PW5A 1WWHA 3GPAA 4IG0A 3KLFA 3NGTA 5AXKA 2QLFB 3PHEA 3DDNA 2JH3A 4I6YA 1APSA 2BANB 2OD4A 2CQBA 2K3IA 1HHTP 3DOMA 4ZN1A 2ZM6F 2C2RA 2ADBA 4DR7F 3QSYB 1WC5A 5FLXY 3CDBA 1O6XA 2OH2A 1REGX 3SCKE 1WG4A 2V50A 3W61A 3D67A 2Q1LA 3W5XA 1XMQJ 1RTDB 1FWKA 5ETRA 5EX0A 1CJTA 2W9CA 1M5PC 2BABA 5SZTA 1HW8A 2ZH2A 2ZHAA 1V3RA 2DR9A 2XS2A 3HFZB 2J6UA 4ELTA 2QN6B 3V81B 5LJ5Y 2MQQA 3DI6A 2R3VA 3PO5A 1H6KX 2AYMA 3I5BA 4IOBA 3EGVA 2C3MA 2F3JA 3H2VE 3K89A 4CLFA 2EFPA 2C2OB 5DS7A 4C8ZA 1BQMA 4F4WA 1H74A 2GHVC 1RKIA 4USTA 1MN9A 5D77A 1KOOA 3AHPA 5D3GA 4CLTA 2XSJA 3DLKB 3TJAA 2ERRA 5HMZA 2WBMA 3ISZA 1A6LA 1FXRA 3UR3C 2BJ9A 3I0RA 2R7VA 3QIPA 1HQ2A 4CYUA 2VOPA 2C3YA 1YJUA 2QV6A 1EP4A 2NZ4A 4LF8F 1J5OB 2LFVA 2ZEJA 3DRYA 2MKSA 2QC3A 5CCMA 1ZPVA 3P5BP 2V2VA 1XR7A 5KFNA 1HNIA 4HTIA 2FPHX 4LQ9A 3BSCA 4DXLA 3OR1A 3G82B 3JSMB 2QLJB 2D3O1 1UP1A 1JLFB 5HO4A 3O2IA 1SH2A 1NHUA 2VODA 3QT8A 4Y28C 2PFFB 4F8RA 3TVYA 3J81j 1K8AT 3LAMA 4AQYJ 1BGXT 1SJ3P 1T05B 2N3OA 3BSOA 2HQGA 4KHRA 2HQCA 2F7VA 4NPOA 2LQ9A 3B82A 1MSWD 4MYTA 4J9LA 1WG1A 2CJYB 3K8VA 4NEYA 2BR0A 4HH0A 1ZAWA 1N6QA 3DRRB 1YJVA 4RBVA 3PHTA 2C3PA 2YKNA 1SJQA 2LXIA 3GJTB 3HVTA 2DRAA 1LV5A 1RDRA 4ID8A 2E9RX 1SI9A 4D3GA 5JJBA 2JWNA 4KSEB 3GR0A 2IRXA 4Y2CA 5IM0A 3FBFA 4CLLA 4IFYB 4RU2A 4P75A 3L9ZA 1U4BA 5DG9A 2PO4A 1KLMA 2YKPA 3KNAA 2K2PA 1I51B 4U67Q 3M2UB 2KG0A 2J0WA 1AUDA 3R5CA 4CTAB 1HYSB 1HWIA 1YX2A 4B02A 5KFQA 2W2MP 1JLBA 1TL7B 4JI1F 4KKOA 4CLKA 3CIZA 1RWOB 3PX4A 2VQFJ 5I4MA 1TV6B 4OJ3A 3MEGB 2A1BA 4QCLA 3IR5B 4C11B 2XGPA 1JQGA 1LW2B 1FT8A 3P6YC 2CYYA 1VYAA 1RZMA 2RE1A 2BKNA 4FBTA 1XR5A 1U1MA 3KLFB 1KS2A 4YDDB 5GAGU 4ILMA 5L38A 1U02A 2D3UA 5J1EA 1U7LA 2ZZNA 1HI1A 1WHXA 1M5SA 3TAMA 4NZ6A 5E3AA 4FYDA 4ID5A 1OSDA 4TLQA 2YTCA 3BGUA 5D0HA 3PJXA 4FP9A 2VBZA 1CJUA 1Q8LA 5E3PA 2ZKTA 3BZQA 2VC0A 1L3UA 2E29A 2E5JA 9RUBA 4X4UA 3X3UA 1DLOB 4U95A 2J7UA 3DFEA 5FDLA 4WFYA 4TVAB 4DFJA 3ETMA 2P9EA 1VQKS 3NGUA 4HKQA 2FJAB 1AB8A 1TKTB 3AT1B 4ENOA 3H2UB 3GZ7A 2LU2A 1A9NB 1IKXB 1U45A 2JRSA 3JYTA 4IUFA 1WKJA 1FNXH 2KB2A 4MK7A 3MMCB 2C2EA 3M2VA 2KTQA 4DV5J 2VICA 3ZZUA 4Z7CA 1BQNB 4C3KA 3FBEA 4IOAQ 4RW8B 4ZP7A 1RJJA 4QYZJ 1FO1A 2HAFA 3EWGA 3I4PA 1WC0A 4Z7YA 3MM6A 1CJVB 2M8DB 4EMDA 1TR0A 1N0UA 4LSNA 2HIQA 2RF2B 2BE2B 2P6SA 2HVHA 3PYEA 2JX2A 2KJWA 3PYDA 2EVZA 1WC3A 3C6TB 4EI2A 2AF6A 2LECA 2CQCA 5F3ZA 1X0PA 3G6YA 2HK2A 2ZJQQ 4B9SA 2GCFA 3QBCA 3HZGA 3MPUB 3BO2A 4IKAA 3QMQA 2V4JA 2HQIA 1H2UX 4IFVA 1EP4B 7AT1B 1KHVA 3R8YA 4ZCMA 1N48A 1L3KA 3H7HB 2FZGB 1DAXA 2OFGX 1HNIB 4LVOP 4HH1A 2POKA 3JQKA 7FDRA 2XCAA 1NSPA 5EHHA 5KT6A 4QWEA 5F8GA 1NPPA 5B0CA 3FQLA 1OO0B 3BSAA 2YKQA 4A48A 4X4QA 4ZPWR 4DQPA 4OZNA 2D74B 1S76D 3TA2A 2IC3A 1WDTA 3OSNA 2MQPA 1PO6A 5HQ8A 1FFSB 5KFIA 1T9UA 4RUAA 1YRUA 3UDCA 2HVEA 4IR9A 1TU0B 1W2BR 2VASA 3HJVA 4DV6J 4MTPA 1Q7YT 2HMIA 5KT2A 4F2RA 4WFZA 2R7XA 2CJAA 1UVNA 2DHGA 4OI6A 3OPKA 3E51A 2R7QA 4ED8A 5H1SV 4K4ZA 3M1VB 3WDOA 3GYXB 1IM4A 1DBDA 3DN9A 2MZ1A 4NLXA 4U8YA 2MSSA 1GT8A 2EKYA 1V6HA 4DL6A 3HVTB 3ZFVA 3OXGA 4XPCA 4I67A 2ALZA 2W2OP 1TZ0A 5HBMB 4TXSA 1JLEB 1SL1A 1PAEX 4QR1A 3IBWA 4WZQA 1KLMB 2C1EB 3NS6A 4URQU 3EM1A 1JJ4A 3BQ2A 3GYGA 1XMOJ 2QX0A 4NRUA 2ZH3A 2O3DA 2FVPA 1U2CA 4KKOB 1YTYA 4LIRA 2U2FA 2W7AA 1S1WA 1B4SA 3QLHB 2PIIA 4RWWA 4OYPA 3OQ2A 2DNYA 5BJRA 2VPWB 4B3RF 5L1JA 1M1HA 2W9BA 3CDUA 2E7WA 2B5JB 2QIFA 2HAIA 3MXHP 5DQHA 5J1EB 2WRMA 3EUNA 4DV2J 2BE9B 1FXDA 4WK1A 1HNXJ 2OTJS 3DHXA 2FGOA 2MKIA 2UUBJ 2BJDA 2PMWA 3D1HA 3HHLC 3Q24A 1WTBA 1R6YA 1IBMJ 3W5YA 3N5FA 2F9JA 1QY7A 1UL3A 4KE5A 1VCTA 5FDLB 4LRFA 3W64A 4EWTA 4IO1A 4X4NA 4O3SA 1MMLA 4RUCA 3GFHA 5HATA 1ELOA 2HRYA 5CCLA 5HJXA 1AA1B 2DR7A 1ZOTA 3A3PB 3OUYA 2V9WA 2Z0GA 3L7PA 5K20B 3J81Y 3BYPA 2KKHA 3FCHA 3G96A 4A8QA 2IHR1 2Z57B 5F8HA 3JAMY 2A2DA 4U7UK 8AT1B 4RUBA 5A8KA 2DNNA 2Z2ZA 5B0GA 2XHCA 3G8SA 3MM6B 2CKWA 4EFAC 3TAQA 2PN6A 1UVKA 1SQGA 3S01A 4LREA 4TY9A 4ZPAA 2FVQA 2B7BB 2RAQA 4ZS6A 5HQLA 3LOUA 1FF2A 2ZH7A 2ADCA 4CDIA 2CXEA 1VISA 3DOKA 1SPBP 1U2RA 1Q8KA 2LVWA 5L9XA 3QGHA 3TUZC 2OSQA 4PG5A 2FGCA 2HHSA 2E7VA 4DUZF 2DXFA 3FZBA 2KFYA 2UVWA 2BUNA 2VJVA 3DLEA 3RAXA 4J37A 1FE0A 2J6SA 4QIVA 1RTIA 1GFWB 2ALYB 2CG8A 2OMOA 1UMJA 3DGPA 3G2XA 5DDQC 4F3QA 5IV3A 2BJEA 2IC3B 3Q8SB 2MKKA 1EKSA 1ZM3A 5JXSA 1IJFB 4WIQA 2W2QP 1SKWA 1MWYA 2VG7A 3WBZA 3RZAA 4KHMA 4YP3A 4AQYF 5FLXU 5LMNF 1KD1T 2LXFA 2BM1A 2GVZB 3QJJA 1OQ6A 5IFMA 1G3OA 4O0IA 3H90A 3DDKA 4CH7A 1S5ZA 4X62J 4WU2A 2C3OA 4H4KA 2K1RB 1REVA 2HS3A 4ECRA 1NH8A 1YLXA 2DYAA 4ZHRA 2XTJP 2F40A 1ITPA 2RRNA 1JWWA 4DV4F 3V2UC 1VQ9S 4DCJB 1B99A 2CQGA 4G1PA 3SIPB 4RNMA 1FDNA 4IQXA 4FBUA 2Y0BB 2RS2A 3D1QA 3IC1A 3KK3A 3MPYA 2H4YB 3BJYA 1RA7A 1FRKA 5KG4A 1F9EB 4LF1A 4ZVUB 1QAJA 3KLHA 1WC4A 4Y6IA 2KT5A 2BM0A 5ADZA 1Q5VA 1XERA 3RUBL 4OFZA 4NA2A 4I7FA 1N5TA 3LGHA 6AT1B 3VAGA 1EB0A 3I87A 1S0MA 3VWSA 1FRMA 4FDFA 1WHWA 3HDSA 2HZCA 3O3LA 3AJ2A 1PJ6A 1HNWJ 3I31A 1P9YA 4DL3A 3LH2S 1SJRA 4KO0A 2IBKA 4CLUA 2BQRA 4ER8A 5H9EK 3OL7A 2KHDA 2RKIB 3CTRA 3ZXWA 4YN3B 5D0GA 2R4FA 2DITA 1T9YA 2FIUA 1YDLA 3M9NB 1LWCB 1UZDA 2YKOA 5LMUJ 1GXUA 3A13A 4OHWA 3EPGA 3DMJA 3K5LA 1XQIA 2ILZA 3AB2B 5HANA 4CNZA 2MJUA 5EDWA 3KLEA 2AJ1A 4ED7A 3DLLQ 3I32A 1F5AA 3N79A 3LALA 3PJWA 3J7AN 2QL5B 2FC9A 2MQNA 1S49A 2QT7A 1AFJA 1K47A 2H4WB 1S7HA 2KL8A 4DU8A 4O44B 3R1LA 5CA5A 2KO1A 5CHCB 3MFIA 4FKYA 1UVIA 1NK5A 1T9TA 4F02A 4UUWA 2JC1A 1TFYA 1RBLA 3V4IA 1GMVA 1NCLA 3VHQA 4UT4A 4USJC 2UVVA 1U6ZA 4DQIA 3OFEA 1UETA 4DUYJ 3AOAA 1K0TA 4RNHA 2JZ5A 2PD1A 3BBCA 4V19J 4UF4A 4JP8A 3WHIA 1NJYA 3KMSA 4BBYA 3H5SA 1NKBA 3TQ1A 2HHHJ 2XLKA 4DR2F 4NI2A 4NLOA 4AE5A 3MHYA 2RQCA 3FRZA 2GAHC 1S1TB 1W26A 5IOLA 1UAWA 4LF7F 4DN0A 2ZH4A 1S9GA 5RUBA 4DPOA 4OX6A 3RB4A 4XDCA 2VJUA 1P8GA 4WF9Q 1JLAB 3OL6A 3EGWB 4PQAA 2DPJA 2ZVIA 5HLFA 1AW0A 3DGPB 2ZJRQ 4DX6A 1IBKF 4RW6A 1X4DA 4CO5A 3PFEA 3VGTA 3CCES 4DX7A 1FWLA 1DQ9A 1FJGJ 3CJSA 2DNKA 5HMWA 6FD1A 3ELHA 2UUAJ 1JNRB 4Y2MA 4R0JA 3EMTA 4Y2IA 2J9CA 3PXGa 1UW4A 5DDPC 3OTEA 1FVQA 1TUWA 1XJWB 2GMJA 2NSCA 1JJCB 4C7QA 4J91A 4LBIA 3R5BA 1UWBA 3SQOP 1NZ8A 2AMCB 1SXLA 3DDIA 5J2PB 3FMWA 3K8WA 4GMKA 2GW8A 1WI8A 5C7PA 1DURA 1GX6A 2L3MA 5G0RA 5KG5A 4ZHRB 2XNRA 4CNYA 5E5NA 5ETKA 3QJLA 4DU7A 2WVFA 2CA9A 2K8GA 2YY3A 3GTYX 3FSYA 1YJWS 2EC2A 2QFJA 1K0VA 5C25B 2XM3A 4EZ9A 1FNMA 2QMUB 1N5VA 3PV8A 4OHVA 2CPHA 2XMJA 2DB1A 3IG1A 3CT9A 2QTWA 3PTWA 1HFEL 5K14A 4X65F 2AJ0A 4NLTA 2M3DA 1TVRA 1LQ9A 4PKDB 1DTTA 4ED0A 1KN6A 4J9QA 4I7FB 1IQTA 3KTQA 3HVRA 5C42A 2X1BA 3H5UA 2YNIA 2RSQA 3TARA 2I5JB 4AXJA 3FCVA 3KWMA 3KLIA 4TU7A 1RCOB 4NA1A 3OTOJ 2CJBA 1WDDA 4M5MA 5CYQB 2B8QA 2RDIA 3T9ZA 1F60B 3NXZA 2RRAA 2DBBA 3MAHA 1RTZA 1Y10A 3T1AA 1W25A 4X66J 4I0WA 2LDIA 2P2CB 3PNIA 2HBRB 4A47A 2UUBF 5F8IA 4JOUA 1RHMB 2UUCF 3D0GE 2CVIA 1U6BA 2OPRB 1Y00A 2DXDA 3MGJA 2JLGA 1GTEA 3QWUA 3MFHA 1SVDA 1UVMA 4KRWA 1ZPWX 5L8RC 4NOHA 2EG2A 1NLKL 2UV8A 3OXFA 3CMAS 5F9LA 3MMAA 2WOMA 1T02A 3Q0AA 4KH0B 4F2SA 4K4SA 2LCWA 4WFAQ 2CPFA 1XWLA 3UWTA 4DSIA 2J9EA 5IXUA 4F04B 2HZVA 4WCEQ 3ENVA 2EEYA 1NKCA 1G2EA 5I3QA 3IMQJ 2H54B 4JV0A 2O5DA 5D4PA 3SSSA 2Z2LA 4NLRA 5IWAJ 1DTQB 4HTJA 2JDJA 2C22A 1FKAF 1OMSA 4P74A 4I6AA 1WORA 4CM2A 5EGYA 1WC1A 1R0AB 5A8RA 4U6PA 3G86A 2U1AA 1S9GB 2HVZA 2VBXA 2OPQB 5A0YB 2CWXA 4PUOA 2CPEA 2JLFA 2ZHOA 3MCOA 3EGZA 2GGPB 4FN5A 4HACA 3C8YA 1VQ8S 2W01A 3HVWA 3US5A 2UUWA 4RW6B 2HWIA 3DU5A 2PI4A 2O66A 4B3MJ 2A18A 1I94J 3BGFA 3S1TA 1N8RT 2WSFC 4K0KJ 2UXDJ 3NG8A 4NZ7A 5L9NA 1Y0HA 2GHWA 1U1PA 3ZNJ1 3ADAC 3KKFA 4ZCKA 4DV7J 4OMFG 3M9MB 5LL6d 1YIJS 4QIEA 4HYKA 5ETLA 3QATA 2DNMA 3KG1A 2OEKA 2R9LA 5J2MA 3F73A 3MD1A 2KVQE 2KZMA 1JLGB 1MU2A 1KNZA 1RAIB 2OFHX 3MPVA 3GYNA 1N54B 3C19A 3LF0A 2PDAA 1D09B 3LPYA 2DVIA 2KT3A 1B70B 3OV7A 3J81U 2RMLA 4WZMA 4FYYB 4R8UB 2HNDB 3W9HA 3JAMU 3QO9B 2V8PA 4HEA9 4UQGA 2D69A 1RK8A 5DQGA 5LXYA 1K1SA 5HMYA 4ES2A 2Q6CA 3VZHA 2L41A 4WE1A 5KFFA 2KXNB 3Q8PB 3V6KA 4UOCA 4N41A 4OJ1A 2DCUB 2G2YA 1TP7A 4MYUA 3AAWB 3RW7A 1WC6A 2GJ2A 1HBNB 1CULB 1AUSL 1R27B 2YNHA 5C42B 3POTA 2YQ3A 4JBCA 4RR5A 4ZJLA 3W66A 1NJIT 3A8JA 2MTLA 4KGMA 2BW2A 3ILJA 2KM8B 3IN5A 1RWXB 2AJQA 1SH0A 3I96A 3PM9A 2LYVA 3IP0A 1RT5B 1F9FA 1HNZF 1WOSA 1O5JA 1NBEB 2AGOA 2HFSA 2GX8A 2RB7A 5KG1A 3ZZOA 3CC2S 2HHQA 2BEFA 2ZE2B 1V3ZA 2VKZG 1VRTA 2ZWOA 4JI6J 1PCAA 5J1NA 3Q8QB 5DQIA 2F65A 4B3SF 3HHDA 3HHLD 5IV4A 5L1KA 5LMUF 4K4XA 3AJ1A 5ETVA 5T41A 1PGZA 4W90B 2B8PA 3CULA 5KT3A 4PZVA 5JVHQ 2B4OA 2WOMB 1Q86T 4GVBB 4ZVRB 3DLGB 3U7JA 2A0FB 1RISA 2E1CA 3MM7A 2FHKA 5D78A 3FKBA 1TMJA 4ZIVA 4NCGB 3FGVA 3QIDA 2M7SA 1R3NA 5AJ3J 5A2QY 3H42A 4GKJF 3CDAA 1FRXA 3OT9A 1U6FA 2B9EA 3LTOA 1BQXA 2ROGA 2XI3A 3T1HF 2EW9A 4OZ0A 4TY8A 3W2WA 1TL3A 4USHA 4OV1A 1U25A 4M5IA 4MKVA 4O0NA 2LEPA 5C24B 5C2GA 1KFSA 3H0PA 2BVZA 1NB7A 5HK4A 1QLNA 2IY5B 5F3TA 5IS2A 2CQIA 1S6PB 1HR0F 3FBCA 2HHHF 3VAHA 1OJ4A 3I55S 3WZ0A 4OYAA 2VKRA 1ICEB 4F0MA 3HVAA 5GMKa 2MGZB 2Q6BA 2QJ3A 5G4DA 2DNQA 3BH6B 4DSJA 1YJ7A 4Q0BA 5CYMA 3P8BB 1T9WA 2CQPA 4X4PA 5I42A 4ECXA 4NXNF 4HACB 2QG9B 4CT9A 2XB2D 2PT0A 3DXBA 1JIHA 5HI7A 3ZZPA 5DDRC 2G13A 3CEDA 3EJMA 4KFBB 4F4ZA 4I2QA 1TUVA 1U1KA 2NXEA 1O0PA 3W65A 1HD1A 4KV8B 1RAJA 1NH7A 3A12A 5I3UA 3KHHA 1IR2A 4E98A 4DR6J 3L4BC 1FJGF 3HSJA 3MF5A 2J76E 5ETMA 3SQGA 4ED5A 4X84A 1V5VA 2ASJA 2IJRA 3IO1A 1S97A 4WWSA 1TK5A 5J2QB 2LMIA 1U1QA 5J2MB 2VDHA 2CQDA 1S6OA 2YKAA 1NAQA 4AYBD 3IGNA 4ED2A 2UVUA 3OBIA 4WBFA 3D1OA 1WD6A 4XIUA 3H8YA 5KFTA 2WSEC 4QZVB 3KJVA 4I56A 2LEBA 2YBVA 2NQPA 4Y3CA 1K73T 2UUTA 3A3OB 1F6TA 1HWJA 4QWDA 1ZA1B 2V2ZA 4FF1A 4O23A 1NSQA 3SMZA 2UU9J 1VQMS 1VS3A 4RX6A 1FX2A 4UUXA 1YJRA 3RB6A 1HL6A 4ATNA 3GP9A 3NOGA 3A1YG 2V4RA 2GA7A 1X5SA 2Q43A 1BC6A 2QYCA 3WC2A 2VDIA 2YNHB 4YR2A 2A6OA 1HI8A 4N7TA 3SFUA 2V94A 4R0EA 2VF3A 5CABA 4DN9A 5BYQA 3M2RA 1Z1ZA 4F36A 3HZEA 1G6BA 3LANA 2IAJA 2G0IA 2FHMA 2HQFA 3VCDA 4GO5X 3LWLA 2F4VF 4ETXA 2FY1A 4ZN3A 2GNKA 3FCWA 1FKOA 4CH0S 3W2VA 3B54A 5T7LB 1N5YB 2BACA 2RILA 3SCIE 4O4GA 2OTLS 4DFKA 3N5BA 1GXTA 1RHRB 4NL5A 4OYXA 1MROB 5B0BA 2XZTB 2RVJA 2B3TB 3WQPA 4MH8A 4DR7J 2AJ2A 2XMTA 2V8HA 1KVKA 3BBBA 2WW8A 2HNYA 6FDRA 2GMLA 2DRBA 3DYAB 1HBMA 2GC8A 4KH1B 2FB0A 4IH6A 1QE1A 2HBZB 4FVMA 3MM7B 3KLGA 4HT5A 2D1CA 4ZMMA 1RT1A 2VL1A 2DRDA 3VV2B 2EI5A 3PCOB 2NPFA 3R1HA 4DPWA 3EZUA 5F8JA 2KZZA 2IIHA 4M1KA 4DG1A 1R89A 1UPMB 3FFIB 2JEFA 2HRUA 1Y3KA 3JQMA 2BZ2A 3SCJE 3CWJA 5CD4H 4RZRA 1WEYA 2HVDA 2NSBA 4P6QA 2QLBB 1S6QA 4ZVQB 4G6VB 2C28A 5HP1A 4RUHA 2F63A 1RWPB 4A8WA 2Q79A 2LEAA 4ECZA 1JLCA 1HBOA 2LU1A 2R7WA 5KFLA 1RE1B 1GTHA 1NZAA 3P5TL 1Q7LB 2PSZA 3N4WA 5I42B 2ACMA 4I68A 1C0UA 1BY9A 3HJFA 2FLLA 1IKVB 3D0IE 2XHWA 4OI0A 3CJ8A 4PWWA 3CVKA 1WNEA 4KTQA 2MMYA 4ECQA 4ZVEA 3SSRA 2ZOFA 2R2SA 2WB4A 4DJBA 3IAM9 4GO7X 5I3UB 4NMXA 1AXQA 1IWGA 1VHFA 2VFUA 2LA4A 3N0VA 4ZCLA 3NOCA 4R5PB 1C1CA 5IC6B 4M5KA 3CJ5A 1NK7A 3D3BJ 3TJ8A 1X60A 1VQNS 4C9DA 4QPTA 3PIOQ 1UPPA 2V68A 4OZ3A 3FBBA 1NB2A 3C16A 1C1BB 3BQ1A 2CQ0A 1EKRA 3AXKA 2IYIA 4MK9A 2CPIA 2JEIA 2AW0A 1NHKL 3R7NB 3M30B 2GZOA 1WSVA 3V6HA 1T03A 1JLQB 5CZVA 5A6PA 4F4KA 1H98A 2QRRA 1SKSA 4U7CA 1BD6A 3NMAA 4DEZA 4OZLA 1Y3JA 3M8ZA 2VZ9A 1Y7PA 1VRQC 1S4EA 4C4WA 3G6ES 2AIRB 3CJ0A 2Y1RI 1QD1A 3M32B 3CMES 4F3MA 4AL5A 1QVFR 3KHLA 4DV3J 2IM3A 1FRHA 3NY0A 4EUVA 2ZVSA 4JI1J 3ILLA 1K44A 4N76A 4GKKF 3PW0A 3IR7B 2Y0SD 2IAJB 4EGLA 3PX6A 2IMWP 4CCHA 4JI4F 4LF6F 2FLNA 3AXMA 2QA2A 4OZ5A 2CZ9A 1KR4A 1TKZA 4OYBA 2FY8A 1WEXA 3NP5A 4O3QA 3QJPA 5HMXA 4ZJOA 4O4GB 3U1NA 2YNGB 1GXLA 3C2PA 1CC7A 4F0HA 4W92B 3NAIA 3PW4A 3OJUA 4DQQA 4OQJA 5H9EJ 2RHSB 1T7PA 3SDEA 3QT6A 3J7A1 2B9YA 3PEHA 4HDGA 1NK0A 1Q79A 3LP2B 2VPXB 2FJBB 1DZ5A 3BPDA 4HHUA 2GQCA 1XR6A 3EICA 2FUG9 3QPIA 2V4QA 1S1XB 5T14A 3BREA 3L95X 2HBQB 3EGNA 2M8HA 2EFNA 2C42A 4ECTA 1FHTA 2R7UA 3CD5A 4I2PB 2UV8G 2MSTA 2RT3A 2W2PP 3OXLA 5DJBA 3PKMA 1X4FA 3KK1B 2AGPA 4ITSA 2AYBA 2J5AA 4PG7A 1DQ8A 1FEEA 3BKFA 4KB7A 4LSLB 3K57A 3MECA 3HKWA 2JOQA 1YVFA 2YX1A 9ATCB 3KG0A 1VC6A 3DOLA 2J0QD 2QYGA 1Q95G 3EXCX 3NAHA 3NLCA 2YNFA 3B4DA 3ILIA 3KFWX 3DC2A 3GCWP 3AQOA 2WSCC 1J5EF 5KT5A 1JLCB 4DPYA 1HBOB 4K8RA 1S1UB 1FERA 4DV1F 4JYAF 1QUVA 3G6VA 4DX5A 4DL4A 1UVJA 2QO3A 3Q86A 1NNDA 4C8KA 5IT0A 1DJ0A 1WF2A 1Y9OA 1C0UB 2DGUA 1HKAA 3VAIA 2JHEA 3MCNA 1YI2S 1RT3B 1UJ5A 4HT7A 3ISND 4OZ1A 3GCXP 1QAXA 8ATCB 3PDNA 2DKOB 4AT1B 4DFMA 3HHKA 3THVA 5DG7A 5ETQA 3V5RA 5B0DA 2WONB 4QU7A 2B9WA 1SJ4P 2MPUA 3LP1B 4ZITA 5CD4A 1U2FA 1ZZFA 3QGIA 4L73A 1B0VA 1C1CB 1MLAA 1S0VA 3VGVA 2HFZA 2PA8D 1N33F 2ZZMA 1WHYA 3GIRA 1HQUA 4EZ6A 1VQLS 4YS2A 3CJTA 3R6GB 2FLOA 4NLVA 4ZCIA 2V5HG 3F44A 2MQOA 4LBHA 3BYRA 4RBUA 3D6HB 3J80Y 3PYFA 4NEZA 3KDOA 4ZVFA 2AU0A 2GJFA 4AL7A 2MKCA 2CJXB 4K4YA 4J9MA 3PZPA 5KFHA 3CIMA 3UQSA 2JJ4D 2ZNZA 5DO2A 1EHWA 3KK2A 2DR5A 5A2QU 4LFAF 1RWKB 3B4MA 3K0JA 1S10A 1EZZB 2X3DA 1T0TV 4DL0C 3HSDA 4F7VA 2UP1A 4JI7F 2V67A 3RBXA 4QR0A 2MKHA 1IKYA 5BR8J 3PRVA 4USKA 1LW0A 2WAQD 3Q8VA 5KFRA 2AEFA 4OI2A 1RU1A 4FVCA 1FKPA 1UA1A 5CXTA 2QL7B 2XG8A 4ZPDA 3MUVP 2C3UA 3JTOA 3K59A 5J2NB 5DM6Q 2EK1A 1S79A 4OL8A 1BHNA 5B09A 5DGAA 2R2UA 2WHOA 1G1XA 3R5GA 4ZVSB 3P4UB 3BBFA 1NMEB 4B3RJ 2QE5A 3MR2A 3ZZ0A 3DLHA 1PSDA 1NK4A 3LP0A 5LM7E 1JKHB 3W8PA 2K7KA 4URGA 4KGKA 3K5MA 2IPOB 3CJ3A 3SDEB 3NCPA 1T8EA 4N77A 2WVBA 4OV6A 2BJ3A 3CD7A 4MKAA 2R8HA 3OR2A 2LLZA 4ZK7M 1VQ6S 5LOQA 1DY3A 2G2OA 2GV1A 3GSDA 3MAAA 3QZ8A 4JV5F 4DF4A 4OX9J 1RT4A 3HD1A 1YJNS 1FNOA 4Q8FA 1L3TA 4CIOA 1O8BA 1NK8A 3FJ2A 2V69A 4IDKB 2OP5A 4RW9A 3JXOA 1CPZA 3HSZA 4F25A 3QWPA 4DQSA 1YWXA 4N8NA 1ZM4A 1N5SA 3M8QB 4AFFA 4X64F 4Y0FA 1KSPA 1HPZA 2DNLA 5KFAA 1HQEB 1MW7A 1AFIA 1U26A 2EPIA 2HNZB 1HWKA 4M5DB 4LF2A 3MTKA 3I4HX 4BWMA 3DOLB 3HHLA 1RWNB 4OYIA 2NXJA 1RKJA 2W1BA 5KG2A 4USMA 1YJ9S 2F5GA 2H5IB 4EEYA 4TQSA 4DZDA 1PYOB 4ES1A 2OGUA 4FYVB 1HHQA 3MMBA 5K8OA 1HNVB 2EC0A 3GFZA 4ANDA 1D9DA 4DL2A 3RAMA 4K7QA 3FEXB 1T9XA 3C15A 2ZFHA 4NLGA 3NGRA 5H9FJ 3M8SA 4Q2LA 2YX7A 3KMQA 3CJQA 1IM6A 1FEHA 3H4DA 5LT5A 4DUZJ 1OS5A 1LOUA 2Z30B 5ITHA 2X7IA 2EBEA 4OIXA 2HG4A 1UWAA 1VOMA 1XBWA 1TKXA 4BC7A 3UI3A 1VC0A 2G9OA 2WTFA 4KAIA 4P2MA 5AE1A 4L76A 3MM8A 1RT7A 2ZH1A 2FVCA 4JI2F 4JI3J 1ZS6A 1S0NA 4CLSA 4PG8A 1X5OA 1D9AA 4N5SA 1RHKB 5LMNJ 4J5OA 2WB1D 1IXKA 2N7YA 4L75A 2VQEF 2O01C 2D3ZA 3E3XA 2MQMA 1RTJB 5FIIA 2MZJA 4L3NA 2ZD1A 1OQ3A 2ZKUA 2FHOB 4DQRA 3W63A 1E6YA 5GAHI 1RAGB 4RW4A 2H51B 4QW8A 4K4VA 1PKUA 1YQHA 2HGLA 1IKYB 1K9MT 2YKMA 3NWGA 3O1LA 4DV4J 3EXYA 5E33A 4WKYA 1ACMB 1FI4A 2B9XA 4MKYA 3D6TB 1Y4ZB 3VAJA 1LWEA 3BR9A 1RBAA 2XMVA 4DSEA 1PBAA 1R6VA 5E2QA 3MPDA 2N82B 3MM5A 3WIVA 2NUUG 4ZPTR 3FZ2A 4FNHA 1SQFA 1E6VA 2PMHA 2KM8C 3UCUP 1YBUA 3RB0A 4DV3F 2MHEA 4USIA 1VHIA 1L3SA 4CO2A 2MY7A 3C14B 1N32F 3P96A 4MIBA 2RQKA 2CPJA 5EWFA 4NA3A 3UCGA 4UOFA 3ILOA 3JSRA 3C3LA 4IR1A 2IVFB 2HHUA 3RBDA 4IG0B 1SV5A 2IDEA 2EBGA 2P6TA 4UW2A 4B9TA 4B3OA 2ZBCA 5E3RA 3X1LB 3KUGA 3Q2SC 3UD3P 1FD8A 1R8AA 2I2YA 1CVJA 1NJZA 4AL6A 3OTCA 4HL9A 3EE3A 3BN7A 3DOMB 2IJFA 2N3LA 4J9RA 1PBUA 1B7YB 3R5JB 3D7SB 5THWA 3MAAB 2V63A 1QDUB 2Y1LB 3UN5A 4Q2MA 3ET6A 2BBEA 2DY1A 4N56A 2WBRA 4NRTA 5AXMA 5L1IA 1SB6A 1NDLA 2A6MA 4C97A 1AZSA 1R0BG 1CJTB 2W9CB 3GFXA 4IYQA 2HHXA 1FD2A 3R97A 1K1QA 4OZ2A 1IBLF 2HFUA 1U1RA 2PFDA 4ZIWA 3UN2A 3DI6B 3BKUA 3RG6A 2VFVA 4CLYA 2QMWA 4B9LA 1KKHA 2BJ8A 2XWYA 4EO8A 3D4JA 3UVJA 3MR6A 1BQMB 4IQMA 3O6QA 3MMBB 5C2CA 3IWLA 5D3GB 2DJWA 3VQTA 4DR2J 4K4TA 2XSJB 4ALZA 2OKQA 2XMUA 2VFRA 4DCPB 3CNQP 3I0RB 4LF7J 5KAKA 1M5VC 3QIPB 1KRPA 4CYUB 1CEZA 1Q82T 2LQBA 2CJ9A 1HMVA 1G4CA 1V9OA 4ED4A 1U1OA 4TNOA 3FC9A 2CUYA 4FS2A 2HYIB 3LA0A 3HI9A 1IBKJ 2HW3A 3OR1B 1Q5YA 4DR3F 3AFGA 2CPZA 2DCLA 4I64A 2MKYA 4LRAA 2RUSA 1VI7A 2F8MA 3R2CJ 4OX8A 1SJFA 4WPAA 3GIKA 1RT7B 1VK8A 1FA0A 5HVHA 2M5YA 3HSGA 3GE9A 5KG6A 1KC8T 1FK9A 2R8IA 1WUUA 1KEKA 2NUHA 2DPIA 3PFOA 3BDEA 2R7OA 4K4WA 5AXLA 4NYPA 4OI4A 2ZOGA 2VG6A 2MLYA 1RWVB 3VALA 3GR1A 3DRPA 4NLPA 1IJEB 2HZAA 1EIYB 1QTMA 1D8YA 4YR0A 3M8PA 3UD4P 3TA0A 4RW4B 4GC7A 4CO0A 1N6QB 2HFVA 3IBFB 3ZNUA 4KJIA 2YKNB 2C2KB 3KDNA 1LWFA 2HLUA 4N47A 1H38A 1PG5B 3HCXA 3ITHA 2P9CA 5BR8F 3FDSA 1LWEB 3A8KA 3NWRA 2E66A 2JVOA 5IM0B 2X51A 1GNKA 3DRXA 4C8OA 4JI8J 2HEKA 3GIJA 4X65J 4L74A 1C0TA 3BS9A 5GMEA 1JLBB 3DRSA 2QL9B 4ECUA 1Q0NA 2CQ3A 1TL1A 2CIMA 3AOBA 4KIAA 2OEJA 4WP8A 1P27B 1NM2A 2Z2MA 4DV0F 1Q4RA 1GAOA 5ETNA 4CP5A 3VF0B 4C8YA 4K4UA 3KJNB 1SV5B 5DLGA 3EVWA 3R7BB 2ASDA 4OJHA 1HLWA 1U09A 4PXDA 3GJQB 3TAMB 3MOZA 4DDFA 1DFDA 1T9VA 4ID5B 2UUCJ 2B6AA 3J7YU 4RL1A 1CJUB 1VGYA 1TQLA 2P5VA 5KFEA 4P2XA 3ET6B 2I9SA 1CS4A 1OY6A 5HVGA 4WYLA 2K3KA 1MWZA 1PIEA 2EXUA 1URRA 3HPOA 3J80U 1UCNA 4OX9F 1X4BA 4QPXA 3OL9A 2ZOMA 5AE2A 3HMJG 5KFDA 2I1RA 4L72B 3IM8A 3D9BA 3F41A 3JYTB 4M5HA 1S6UA 2FVSA 4ZVPB 2PEHA 5KFXA 4BDPA 2IRUA 3MM9A 3M2VB 1SIZA 3SEOA 3TOQA 2FJVA 2DNOA 4DR4F 1VBZA 4FXDA 3CXCR 1VDHA 2I8EA 3GILA 5DDOC 3UVJB 2DH8A 3ENQA 3I6PA 4E8UA 2E5LF 5JVGQ 2KN4A 2DD8S 1ZM2A 4K2XA 4DLEA 3A3NB 3VVTA 2H65B 4HVZA 4LSNB 2QMXA 2XYHB 2HHWA 4DR5F 4QW9A 2AHOB 2M88A 1QJHA 1RTDA 4LMZA 4B9UA 2JSXA 4DS4A 2RS8A 2KRBA 5LSOA 1VLOA 2W9AA 4FYXB 2ZC4A 2V4JB 4O3OA 3S7RA 4J9PA 4IFVB 3OTBA 5HSPA 1WJ9A 3UO0A 1XEZA 3GJRB 3PYGA 2WZ1A 2CQ4A 4QWCA 1B0TA 3TUIC 4BCAA 1FDAA 2FDNA 4HI2A 4X4VA 3K5OA 2RQ4A 4URSA 3KYLA 2COLA 3NL0A 1LK7A 3GV5B 4DF8A 2OHDA 3RU0A 1B7FA 2HLTA 4RWXA 2YPYA 4ZPCA 3Q8YA 1VQYA 1CG2A 4IO9Q 2H9ZA 5D8HB 1CBKA 2N4DA 2HMIB 4JI5J 4JI3F 2FYXA 2EWHA 2GIRA 4OX7A 1N52B 2E7XA 5GADU 3I0SA 5KFMA 4LQ3A 3RRKA 2CJQA 4DFPA 1F5CA 5E41A 2OAUA 1T3NA 3PY8A 2B51A 3Q8RB 4KBIA 4ELVA 1X4AA 3BKTA 4F3OA 1LWFB 2RRBA 2GFFA 1FTCA 3OJSA 2HQ3A 2AEJA 2DGSA 3ITHB 3BQ0A 1OY8A 3JSYA 1RLCL 2VV5A 1T05A 2KVIA 4S0MA 1TK8A 2RDDA 1XN9A 1TMMA 4ED6A 4H54A 2DR8A 4JV1A 4A8KA 2CPDA 3DRSB 5F8MA 1EX8A 3TO8A 1S1WB 1UVLA 3JTPA 4ILRA 3E01A 3DRRA 1KDNA 2CQ2A 1TAUA 3Q89A 4J9VA 4DSKA 2NYIA 2LA6A 4QOTA 3SV3A 4NE9C 5KFGA 4LIWA 2W9BB 1HNZJ 2N4CA 4CWBA 4FS1A 2EFOA 2OPSA 5M2UA 4IFYA 1HIYA 1XNQF 3GWCA 2VBWA 5GVQA 3ZZZA 5IC4B 5IQ6A 2FD2A 2B6AB 4WK3A 1KTQA 4RNOA 2AV5A 1LXNA 1EJ7L 4B3SJ 1WOPA 4MFBA 5E7OB 1FTRA 4PPDA 4D3HA 1TL7A 4YB6A 3ONQA 1TV6A 3MEGA 4HHHA 3OLAA 3T19A 4C11A 1LW2A 1WTFA 4B3TF 3U27A 2F9DA 4ZKAA 3QRPA 2ZH9A 1R0CB 3N6NA 1F5BA 2EK6A 5C5JA 3OUYB 3RW6A 1IR0A 2AQ4A 3FK4A 2CADA 3T41A 3H5XA 4Q43A 3MM9B 4GKJJ 4TLRA 1IKWA 4H4OA 1QSYA 3MPWA 2BA9A 1UTAA 4NLQA 3NGDA 4MMOA 8RUCA 5A8KB 3T1HJ 4DS5A 1N36F 2QLXA 1SIWB 1WEZA 3LGMA 4F67A 4KT0C 4K50A 1DLOA 2ATLA 1P1LA 1SH3A 4NLWA 2DK2A 5ETSA 1RABB 4RJVA 2DR6A 2QEXS 2YQ0A 2W4DA 2LQ5A 3NCRA 1Y5IB 1TKTA 1PJ7A 1S0OA 4FPRA 1HR0J 4C98A 3DLBA 2Z56B 3ETOA 1D1UA 2M70A 4DZ6A 4C8MA 3RTVA 1IKXA 1L5UA 3DOKB 3M9OB 3MMCA 2CNNB 3OD2A 3HLUA 4X4OA 3TZZA 2E44A 1BQNA 4NXNJ 3AB4B 4RW8A 2NCKL 2YWHA 3DLEB 2OD6A 1RTIB 2AZ1A 2KH9A 3G87A 4F26A 1S1VA 2OSRA 1WF0A 2CVEA 1CJVA 1R7IA 3M8YA 4PABA 1NK6A 2XWXA 2LP4A 2AJ4A 1VBYA 1GK8A 4RU9A 2XSFA 2RF2A 2BE2A 5KFKA 3C6TA 5HROA 2HHVA 2V0NA 5MAOA 4IRKA 2MZRA 3ZTOA 4RLEA 3W60A 2VG7B 5KTQA 4O3RA 3QRRA 3TA1A 2RD5C 2W4CA 2R7TA 3I0SB 2IBOA 3M6XA 1UFLA 1SL2A 3A8EA 1BXNA 3F0NA 1S7IA 2D3OR 2QA1A 3LWMA 2B4UA 1SL0A 2J8SA 3QFWA 1REVB 3H98A 2B4PA 2CPXA 3D28A 2XLJA 1NDKA 1DARA 2IMOA 2AP6A 2APOA 2V6AA 1YGYA 4ZPBA 3OFGA 4NXMJ 1RWWB 1RQ0A 1TELA 1ZAXA 4OHYA 1Q1KA 3BR8A 3DU6A 3MR5A 3BM7A 3KK3B 1YJTA 2DIVA 2OELA 3BGOP 2R8JA 1H73A 1JJ2R 2UZAA 3CB4A 3NCQA 4JI8F 4A8FA 4X4TA 3M1VA 4CO1A 3KLHB 7FD1A 5KFCA 3RBZA 3E01B 3H2LA 2RJZA 1T95A 4ZLPA 2IJNA 3VGUA 3T9NA 3V6JA 2DGQA 4OLOA 2IFXA 2R2RA 4UZBA 2HQDA 5HBMA 1JLEA 2F4VJ 2BKPA 4CLZA 3CCQS 4KO0B 4PXEA 2OPSB 1TAQA 5EWEA 4J7CA 3UW1A 3R2DJ 1YZ7A 1R43A 2RH3A 3R3TA 2MXYA 2H48B 4MFBB 2XYPB 3DMJB 1F9HA 2XEXA 3M6UA 2VB6A 4PG4A 4ECSA 1S72S 2FJWA 4LF4F 5EN1A 4NYOA 3QLHA 3MDFA 3BF4A 3CO9A 2VUGA 3KLEB 1BE4A 1RSCA 2NXUA 4C0HA 2GIFA 1I5OB 4U8VA 1KFDA 2C2DA 2B5JA 1XC9A 4JUZA 3Q23A 2E1RA 5HN0A 2CFXA 4B17A 3IXQA 1IKWB 4H4OB 4NLDA 1PILA 2DNGA 5KFOA 4LRCA 3DM2A 4EYIB 4V19X 3V4IB 2YWWA 1VQOS 4X2BA 3PW7A 3NBPA 4LRDA 1D0EA 4M94A 2JFKA 1NPKA 2F1FA 1HWLA 4YB5A 2AT1B 1RAAB 4QQBA 3PIPQ 4P9SA 3L7OA 3RJMB 5M2PA 2V2QA 2MHNA 2L9DA 2RQMA 2FVRA 5CZXA 4YEAA 3NGKA 2DGWA 3E8OA 1RAHB 1IQZA 2J7KA 2WW4A 2CDRB 4NI2B 2Y3YA 2DEJA 4IH7A 3TANA 4LVNP 1WG5A 2GJIA 4ECVA 1RGVA 3R5AA 2HS0A 4PPZA 1SC3B 3THPA 4QWBA 3IFEA 2XCPA 4LR7A 3RR8A 3FUYA 4IOCQ 3MWBA 3QGGA 3NNHA 1BLUA 3PRBA 3JB9k 1N34J 2G0CA 1S1VB 5HLFB 1SC1B 1NEEA 2YWEA 4LUBA 1VFJA 1VLYA 4P71A 1NU4A 1S12A 1X31C 3QQCD 2JNJA 3DKDA 5HROB 4MKBA 2M52A 4O3PA 3CDWA 2D41A 4RNFA 3V6DA 4LF5J 2B56A 2EFGA 2BV3A 5LJ3Y 2DHXA 2BW7A 4A8XA 4X4SA 4UY85 4KPYA 4DSFA 4JI5F 4NASA 2JEJA 1UWBB 5BXIA 2RHQB 4R25A 4B9NA 2DISA 4JV2A 4C3MA 3MAQA 1B3TA 1U49A 1T11A 5E0OA 5ETTA 5G0RB 5L1LA 1HI0P 4YB1P 1MMDA 4LF9F 2LKZA 1YSJA 4XO0A 1F3VA 4GC6A 1Q81T 5KFUA 4PCQA 1FDBA 3JS9A 4QYRA 3I5AA 5GAGI 1VIXA 3IG1B 1MN7A 4ICLA 5AXNA 3T1YF 2DNHA 3IWXA 2XS5A 2MQLA 2GVZA 5K14B 3RGIA 3EX7B 1HHSA 3A8IA 1RWUA 3D66A 1X4HA 1TVRB 2M2BA 4Y65A 1DTTB 4Q5VA 2G2ZA 1U1LA 2K1RA 2HFOA 3EDRB 4GRSA 1LK5A 1S57A 4ECYA 2W8KA 1JXLA 1OPZA 2YNIB 4QU6A 5I3PA 4GKKJ 3KLIB 5D15A 2ROEA 2M4MA 3S8SA 4JI4J 4LF6J 2Y1JA 1PC4A 1UFWA 5DETA 4LBPA 4DR1F 4OYWA 2XGQA 3VGSA 3I82A 2J6TA 2VOOA 4UY8T 2XLIA 3Q8UA 2KYZA 3IBCB 2F4FA 4U7UD 5D4LA 2XMWA 4K5SA 2CNLB 4EBCA 2ROPA 1XNRF 2MKJA 4KHPF 2FZCB 3R27A 3W9IA 1GX5A 1FJEB 1EETA 1M0SA 4ZA1A 4CLWA 1NKEA 2E5GA 3TRGA 3FEYB 1EQ0A 4KGXB 3NNCA 3MMAB 2BYCA 3CGIA 3DHWC 3KHRA 2OO4A 1ZAVA 5A76A 4ZVHA 2W7OA 4PWUA 2RKIA 3D2WA 3LGNA 3DM2B 3T5JA 3R9LA 2BJ1A 3TVKA 3BPSP 4FF2A 1LWCA 2R8GA 1I3OB 3NBPB 1RA6A 3GMGA 1UA0A 2NS1B 1RAOA 2KG1A 4QIWD 3ZZTA 3F56A 3CC7S 4KGZB 4QBUA 1UKUA 1RTHA 4NWBA 5HVFA 4IG3A 2YPZA 4NLYA 2IM0A 3H25A 1NK9A 5HQMA 4J9OA 2DXEA 5A8WA 4Y2KA 1XMQF 3DCAA 4PXCA 2ABYA 1J5EJ 4M5JA 5A8RB 4DV1J 4JYAJ 2XZWA 4O44A 1JX4A 3HXMA 2CPYA 3T5KA 3TW0A 4P7VA 3I9V9 2HSEB 4K5RA 2H5EA 4PUOB 3OTDA 2ASYA 1VQ7S 2I38A 2KXFA 1X5TA 3AQPA 2XMKA 1ZTTA 3RYLA 2GHPA 3FSXA 5KG0A 3UFCX 1NJWA 2YH1A 3MI7X 1X9SA 2VHGA 4WJBA 3V6DB 3CCSS 4OI1A 2UVRA 2DNZA 3CCMS 3VR1A 1MNEA 1N33J 5F9NA 1S1TA 1RHQB 4FPIA 3AOCA 5D0EA 2VPYB 3HFKA 3KG4A 1JLAA 3HHNB 1MU2B 4L3KA 3CJ2A 2C2NA 1X4EA 1RCXB 1Q78A 3T5HA 4FKXA 4LFAJ 2IVYA 2PEBA 4DPUA 3EDQB 4J9KA 3AY0A 2D7SA 1V5IB 4JI7J 5IT9Y 3VAKA 2MZTA 4NXMF 1WKKA 1EARA 2DIUA 2IYGA 4CLPA 4XAKA 2O1PA 4ICLB 3ZTSA 1KONA 4DHVA 3TYTA 1YBAA 3QT5A 2GMHA 3TVZA 4WE1B 4MK8A 1NXIA 3TUPA 1VBKA 2LXUA 3J7YI 1BUXA 4BS2A 3RR7A 3GQCA 5J2PA 4NLSA 2GO9A 3EZ5A 3POTB 3PJ9A 1Y5NB 3QAEA 2ZH5A 5BYRA 3NKYA 1H2TZ 2OI2A 3NGSA 3CO0P 5GAEU 5K5MA 3UDLA 4JI0J 3OLBA 2IA6A 3LW5C 5C25A 3CF5Q 1JJHA 2AJFE 2RIJA 3ZTRA 4NZ0A 1R8PA 2HPUA 5F0UA 4ZP8A 1VRTB 2IDLA 2LQ8A 5B7WA 2KFNA 1AYEA 2E9ZA 2OMLA 4TQRA 3BGLA 4W4MA 4MT1A 2HRTA 2VQFF 2BMBA 3TR5A 2IRYA 1EETB 2KI2A 2Y8WA 2I5JA 2DHHA 3R5DA 1A0OB 3B78A 3I9ZA 4JV5J 2JFDA 3HHEA 4I4BA 3BO3A 2XI2A 1VQSA 3CCZA 1AT1B 2KYXA 5CYQA 2UXCJ 2CG4A 2FJEB 4F4AA 4XTTA 3PVXA 3IRXA 2EG1A 4WFBQ 1M5KC 3NEKA 4MIWA 2VG5A 2W8LA 1NSKL 3QT7A 3KLVA 4TN2A 1H2VZ 1F2GA 4X64J 2BX6A 3N01A 1WOOA 5F41A 4AXIA 4P73A 5EWGA 1N4LA 2OPRA 4TY8B 3W2WB 2CAJA 4U9RA 1TL3B 3SV4A 2IM1A 1RTHB 4IG3B 4V1Ak 2YXLA 3C66A 4ZLNA 4TYAA 3KOAA 5A8WB 3CSKA 3T5LA 1QVGR 3W5ZA 3VZIA 1MG7A 5F8LA 1NRKA 4I69A 1B0PA 4F4XA 5AE3A 5F0WA 3K2YA 3IRWP 4AD6A 5GADI 4Q0BB 4ZDNA 5CYMB 3UE2A 4UZCA 4DV5F 3TEGA 3CJRA 2VA2A 3M8WA 1IVZA 1XIQA 2Q66A 3TI0A 3AD7C 1ZETA 3ZZRA 5K8NA 1W7WA 4FXVA 1XK8A 3U02A 1N34F 1QSLA 4J9SA 1DTQA 4DPXA 2XULA 4I2QB 3J7Z5 2AYGA 1G7CB 2J9DE 2KXHA 4RW7A 4ERDA 3H59A 2ACYA 1WHVA 1R0AA 3WC0A 4EU0A 1M90T 2BKOA 5D4NA 1O51A 5CQGA 3M4XA 4MIAA 4P2FA 3SQGB 2NXCA 1T3OA 4LF5F 1IBCB 1XMBA 4JI2J 2OPQA 5A0YA 3K17A 1GEHA 2DGVA 2SXLA 2JLEA 3LO3A 2VQEJ 3D6FB 4HDHA 4ECWA 4EYHB 2GGPA 5HL7Q 4DUTA 4LRBA 2XO6A 4YHHJ 3S6EA 2ASLA 1Q8BA 3KJVB 1RUSA 1VQ5S 3UDEA 4DL7A 1QTNB 5KFJA 1U0HA 3R6LB 3B8HA 4KQZA 4CM0A 4LSZB 3G4SS 3W7BA 1VMBA 2VIHA 1LXJA 2NYHA 3GU0A 2AKWB 2R7RA 4DV6F 4BLGA 2E1AA 1S9FA 1A7GE 2DH7A 2AZ3A 2B43A 1KQFB 2OLWA 4WXWA 2RU3A 3MD3A 1NSAA 1UEVA 2X1AA 2AEMA 4OYOA 1FESA 2OUGA 2M0GB 4RPFA 1RWMB 1ZZNA 2GQQA 3AA9A 1RP5A 1ZBTA 1JLGA 2GVDA 2E1PA 3TUJC 5B0EA 5IQQA 4GVLA 4UTGA 2FC8A 3J7ZT 3PW2A 1N32J 3GG0A 3M2RB 4XDDA 3ENAA 5SUHA 4R8UA 2HNDA 3D0HE 4ILLA 3QO9A 1YITS 5DG8A 1WELA 2PMZD 4A8MP 2R2TA 2IA0A 4NLUA 1I1GA 2KT2A 2VH7A 1NJXA 5KFYA 1VIOA 1FKOB 4YR3A 4FF3A 3W2VB 2H3EB 4HLBA 1VQPS 4Q8EA 2KHCA 3C6UA 1XMOF 1U1NA 3RRHA 3MZIA 2EFQA 4UOGA 1BWVA 4ED1A 1HBNA 1CULA 2GQ2A 2W4PA 3QFHA 3QAUA 2XMAA 1HARA 2HURA 4TU9A 1YG0A 1DHMA 3QNWB 2HNYB 2V8VA 1NDCA 5EX3A 1HBMB 4PWDA 1QE1B 3ZTPA 5MLCV 1SUQA 1RT5A 1W2IA 1SJ1A 3KLGB 3IRXB 5JMNA 2DGTA 3HT3A 1RT1B 1OY9A 1KTVA 2VG5B 5D4OA 1FFGB 4DV2F 3JTNA 4YOEA 1IBLJ 1HNXF 2IVMA 4DG1B 3EVMA 1BMQB 2J8AA 2ZE2A 3W1YC 5KFPA 3FMBA 2E1MC 1HBUA 1FRIA 2VU5A 2KJVA 3TX0A 1IBMF 1N88A 3P45B 4OHXA 1S6QB 5IZHA 2RNEA 3AJDA 4PEOA 1HWUA 4K2JA 3OFHA 1M5HA 4E2FB 3M6WA 2XY5A 4PYDA 4EK2A 5HP1B 4GVBA 1S59A 3DLGA 3DXSX 1VQ4S 4WP3A 4USVA 2C2MB 4NCGA 2Z2YB 4ANEA 2F8HA 4YY3J 1F3FA 1YBTA 3FRYA 5KG7A 1CSJA 3LQVA 5KFSA 3VTIA 1DRZA 2QSFA 2C2ZB 4A46A 2PC6A 1CQMA 3UNGC 4FNIA 3L7UA 2KRRA 2BOPA 4X4RA 2DNRA 3UPFA 5K8MA 4KYZA 4LFBJ 2A2CA 4P52A 2FJXA 3OVBA 3D68A 4Y00A 2HK3A 3W3SA 5C24A 2AX0A 4QR2A 4RW7B 1NPRA 4DR3J 4J90A 3D6MB 2EFVA 2CQHA 1X7VA 1S6PA 5H9FK 1L3VA 3GB0A 3K7RA 3TNVA 2MGZA 5BYSA 2FHJD 4P2SA 5D6GA 2UXBJ 3ISNC 3JSBA 4H4KC 5D0RA 2R8KA 2L9NA 2PE8A 4FZVA 5CAAA 3C16B 3EYZA 4BWJA 3BDPA 1YRXA 2MZQA 2A3JA 4KFBA 1LKZA 4QIFA 1TK0A 4LFCJ 1U0HB 2AWZA 4CT8A 2QA4G 4KV8A 1P1TA 2Y8YA 2W2NP 3MR3A 1N5QA 1T03B 2KFZA 3E2EA 2HKEA 1GMWD 1S9EA 1UEUA 1PYTA 1KQGB 2RUGA 2YQ1A 5J2QA 4H4MA 2CWKA 1LFWA 3P49B 3AODA 3WX8A 3OFFA 4J9UE 4X62F 2GVDB 3BB5A 2AGQA 3SI8A 4XPEA 2XO7A 1LEOA 3W62A 1NDPA 4PR6A 1OYDA 1RYRA 2MLZA 3MUTP 1KQSR 4LT6A 3M6VA 1Z2LA 4DL5A 4PAAA 3GJSB 3D3CJ 4YUDA 2EKNA 1CJKA 4JI0F 1KWMA 2IM2A 4DV0J 1TKZB 1TFWA 4HR2A 2AYEA 2ZDOA 2QGFB 3BH7B 1H72C 3OVAA 4DMZA 1NO8A 1J27A 3C6UB 4ZVGA 3BV8A 3V4MA 3SYZA 3PRDA 5DGBA 1YZ6A 1HA1A 2LDYA 3C46A 4A4JA 1U24A 2ZBRA 2AD9A 4QJVA 2WVEA 3PO4A 2G0JA 2BRLA 3M05A 3EVOA 2MEWA 4ETZA 1BWEA 5GAHU 2HHTA 4C6AA 4PWDB 1SUQB 4WTYA 3TZXA 3PR4A 1FXLA 3CC4S 1HNWF 4C3LA 1QAYA 2V2KA 2N7CA 2UXCF 5CYJA 2YX4A 3O5TB 1IWAA 1KHWA 2CJKA 3ENWA 1Z2ZA 5T7LA 1T94A 1N5YA 2P8IA 2G1DA 1HBUB 4OZJA 1IUJA 1P9QC 3PEJA 1MROA 4O3NA 1RT2A 4DR4J 2M9KA 5IT9U 2GS8A 2NXNA 3MECB 3MTJA 2QA4S 3GSIA 3P3DA 4N8OA 2E5LJ 3DYAA 2YNFB 3FVYA 2CNOB 3GLJA 2LQJA 3GIIA 1S77D 4DR5J 3BEGB 4I1TA 2ZNYA 1R31A 3SXLA 3FSIA 2HS4A 5LSLA 4QWAA 1QSSA 4C0BA 4ZJQA 4JB8B 4QYZK 3FFIA 4UOHA 1PAUB 1FRJA 3R7SB 5L39A 4E0DA 4HHJA 3TQEA 4DUYF 1WKLA 1R8BA 2V8GA 3M8RA 4CH1A 4ED3A 4WFNQ 4KR0B 3EZOA 2XNQA 3IM9A 3AH6A 4BC9A 4EBEA 5KT4A 4NX9A 2JVRA 1VBXA 1JXEA 1Y5LB 3FEZA 2H1YA 3K5NA 3NNAA 4DX8H 1HQUB 3N6MA 4PYAA 3TX8A 3MCSA 2YWFA 1SBRA 2W24A 1C2PA 5ETOA 3CCWA 5CH7B 3SCLE 2HGNA 2QZ8A 2PA3A 4K59A 1IKVA 3PACA 3IS9A 1CC8A 3GFYA 1H7XA 2P9GA 2MB0B 4YHHF 5A6WA 4M95A 1CQNA 5L46A 2VPZB 3PX0A 3KK2B 3BSNA 4USWA 2MJNA 1QM9A 2BOAA 2GO8A 1UJ6A 1KBRA 2ZDPA 4U96A 3BGRA 1B64A 2UUAF 1JMTA 4YB7A 5FJ4A 1S9EB 4DI6A 3TWZA 2WVCA 5KOWA 2VFTA 5AT1B 2ZITA 1MWQA 4R5PA 4TU8A 4CQ1A 2Z8QA 1LW0B 4H4MB 3O44A 4MAKA 1KVIA 1SC6A 3CJKA 1FKPB 4EO6A 3VAMA 4F0KA 1ZA2B 4DWIA 2HVIA 1V3SA 3THTA 2CZVC 2XZDB 3A4TA 1C1BA 4RNNA 3OW2R 1OPIA 5LXRA 4PXBA 2FTRA 1Y11A 4EBDA 3M30A 2GAGC 3B6BA 1CJKB 2RDJA 4M5LA 3ICLA 3TJ9A 2DNPA 2DGXA 1VC5A 4FYWB 1JLQA 2DY9A 2HIYA 4P7TA 4ZLJA 3LP0B 3HF5A 3MEDA 3QRQA 1NUEA 4P72A 2ZBIA 4C2MA 3MEEA 1FX4A 4LJMA 1C4CA 4TKTA 1XNQJ 3KJFB 1YRTA 4MJKA
chains in the Genus database with same CATH topology
2FYXA 2XM3A 2XQCA 2A6OA 2XO6A 2VHGA 2VICA 2EC2A 2VIHA 2VJVA 2F4FA 2A6MA 2VJUA 2XMAA 2F5GA 4ER8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYX A;  2XM3 A;  2XQC A;  2A6O A;  2XO6 A;  2VHG A;  2VIC A;  2EC2 A;  2VIH A;  2VJV A;  2F4F A;  2A6M A;  2VJU A;  2XMA A;  2F5G A;  4ER8 A; 
#chains in the Genus database with same CATH topology
 3OSP A;  1Q16 B;  2XY6 A;  2J0S D;  1R8C A;  2E5H A;  3M32 A;  3HM9 A;  1U8S A;  2ZZT A;  3NRB A;  2DH9 A;  3CUN A;  2V8D A;  3ZO7 A;  1KVJ A;  1QAI A;  2HGM A;  1D3W A;  3N28 A;  4PRF A;  1EQM A;  1KP6 A;  3HUL A;  3OR2 B;  1F0X A;  4G1Q A;  1RAC B;  1KOH A;  2QFI A;  4Z37 A;  5DZ7 A;  3UR0 A;  1MMN A;  2HWT A;  2D9P A;  1S4F A;  1C4A A;  1RHJ B;  3OTO F;  4DOZ A;  4B3T J;  2XMM A;  1RT4 B;  2GIQ A;  2J7W A;  5F8N A;  2CDQ A;  3U1M A;  3HK2 A;  4G65 A;  4P10 A;  5KFW A;  4RBT A;  1OWX A;  4ELU A;  3NS5 A;  2FJD B;  1X9W A;  2MZS A;  3LUY A;  4RW9 B;  2YNG A;  4X66 F;  4ANC A;  1SKR A;  3KJQ B;  3UNY A;  4OYZ A;  1IR1 A;  1RT2 B;  1U0S A;  1HPZ B;  3MR7 A;  2BJ7 A;  2I0X A;  1YKW A;  1OSC A;  5KT7 A;  2ZM6 J;  3LP2 A;  1TL5 A;  1H3D A;  1SC4 B;  3LPE A;  1N36 J;  3QGP A;  2KU7 A;  2PI5 A;  1WF1 A;  3D54 A;  4IRD A;  1S1X A;  3HHL B;  3CJ4 A;  2ZH6 A;  1PYS B;  4C0O C;  2R7S A;  3KHG A;  4M8L A;  2D9O A;  4RO0 A;  5HAO A;  2FZK B;  3KNG A;  2MYF A;  4C8L A;  4Q45 A;  3HKZ D;  4I2P A;  4Y34 A;  3WX4 A;  2V34 A;  3CCV S;  3W8G A;  2J9D A;  4KC5 A;  4YY3 F;  3KK1 A;  3C15 B;  3AD8 C;  1VRU A;  2K7J A;  1WSR A;  3AD9 C;  1YHQ S;  3CE8 A;  3M7V A;  4CI0 B;  5U47 A;  2HFN A;  4LSL A;  4FF4 A;  1LNQ A;  4WKR A;  3L09 A;  1TL4 A;  5EUH A;  3RAQ A;  4LFB F;  1X4C A;  5FD1 A;  5B0F A;  5IWA F;  3T3F A;  1VJW A;  1FJ7 A;  1TUG B;  1VJQ A;  3N6L A;  3BO4 A;  1D8Z A;  1D9F A;  1M1G A;  3SFG A;  2JC0 A;  2B4V A;  3T6J A;  1TKX B;  3MUR P;  4NCA A;  2VFS A;  1S1U A;  4HI1 A;  5DLF A;  2L48 A;  2VC1 A;  1Q8I A;  3MM8 B;  2WK4 A;  4A8S A;  1X8D A;  4UQT A;  1FFW B;  3GG1 A;  4NCB A;  1ZTW A;  2UXB F;  4C48 A;  4DBQ A;  1FDD A;  1RT3 A;  4WYW A;  4RKU C;  1FRL A;  3IS9 B;  1PC5 A;  4LF8 J;  2YWK A;  1I6J A;  5DZ6 A;  3CW2 C;  4USU A;  3G8Q A;  5GAE I;  2ZD1 B;  1U48 A;  2WON A;  4B3M F;  2DEI A;  1E6Y B;  3LP1 A;  2E9T A;  2DTJ A;  1I94 F;  4M63 A;  4LFC F;  3BGR B;  3QZ7 A;  4YME A;  1RYS A;  4K0K F;  2UXD F;  2ZWP A;  2WCX A;  2L08 A;  3BN4 A;  1OIA A;  3GIM A;  3OHA A;  1H7W A;  2YKM B;  3I5C A;  2QLW A;  1RT6 A;  2ZC3 A;  3PR5 B;  1SKU B;  3RRG A;  3DGV A;  1HD0 A;  1TTH B;  3MEK A;  4DV7 F;  2W25 A;  3CJK B;  4DCO B;  1LFP A;  4KPC A;  3CCR S;  2X1F A;  2MQ8 A;  2BQU A;  1M5O C;  3MUM P;  3TP2 A;  5JUM A;  1VK3 A;  4ZP6 A;  1JB0 C;  2DGO A;  3UN3 A;  2XYG B;  3MM5 B;  2ZJP Q;  1S99 A;  3AA8 A;  2BXJ A;  1URN A;  3MCM A;  1E6V B;  2ZBQ A;  3IR6 B;  2DT9 A;  4B08 A;  2XC9 A;  4Z2X A;  5K9F A;  2G4B A;  1YK9 A;  4LR9 A;  1JK9 B;  2XY7 A;  3DNC A;  1UW9 A;  3CD0 A;  2OEM A;  2NR0 A;  1KQK A;  4WTO B;  4A8O A;  2YH0 A;  3MED B;  3MEE B;  4PQU A;  3CCU S;  4KGV B;  2B7C B;  4WXO A;  2NZC A;  5M2R A;  3OHB A;  3TZY A;  4B3O B;  1RI7 A;  4G3I A;  3GV7 B;  2RU9 A;  1FJC A;  2DHA A;  2VA3 A;  1ARO P;  2OPP A;  1UZH A;  3CD6 S;  3CCT A;  3QYY A;  4LR8 A;  5J1P A;  3HX9 A;  1N56 A;  5J2N A;  4ES3 A;  3G71 S;  2YWG A;  4M5N A;  3H4B A;  4G1Q B;  3UDV A;  2H5J B;  1VR6 A;  1PJ5 A;  1DQA A;  1ROF A;  1RHU B;  4LF4 J;  4CO3 A;  1X9M A;  2VON A;  3IGV A;  4J9N A;  4ZVT B;  1SCJ B;  4OYM A;  2ZUA A;  4OJG A;  2X3G A;  2O67 A;  1JKH A;  1AZS B;  3Q83 A;  3FNN A;  1J2V A;  3ULH A;  1JXV A;  3KUE A;  2A10 A;  1F2H A;  2F8E X;  2XBP A;  1X4G A;  3QSI A;  4JI6 F;  3U1L A;  2ZUG A;  2Q3P A;  2BAN A;  1ZH5 A;  3H40 A;  3TAP A;  4KY3 A;  1FE4 A;  1FVS A;  3ZZY A;  5KFZ A;  1UJ4 A;  4NYZ A;  2HWH A;  4B9V A;  3CCL S;  2DO4 A;  1RBO B;  1RAF B;  3CMQ A;  3UD5 A;  2NPI A;  4F4Y A;  3RB3 A;  5DM7 Q;  5E3C A;  1RLD A;  2WVD A;  2AX1 A;  4DLG A;  1CLF A;  2VD3 A;  1WAC A;  3TEH B;  3H5Y A;  2MY8 A;  5AJ3 F;  2I6W A;  1X5P A;  4IDK A;  3NS7 B;  1M1K T;  1VRU B;  3KXD A;  3NMR A;  1H0H B;  3M8Q A;  4I6W A;  4Q44 A;  1HMV B;  5LSR A;  1HQE A;  3V81 A;  1Q53 A;  3LAK A;  5IT4 A;  2NRE A;  3MMJ A;  3G8T A;  2HNZ A;  4M5D A;  1N0V C;  3OVS A;  2Z58 B;  3RBE A;  3EPI A;  3VVU A;  1IN0 A;  1JNZ B;  3I56 S;  4QIG A;  3W9J A;  3L3C A;  3K58 A;  4O4R A;  2MDA A;  1SQE A;  2FLP A;  1QUP A;  2CNK B;  1EAY C;  1NHV A;  2OJ3 A;  1HNV A;  4F50 A;  4NML A;  1RAE B;  3CDE A;  2JEG A;  5KFV A;  3DLK A;  1FK9 B;  3IAS 9;  4L6V 3;  3ZTQ A;  3D5M A;  2KDO A;  4FXW A;  2HBY B;  2W7P A;  4AUK A;  2R42 A;  3H20 A;  2ZHB A;  2VG6 B;  3VQS A;  5KFB A;  3CCJ S;  4YFU A;  5ETP A;  2VBY A;  1FCA A;  1S48 A;  3WIU A;  4BHQ A;  4CZC A;  2XQC A;  1GH8 A;  1ULR A;  1TKD A;  3DRP B;  3OL8 A;  2X1G A;  2ZH8 A;  3TZW A;  4YQW A;  1OYE A;  4IRC A;  1J5O A;  3M8P B;  3SBM A;  1GMU A;  1WI6 A;  5B08 A;  4WP9 A;  1LWX A;  3G82 A;  4LF9 J;  1RB0 A;  1RT6 B;  3SSQ A;  3JSM A;  1XTZ A;  4DR6 F;  3IA0 A;  4IH5 A;  2BDP A;  1JLF A;  4ZVO B;  3ZC4 A;  2BE7 D;  4A8Y A;  4OLP A;  4C8N A;  1UEK A;  2MLX A;  1P6T A;  4ZPV R;  2QSW A;  4G1I A;  4XK8 C;  4TYB A;  3GON A;  5GMD A;  3N9U C;  3T1Y J;  2L9W A;  4DSL A;  2K06 A;  5B0A A;  4Q7A A;  3HP6 A;  1RAD B;  2FHJ A;  2G1H A;  4OHZ A;  4M5G A;  4YDX A;  3HT0 A;  3IWN C;  1C0T B;  1GQE A;  1U47 A;  3HD2 A;  1U8W A;  2BQ3 A;  3PG9 A;  1F1B B;  1RTJ A;  2ILY A;  3KUH A;  3HO1 A;  2CQ1 A;  1TL1 B;  2NLW A;  2DHS A;  4DPT A;  3PKY A;  5E3Q A;  3UCZ P;  2HHP A;  3FQK A;  1ZYQ A;  3Q2T C;  3HFV A;  4ZP9 A;  4ZLL A;  4PQU B;  1FWP A;  4WFX A;  2UU9 F;  2Y1I A;  1ZM9 A;  4DR1 J;  3VAF A;  2E5I A;  2OIH A;  3GV8 B;  1X0F A;  2PGC A;  4W98 A;  3DLJ A;  3K5P A;  2OPP B;  1R8H A;  1GMW A;  3O8W A;  2ATC B;  2J0X A;  5K8P A;  4CO4 A;  4OI3 A;  2YVS A;  2BRK A;  3JQJ A;  2Y9H A;  1RXO B;  3SZ2 A;  3G6X A;  3M2U A;  2FQQ B;  2V9K A;  3G9C A;  1XNR J;  4CTA A;  2CZ4 A;  1HYS A;  4Y2A A;  4KHP J;  5KG3 A;  2Z4P A;  1HW9 A;  4WU3 A;  1RU2 A;  2XS7 A;  1CS4 B;  3MOJ B;  3C14 A;  2JL9 A;  4WII A;  4CRJ A;  5KOX A;  1UFK A;  3T6B A;  2B0G A;  4B9M A;  5HJY A;  2ZBP A;  3CPW R;  1KLN A;  4ZOS A;  2CRL A;  2DO0 A;  5DRK A;  4PG6 A;  1Z4U A;  3Q22 A;  3PW5 A;  1WWH A;  3GPA A;  4IG0 A;  3KLF A;  3NGT A;  5AXK A;  2QLF B;  3PHE A;  3DDN A;  2JH3 A;  4I6Y A;  1APS A;  2BAN B;  2OD4 A;  2CQB A;  2K3I A;  1HHT P;  3DOM A;  4ZN1 A;  2ZM6 F;  2C2R A;  2ADB A;  4DR7 F;  3QSY B;  1WC5 A;  5FLX Y;  3CDB A;  1O6X A;  2OH2 A;  1REG X;  3SCK E;  1WG4 A;  2V50 A;  3W61 A;  3D67 A;  2Q1L A;  3W5X A;  1XMQ J;  1RTD B;  1FWK A;  5ETR A;  5EX0 A;  1CJT A;  2W9C A;  1M5P C;  2BAB A;  5SZT A;  1HW8 A;  2ZH2 A;  2ZHA A;  1V3R A;  2DR9 A;  2XS2 A;  3HFZ B;  2J6U A;  4ELT A;  2QN6 B;  3V81 B;  5LJ5 Y;  2MQQ A;  3DI6 A;  2R3V A;  3PO5 A;  1H6K X;  2AYM A;  3I5B A;  4IOB A;  3EGV A;  2C3M A;  2F3J A;  3H2V E;  3K89 A;  4CLF A;  2EFP A;  2C2O B;  5DS7 A;  4C8Z A;  1BQM A;  4F4W A;  1H74 A;  2GHV C;  1RKI A;  4UST A;  1MN9 A;  5D77 A;  1KOO A;  3AHP A;  5D3G A;  4CLT A;  2XSJ A;  3DLK B;  3TJA A;  2ERR A;  5HMZ A;  2WBM A;  3ISZ A;  1A6L A;  1FXR A;  3UR3 C;  2BJ9 A;  3I0R A;  2R7V A;  3QIP A;  1HQ2 A;  4CYU A;  2VOP A;  2C3Y A;  1YJU A;  2QV6 A;  1EP4 A;  2NZ4 A;  4LF8 F;  1J5O B;  2LFV A;  2ZEJ A;  3DRY A;  2MKS A;  2QC3 A;  5CCM A;  1ZPV A;  3P5B P;  2V2V A;  1XR7 A;  5KFN A;  1HNI A;  4HTI A;  2FPH X;  4LQ9 A;  3BSC A;  4DXL A;  3OR1 A;  3G82 B;  3JSM B;  2QLJ B;  2D3O 1;  1UP1 A;  1JLF B;  5HO4 A;  3O2I A;  1SH2 A;  1NHU A;  2VOD A;  3QT8 A;  4Y28 C;  2PFF B;  4F8R A;  3TVY A;  3J81 j;  1K8A T;  3LAM A;  4AQY J;  1BGX T;  1SJ3 P;  1T05 B;  2N3O A;  3BSO A;  2HQG A;  4KHR A;  2HQC A;  2F7V A;  4NPO A;  2LQ9 A;  3B82 A;  1MSW D;  4MYT A;  4J9L A;  1WG1 A;  2CJY B;  3K8V A;  4NEY A;  2BR0 A;  4HH0 A;  1ZAW A;  1N6Q A;  3DRR B;  1YJV A;  4RBV A;  3PHT A;  2C3P A;  2YKN A;  1SJQ A;  2LXI A;  3GJT B;  3HVT A;  2DRA A;  1LV5 A;  1RDR A;  4ID8 A;  2E9R X;  1SI9 A;  4D3G A;  5JJB A;  2JWN A;  4KSE B;  3GR0 A;  2IRX A;  4Y2C A;  5IM0 A;  3FBF A;  4CLL A;  4IFY B;  4RU2 A;  4P75 A;  3L9Z A;  1U4B A;  5DG9 A;  2PO4 A;  1KLM A;  2YKP A;  3KNA A;  2K2P A;  1I51 B;  4U67 Q;  3M2U B;  2KG0 A;  2J0W A;  1AUD A;  3R5C A;  4CTA B;  1HYS B;  1HWI A;  1YX2 A;  4B02 A;  5KFQ A;  2W2M P;  1JLB A;  1TL7 B;  4JI1 F;  4KKO A;  4CLK A;  3CIZ A;  1RWO B;  3PX4 A;  2VQF J;  5I4M A;  1TV6 B;  4OJ3 A;  3MEG B;  2A1B A;  4QCL A;  3IR5 B;  4C11 B;  2XGP A;  1JQG A;  1LW2 B;  1FT8 A;  3P6Y C;  2CYY A;  1VYA A;  1RZM A;  2RE1 A;  2BKN A;  4FBT A;  1XR5 A;  1U1M A;  3KLF B;  1KS2 A;  4YDD B;  5GAG U;  4ILM A;  5L38 A;  1U02 A;  2D3U A;  5J1E A;  1U7L A;  2ZZN A;  1HI1 A;  1WHX A;  1M5S A;  3TAM A;  4NZ6 A;  5E3A A;  4FYD A;  4ID5 A;  1OSD A;  4TLQ A;  2YTC A;  3BGU A;  5D0H A;  3PJX A;  4FP9 A;  2VBZ A;  1CJU A;  1Q8L A;  5E3P A;  2ZKT A;  3BZQ A;  2VC0 A;  1L3U A;  2E29 A;  2E5J A;  9RUB A;  4X4U A;  3X3U A;  1DLO B;  4U95 A;  2J7U A;  3DFE A;  5FDL A;  4WFY A;  4TVA B;  4DFJ A;  3ETM A;  2P9E A;  1VQK S;  3NGU A;  4HKQ A;  2FJA B;  1AB8 A;  1TKT B;  3AT1 B;  4ENO A;  3H2U B;  3GZ7 A;  2LU2 A;  1A9N B;  1IKX B;  1U45 A;  2JRS A;  3JYT A;  4IUF A;  1WKJ A;  1FNX H;  2KB2 A;  4MK7 A;  3MMC B;  2C2E A;  3M2V A;  2KTQ A;  4DV5 J;  2VIC A;  3ZZU A;  4Z7C A;  1BQN B;  4C3K A;  3FBE A;  4IOA Q;  4RW8 B;  4ZP7 A;  1RJJ A;  4QYZ J;  1FO1 A;  2HAF A;  3EWG A;  3I4P A;  1WC0 A;  4Z7Y A;  3MM6 A;  1CJV B;  2M8D B;  4EMD A;  1TR0 A;  1N0U A;  4LSN A;  2HIQ A;  2RF2 B;  2BE2 B;  2P6S A;  2HVH A;  3PYE A;  2JX2 A;  2KJW A;  3PYD A;  2EVZ A;  1WC3 A;  3C6T B;  4EI2 A;  2AF6 A;  2LEC A;  2CQC A;  5F3Z A;  1X0P A;  3G6Y A;  2HK2 A;  2ZJQ Q;  4B9S A;  2GCF A;  3QBC A;  3HZG A;  3MPU B;  3BO2 A;  4IKA A;  3QMQ A;  2V4J A;  2HQI A;  1H2U X;  4IFV A;  1EP4 B;  7AT1 B;  1KHV A;  3R8Y A;  4ZCM A;  1N48 A;  1L3K A;  3H7H B;  2FZG B;  1DAX A;  2OFG X;  1HNI B;  4LVO P;  4HH1 A;  2POK A;  3JQK A;  7FDR A;  2XCA A;  1NSP A;  5EHH A;  5KT6 A;  4QWE A;  5F8G A;  1NPP A;  5B0C A;  3FQL A;  1OO0 B;  3BSA A;  2YKQ A;  4A48 A;  4X4Q A;  4ZPW R;  4DQP A;  4OZN A;  2D74 B;  1S76 D;  3TA2 A;  2IC3 A;  1WDT A;  3OSN A;  2MQP A;  1PO6 A;  5HQ8 A;  1FFS B;  5KFI A;  1T9U A;  4RUA A;  1YRU A;  3UDC A;  2HVE A;  4IR9 A;  1TU0 B;  1W2B R;  2VAS A;  3HJV A;  4DV6 J;  4MTP A;  1Q7Y T;  2HMI A;  5KT2 A;  4F2R A;  4WFZ A;  2R7X A;  2CJA A;  1UVN A;  2DHG A;  4OI6 A;  3OPK A;  3E51 A;  2R7Q A;  4ED8 A;  5H1S V;  4K4Z A;  3M1V B;  3WDO A;  3GYX B;  1IM4 A;  1DBD A;  3DN9 A;  2MZ1 A;  4NLX A;  4U8Y A;  2MSS A;  1GT8 A;  2EKY A;  1V6H A;  4DL6 A;  3HVT B;  3ZFV A;  3OXG A;  4XPC A;  4I67 A;  2ALZ A;  2W2O P;  1TZ0 A;  5HBM B;  4TXS A;  1JLE B;  1SL1 A;  1PAE X;  4QR1 A;  3IBW A;  4WZQ A;  1KLM B;  2C1E B;  3NS6 A;  4URQ U;  3EM1 A;  1JJ4 A;  3BQ2 A;  3GYG A;  1XMO J;  2QX0 A;  4NRU A;  2ZH3 A;  2O3D A;  2FVP A;  1U2C A;  4KKO B;  1YTY A;  4LIR A;  2U2F A;  2W7A A;  1S1W A;  1B4S A;  3QLH B;  2PII A;  4RWW A;  4OYP A;  3OQ2 A;  2DNY A;  5BJR A;  2VPW B;  4B3R F;  5L1J A;  1M1H A;  2W9B A;  3CDU A;  2E7W A;  2B5J B;  2QIF A;  2HAI A;  3MXH P;  5DQH A;  5J1E B;  2WRM A;  3EUN A;  4DV2 J;  2BE9 B;  1FXD A;  4WK1 A;  1HNX J;  2OTJ S;  3DHX A;  2FGO A;  2MKI A;  2UUB J;  2BJD A;  2PMW A;  3D1H A;  3HHL C;  3Q24 A;  1WTB A;  1R6Y A;  1IBM J;  3W5Y A;  3N5F A;  2F9J A;  1QY7 A;  1UL3 A;  4KE5 A;  1VCT A;  5FDL B;  4LRF A;  3W64 A;  4EWT A;  4IO1 A;  4X4N A;  4O3S A;  1MML A;  4RUC A;  3GFH A;  5HAT A;  1ELO A;  2HRY A;  5CCL A;  5HJX A;  1AA1 B;  2DR7 A;  1ZOT A;  3A3P B;  3OUY A;  2V9W A;  2Z0G A;  3L7P A;  5K20 B;  3J81 Y;  3BYP A;  2KKH A;  3FCH A;  3G96 A;  4A8Q A;  2IHR 1;  2Z57 B;  5F8H A;  3JAM Y;  2A2D A;  4U7U K;  8AT1 B;  4RUB A;  5A8K A;  2DNN A;  2Z2Z A;  5B0G A;  2XHC A;  3G8S A;  3MM6 B;  2CKW A;  4EFA C;  3TAQ A;  2PN6 A;  1UVK A;  1SQG A;  3S01 A;  4LRE A;  4TY9 A;  4ZPA A;  2FVQ A;  2B7B B;  2RAQ A;  4ZS6 A;  5HQL A;  3LOU A;  1FF2 A;  2ZH7 A;  2ADC A;  4CDI A;  2CXE A;  1VIS A;  3DOK A;  1SPB P;  1U2R A;  1Q8K A;  2LVW A;  5L9X A;  3QGH A;  3TUZ C;  2OSQ A;  4PG5 A;  2FGC A;  2HHS A;  2E7V A;  4DUZ F;  2DXF A;  3FZB A;  2KFY A;  2UVW A;  2BUN A;  2VJV A;  3DLE A;  3RAX A;  4J37 A;  1FE0 A;  2J6S A;  4QIV A;  1RTI A;  1GFW B;  2ALY B;  2CG8 A;  2OMO A;  1UMJ A;  3DGP A;  3G2X A;  5DDQ C;  4F3Q A;  5IV3 A;  2BJE A;  2IC3 B;  3Q8S B;  2MKK A;  1EKS A;  1ZM3 A;  5JXS A;  1IJF B;  4WIQ A;  2W2Q P;  1SKW A;  1MWY A;  2VG7 A;  3WBZ A;  3RZA A;  4KHM A;  4YP3 A;  4AQY F;  5FLX U;  5LMN F;  1KD1 T;  2LXF A;  2BM1 A;  2GVZ B;  3QJJ A;  1OQ6 A;  5IFM A;  1G3O A;  4O0I A;  3H90 A;  3DDK A;  4CH7 A;  1S5Z A;  4X62 J;  4WU2 A;  2C3O A;  4H4K A;  2K1R B;  1REV A;  2HS3 A;  4ECR A;  1NH8 A;  1YLX A;  2DYA A;  4ZHR A;  2XTJ P;  2F40 A;  1ITP A;  2RRN A;  1JWW A;  4DV4 F;  3V2U C;  1VQ9 S;  4DCJ B;  1B99 A;  2CQG A;  4G1P A;  3SIP B;  4RNM A;  1FDN A;  4IQX A;  4FBU A;  2Y0B B;  2RS2 A;  3D1Q A;  3IC1 A;  3KK3 A;  3MPY A;  2H4Y B;  3BJY A;  1RA7 A;  1FRK A;  5KG4 A;  1F9E B;  4LF1 A;  4ZVU B;  1QAJ A;  3KLH A;  1WC4 A;  4Y6I A;  2KT5 A;  2BM0 A;  5ADZ A;  1Q5V A;  1XER A;  3RUB L;  4OFZ A;  4NA2 A;  4I7F A;  1N5T A;  3LGH A;  6AT1 B;  3VAG A;  1EB0 A;  3I87 A;  1S0M A;  3VWS A;  1FRM A;  4FDF A;  1WHW A;  3HDS A;  2HZC A;  3O3L A;  3AJ2 A;  1PJ6 A;  1HNW J;  3I31 A;  1P9Y A;  4DL3 A;  3LH2 S;  1SJR A;  4KO0 A;  2IBK A;  4CLU A;  2BQR A;  4ER8 A;  5H9E K;  3OL7 A;  2KHD A;  2RKI B;  3CTR A;  3ZXW A;  4YN3 B;  5D0G A;  2R4F A;  2DIT A;  1T9Y A;  2FIU A;  1YDL A;  3M9N B;  1LWC B;  1UZD A;  2YKO A;  5LMU J;  1GXU A;  3A13 A;  4OHW A;  3EPG A;  3DMJ A;  3K5L A;  1XQI A;  2ILZ A;  3AB2 B;  5HAN A;  4CNZ A;  2MJU A;  5EDW A;  3KLE A;  2AJ1 A;  4ED7 A;  3DLL Q;  3I32 A;  1F5A A;  3N79 A;  3LAL A;  3PJW A;  3J7A N;  2QL5 B;  2FC9 A;  2MQN A;  1S49 A;  2QT7 A;  1AFJ A;  1K47 A;  2H4W B;  1S7H A;  2KL8 A;  4DU8 A;  4O44 B;  3R1L A;  5CA5 A;  2KO1 A;  5CHC B;  3MFI A;  4FKY A;  1UVI A;  1NK5 A;  1T9T A;  4F02 A;  4UUW A;  2JC1 A;  1TFY A;  1RBL A;  3V4I A;  1GMV A;  1NCL A;  3VHQ A;  4UT4 A;  4USJ C;  2UVV A;  1U6Z A;  4DQI A;  3OFE A;  1UET A;  4DUY J;  3AOA A;  1K0T A;  4RNH A;  2JZ5 A;  2PD1 A;  3BBC A;  4V19 J;  4UF4 A;  4JP8 A;  3WHI A;  1NJY A;  3KMS A;  4BBY A;  3H5S A;  1NKB A;  3TQ1 A;  2HHH J;  2XLK A;  4DR2 F;  4NI2 A;  4NLO A;  4AE5 A;  3MHY A;  2RQC A;  3FRZ A;  2GAH C;  1S1T B;  1W26 A;  5IOL A;  1UAW A;  4LF7 F;  4DN0 A;  2ZH4 A;  1S9G A;  5RUB A;  4DPO A;  4OX6 A;  3RB4 A;  4XDC A;  2VJU A;  1P8G A;  4WF9 Q;  1JLA B;  3OL6 A;  3EGW B;  4PQA A;  2DPJ A;  2ZVI A;  5HLF A;  1AW0 A;  3DGP B;  2ZJR Q;  4DX6 A;  1IBK F;  4RW6 A;  1X4D A;  4CO5 A;  3PFE A;  3VGT A;  3CCE S;  4DX7 A;  1FWL A;  1DQ9 A;  1FJG J;  3CJS A;  2DNK A;  5HMW A;  6FD1 A;  3ELH A;  2UUA J;  1JNR B;  4Y2M A;  4R0J A;  3EMT A;  4Y2I A;  2J9C A;  3PXG a;  1UW4 A;  5DDP C;  3OTE A;  1FVQ A;  1TUW A;  1XJW B;  2GMJ A;  2NSC A;  1JJC B;  4C7Q A;  4J91 A;  4LBI A;  3R5B A;  1UWB A;  3SQO P;  1NZ8 A;  2AMC B;  1SXL A;  3DDI A;  5J2P B;  3FMW A;  3K8W A;  4GMK A;  2GW8 A;  1WI8 A;  5C7P A;  1DUR A;  1GX6 A;  2L3M A;  5G0R A;  5KG5 A;  4ZHR B;  2XNR A;  4CNY A;  5E5N A;  5ETK A;  3QJL A;  4DU7 A;  2WVF A;  2CA9 A;  2K8G A;  2YY3 A;  3GTY X;  3FSY A;  1YJW S;  2EC2 A;  2QFJ A;  1K0V A;  5C25 B;  2XM3 A;  4EZ9 A;  1FNM A;  2QMU B;  1N5V A;  3PV8 A;  4OHV A;  2CPH A;  2XMJ A;  2DB1 A;  3IG1 A;  3CT9 A;  2QTW A;  3PTW A;  1HFE L;  5K14 A;  4X65 F;  2AJ0 A;  4NLT A;  2M3D A;  1TVR A;  1LQ9 A;  4PKD B;  1DTT A;  4ED0 A;  1KN6 A;  4J9Q A;  4I7F B;  1IQT A;  3KTQ A;  3HVR A;  5C42 A;  2X1B A;  3H5U A;  2YNI A;  2RSQ A;  3TAR A;  2I5J B;  4AXJ A;  3FCV A;  3KWM A;  3KLI A;  4TU7 A;  1RCO B;  4NA1 A;  3OTO J;  2CJB A;  1WDD A;  4M5M A;  5CYQ B;  2B8Q A;  2RDI A;  3T9Z A;  1F60 B;  3NXZ A;  2RRA A;  2DBB A;  3MAH A;  1RTZ A;  1Y10 A;  3T1A A;  1W25 A;  4X66 J;  4I0W A;  2LDI A;  2P2C B;  3PNI A;  2HBR B;  4A47 A;  2UUB F;  5F8I A;  4JOU A;  1RHM B;  2UUC F;  3D0G E;  2CVI A;  1U6B A;  2OPR B;  1Y00 A;  2DXD A;  3MGJ A;  2JLG A;  1GTE A;  3QWU A;  3MFH A;  1SVD A;  1UVM A;  4KRW A;  1ZPW X;  5L8R C;  4NOH A;  2EG2 A;  1NLK L;  2UV8 A;  3OXF A;  3CMA S;  5F9L A;  3MMA A;  2WOM A;  1T02 A;  3Q0A A;  4KH0 B;  4F2S A;  4K4S A;  2LCW A;  4WFA Q;  2CPF A;  1XWL A;  3UWT A;  4DSI A;  2J9E A;  5IXU A;  4F04 B;  2HZV A;  4WCE Q;  3ENV A;  2EEY A;  1NKC A;  1G2E A;  5I3Q A;  3IMQ J;  2H54 B;  4JV0 A;  2O5D A;  5D4P A;  3SSS A;  2Z2L A;  4NLR A;  5IWA J;  1DTQ B;  4HTJ A;  2JDJ A;  2C22 A;  1FKA F;  1OMS A;  4P74 A;  4I6A A;  1WOR A;  4CM2 A;  5EGY A;  1WC1 A;  1R0A B;  5A8R A;  4U6P A;  3G86 A;  2U1A A;  1S9G B;  2HVZ A;  2VBX A;  2OPQ B;  5A0Y B;  2CWX A;  4PUO A;  2CPE A;  2JLF A;  2ZHO A;  3MCO A;  3EGZ A;  2GGP B;  4FN5 A;  4HAC A;  3C8Y A;  1VQ8 S;  2W01 A;  3HVW A;  3US5 A;  2UUW A;  4RW6 B;  2HWI A;  3DU5 A;  2PI4 A;  2O66 A;  4B3M J;  2A18 A;  1I94 J;  3BGF A;  3S1T A;  1N8R T;  2WSF C;  4K0K J;  2UXD J;  3NG8 A;  4NZ7 A;  5L9N A;  1Y0H A;  2GHW A;  1U1P A;  3ZNJ 1;  3ADA C;  3KKF A;  4ZCK A;  4DV7 J;  4OMF G;  3M9M B;  5LL6 d;  1YIJ S;  4QIE A;  4HYK A;  5ETL A;  3QAT A;  2DNM A;  3KG1 A;  2OEK A;  2R9L A;  5J2M A;  3F73 A;  3MD1 A;  2KVQ E;  2KZM A;  1JLG B;  1MU2 A;  1KNZ A;  1RAI B;  2OFH X;  3MPV A;  3GYN A;  1N54 B;  3C19 A;  3LF0 A;  2PDA A;  1D09 B;  3LPY A;  2DVI A;  2KT3 A;  1B70 B;  3OV7 A;  3J81 U;  2RML A;  4WZM A;  4FYY B;  4R8U B;  2HND B;  3W9H A;  3JAM U;  3QO9 B;  2V8P A;  4HEA 9;  4UQG A;  2D69 A;  1RK8 A;  5DQG A;  5LXY A;  1K1S A;  5HMY A;  4ES2 A;  2Q6C A;  3VZH A;  2L41 A;  4WE1 A;  5KFF A;  2KXN B;  3Q8P B;  3V6K A;  4UOC A;  4N41 A;  4OJ1 A;  2DCU B;  2G2Y A;  1TP7 A;  4MYU A;  3AAW B;  3RW7 A;  1WC6 A;  2GJ2 A;  1HBN B;  1CUL B;  1AUS L;  1R27 B;  2YNH A;  5C42 B;  3POT A;  2YQ3 A;  4JBC A;  4RR5 A;  4ZJL A;  3W66 A;  1NJI T;  3A8J A;  2MTL A;  4KGM A;  2BW2 A;  3ILJ A;  2KM8 B;  3IN5 A;  1RWX B;  2AJQ A;  1SH0 A;  3I96 A;  3PM9 A;  2LYV A;  3IP0 A;  1RT5 B;  1F9F A;  1HNZ F;  1WOS A;  1O5J A;  1NBE B;  2AGO A;  2HFS A;  2GX8 A;  2RB7 A;  5KG1 A;  3ZZO A;  3CC2 S;  2HHQ A;  2BEF A;  2ZE2 B;  1V3Z A;  2VKZ G;  1VRT A;  2ZWO A;  4JI6 J;  1PCA A;  5J1N A;  3Q8Q B;  5DQI A;  2F65 A;  4B3S F;  3HHD A;  3HHL D;  5IV4 A;  5L1K A;  5LMU F;  4K4X A;  3AJ1 A;  5ETV A;  5T41 A;  1PGZ A;  4W90 B;  2B8P A;  3CUL A;  5KT3 A;  4PZV A;  5JVH Q;  2B4O A;  2WOM B;  1Q86 T;  4GVB B;  4ZVR B;  3DLG B;  3U7J A;  2A0F B;  1RIS A;  2E1C A;  3MM7 A;  2FHK A;  5D78 A;  3FKB A;  1TMJ A;  4ZIV A;  4NCG B;  3FGV A;  3QID A;  2M7S A;  1R3N A;  5AJ3 J;  5A2Q Y;  3H42 A;  4GKJ F;  3CDA A;  1FRX A;  3OT9 A;  1U6F A;  2B9E A;  3LTO A;  1BQX A;  2ROG A;  2XI3 A;  3T1H F;  2EW9 A;  4OZ0 A;  4TY8 A;  3W2W A;  1TL3 A;  4USH A;  4OV1 A;  1U25 A;  4M5I A;  4MKV A;  4O0N A;  2LEP A;  5C24 B;  5C2G A;  1KFS A;  3H0P A;  2BVZ A;  1NB7 A;  5HK4 A;  1QLN A;  2IY5 B;  5F3T A;  5IS2 A;  2CQI A;  1S6P B;  1HR0 F;  3FBC A;  2HHH F;  3VAH A;  1OJ4 A;  3I55 S;  3WZ0 A;  4OYA A;  2VKR A;  1ICE B;  4F0M A;  3HVA A;  5GMK a;  2MGZ B;  2Q6B A;  2QJ3 A;  5G4D A;  2DNQ A;  3BH6 B;  4DSJ A;  1YJ7 A;  4Q0B A;  5CYM A;  3P8B B;  1T9W A;  2CQP A;  4X4P A;  5I42 A;  4ECX A;  4NXN F;  4HAC B;  2QG9 B;  4CT9 A;  2XB2 D;  2PT0 A;  3DXB A;  1JIH A;  5HI7 A;  3ZZP A;  5DDR C;  2G13 A;  3CED A;  3EJM A;  4KFB B;  4F4Z A;  4I2Q A;  1TUV A;  1U1K A;  2NXE A;  1O0P A;  3W65 A;  1HD1 A;  4KV8 B;  1RAJ A;  1NH7 A;  3A12 A;  5I3U A;  3KHH A;  1IR2 A;  4E98 A;  4DR6 J;  3L4B C;  1FJG F;  3HSJ A;  3MF5 A;  2J76 E;  5ETM A;  3SQG A;  4ED5 A;  4X84 A;  1V5V A;  2ASJ A;  2IJR A;  3IO1 A;  1S97 A;  4WWS A;  1TK5 A;  5J2Q B;  2LMI A;  1U1Q A;  5J2M B;  2VDH A;  2CQD A;  1S6O A;  2YKA A;  1NAQ A;  4AYB D;  3IGN A;  4ED2 A;  2UVU A;  3OBI A;  4WBF A;  3D1O A;  1WD6 A;  4XIU A;  3H8Y A;  5KFT A;  2WSE C;  4QZV B;  3KJV A;  4I56 A;  2LEB A;  2YBV A;  2NQP A;  4Y3C A;  1K73 T;  2UUT A;  3A3O B;  1F6T A;  1HWJ A;  4QWD A;  1ZA1 B;  2V2Z A;  4FF1 A;  4O23 A;  1NSQ A;  3SMZ A;  2UU9 J;  1VQM S;  1VS3 A;  4RX6 A;  1FX2 A;  4UUX A;  1YJR A;  3RB6 A;  1HL6 A;  4ATN A;  3GP9 A;  3NOG A;  3A1Y G;  2V4R A;  2GA7 A;  1X5S A;  2Q43 A;  1BC6 A;  2QYC A;  3WC2 A;  2VDI A;  2YNH B;  4YR2 A;  2A6O A;  1HI8 A;  4N7T A;  3SFU A;  2V94 A;  4R0E A;  2VF3 A;  5CAB A;  4DN9 A;  5BYQ A;  3M2R A;  1Z1Z A;  4F36 A;  3HZE A;  1G6B A;  3LAN A;  2IAJ A;  2G0I A;  2FHM A;  2HQF A;  3VCD A;  4GO5 X;  3LWL A;  2F4V F;  4ETX A;  2FY1 A;  4ZN3 A;  2GNK A;  3FCW A;  1FKO A;  4CH0 S;  3W2V A;  3B54 A;  5T7L B;  1N5Y B;  2BAC A;  2RIL A;  3SCI E;  4O4G A;  2OTL S;  4DFK A;  3N5B A;  1GXT A;  1RHR B;  4NL5 A;  4OYX A;  1MRO B;  5B0B A;  2XZT B;  2RVJ A;  2B3T B;  3WQP A;  4MH8 A;  4DR7 J;  2AJ2 A;  2XMT A;  2V8H A;  1KVK A;  3BBB A;  2WW8 A;  2HNY A;  6FDR A;  2GML A;  2DRB A;  3DYA B;  1HBM A;  2GC8 A;  4KH1 B;  2FB0 A;  4IH6 A;  1QE1 A;  2HBZ B;  4FVM A;  3MM7 B;  3KLG A;  4HT5 A;  2D1C A;  4ZMM A;  1RT1 A;  2VL1 A;  2DRD A;  3VV2 B;  2EI5 A;  3PCO B;  2NPF A;  3R1H A;  4DPW A;  3EZU A;  5F8J A;  2KZZ A;  2IIH A;  4M1K A;  4DG1 A;  1R89 A;  1UPM B;  3FFI B;  2JEF A;  2HRU A;  1Y3K A;  3JQM A;  2BZ2 A;  3SCJ E;  3CWJ A;  5CD4 H;  4RZR A;  1WEY A;  2HVD A;  2NSB A;  4P6Q A;  2QLB B;  1S6Q A;  4ZVQ B;  4G6V B;  2C28 A;  5HP1 A;  4RUH A;  2F63 A;  1RWP B;  4A8W A;  2Q79 A;  2LEA A;  4ECZ A;  1JLC A;  1HBO A;  2LU1 A;  2R7W A;  5KFL A;  1RE1 B;  1GTH A;  1NZA A;  3P5T L;  1Q7L B;  2PSZ A;  3N4W A;  5I42 B;  2ACM A;  4I68 A;  1C0U A;  1BY9 A;  3HJF A;  2FLL A;  1IKV B;  3D0I E;  2XHW A;  4OI0 A;  3CJ8 A;  4PWW A;  3CVK A;  1WNE A;  4KTQ A;  2MMY A;  4ECQ A;  4ZVE A;  3SSR A;  2ZOF A;  2R2S A;  2WB4 A;  4DJB A;  3IAM 9;  4GO7 X;  5I3U B;  4NMX A;  1AXQ A;  1IWG A;  1VHF A;  2VFU A;  2LA4 A;  3N0V A;  4ZCL A;  3NOC A;  4R5P B;  1C1C A;  5IC6 B;  4M5K A;  3CJ5 A;  1NK7 A;  3D3B J;  3TJ8 A;  1X60 A;  1VQN S;  4C9D A;  4QPT A;  3PIO Q;  1UPP A;  2V68 A;  4OZ3 A;  3FBB A;  1NB2 A;  3C16 A;  1C1B B;  3BQ1 A;  2CQ0 A;  1EKR A;  3AXK A;  2IYI A;  4MK9 A;  2CPI A;  2JEI A;  2AW0 A;  1NHK L;  3R7N B;  3M30 B;  2GZO A;  1WSV A;  3V6H A;  1T03 A;  1JLQ B;  5CZV A;  5A6P A;  4F4K A;  1H98 A;  2QRR A;  1SKS A;  4U7C A;  1BD6 A;  3NMA A;  4DEZ A;  4OZL A;  1Y3J A;  3M8Z A;  2VZ9 A;  1Y7P A;  1VRQ C;  1S4E A;  4C4W A;  3G6E S;  2AIR B;  3CJ0 A;  2Y1R I;  1QD1 A;  3M32 B;  3CME S;  4F3M A;  4AL5 A;  1QVF R;  3KHL A;  4DV3 J;  2IM3 A;  1FRH A;  3NY0 A;  4EUV A;  2ZVS A;  4JI1 J;  3ILL A;  1K44 A;  4N76 A;  4GKK F;  3PW0 A;  3IR7 B;  2Y0S D;  2IAJ B;  4EGL A;  3PX6 A;  2IMW P;  4CCH A;  4JI4 F;  4LF6 F;  2FLN A;  3AXM A;  2QA2 A;  4OZ5 A;  2CZ9 A;  1KR4 A;  1TKZ A;  4OYB A;  2FY8 A;  1WEX A;  3NP5 A;  4O3Q A;  3QJP A;  5HMX A;  4ZJO A;  4O4G B;  3U1N A;  2YNG B;  1GXL A;  3C2P A;  1CC7 A;  4F0H A;  4W92 B;  3NAI A;  3PW4 A;  3OJU A;  4DQQ A;  4OQJ A;  5H9E J;  2RHS B;  1T7P A;  3SDE A;  3QT6 A;  3J7A 1;  2B9Y A;  3PEH A;  4HDG A;  1NK0 A;  1Q79 A;  3LP2 B;  2VPX B;  2FJB B;  1DZ5 A;  3BPD A;  4HHU A;  2GQC A;  1XR6 A;  3EIC A;  2FUG 9;  3QPI A;  2V4Q A;  1S1X B;  5T14 A;  3BRE A;  3L95 X;  2HBQ B;  3EGN A;  2M8H A;  2EFN A;  2C42 A;  4ECT A;  1FHT A;  2R7U A;  3CD5 A;  4I2P B;  2UV8 G;  2MST A;  2RT3 A;  2W2P P;  3OXL A;  5DJB A;  3PKM A;  1X4F A;  3KK1 B;  2AGP A;  4ITS A;  2AYB A;  2J5A A;  4PG7 A;  1DQ8 A;  1FEE A;  3BKF A;  4KB7 A;  4LSL B;  3K57 A;  3MEC A;  3HKW A;  2JOQ A;  1YVF A;  2YX1 A;  9ATC B;  3KG0 A;  1VC6 A;  3DOL A;  2J0Q D;  2QYG A;  1Q95 G;  3EXC X;  3NAH A;  3NLC A;  2YNF A;  3B4D A;  3ILI A;  3KFW X;  3DC2 A;  3GCW P;  3AQO A;  2WSC C;  1J5E F;  5KT5 A;  1JLC B;  4DPY A;  1HBO B;  4K8R A;  1S1U B;  1FER A;  4DV1 F;  4JYA F;  1QUV A;  3G6V A;  4DX5 A;  4DL4 A;  1UVJ A;  2QO3 A;  3Q86 A;  1NND A;  4C8K A;  5IT0 A;  1DJ0 A;  1WF2 A;  1Y9O A;  1C0U B;  2DGU A;  1HKA A;  3VAI A;  2JHE A;  3MCN A;  1YI2 S;  1RT3 B;  1UJ5 A;  4HT7 A;  3ISN D;  4OZ1 A;  3GCX P;  1QAX A;  8ATC B;  3PDN A;  2DKO B;  4AT1 B;  4DFM A;  3HHK A;  3THV A;  5DG7 A;  5ETQ A;  3V5R A;  5B0D A;  2WON B;  4QU7 A;  2B9W A;  1SJ4 P;  2MPU A;  3LP1 B;  4ZIT A;  5CD4 A;  1U2F A;  1ZZF A;  3QGI A;  4L73 A;  1B0V A;  1C1C B;  1MLA A;  1S0V A;  3VGV A;  2HFZ A;  2PA8 D;  1N33 F;  2ZZM A;  1WHY A;  3GIR A;  1HQU A;  4EZ6 A;  1VQL S;  4YS2 A;  3CJT A;  3R6G B;  2FLO A;  4NLV A;  4ZCI A;  2V5H G;  3F44 A;  2MQO A;  4LBH A;  3BYR A;  4RBU A;  3D6H B;  3J80 Y;  3PYF A;  4NEZ A;  3KDO A;  4ZVF A;  2AU0 A;  2GJF A;  4AL7 A;  2MKC A;  2CJX B;  4K4Y A;  4J9M A;  3PZP A;  5KFH A;  3CIM A;  3UQS A;  2JJ4 D;  2ZNZ A;  5DO2 A;  1EHW A;  3KK2 A;  2DR5 A;  5A2Q U;  4LFA F;  1RWK B;  3B4M A;  3K0J A;  1S10 A;  1EZZ B;  2X3D A;  1T0T V;  4DL0 C;  3HSD A;  4F7V A;  2UP1 A;  4JI7 F;  2V67 A;  3RBX A;  4QR0 A;  2MKH A;  1IKY A;  5BR8 J;  3PRV A;  4USK A;  1LW0 A;  2WAQ D;  3Q8V A;  5KFR A;  2AEF A;  4OI2 A;  1RU1 A;  4FVC A;  1FKP A;  1UA1 A;  5CXT A;  2QL7 B;  2XG8 A;  4ZPD A;  3MUV P;  2C3U A;  3JTO A;  3K59 A;  5J2N B;  5DM6 Q;  2EK1 A;  1S79 A;  4OL8 A;  1BHN A;  5B09 A;  5DGA A;  2R2U A;  2WHO A;  1G1X A;  3R5G A;  4ZVS B;  3P4U B;  3BBF A;  1NME B;  4B3R J;  2QE5 A;  3MR2 A;  3ZZ0 A;  3DLH A;  1PSD A;  1NK4 A;  3LP0 A;  5LM7 E;  1JKH B;  3W8P A;  2K7K A;  4URG A;  4KGK A;  3K5M A;  2IPO B;  3CJ3 A;  3SDE B;  3NCP A;  1T8E A;  4N77 A;  2WVB A;  4OV6 A;  2BJ3 A;  3CD7 A;  4MKA A;  2R8H A;  3OR2 A;  2LLZ A;  4ZK7 M;  1VQ6 S;  5LOQ A;  1DY3 A;  2G2O A;  2GV1 A;  3GSD A;  3MAA A;  3QZ8 A;  4JV5 F;  4DF4 A;  4OX9 J;  1RT4 A;  3HD1 A;  1YJN S;  1FNO A;  4Q8F A;  1L3T A;  4CIO A;  1O8B A;  1NK8 A;  3FJ2 A;  2V69 A;  4IDK B;  2OP5 A;  4RW9 A;  3JXO A;  1CPZ A;  3HSZ A;  4F25 A;  3QWP A;  4DQS A;  1YWX A;  4N8N A;  1ZM4 A;  1N5S A;  3M8Q B;  4AFF A;  4X64 F;  4Y0F A;  1KSP A;  1HPZ A;  2DNL A;  5KFA A;  1HQE B;  1MW7 A;  1AFI A;  1U26 A;  2EPI A;  2HNZ B;  1HWK A;  4M5D B;  4LF2 A;  3MTK A;  3I4H X;  4BWM A;  3DOL B;  3HHL A;  1RWN B;  4OYI A;  2NXJ A;  1RKJ A;  2W1B A;  5KG2 A;  4USM A;  1YJ9 S;  2F5G A;  2H5I B;  4EEY A;  4TQS A;  4DZD A;  1PYO B;  4ES1 A;  2OGU A;  4FYV B;  1HHQ A;  3MMB A;  5K8O A;  1HNV B;  2EC0 A;  3GFZ A;  4AND A;  1D9D A;  4DL2 A;  3RAM A;  4K7Q A;  3FEX B;  1T9X A;  3C15 A;  2ZFH A;  4NLG A;  3NGR A;  5H9F J;  3M8S A;  4Q2L A;  2YX7 A;  3KMQ A;  3CJQ A;  1IM6 A;  1FEH A;  3H4D A;  5LT5 A;  4DUZ J;  1OS5 A;  1LOU A;  2Z30 B;  5ITH A;  2X7I A;  2EBE A;  4OIX A;  2HG4 A;  1UWA A;  1VOM A;  1XBW A;  1TKX A;  4BC7 A;  3UI3 A;  1VC0 A;  2G9O A;  2WTF A;  4KAI A;  4P2M A;  5AE1 A;  4L76 A;  3MM8 A;  1RT7 A;  2ZH1 A;  2FVC A;  4JI2 F;  4JI3 J;  1ZS6 A;  1S0N A;  4CLS A;  4PG8 A;  1X5O A;  1D9A A;  4N5S A;  1RHK B;  5LMN J;  4J5O A;  2WB1 D;  1IXK A;  2N7Y A;  4L75 A;  2VQE F;  2O01 C;  2D3Z A;  3E3X A;  2MQM A;  1RTJ B;  5FII A;  2MZJ A;  4L3N A;  2ZD1 A;  1OQ3 A;  2ZKU A;  2FHO B;  4DQR A;  3W63 A;  1E6Y A;  5GAH I;  1RAG B;  4RW4 A;  2H51 B;  4QW8 A;  4K4V A;  1PKU A;  1YQH A;  2HGL A;  1IKY B;  1K9M T;  2YKM A;  3NWG A;  3O1L A;  4DV4 J;  3EXY A;  5E33 A;  4WKY A;  1ACM B;  1FI4 A;  2B9X A;  4MKY A;  3D6T B;  1Y4Z B;  3VAJ A;  1LWE A;  3BR9 A;  1RBA A;  2XMV A;  4DSE A;  1PBA A;  1R6V A;  5E2Q A;  3MPD A;  2N82 B;  3MM5 A;  3WIV A;  2NUU G;  4ZPT R;  3FZ2 A;  4FNH A;  1SQF A;  1E6V A;  2PMH A;  2KM8 C;  3UCU P;  1YBU A;  3RB0 A;  4DV3 F;  2MHE A;  4USI A;  1VHI A;  1L3S A;  4CO2 A;  2MY7 A;  3C14 B;  1N32 F;  3P96 A;  4MIB A;  2RQK A;  2CPJ A;  5EWF A;  4NA3 A;  3UCG A;  4UOF A;  3ILO A;  3JSR A;  3C3L A;  4IR1 A;  2IVF B;  2HHU A;  3RBD A;  4IG0 B;  1SV5 A;  2IDE A;  2EBG A;  2P6T A;  4UW2 A;  4B9T A;  4B3O A;  2ZBC A;  5E3R A;  3X1L B;  3KUG A;  3Q2S C;  3UD3 P;  1FD8 A;  1R8A A;  2I2Y A;  1CVJ A;  1NJZ A;  4AL6 A;  3OTC A;  4HL9 A;  3EE3 A;  3BN7 A;  3DOM B;  2IJF A;  2N3L A;  4J9R A;  1PBU A;  1B7Y B;  3R5J B;  3D7S B;  5THW A;  3MAA B;  2V63 A;  1QDU B;  2Y1L B;  3UN5 A;  4Q2M A;  3ET6 A;  2BBE A;  2DY1 A;  4N56 A;  2WBR A;  4NRT A;  5AXM A;  5L1I A;  1SB6 A;  1NDL A;  2A6M A;  4C97 A;  1AZS A;  1R0B G;  1CJT B;  2W9C B;  3GFX A;  4IYQ A;  2HHX A;  1FD2 A;  3R97 A;  1K1Q A;  4OZ2 A;  1IBL F;  2HFU A;  1U1R A;  2PFD A;  4ZIW A;  3UN2 A;  3DI6 B;  3BKU A;  3RG6 A;  2VFV A;  4CLY A;  2QMW A;  4B9L A;  1KKH A;  2BJ8 A;  2XWY A;  4EO8 A;  3D4J A;  3UVJ A;  3MR6 A;  1BQM B;  4IQM A;  3O6Q A;  3MMB B;  5C2C A;  3IWL A;  5D3G B;  2DJW A;  3VQT A;  4DR2 J;  4K4T A;  2XSJ B;  4ALZ A;  2OKQ A;  2XMU A;  2VFR A;  4DCP B;  3CNQ P;  3I0R B;  4LF7 J;  5KAK A;  1M5V C;  3QIP B;  1KRP A;  4CYU B;  1CEZ A;  1Q82 T;  2LQB A;  2CJ9 A;  1HMV A;  1G4C A;  1V9O A;  4ED4 A;  1U1O A;  4TNO A;  3FC9 A;  2CUY A;  4FS2 A;  2HYI B;  3LA0 A;  3HI9 A;  1IBK J;  2HW3 A;  3OR1 B;  1Q5Y A;  4DR3 F;  3AFG A;  2CPZ A;  2DCL A;  4I64 A;  2MKY A;  4LRA A;  2RUS A;  1VI7 A;  2F8M A;  3R2C J;  4OX8 A;  1SJF A;  4WPA A;  3GIK A;  1RT7 B;  1VK8 A;  1FA0 A;  5HVH A;  2M5Y A;  3HSG A;  3GE9 A;  5KG6 A;  1KC8 T;  1FK9 A;  2R8I A;  1WUU A;  1KEK A;  2NUH A;  2DPI A;  3PFO A;  3BDE A;  2R7O A;  4K4W A;  5AXL A;  4NYP A;  4OI4 A;  2ZOG A;  2VG6 A;  2MLY A;  1RWV B;  3VAL A;  3GR1 A;  3DRP A;  4NLP A;  1IJE B;  2HZA A;  1EIY B;  1QTM A;  1D8Y A;  4YR0 A;  3M8P A;  3UD4 P;  3TA0 A;  4RW4 B;  4GC7 A;  4CO0 A;  1N6Q B;  2HFV A;  3IBF B;  3ZNU A;  4KJI A;  2YKN B;  2C2K B;  3KDN A;  1LWF A;  2HLU A;  4N47 A;  1H38 A;  1PG5 B;  3HCX A;  3ITH A;  2P9C A;  5BR8 F;  3FDS A;  1LWE B;  3A8K A;  3NWR A;  2E66 A;  2JVO A;  5IM0 B;  2X51 A;  1GNK A;  3DRX A;  4C8O A;  4JI8 J;  2HEK A;  3GIJ A;  4X65 J;  4L74 A;  1C0T A;  3BS9 A;  5GME A;  1JLB B;  3DRS A;  2QL9 B;  4ECU A;  1Q0N A;  2CQ3 A;  1TL1 A;  2CIM A;  3AOB A;  4KIA A;  2OEJ A;  4WP8 A;  1P27 B;  1NM2 A;  2Z2M A;  4DV0 F;  1Q4R A;  1GAO A;  5ETN A;  4CP5 A;  3VF0 B;  4C8Y A;  4K4U A;  3KJN B;  1SV5 B;  5DLG A;  3EVW A;  3R7B B;  2ASD A;  4OJH A;  1HLW A;  1U09 A;  4PXD A;  3GJQ B;  3TAM B;  3MOZ A;  4DDF A;  1DFD A;  1T9V A;  4ID5 B;  2UUC J;  2B6A A;  3J7Y U;  4RL1 A;  1CJU B;  1VGY A;  1TQL A;  2P5V A;  5KFE A;  4P2X A;  3ET6 B;  2I9S A;  1CS4 A;  1OY6 A;  5HVG A;  4WYL A;  2K3K A;  1MWZ A;  1PIE A;  2EXU A;  1URR A;  3HPO A;  3J80 U;  1UCN A;  4OX9 F;  1X4B A;  4QPX A;  3OL9 A;  2ZOM A;  5AE2 A;  3HMJ G;  5KFD A;  2I1R A;  4L72 B;  3IM8 A;  3D9B A;  3F41 A;  3JYT B;  4M5H A;  1S6U A;  2FVS A;  4ZVP B;  2PEH A;  5KFX A;  4BDP A;  2IRU A;  3MM9 A;  3M2V B;  1SIZ A;  3SEO A;  3TOQ A;  2FJV A;  2DNO A;  4DR4 F;  1VBZ A;  4FXD A;  3CXC R;  1VDH A;  2I8E A;  3GIL A;  5DDO C;  3UVJ B;  2DH8 A;  3ENQ A;  3I6P A;  4E8U A;  2E5L F;  5JVG Q;  2KN4 A;  2DD8 S;  1ZM2 A;  4K2X A;  4DLE A;  3A3N B;  3VVT A;  2H65 B;  4HVZ A;  4LSN B;  2QMX A;  2XYH B;  2HHW A;  4DR5 F;  4QW9 A;  2AHO B;  2M88 A;  1QJH A;  1RTD A;  4LMZ A;  4B9U A;  2JSX A;  4DS4 A;  2RS8 A;  2KRB A;  5LSO A;  1VLO A;  2W9A A;  4FYX B;  2ZC4 A;  2V4J B;  4O3O A;  3S7R A;  4J9P A;  4IFV B;  3OTB A;  5HSP A;  1WJ9 A;  3UO0 A;  1XEZ A;  3GJR B;  3PYG A;  2WZ1 A;  2CQ4 A;  4QWC A;  1B0T A;  3TUI C;  4BCA A;  1FDA A;  2FDN A;  4HI2 A;  4X4V A;  3K5O A;  2RQ4 A;  4URS A;  3KYL A;  2COL A;  3NL0 A;  1LK7 A;  3GV5 B;  4DF8 A;  2OHD A;  3RU0 A;  1B7F A;  2HLT A;  4RWX A;  2YPY A;  4ZPC A;  3Q8Y A;  1VQY A;  1CG2 A;  4IO9 Q;  2H9Z A;  5D8H B;  1CBK A;  2N4D A;  2HMI B;  4JI5 J;  4JI3 F;  2FYX A;  2EWH A;  2GIR A;  4OX7 A;  1N52 B;  2E7X A;  5GAD U;  3I0S A;  5KFM A;  4LQ3 A;  3RRK A;  2CJQ A;  4DFP A;  1F5C A;  5E41 A;  2OAU A;  1T3N A;  3PY8 A;  2B51 A;  3Q8R B;  4KBI A;  4ELV A;  1X4A A;  3BKT A;  4F3O A;  1LWF B;  2RRB A;  2GFF A;  1FTC A;  3OJS A;  2HQ3 A;  2AEJ A;  2DGS A;  3ITH B;  3BQ0 A;  1OY8 A;  3JSY A;  1RLC L;  2VV5 A;  1T05 A;  2KVI A;  4S0M A;  1TK8 A;  2RDD A;  1XN9 A;  1TMM A;  4ED6 A;  4H54 A;  2DR8 A;  4JV1 A;  4A8K A;  2CPD A;  3DRS B;  5F8M A;  1EX8 A;  3TO8 A;  1S1W B;  1UVL A;  3JTP A;  4ILR A;  3E01 A;  3DRR A;  1KDN A;  2CQ2 A;  1TAU A;  3Q89 A;  4J9V A;  4DSK A;  2NYI A;  2LA6 A;  4QOT A;  3SV3 A;  4NE9 C;  5KFG A;  4LIW A;  2W9B B;  1HNZ J;  2N4C A;  4CWB A;  4FS1 A;  2EFO A;  2OPS A;  5M2U A;  4IFY A;  1HIY A;  1XNQ F;  3GWC A;  2VBW A;  5GVQ A;  3ZZZ A;  5IC4 B;  5IQ6 A;  2FD2 A;  2B6A B;  4WK3 A;  1KTQ A;  4RNO A;  2AV5 A;  1LXN A;  1EJ7 L;  4B3S J;  1WOP A;  4MFB A;  5E7O B;  1FTR A;  4PPD A;  4D3H A;  1TL7 A;  4YB6 A;  3ONQ A;  1TV6 A;  3MEG A;  4HHH A;  3OLA A;  3T19 A;  4C11 A;  1LW2 A;  1WTF A;  4B3T F;  3U27 A;  2F9D A;  4ZKA A;  3QRP A;  2ZH9 A;  1R0C B;  3N6N A;  1F5B A;  2EK6 A;  5C5J A;  3OUY B;  3RW6 A;  1IR0 A;  2AQ4 A;  3FK4 A;  2CAD A;  3T41 A;  3H5X A;  4Q43 A;  3MM9 B;  4GKJ J;  4TLR A;  1IKW A;  4H4O A;  1QSY A;  3MPW A;  2BA9 A;  1UTA A;  4NLQ A;  3NGD A;  4MMO A;  8RUC A;  5A8K B;  3T1H J;  4DS5 A;  1N36 F;  2QLX A;  1SIW B;  1WEZ A;  3LGM A;  4F67 A;  4KT0 C;  4K50 A;  1DLO A;  2ATL A;  1P1L A;  1SH3 A;  4NLW A;  2DK2 A;  5ETS A;  1RAB B;  4RJV A;  2DR6 A;  2QEX S;  2YQ0 A;  2W4D A;  2LQ5 A;  3NCR A;  1Y5I B;  1TKT A;  1PJ7 A;  1S0O A;  4FPR A;  1HR0 J;  4C98 A;  3DLB A;  2Z56 B;  3ETO A;  1D1U A;  2M70 A;  4DZ6 A;  4C8M A;  3RTV A;  1IKX A;  1L5U A;  3DOK B;  3M9O B;  3MMC A;  2CNN B;  3OD2 A;  3HLU A;  4X4O A;  3TZZ A;  2E44 A;  1BQN A;  4NXN J;  3AB4 B;  4RW8 A;  2NCK L;  2YWH A;  3DLE B;  2OD6 A;  1RTI B;  2AZ1 A;  2KH9 A;  3G87 A;  4F26 A;  1S1V A;  2OSR A;  1WF0 A;  2CVE A;  1CJV A;  1R7I A;  3M8Y A;  4PAB A;  1NK6 A;  2XWX A;  2LP4 A;  2AJ4 A;  1VBY A;  1GK8 A;  4RU9 A;  2XSF A;  2RF2 A;  2BE2 A;  5KFK A;  3C6T A;  5HRO A;  2HHV A;  2V0N A;  5MAO A;  4IRK A;  2MZR A;  3ZTO A;  4RLE A;  3W60 A;  2VG7 B;  5KTQ A;  4O3R A;  3QRR A;  3TA1 A;  2RD5 C;  2W4C A;  2R7T A;  3I0S B;  2IBO A;  3M6X A;  1UFL A;  1SL2 A;  3A8E A;  1BXN A;  3F0N A;  1S7I A;  2D3O R;  2QA1 A;  3LWM A;  2B4U A;  1SL0 A;  2J8S A;  3QFW A;  1REV B;  3H98 A;  2B4P A;  2CPX A;  3D28 A;  2XLJ A;  1NDK A;  1DAR A;  2IMO A;  2AP6 A;  2APO A;  2V6A A;  1YGY A;  4ZPB A;  3OFG A;  4NXM J;  1RWW B;  1RQ0 A;  1TEL A;  1ZAX A;  4OHY A;  1Q1K A;  3BR8 A;  3DU6 A;  3MR5 A;  3BM7 A;  3KK3 B;  1YJT A;  2DIV A;  2OEL A;  3BGO P;  2R8J A;  1H73 A;  1JJ2 R;  2UZA A;  3CB4 A;  3NCQ A;  4JI8 F;  4A8F A;  4X4T A;  3M1V A;  4CO1 A;  3KLH B;  7FD1 A;  5KFC A;  3RBZ A;  3E01 B;  3H2L A;  2RJZ A;  1T95 A;  4ZLP A;  2IJN A;  3VGU A;  3T9N A;  3V6J A;  2DGQ A;  4OLO A;  2IFX A;  2R2R A;  4UZB A;  2HQD A;  5HBM A;  1JLE A;  2F4V J;  2BKP A;  4CLZ A;  3CCQ S;  4KO0 B;  4PXE A;  2OPS B;  1TAQ A;  5EWE A;  4J7C A;  3UW1 A;  3R2D J;  1YZ7 A;  1R43 A;  2RH3 A;  3R3T A;  2MXY A;  2H48 B;  4MFB B;  2XYP B;  3DMJ B;  1F9H A;  2XEX A;  3M6U A;  2VB6 A;  4PG4 A;  4ECS A;  1S72 S;  2FJW A;  4LF4 F;  5EN1 A;  4NYO A;  3QLH A;  3MDF A;  3BF4 A;  3CO9 A;  2VUG A;  3KLE B;  1BE4 A;  1RSC A;  2NXU A;  4C0H A;  2GIF A;  1I5O B;  4U8V A;  1KFD A;  2C2D A;  2B5J A;  1XC9 A;  4JUZ A;  3Q23 A;  2E1R A;  5HN0 A;  2CFX A;  4B17 A;  3IXQ A;  1IKW B;  4H4O B;  4NLD A;  1PIL A;  2DNG A;  5KFO A;  4LRC A;  3DM2 A;  4EYI B;  4V19 X;  3V4I B;  2YWW A;  1VQO S;  4X2B A;  3PW7 A;  3NBP A;  4LRD A;  1D0E A;  4M94 A;  2JFK A;  1NPK A;  2F1F A;  1HWL A;  4YB5 A;  2AT1 B;  1RAA B;  4QQB A;  3PIP Q;  4P9S A;  3L7O A;  3RJM B;  5M2P A;  2V2Q A;  2MHN A;  2L9D A;  2RQM A;  2FVR A;  5CZX A;  4YEA A;  3NGK A;  2DGW A;  3E8O A;  1RAH B;  1IQZ A;  2J7K A;  2WW4 A;  2CDR B;  4NI2 B;  2Y3Y A;  2DEJ A;  4IH7 A;  3TAN A;  4LVN P;  1WG5 A;  2GJI A;  4ECV A;  1RGV A;  3R5A A;  2HS0 A;  4PPZ A;  1SC3 B;  3THP A;  4QWB A;  3IFE A;  2XCP A;  4LR7 A;  3RR8 A;  3FUY A;  4IOC Q;  3MWB A;  3QGG A;  3NNH A;  1BLU A;  3PRB A;  3JB9 k;  1N34 J;  2G0C A;  1S1V B;  5HLF B;  1SC1 B;  1NEE A;  2YWE A;  4LUB A;  1VFJ A;  1VLY A;  4P71 A;  1NU4 A;  1S12 A;  1X31 C;  3QQC D;  2JNJ A;  3DKD A;  5HRO B;  4MKB A;  2M52 A;  4O3P A;  3CDW A;  2D41 A;  4RNF A;  3V6D A;  4LF5 J;  2B56 A;  2EFG A;  2BV3 A;  5LJ3 Y;  2DHX A;  2BW7 A;  4A8X A;  4X4S A;  4UY8 5;  4KPY A;  4DSF A;  4JI5 F;  4NAS A;  2JEJ A;  1UWB B;  5BXI A;  2RHQ B;  4R25 A;  4B9N A;  2DIS A;  4JV2 A;  4C3M A;  3MAQ A;  1B3T A;  1U49 A;  1T11 A;  5E0O A;  5ETT A;  5G0R B;  5L1L A;  1HI0 P;  4YB1 P;  1MMD A;  4LF9 F;  2LKZ A;  1YSJ A;  4XO0 A;  1F3V A;  4GC6 A;  1Q81 T;  5KFU A;  4PCQ A;  1FDB A;  3JS9 A;  4QYR A;  3I5A A;  5GAG I;  1VIX A;  3IG1 B;  1MN7 A;  4ICL A;  5AXN A;  3T1Y F;  2DNH A;  3IWX A;  2XS5 A;  2MQL A;  2GVZ A;  5K14 B;  3RGI A;  3EX7 B;  1HHS A;  3A8I A;  1RWU A;  3D66 A;  1X4H A;  1TVR B;  2M2B A;  4Y65 A;  1DTT B;  4Q5V A;  2G2Z A;  1U1L A;  2K1R A;  2HFO A;  3EDR B;  4GRS A;  1LK5 A;  1S57 A;  4ECY A;  2W8K A;  1JXL A;  1OPZ A;  2YNI B;  4QU6 A;  5I3P A;  4GKK J;  3KLI B;  5D15 A;  2ROE A;  2M4M A;  3S8S A;  4JI4 J;  4LF6 J;  2Y1J A;  1PC4 A;  1UFW A;  5DET A;  4LBP A;  4DR1 F;  4OYW A;  2XGQ A;  3VGS A;  3I82 A;  2J6T A;  2VOO A;  4UY8 T;  2XLI A;  3Q8U A;  2KYZ A;  3IBC B;  2F4F A;  4U7U D;  5D4L A;  2XMW A;  4K5S A;  2CNL B;  4EBC A;  2ROP A;  1XNR F;  2MKJ A;  4KHP F;  2FZC B;  3R27 A;  3W9I A;  1GX5 A;  1FJE B;  1EET A;  1M0S A;  4ZA1 A;  4CLW A;  1NKE A;  2E5G A;  3TRG A;  3FEY B;  1EQ0 A;  4KGX B;  3NNC A;  3MMA B;  2BYC A;  3CGI A;  3DHW C;  3KHR A;  2OO4 A;  1ZAV A;  5A76 A;  4ZVH A;  2W7O A;  4PWU A;  2RKI A;  3D2W A;  3LGN A;  3DM2 B;  3T5J A;  3R9L A;  2BJ1 A;  3TVK A;  3BPS P;  4FF2 A;  1LWC A;  2R8G A;  1I3O B;  3NBP B;  1RA6 A;  3GMG A;  1UA0 A;  2NS1 B;  1RAO A;  2KG1 A;  4QIW D;  3ZZT A;  3F56 A;  3CC7 S;  4KGZ B;  4QBU A;  1UKU A;  1RTH A;  4NWB A;  5HVF A;  4IG3 A;  2YPZ A;  4NLY A;  2IM0 A;  3H25 A;  1NK9 A;  5HQM A;  4J9O A;  2DXE A;  5A8W A;  4Y2K A;  1XMQ F;  3DCA A;  4PXC A;  2ABY A;  1J5E J;  4M5J A;  5A8R B;  4DV1 J;  4JYA J;  2XZW A;  4O44 A;  1JX4 A;  3HXM A;  2CPY A;  3T5K A;  3TW0 A;  4P7V A;  3I9V 9;  2HSE B;  4K5R A;  2H5E A;  4PUO B;  3OTD A;  2ASY A;  1VQ7 S;  2I38 A;  2KXF A;  1X5T A;  3AQP A;  2XMK A;  1ZTT A;  3RYL A;  2GHP A;  3FSX A;  5KG0 A;  3UFC X;  1NJW A;  2YH1 A;  3MI7 X;  1X9S A;  2VHG A;  4WJB A;  3V6D B;  3CCS S;  4OI1 A;  2UVR A;  2DNZ A;  3CCM S;  3VR1 A;  1MNE A;  1N33 J;  5F9N A;  1S1T A;  1RHQ B;  4FPI A;  3AOC A;  5D0E A;  2VPY B;  3HFK A;  3KG4 A;  1JLA A;  3HHN B;  1MU2 B;  4L3K A;  3CJ2 A;  2C2N A;  1X4E A;  1RCX B;  1Q78 A;  3T5H A;  4FKX A;  4LFA J;  2IVY A;  2PEB A;  4DPU A;  3EDQ B;  4J9K A;  3AY0 A;  2D7S A;  1V5I B;  4JI7 J;  5IT9 Y;  3VAK A;  2MZT A;  4NXM F;  1WKK A;  1EAR A;  2DIU A;  2IYG A;  4CLP A;  4XAK A;  2O1P A;  4ICL B;  3ZTS A;  1KON A;  4DHV A;  3TYT A;  1YBA A;  3QT5 A;  2GMH A;  3TVZ A;  4WE1 B;  4MK8 A;  1NXI A;  3TUP A;  1VBK A;  2LXU A;  3J7Y I;  1BUX A;  4BS2 A;  3RR7 A;  3GQC A;  5J2P A;  4NLS A;  2GO9 A;  3EZ5 A;  3POT B;  3PJ9 A;  1Y5N B;  3QAE A;  2ZH5 A;  5BYR A;  3NKY A;  1H2T Z;  2OI2 A;  3NGS A;  3CO0 P;  5GAE U;  5K5M A;  3UDL A;  4JI0 J;  3OLB A;  2IA6 A;  3LW5 C;  5C25 A;  3CF5 Q;  1JJH A;  2AJF E;  2RIJ A;  3ZTR A;  4NZ0 A;  1R8P A;  2HPU A;  5F0U A;  4ZP8 A;  1VRT B;  2IDL A;  2LQ8 A;  5B7W A;  2KFN A;  1AYE A;  2E9Z A;  2OML A;  4TQR A;  3BGL A;  4W4M A;  4MT1 A;  2HRT A;  2VQF F;  2BMB A;  3TR5 A;  2IRY A;  1EET B;  2KI2 A;  2Y8W A;  2I5J A;  2DHH A;  3R5D A;  1A0O B;  3B78 A;  3I9Z A;  4JV5 J;  2JFD A;  3HHE A;  4I4B A;  3BO3 A;  2XI2 A;  1VQS A;  3CCZ A;  1AT1 B;  2KYX A;  5CYQ A;  2UXC J;  2CG4 A;  2FJE B;  4F4A A;  4XTT A;  3PVX A;  3IRX A;  2EG1 A;  4WFB Q;  1M5K C;  3NEK A;  4MIW A;  2VG5 A;  2W8L A;  1NSK L;  3QT7 A;  3KLV A;  4TN2 A;  1H2V Z;  1F2G A;  4X64 J;  2BX6 A;  3N01 A;  1WOO A;  5F41 A;  4AXI A;  4P73 A;  5EWG A;  1N4L A;  2OPR A;  4TY8 B;  3W2W B;  2CAJ A;  4U9R A;  1TL3 B;  3SV4 A;  2IM1 A;  1RTH B;  4IG3 B;  4V1A k;  2YXL A;  3C66 A;  4ZLN A;  4TYA A;  3KOA A;  5A8W B;  3CSK A;  3T5L A;  1QVG R;  3W5Z A;  3VZI A;  1MG7 A;  5F8L A;  1NRK A;  4I69 A;  1B0P A;  4F4X A;  5AE3 A;  5F0W A;  3K2Y A;  3IRW P;  4AD6 A;  5GAD I;  4Q0B B;  4ZDN A;  5CYM B;  3UE2 A;  4UZC A;  4DV5 F;  3TEG A;  3CJR A;  2VA2 A;  3M8W A;  1IVZ A;  1XIQ A;  2Q66 A;  3TI0 A;  3AD7 C;  1ZET A;  3ZZR A;  5K8N A;  1W7W A;  4FXV A;  1XK8 A;  3U02 A;  1N34 F;  1QSL A;  4J9S A;  1DTQ A;  4DPX A;  2XUL A;  4I2Q B;  3J7Z 5;  2AYG A;  1G7C B;  2J9D E;  2KXH A;  4RW7 A;  4ERD A;  3H59 A;  2ACY A;  1WHV A;  1R0A A;  3WC0 A;  4EU0 A;  1M90 T;  2BKO A;  5D4N A;  1O51 A;  5CQG A;  3M4X A;  4MIA A;  4P2F A;  3SQG B;  2NXC A;  1T3O A;  4LF5 F;  1IBC B;  1XMB A;  4JI2 J;  2OPQ A;  5A0Y A;  3K17 A;  1GEH A;  2DGV A;  2SXL A;  2JLE A;  3LO3 A;  2VQE J;  3D6F B;  4HDH A;  4ECW A;  4EYH B;  2GGP A;  5HL7 Q;  4DUT A;  4LRB A;  2XO6 A;  4YHH J;  3S6E A;  2ASL A;  1Q8B A;  3KJV B;  1RUS A;  1VQ5 S;  3UDE A;  4DL7 A;  1QTN B;  5KFJ A;  1U0H A;  3R6L B;  3B8H A;  4KQZ A;  4CM0 A;  4LSZ B;  3G4S S;  3W7B A;  1VMB A;  2VIH A;  1LXJ A;  2NYH A;  3GU0 A;  2AKW B;  2R7R A;  4DV6 F;  4BLG A;  2E1A A;  1S9F A;  1A7G E;  2DH7 A;  2AZ3 A;  2B43 A;  1KQF B;  2OLW A;  4WXW A;  2RU3 A;  3MD3 A;  1NSA A;  1UEV A;  2X1A A;  2AEM A;  4OYO A;  1FES A;  2OUG A;  2M0G B;  4RPF A;  1RWM B;  1ZZN A;  2GQQ A;  3AA9 A;  1RP5 A;  1ZBT A;  1JLG A;  2GVD A;  2E1P A;  3TUJ C;  5B0E A;  5IQQ A;  4GVL A;  4UTG A;  2FC8 A;  3J7Z T;  3PW2 A;  1N32 J;  3GG0 A;  3M2R B;  4XDD A;  3ENA A;  5SUH A;  4R8U A;  2HND A;  3D0H E;  4ILL A;  3QO9 A;  1YIT S;  5DG8 A;  1WEL A;  2PMZ D;  4A8M P;  2R2T A;  2IA0 A;  4NLU A;  1I1G A;  2KT2 A;  2VH7 A;  1NJX A;  5KFY A;  1VIO A;  1FKO B;  4YR3 A;  4FF3 A;  3W2V B;  2H3E B;  4HLB A;  1VQP S;  4Q8E A;  2KHC A;  3C6U A;  1XMO F;  1U1N A;  3RRH A;  3MZI A;  2EFQ A;  4UOG A;  1BWV A;  4ED1 A;  1HBN A;  1CUL A;  2GQ2 A;  2W4P A;  3QFH A;  3QAU A;  2XMA A;  1HAR A;  2HUR A;  4TU9 A;  1YG0 A;  1DHM A;  3QNW B;  2HNY B;  2V8V A;  1NDC A;  5EX3 A;  1HBM B;  4PWD A;  1QE1 B;  3ZTP A;  5MLC V;  1SUQ A;  1RT5 A;  1W2I A;  1SJ1 A;  3KLG B;  3IRX B;  5JMN A;  2DGT A;  3HT3 A;  1RT1 B;  1OY9 A;  1KTV A;  2VG5 B;  5D4O A;  1FFG B;  4DV2 F;  3JTN A;  4YOE A;  1IBL J;  1HNX F;  2IVM A;  4DG1 B;  3EVM A;  1BMQ B;  2J8A A;  2ZE2 A;  3W1Y C;  5KFP A;  3FMB A;  2E1M C;  1HBU A;  1FRI A;  2VU5 A;  2KJV A;  3TX0 A;  1IBM F;  1N88 A;  3P45 B;  4OHX A;  1S6Q B;  5IZH A;  2RNE A;  3AJD A;  4PEO A;  1HWU A;  4K2J A;  3OFH A;  1M5H A;  4E2F B;  3M6W A;  2XY5 A;  4PYD A;  4EK2 A;  5HP1 B;  4GVB A;  1S59 A;  3DLG A;  3DXS X;  1VQ4 S;  4WP3 A;  4USV A;  2C2M B;  4NCG A;  2Z2Y B;  4ANE A;  2F8H A;  4YY3 J;  1F3F A;  1YBT A;  3FRY A;  5KG7 A;  1CSJ A;  3LQV A;  5KFS A;  3VTI A;  1DRZ A;  2QSF A;  2C2Z B;  4A46 A;  2PC6 A;  1CQM A;  3UNG C;  4FNI A;  3L7U A;  2KRR A;  2BOP A;  4X4R A;  2DNR A;  3UPF A;  5K8M A;  4KYZ A;  4LFB J;  2A2C A;  4P52 A;  2FJX A;  3OVB A;  3D68 A;  4Y00 A;  2HK3 A;  3W3S A;  5C24 A;  2AX0 A;  4QR2 A;  4RW7 B;  1NPR A;  4DR3 J;  4J90 A;  3D6M B;  2EFV A;  2CQH A;  1X7V A;  1S6P A;  5H9F K;  1L3V A;  3GB0 A;  3K7R A;  3TNV A;  2MGZ A;  5BYS A;  2FHJ D;  4P2S A;  5D6G A;  2UXB J;  3ISN C;  3JSB A;  4H4K C;  5D0R A;  2R8K A;  2L9N A;  2PE8 A;  4FZV A;  5CAA A;  3C16 B;  3EYZ A;  4BWJ A;  3BDP A;  1YRX A;  2MZQ A;  2A3J A;  4KFB A;  1LKZ A;  4QIF A;  1TK0 A;  4LFC J;  1U0H B;  2AWZ A;  4CT8 A;  2QA4 G;  4KV8 A;  1P1T A;  2Y8Y A;  2W2N P;  3MR3 A;  1N5Q A;  1T03 B;  2KFZ A;  3E2E A;  2HKE A;  1GMW D;  1S9E A;  1UEU A;  1PYT A;  1KQG B;  2RUG A;  2YQ1 A;  5J2Q A;  4H4M A;  2CWK A;  1LFW A;  3P49 B;  3AOD A;  3WX8 A;  3OFF A;  4J9U E;  4X62 F;  2GVD B;  3BB5 A;  2AGQ A;  3SI8 A;  4XPE A;  2XO7 A;  1LEO A;  3W62 A;  1NDP A;  4PR6 A;  1OYD A;  1RYR A;  2MLZ A;  3MUT P;  1KQS R;  4LT6 A;  3M6V A;  1Z2L A;  4DL5 A;  4PAA A;  3GJS B;  3D3C J;  4YUD A;  2EKN A;  1CJK A;  4JI0 F;  1KWM A;  2IM2 A;  4DV0 J;  1TKZ B;  1TFW A;  4HR2 A;  2AYE A;  2ZDO A;  2QGF B;  3BH7 B;  1H72 C;  3OVA A;  4DMZ A;  1NO8 A;  1J27 A;  3C6U B;  4ZVG A;  3BV8 A;  3V4M A;  3SYZ A;  3PRD A;  5DGB A;  1YZ6 A;  1HA1 A;  2LDY A;  3C46 A;  4A4J A;  1U24 A;  2ZBR A;  2AD9 A;  4QJV A;  2WVE A;  3PO4 A;  2G0J A;  2BRL A;  3M05 A;  3EVO A;  2MEW A;  4ETZ A;  1BWE A;  5GAH U;  2HHT A;  4C6A A;  4PWD B;  1SUQ B;  4WTY A;  3TZX A;  3PR4 A;  1FXL A;  3CC4 S;  1HNW F;  4C3L A;  1QAY A;  2V2K A;  2N7C A;  2UXC F;  5CYJ A;  2YX4 A;  3O5T B;  1IWA A;  1KHW A;  2CJK A;  3ENW A;  1Z2Z A;  5T7L A;  1T94 A;  1N5Y A;  2P8I A;  2G1D A;  1HBU B;  4OZJ A;  1IUJ A;  1P9Q C;  3PEJ A;  1MRO A;  4O3N A;  1RT2 A;  4DR4 J;  2M9K A;  5IT9 U;  2GS8 A;  2NXN A;  3MEC B;  3MTJ A;  2QA4 S;  3GSI A;  3P3D A;  4N8O A;  2E5L J;  3DYA A;  2YNF B;  3FVY A;  2CNO B;  3GLJ A;  2LQJ A;  3GII A;  1S77 D;  4DR5 J;  3BEG B;  4I1T A;  2ZNY A;  1R31 A;  3SXL A;  3FSI A;  2HS4 A;  5LSL A;  4QWA A;  1QSS A;  4C0B A;  4ZJQ A;  4JB8 B;  4QYZ K;  3FFI A;  4UOH A;  1PAU B;  1FRJ A;  3R7S B;  5L39 A;  4E0D A;  4HHJ A;  3TQE A;  4DUY F;  1WKL A;  1R8B A;  2V8G A;  3M8R A;  4CH1 A;  4ED3 A;  4WFN Q;  4KR0 B;  3EZO A;  2XNQ A;  3IM9 A;  3AH6 A;  4BC9 A;  4EBE A;  5KT4 A;  4NX9 A;  2JVR A;  1VBX A;  1JXE A;  1Y5L B;  3FEZ A;  2H1Y A;  3K5N A;  3NNA A;  4DX8 H;  1HQU B;  3N6M A;  4PYA A;  3TX8 A;  3MCS A;  2YWF A;  1SBR A;  2W24 A;  1C2P A;  5ETO A;  3CCW A;  5CH7 B;  3SCL E;  2HGN A;  2QZ8 A;  2PA3 A;  4K59 A;  1IKV A;  3PAC A;  3IS9 A;  1CC8 A;  3GFY A;  1H7X A;  2P9G A;  2MB0 B;  4YHH F;  5A6W A;  4M95 A;  1CQN A;  5L46 A;  2VPZ B;  3PX0 A;  3KK2 B;  3BSN A;  4USW A;  2MJN A;  1QM9 A;  2BOA A;  2GO8 A;  1UJ6 A;  1KBR A;  2ZDP A;  4U96 A;  3BGR A;  1B64 A;  2UUA F;  1JMT A;  4YB7 A;  5FJ4 A;  1S9E B;  4DI6 A;  3TWZ A;  2WVC A;  5KOW A;  2VFT A;  5AT1 B;  2ZIT A;  1MWQ A;  4R5P A;  4TU8 A;  4CQ1 A;  2Z8Q A;  1LW0 B;  4H4M B;  3O44 A;  4MAK A;  1KVI A;  1SC6 A;  3CJK A;  1FKP B;  4EO6 A;  3VAM A;  4F0K A;  1ZA2 B;  4DWI A;  2HVI A;  1V3S A;  3THT A;  2CZV C;  2XZD B;  3A4T A;  1C1B A;  4RNN A;  3OW2 R;  1OPI A;  5LXR A;  4PXB A;  2FTR A;  1Y11 A;  4EBD A;  3M30 A;  2GAG C;  3B6B A;  1CJK B;  2RDJ A;  4M5L A;  3ICL A;  3TJ9 A;  2DNP A;  2DGX A;  1VC5 A;  4FYW B;  1JLQ A;  2DY9 A;  2HIY A;  4P7T A;  4ZLJ A;  3LP0 B;  3HF5 A;  3MED A;  3QRQ A;  1NUE A;  4P72 A;  2ZBI A;  4C2M A;  3MEE A;  1FX4 A;  4LJM A;  1C4C A;  4TKT A;  1XNQ J;  3KJF B;  1YRT A;  4MJK A; 
#chains in the Genus database with same CATH homology
 2FYX A;  2XM3 A;  2XQC A;  2A6O A;  2XO6 A;  2VHG A;  2VIC A;  2EC2 A;  2VIH A;  2VJV A;  2F4F A;  2A6M A;  2VJU A;  2XMA A;  2F5G A;  4ER8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...