2VL2C

Oxidized and reduced forms of human peroxiredoxin 5
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
161
structure length
161
Chain Sequence
APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN-5
publication title The Crystal Structures of Oxidized Forms of Human Peroxiredoxin 5 with an Intramolecular Disulfide Bond Confirm the Proposed Enzymatic Mechanism for Atypical 2-Cys Peroxiredoxins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 41
structure length 161
sequence length 161
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vl2C00
1VF2A 3KEBA 1OKDA 4YH2A 1YEXA 4JR6A 3F6FA 2DMLA 4WETA 3F4RA 1WP0A 4Q5NA 3KJYA 4IJIA 3RPPA 1PL2A 1GNEA 4XS1A 1HQOA 1YF1A 4NPBA 1JLVA 3BCKA 4I2UA 3WGEA 2A2SA 3CRUA 1F2EA 3HKRA 22GSA 2H0GA 5ECPB 1G7EA 1UC7A 3FZ9A 3IBHA 4BA7A 1PX7A 2IWTA 1RW1A 1NHOA 3KCMA 5G1KA 4NV2A 1WOUA 3I6AA 1EEJA 4GSNA 5FHIA 3FY7A 3M8NA 2CAIA 4PQ1A 2H01A 2IIYA 2KP2A 3I69A 3UVTA 5D9TA 4XRDA 5G2ZA 2FD3A 4LL1B 1ILOA 1ON4A 2DC5A 1M9AA 1GSSA 1E6BA 4XS4A 2F8AA 4L8EA 1VF1A 3MWHA 1K0CA 2K6VA 4KCAA 3CSHA 1XFLA 5B6NA 1GSUA 3F8UA 3DGQA 5DALB 2F9SA 4DSSA 3I9V2 4K2DA 3M1GA 2NBSA 3GX8A 2B5YA 4IN0A 4DSQA 1B4QA 1K0DA 2DJKA 2PUKC 4KGIA 5JCGA 2PN8A 4X0XA 5CRGA 4FH8A 1XOBA 1ACVA 3MNGA 3P2AA 3VPTA 3HZ8A 3MAKA 2V2GA 3P90A 18GSA 1GTBA 5F0GA 3FW2A 4EVMA 2MBTA 3LWAA 1GTAA 4PQIA 1LBKA 4ECIA 3L0HA 2C1YA 3HHVA 2BMXA 4G10A 5AGYA 4HQZA 2VD0A 5ECQB 5H5RA 1DBYA 3GA4A 2L57A 5HR1A 3LG6A 1FB6A 2I81A 1F37A 3HYPA 9GSSA 1YF0A 2E2GA 3DXBA 3E9JB 2NPBA 3ZIJA 2IMKA 3HY2A 4MH3A 3A3TA 3HDCA 1K3OA 3LYKA 4IGJA 4V1Ap 1Z5YE 3F6DA 2LSTA 3IAM2 5IMAA 2L59A 3LXTA 4IP1A 1TJDA 4GQCA 4HS1A 7GSSA 2FHEA 1A8YA 1M2DA 5IOXA 3DEXA 4IQ1A 2CZ2A 3LXZA 4OCFA 3DYRA 4TVEA 4RQRA 1XVWA 2ALBA 2CZ3A 1N8JA 5CRDA 4ZB8A 3WYWA 2IMEA 3LYPA 1XIYA 1XW9A 3FR9A 5IIZA 4KAEA 5CO3A 4V1Ag 4HZ2A 2C0FA 2VOCA 2YJ7A 4QL9A 3GYKA 1ZCPA 3ZVJD 1V58A 1GH2A 1R7HA 4ZL8A 2R37A 1J9BA 2B5EA 1FVJA 1Y6EA 4IELA 1YJ6A 5CYYA 2L6CA 1CQHA 3G7IA 1ZYEA 4GCIA 1TK5B 5DCGA 1XCCA 1T8EB 3F3RA 3TJKA 2YWOA 1U6TA 3Q18A 2H71A 2VIMA 1GWCA 4PURA 4HU9A 4MK3A 1OE8A 5EVOA 4D73B 3FR3A 5B8BA 4ZL7A 5IQYA 3ZFBA 4RI6A 2HSHA 4LMVA 2HI7A 5B8AA 4MP4A 1TI1A 2CVBA 1WJKA 3Q19A 3D21A 4MF5A 2G2QA 2YCDA 2H1GA 1GTIA 1Y25A 1A24A 3EMXA 2GVPA 2YNXA 1EOHA 1QK8A 2JADA 1SKRB 3ERWA 2O85A 1X5CA 3TGZA 2VAFA 2VL2A 3IC4A 4XHMA 4LL4B 2X8GA 3P7XA 3ZMKA 1SD8A 4ACSA 4BVXA 3DIEA 2C3QA 1HYUA 3J7Yk 1Z7PA 3RPNA 1FW1A 2FWFA 4QL7A 3APQA 4O7HA 3CTGA 4TR0A 1Z7RA 1K0OA 3M3MA 4RQXA 3GKNA 5GZZB 3KGKA 2V41A 2GSTA 3GSSA 4ZB9A 3LGCA 3OR5A 5KN3A 1K3YA 2VCQA 1M0UA 2VLVA 3TKPA 4CHSA 1OC8A 3HVVA 4TXOA 3E0UA 4PNGA 5B7CA 4IKHA 2CV4A 2VM2A 2AHEA 3VFIA 3F3QA 4AGSA 4OO4A 4ECBA 3CMIA 5JWOB 3D5JA 1UVZA 2AAWA 4YQVA 1BAYA 3EC3A 4DEJA 3M0FA 2JSZA 3IRAA 4EUYA 4HI7A 3SBCA 2RUEA 5INYA 1OC3A 2YP6A 5F07A 4WBRD 3W8SA 2F51A 3J7Yb 2OBIA 2JU5A 1AAZA 2GZZA 5CP1A 1O8WA 4TW5A 2HZEB 1XWKA 4ULXA 1OE7A 2DJ3A 3HVXA 3UMAA 4K7NA 2E7PA 6GSUA 2PWJA 2WGRA 3DD3A 5ECHB 1A0FA 3EU3A 4MF7A 2IN3A 2AJQB 2LEGA 5CRHA 2H6YA 1SYXA 4GLTA 1TDIA 3LQ7A 1FHEA 5DBQA 1DUGA 1M2AA 1TK8B 4KSMA 3MDKA 2TRCP 6GSWA 3KTLA 4LA1A 3IA1A 3GKXA 1ERTA 4KUNA 4HDEA 1IYIA 4TR1B 2XBQA 5G30A 4MCUA 1FO5A 13GSA 2P31A 3H1NA 1I9DA 2N5AA 3RBTA 4BWSA 2HYXA 2P5RA 5ELAA 3F9UA 2A4VA 5DDLA 4GSTA 1MEKA 5DALA 3EE2A 1THXA 3ZIVA 2VL3A 2I1UA 2RLIA 1QGVA 3ED3A 2KP1A 4IP6A 3TB2A 5J3RA 2RUFA 2BJXA 1T4YA 3UBLA 1TOFA 2VD1A 3L9UA 5AISA 1R4WA 4EC0A 4V2NA 1EOGA 5D9WA 1J08A 1VRSD 3GMFA 2FCHA 4F03A 3GUSA 1HNAA 1GSFA 3TDGA 2M46A 2AB6A 1AXDA 2VL2C 4Q5QA 3FK8A 2GSQA 1O6JA 1ML6A 1TRUA 1OKTA 5KN1A 3FKFA 3QDNA 3VI5A 20GSA 1EV9A 1KEBA 2YN1A 4ID0A 3UJ1A 2LJRA 5EY6A 1Z9HA 1PX6A 3ZYWA 3C1SA 1X5DA 2X8CA 3M9JA 5LNKe 5E4WA 2AV4A 1TXXA 2B5XA 3A2VA 4I5QA 2RIIA 1YZXA 4HJ2A 3IDVA 2V32A 4KDUA 1GUMA 4GSSA 4BPYA 5DJLA 3D4TA 1YQ1A 1CQGA 4GF0A 2K8VA 3BBYA 3U5RE 4POLA 1AW9A 3GIXA 1GSYA 2P0GA 1YKAA 1Q98A 4MZBA 2GLRA 5HFKA 3TKRA 5C04A 4Q5FA 3TOUA 2ON5A 1W89A 4WKWA 3QD9A 1EZKA 4RUVA 1G6YA 3GN3A 1Q4JA 3ME7A 1TK0B 4PX1A 3TUEA 4KB3A 5IMZA 4N11A 4MA9A 5IO2A 2LTKA 1TTZA 1PSQA 4H86A 3Q74A 1PKZA 1Z6NA 4MF6A 1ERUA 2B3SA 2PVQA 4IQAA 5ELGA 1GL8A 1WRYA 2Z9SA 3DVWA 4V2MA 2DBCA 3RDWA 2FY6A 4MLYA 3R2QA 2JZRA 4F2IA 4D73A 1FG4A 4K8MA 1XBSA 2N5FA 3DRNA 2XHFA 4AJ8A 2E2MA 4OCEA 2KUCA 4N0ZA 5IM9A 3VURA 2HE3A 2JSYA 4K1FA 1AQVA 1AQXA 4E8EA 2GTUA 5A4VA 1MD4A 1S3AA 3TKSE 1KBNA 2OA7A 1LJRA 2H19A 2YWNA 4OFNA 3FEUA 1YDKA 4MDCA 1SYRA 3UL3A 1SK1A 1XZOA 2X8HA 2YPMA 2O8VB 3C1RA 1ERVA 1GUHA 2DSAA 3QR6A 4L0WA 4K7OA 1PN9A 1F3AA 2H1AA 4QQ7A 4BVYA 4IBPA 4HU7A 1FVKA 3P8WA 3ME8A 2CAQA 3ZFLA 3C73A 5JCWA 2XBIA 1ZYQB 2LRNA 2R6KA 2H70A 2TRXA 2JACA 2R5GA 2H72A 2O89A 3GTUB 4MJBA 3WGDA 1TU8A 1F9MA 1XWAA 3FYGA 1T00A 4JR4A 2OE1A 3TJJA 5D8IA 4WR5A 1WE0A 4V2LA 3GURA 4TRXA 2B6MA 4G2EA 3GNJA 4KX4A 3TJFA 4MZCA 11GSA 3N9JA 3HD5A 3KTBA 1USBA 2CX3A 1MDKA 2C8UA 2BTOT 3NOFA 1T3BA 1JZWA 1BEDA 2DMMA 3UARA 2L5OA 2JL4A 4KE3A 1XOAA 3HJOA 5ABRA 1TU7A 1XW5A 2O7KA 2V6KA 2IMIA 4EKZA 2FUG2 1K0NA 3Q6OA 4POBA 4JBBA 1A23A 4EF0A 1TRVA 1B9XC 1B8XA 1K0MA 1S3DA 5LD0A 1X9MB 2J9HA 1NW2A 3L4NA 4NHZA 1O73A 2AUVA 12GSA 3TRPA 5LCZA 2LS5A 4O5RA 4XS4B 4TR3A 3F4SA 3HVSA 2PBJA 1EP8A 5HQPA 2WFCA 2LUSA 3QCPA 1GSQA 1XXUA 4J57E 3BJ5A 2NVLA 4TR1A 5EPFA 4DSSB 5A4WA 1SENA 8GSSA 5D9XA 1XPVA 4ZBDA 3VPQA 2HXKA 5IOWA 3A2XA 1A0RP 1XVQA 4JU5A 1PD21 2YANA 1R5AA 2CVDA 3GSTA 2MMAA 5IMFA 3UOMA 4EDYA 3TCOA 4ILFA 2DJ2A 1GSEA 5ECMB 3UIWA 4OMVA 5ID2B 5A4UA 2PERA 1GLPA 3IE3A 3APSA 3ZRDA 5L71A 4O92A 3QMXA 3GRXA 3F63A 1XWCA 4ZB6A 6GSTA 1B48A 1V2AA 3G9BA 3DKSA 3DMLA 3RHCA 2M80A 1NHYA 2CX4A 5CRWA 4N10A 3EYTA 3MSZA 1GULA 2VCVA 3A5WA 1O85A 1ZZYA 6GSSA 2HSYA 2C0EA 4IW9A 3TJGA 4FYUA 1HNCA 2OJLA 3VWWA 2HFDA 1H4OA 3ISOA 3H79A 2HT9A 5ECSA 2NTOA 1PKWA 3GKMA 6GSYA 5ECOB 2OBKA 4F82A 1MD3A 2LKUA 1XW6A 5EL8A 4F0CA 2FA8A 4K6XA 2H8LA 2YZHA 2VCXA 1XWBA 4IJ3A 4TN8A 2F8FA 4ZBBA 4Q5RA 1W4VA 1G0TA 2LQOA 1QFNA 2GSSA 2IMFA 2LNTA 4HQSA 2LV3A 1OAZA 1PRXA 4WXTA 3U6VA 3ZVJA 4X1UA 2X64A 4K0GA 5F06A 5GSTA 5JWRB 1V40A 4PGTA 1M99A 4HEA2 4ZBAA 4FIWA 4XTSA 1RQMA 5C00A 2RM5A 4CW9A 1TW9A 5KN2A 4X43A 1GSDA 3TRQA 2D2ZA 2L4QA 4RI7A 4MABA 5JCUA 4G9HA 4ZXGA 2IFQB 2FGXA 2C3TA 2HZFA 4EXJA 4IHUA 2CQ9A 1ZMAA 4F9ZA 4YAVA 5D9VA 2ES7A 5IPHA 4JE1A 4IS0A 1B9YC 3W6GA 2EC4A 2FNOA 2M72A 4L5LA 5IMDA 2TIRA 2CA8A 4ZILA 1IYHA 2ON7A 4NAXA 1NSWA 1G7OA 2GQKA 2DJ0A 1EGRA 1X0RA 5DAKB 4K7IA 4MJEA 5D93A 1ERWA 4FYBA 2H74A 3EURA 3L78A 1R5PA 2XPDA 2FWGA 3KP8A 4LLRA 2FWHA 2H76A 3RAZA 1JFUA 4TKYA 1I5GA 2VM1A 1URMA 2FWEA 4MMMA 3TKSC 3L9VA 4KW6A 2R4VA 3H93A 2H1BA 2O87A 3GHAA 4XIHA 4ML6A 5H5SA 1SL1B 2IL3A 1DE1A 5FT3A 4L0UA 4MJAA 2N5BA 5CREA 3GX0A 4POMA 3O3TA 3H4KA 2QC7A 2WB9A 2FA4A 3HA9A 1VF3A 1T7PB 3UVHA 1FAAA 2B1LA 10GSA 2OE3A 2XPEA 4KSOA 1OC9B 3APOA 2QKEA 1YY7A 1HD2A 3D0ZA 1BX9A 1F6MC 2V6OA 1TKDB 2MMOA 1TI3A 4PNFA 1SK2A 1KTEA 2F3MA 2P5QA 1X9SB 1O81A 4PUAA 2C80A 2QSIA 1ZGNA 2OACA 2PGTA 2YJHA 1BYEA 3C7MA 3IOSA 1K3LA 3ZZXA 5AN1A 2GSRA 2L5LA 2YZUA 4MPGA 3KZQA 3CRTA 4PUFC 2K9FA 5DJMA 3KH9A 4ISDA 1PMTA 2C3NA 3HJMA 3VLNA 2OADA 4NMUA 3EWLA 3DWVA 4ECCA 3ERGA 2JZTA 3G7YA 5GAND 1TRWA 3BOAA 3VWVA 3ZLPA 4GTUA 4MZWA 2R2JA 5ECNB 4EL1A 3IHQA 4WBJA 1T1VA 3IR4A 2GT6A 3EU4A 1GP1A 3ZMLA 3C8EA 1U3IA 3WGXA 4EDZA 4OD7A 2IPAA 3EVIA 19GSA 2VCTA 2K18A 1QMVA 2H6XA 3W8JA 5J9CA 1HNBA 5DVBA 3N5OA 3M9KA 2GQMA 3CSJA 4GWRA 3O76A 4AF2A 1X9WB 2OKAA 2WS2A 2QGVA 1EP7A 3IK9A 2GZPA 1XWGA 3US3A 5ENUA 4J56E 2DLXA 2WCIA 1AC1A 1ZOFA 1SKWB 3TOTA 2R3XA 1MDJA 3QFAC 3ERFA 1THOA 3PINA 5IMCA 3ZITA 4MJCA 4L5OA 4YAPA 3ZREA 4BWQA 3F4TA 1JLWA 4Z7XA 4OFMA 4NXIA 4TXVA 3LORA 5DQSA 4P3YB 5G5FA 1BJXA 1GLQA 2KOKA 2PMTA 3G7JA 3HCZA 5KEJA 2YV9A 2I4AA 3GV1A 3IK7A 3O6TA 2PVOC 6GSXA 3ZTLA 4JEDA 5ID2A 1WMJA 1GTUA 1DE2A 1T4ZA 1MDIA 1SJZA 1E2YA 2VLTA 3FHKA 4OWYA 1R26A 2MMNA 3ZL5A 1YEPA 3D4MA 1UN2A 3KM6A 1SJIA 1AQWA 4YQUA 1LU4A 4K0NA 4DVCA 5F8BA 4ZIJA 2LQQA 4LMWA 1PQNA 2PU9C 3EMPA 4HUAA 3EINA 3GH9A 5IO0A 1BG5A 5J5NA 2B7KA 3LFLA 5ECLB 3GFKA 4GXZA 5ECKB 3NZNA 2XC2A 1KNGA 1QUWA 2H73A 2VCWA 3QAGA 3FZAA 1GUKA 4MPFA 5CNWA 1WPIA 5AIVA 5HFGA 1SD9A 2YOIA 1U3AA 1O8XA 1A2JA 2HLSA 3NIVA 4I6XA 3WT2A 2IJYA 1JZRA 2H30A 4KDYA 1GRXA 4O32A 4N30A 2GQLA 2ZNMA 2KHPA 2OE0A 4FO5A 2WZ9A 4E8HA 4NWYA 5IMVA 4ZL9A 1U87A 3HXSA 3FRCA 2A2RA 2WDUA 4CDOA 4WF5A 1EWXA 2HZEA 1NM3A 1Z6MA 3FZ5A 2VUPA 1SU9A 3V1WA 2DJ1A 1S3CA 5A5KA 1Z3EA 2H1DA 5D96A 2ZCTA 1AIUA 4G19A 4NV5A 2C4JA 4F0BA 2IFQA 2MZCA 2GT5A 2MBSA 2ZUPA 3KXOA 1V98A 2E0QA 5GAPD 5IPGA 3HZ4A 3CYNA 3CTFA 2L6DA 3LJRA 3HJPA 2H0IA 2MYGA 4N0VA 3TKSA 1J0FA 1DSBA 5KN0A 4KCEA 1OVNA 3KD0A 1RK4A 1A2LA 3PR8A 4PQHA 3CXGA 4XRAA 2CT6A 2CVKA 1WIKA 5DAKA 1M7TA 4YQMA 1QXHA 4WR4A 3TJBA 3AY8A 2C0DA 5J9BA 3L9SA 2DJJA 1N2AA 4GQFA 2IMDA 5DCHA 5HR0A 2WJUA 1SKSB 1K0BA 2J23A 1M9BA 5DQYA 1PL1A 1ST9A 1V57A 17GSA 1WWJA 4J2FA 6GSVA 1UA5A 3C71A 1K0AA 2EIOA 4TOPA 4GRFA 4HOJA 1OYJA 5CAXA 4EO3A 5D73A 4HZ4A 2HNLA 1MTCA 1SL0B 4NHWA 2HRNA 1OC9A 3CBUA 3GL3A 2LRTA 3IAS2 2VL9A 1SL2B 5FWGA 5G1LA 2KLXA 2EIRA 3WT1A 3BD2A 4ML1A 4MH2A 3QOUA 5B6MA 4OO5A 3UAPA 3E3EA 5HFIA 4POKA 3PH9A 1G6WA 1FOVA 3UBKA 1M2BA 3D22A 3SWLA 2LJAA 1X5EA 5J4UA 3JCML 2GGTA 1SJ6A 4JRRA 2YWIA 4KNDA 4ECJA 3UEMA 2H6ZA 1JZDA 1B4PA 3FZ4A 4I2TA 1BQ7A 5G5EA 3FR6A 3CSIA 2GZYA 3QAVA 5HR2A 2I3YA 5GSSA 3WD6A 4TR4A 3BCIA 4KH7A 5ECIB 3DVXA 1JZOA 3I43A 2JZSA 3GL5A 3QAWA 2H75A 2FLSA 5ECRB 2LJKA 3D6IA 3TRXA 1F3BA 4HJMA 2NDOA 3PGTA 1H75A 2VO4A 3TKQA 2REMA 1C72A 2PPTA 3GKKA 1EV4A 1U88A 2DIYA 2X99A 3VWUA 1EGOA 3F0IA 3LEFA 5J41A 5H5QA 2H66A 2I9HA 3VI7A 1JHBA 2L4CA 1TP9A 3IV4A 1SK0A 2GDRA 5G31A 2G0FA 2LNSA 4AJ6A 5JWQB 4I8BA 4XCSA 2K8SA 3H8QA 3IXRA 1VGLA 4BL7A 1PA3A 2YV7A 2H0HA 3KIJA 1O7UA 1VF4A 3VK9A 4K9ZA 3S9FA 3QPMA 2B7JA 2WRTA 4OFTA 4JZQA 1AUCA 4WEYA 2MMZA 1TRSA 4AJ7A 1PGTA 4I97A 14GSA 2RM6A 3GH6A 2GS3A 5F05A 3KMOA 1EEMA 2VLUA 3LSZA 5HR3A 3KP9A 5AIXA 1V9WA 3QFBC 1GNWA 2V1MA 1QQ2A 4KA0A 1ZL9A 3RHBA 4XS6A 1YKCA 2HRFA 4TXOB 3VWXA 1ABAA 4IVFA 2WULA 1A2MA 4FYCA 2AYTA 2LRCA 16GSA 1FB0A 5E59A 2B1KA 2DIZA 3GTUA 3A2WA 2EIQA 4KDXA 4WF4A 3KH7A 5COHA 4EE0A 3K8NA 4DSRA 4PXOA 2C0GA 3IPZA 1A8LA 2YWMA 3KMNA 2VCZA
chains in the Genus database with same CATH superfamily
1VF2A 3KEBA 1OKDA 4YH2A 1YEXA 4JR6A 3F6FA 2DMLA 4MNNA 4WETA 3F4RA 1WP0A 4Q5NA 3KJYA 4IJIA 3RPPA 1PL2A 1GNEA 4XS1A 1HQOA 1YF1A 4NPBA 1JLVA 3BCKA 4I2UA 3WGEA 2A2SA 3CRUA 1F2EA 4YKGA 3HKRA 22GSA 2H0GA 5ECPB 1G7EA 1UC7A 3FZ9A 3IBHA 4BA7A 1PN0A 1PX7A 2IWTA 1RW1A 4EIQA 1NHOA 3KCMA 5G1KA 3FMWA 4NV2A 1WOUA 3I6AA 1EEJA 4GSNA 5FHIA 3FY7A 3M8NA 2CAIA 4PQ1A 2H01A 2IIYA 2KP2A 3I69A 3UVTA 5D9TA 4XRDA 5G2ZA 2FD3A 4LL1B 1ILOA 1ON4A 2DC5A 1M9AA 1GSSA 1E6BA 4XS4A 2F8AA 4L8EA 1VF1A 3MWHA 1K0CA 2K6VA 4KCAA 3CSHA 1XFLA 5B6NA 1GSUA 3F8UA 3DGQA 5DALB 2F9SA 3IC8A 4DSSA 3I9V2 4K2DA 3M1GA 2NBSA 3GX8A 2B5YA 4IN0A 4DSQA 1B4QA 1K0DA 2DJKA 2PUKC 4KGIA 5JCGA 2PN8A 4X0XA 5CRGA 4FH8A 1XOBA 1ACVA 3MNGA 3P2AA 3VPTA 4CY8A 3HZ8A 3MAKA 2V2GA 3P90A 18GSA 1GTBA 5F0GA 3FW2A 4EVMA 2MBTA 2HRAA 3LWAA 1GTAA 4PQIA 1LBKA 4ECIA 3L0HA 2C1YA 3HHVA 2BMXA 4G10A 5AGYA 4HQZA 2VD0A 5ECQB 5H5RA 1DBYA 3GA4A 2L57A 5HR1A 3LG6A 1FB6A 2I81A 1F37A 3HYPA 9GSSA 1YF0A 2E2GA 3DXBA 3E9JB 2NPBA 3ZIJA 2IMKA 3HY2A 4MH3A 3A3TA 3HDCA 1K3OA 3LYKA 4IGJA 4V1Ap 1Z5YE 3F6DA 2LSTA 3IAM2 5IMAA 2L59A 3LXTA 4IP1A 1TJDA 4GQCA 4HS1A 7GSSA 2FHEA 1A8YA 1M2DA 5IOXA 3DEXA 4IQ1A 2CZ2A 3LXZA 4OCFA 3DYRA 4TVEA 4RQRA 1XVWA 2ALBA 2CZ3A 3MIXA 1N8JA 5CRDA 4ZB8A 3WYWA 2IMEA 3LYPA 1XIYA 1XW9A 2X4AA 3FR9A 5IIZA 4KAEA 5CO3A 4V1Ag 2A4HA 4HZ2A 2C0FA 2VOCA 2YJ7A 4QL9A 3GYKA 1ZCPA 3ZVJD 1V58A 1GH2A 1R7HA 4ZL8A 2R37A 1J9BA 2B5EA 1FVJA 1Y6EA 4IELA 1YJ6A 5CYYA 2L6CA 1CQHA 3G7IA 1ZYEA 4GCIA 1TK5B 5DCGA 1XCCA 1T8EB 3F3RA 3TJKA 2YWOA 1U6TA 3Q18A 2H71A 2VIMA 1GWCA 4PURA 4HU9A 4MK3A 1OE8A 5EVOA 4D73B 3FR3A 5B8BA 4ZL7A 5IQYA 3ZFBA 4RI6A 2HSHA 4LMVA 4HSCX 2HI7A 5B8AA 4MP4A 1TI1A 2CVBA 1WJKA 3Q19A 3D21A 4MF5A 2G2QA 2YCDA 2H1GA 1GTIA 1Y25A 1A24A 5BRTA 3EMXA 2GVPA 2YNXA 1EOHA 1QK8A 2JADA 1SKRB 2HRKA 3ERWA 2O85A 1X5CA 3TGZA 2VAFA 2VL2A 3IC4A 4XHMA 4LL4B 2X8GA 3P7XA 3ZMKA 1SD8A 4ACSA 4BVXA 3DIEA 2C3QA 1HYUA 3J7Yk 4BVYB 1Z7PA 3RPNA 1FW1A 2FWFA 4QL7A 3APQA 4O7HA 3CTGA 4TR0A 1Z7RA 1K0OA 3M3MA 4RQXA 3GKNA 5GZZB 3KGKA 2V41A 2GSTA 3GSSA 4ZB9A 3LGCA 3OR5A 5KN3A 1K3YA 2VCQA 1M0UA 2VLVA 3TKPA 4CHSA 1OC8A 3HVVA 4TXOA 3E0UA 4PNGA 5B7CA 4IKHA 2CV4A 2VM2A 2AHEA 3VFIA 3F3QA 4AGSA 4Z2TA 4OO4A 4ECBA 3CMIA 5JWOB 3D5JA 1UVZA 4FQUA 2AAWA 4YQVA 1BAYA 3EC3A 4DEJA 3M0FA 2JSZA 3IRAA 4EUYA 4HI7A 3SBCA 2RUEA 5INYA 2X49A 1OC3A 2YP6A 2QA2A 5F07A 4WBRD 3W8SA 2F51A 4KF9A 3J7Yb 2OBIA 2JU5A 1AAZA 2GZZA 5CP1A 1O8WA 4TW5A 2HZEB 1XWKA 4ULXA 1OE7A 2DJ3A 3HVXA 3UMAA 4K7NA 2E7PA 6GSUA 2PWJA 2WGRA 3DD3A 5ECHB 1A0FA 3EU3A 4MF7A 2IN3A 2AJQB 2LEGA 5CRHA 2H6YA 1SYXA 4GLTA 1TDIA 3LQ7A 1FHEA 4CY6A 5DBQA 1DUGA 1M2AA 1TK8B 4KSMA 4Z2UA 3MDKA 2TRCP 6GSWA 3KTLA 4LA1A 3IA1A 3GKXA 1ERTA 4KUNA 4HDEA 1IYIA 4TR1B 2XBQA 5G30A 4MCUA 1FO5A 13GSA 2P31A 3H1NA 1I9DA 2N5AA 3RBTA 4BWSA 2HYXA 1M3JA 2P5RA 5ELAA 3F9UA 2A4VA 5DDLA 4A5PA 4GSTA 1MEKA 5DALA 3EE2A 1THXA 3ZIVA 2VL3A 2I1UA 2RLIA 1QGVA 3ED3A 2KP1A 4IP6A 3TB2A 5J3RA 2RUFA 2BJXA 1T4YA 3UBLA 1TOFA 1S3RA 2VD1A 3L9UA 5AISA 1R4WA 4EC0A 4V2NA 1EOGA 5D9WA 1J08A 1VRSD 3IHGA 3GMFA 2FCHA 4F03A 3GUSA 1HNAA 1GSFA 3TDGA 2M46A 2AB6A 1AXDA 2VL2C 4Q5QA 3FK8A 2GSQA 1O6JA 1ML6A 1TRUA 1OKTA 5BMUA 5KN1A 3FKFA 3QDNA 3VI5A 20GSA 1EV9A 1KEBA 2YN1A 4ID0A 3UJ1A 2LJRA 5EY6A 1Z9HA 1PX6A 3ZYWA 3C1SA 1X5DA 2X8CA 3M9JA 5LNKe 5E4WA 2AV4A 1TXXA 2B5XA 3A2VA 4I5QA 2RIIA 1YZXA 4K5RA 4HJ2A 3IDVA 2V32A 4KDUA 1GUMA 4GSSA 4BPYA 5DJLA 3D4TA 1YQ1A 1CQGA 4GF0A 2K8VA 3BBYA 3U5RE 4POLA 1AW9A 2R0CA 3GIXA 1GSYA 2P0GA 1YKAA 1Q98A 3CQFA 4MZBA 2GLRA 5HFKA 3TKRA 5C04A 4Q5FA 3TOUA 2ON5A 1W89A 4WKWA 4EIPA 3QD9A 1EZKA 4RUVA 1G6YA 3GN3A 1Q4JA 3ME7A 4K5SA 1TK0B 4PX1A 3TUEA 4KB3A 5IMZA 4N11A 4MA9A 5IO2A 2LTKA 1TTZA 1PSQA 4H86A 3Q74A 1PKZA 1Z6NA 4MF6A 1ERUA 2B3SA 2PVQA 4IQAA 5ELGA 1GL8A 1WRYA 2Z9SA 3DVWA 4V2MA 2DBCA 3RDWA 2FY6A 4MLYA 3R2QA 2JZRA 4F2IA 4D73A 1FG4A 4K8MA 1XBSA 2N5FA 3DRNA 2XHFA 4AJ8A 2E2MA 4OCEA 2KUCA 4N0ZA 5IM9A 3VURA 2HE3A 2JSYA 4K1FA 1AQVA 1AQXA 4E8EA 2GTUA 5A4VA 1MD4A 1S3AA 5KOWA 3TKSE 1KBNA 2OA7A 1LJRA 2H19A 2YWNA 4OFNA 3FEUA 1YDKA 4MDCA 1SYRA 3UL3A 1SK1A 1XZOA 2X8HA 2YPMA 2O8VB 3C1RA 1ERVA 1GUHA 2DSAA 3QR6A 4L0WA 4K7OA 1PN9A 1F3AA 2H1AA 4QQ7A 4BVYA 4IBPA 4HU7A 1FVKA 3P8WA 2HSMA 3ME8A 2CAQA 3ZFLA 3C73A 5JCWA 2XBIA 1ZYQB 5KOXA 2LRNA 2R6KA 2H70A 2TRXA 2JACA 2R5GA 2H72A 2O89A 3GTUB 4MJBA 3WGDA 1TU8A 1F9MA 1XWAA 3FYGA 1T00A 4JR4A 2OE1A 3TJJA 5D8IA 4WR5A 1WE0A 4V2LA 3GURA 4TRXA 2B6MA 4G2EA 4USSA 3GNJA 4KX4A 3TJFA 4MZCA 11GSA 3N9JA 3HD5A 3KTBA 1USBA 2CX3A 1MDKA 2C8UA 4ICYA 2BTOT 3NOFA 1T3BA 1JZWA 1BEDA 2DMMA 3UARA 2L5OA 2JL4A 4KE3A 1XOAA 3HJOA 5ABRA 1TU7A 1XW5A 2O7KA 4X4JA 2V6KA 2IMIA 4EKZA 2FUG2 1K0NA 3Q6OA 4POBA 4JBBA 1A23A 4EF0A 1TRVA 2UZ8A 1B9XC 1B8XA 1K0MA 1S3DA 5LD0A 1X9MB 2J9HA 1NW2A 3L4NA 4G0LA 4NHZA 1O73A 2AUVA 12GSA 3TRPA 5LCZA 2LS5A 4O5RA 4XS4B 4TR3A 3F4SA 3HVSA 2PBJA 1EP8A 5HQPA 2WFCA 2LUSA 3QCPA 1GSQA 1XXUA 4J57E 3BJ5A 2NVLA 4TR1A 5EPFA 4DSSB 5A4WA 1SENA 8GSSA 5D9XA 1XPVA 4ZBDA 3VPQA 2HXKA 5IOWA 3A2XA 1A0RP 1FOHA 1XVQA 4JU5A 1PD21 2YANA 1R5AA 2CVDA 3GSTA 2MMAA 5IMFA 3UOMA 4EDYA 3TCOA 4ILFA 2DJ2A 1GSEA 5ECMB 3UIWA 4OMVA 5ID2B 5A4UA 2PERA 1GLPA 3IE3A 3APSA 3ZRDA 5L71A 1M3IA 4O92A 3QMXA 3GRXA 3F63A 1XWCA 4ZB6A 6GSTA 1B48A 1V2AA 3G9BA 3DKSA 3DMLA 3HVNA 3RHCA 2M80A 1NHYA 2CX4A 5CRWA 4N10A 4O5UA 3EYTA 3MSZA 1GULA 2VCVA 3A5WA 1O85A 1ZZYA 6GSSA 2HSYA 2C0EA 4IW9A 3TJGA 4FYUA 1HNCA 2OJLA 3VWWA 2HFDA 1H4OA 3ISOA 3H79A 2HT9A 5ECSA 2NTOA 1PKWA 3GKMA 6GSYA 5ECOB 2OBKA 4F82A 1MD3A 2LKUA 1XW6A 5EL8A 4F0CA 2FA8A 4K6XA 2H8LA 2YZHA 2VCXA 1XWBA 3R3EA 4IJ3A 4TN8A 2F8FA 4ZBBA 4Q5RA 1W4VA 1G0TA 2LQOA 1QFNA 2GSSA 2IMFA 2LNTA 4HQSA 2LV3A 1OAZA 1PRXA 4WXTA 3U6VA 3ZVJA 4X1UA 2X64A 4K0GA 5F06A 5GSTA 5JWRB 1V40A 4PGTA 1M99A 4HEA2 4ZBAA 4FIWA 4XTSA 1RQMA 5C00A 2RM5A 4CW9A 1TW9A 5KN2A 2DKHA 1GSDA 4X43A 3TRQA 2D2ZA 2L4QA 4RI7A 4MABA 5JCUA 4G9HA 4ZXGA 2IFQB 2FGXA 3EPTA 2C3TA 2HZFA 4EXJA 4IHUA 2CQ9A 1ZMAA 4F9ZA 4YAVA 5D9VA 2ES7A 5IPHA 4JE1A 4IS0A 1B9YC 3W6GA 2EC4A 2FNOA 2M72A 4L5LA 5IMDA 2TIRA 2CA8A 4ZILA 1IYHA 2ON7A 4NAXA 1NSWA 1G7OA 2GQKA 2DJ0A 1EGRA 1X0RA 4Z2RA 5DAKB 4K7IA 4MJEA 5D93A 1ERWA 4FYBA 2H74A 3EURA 3L78A 1R5PA 2XPDA 2FWGA 3KP8A 4LLRA 2FWHA 2H76A 3RAZA 1JFUA 4TKYA 1I5GA 2VM1A 1URMA 2FWEA 4MMMA 3TKSC 3L9VA 4KW6A 2R4VA 3H93A 2H1BA 2O87A 3GHAA 4XIHA 4ML6A 5H5SA 1SL1B 2IL3A 1DE1A 5FT3A 4L0UA 4MJAA 2N5BA 5CREA 3GX0A 4POMA 3O3TA 3H4KA 2QC7A 2WB9A 2FA4A 3HA9A 1VF3A 1T7PB 3UVHA 1FAAA 2B1LA 10GSA 2OE3A 2QA1A 2XPEA 4KSOA 1OC9B 3APOA 2QKEA 1YY7A 1HD2A 3D0ZA 1BX9A 1F6MC 2V6OA 1TKDB 2MMOA 1TI3A 4PNFA 1SK2A 1KTEA 2F3MA 2P5QA 1X9SB 1O81A 4PUAA 2C80A 2QSIA 1ZGNA 2OACA 2PGTA 2YJHA 1BYEA 3C7MA 3IOSA 1K3LA 1XG8A 3ZZXA 5AN1A 2GSRA 2L5LA 2YZUA 4PTSA 4MPGA 3KZQA 4BIKA 3CRTA 4PUFC 2K9FA 5DJMA 3KH9A 4ISDA 1PMTA 2C3NA 3HJMA 3VLNA 2OADA 4NMUA 3EWLA 3DWVA 4ECCA 3ERGA 2JZTA 3G7YA 5GAND 1TRWA 3BOAA 3VWVA 3ZLPA 4GTUA 4MZWA 2R2JA 5ECNB 4EL1A 3IHQA 4WBJA 1T1VA 3IR4A 2GT6A 3EU4A 1GP1A 3ZMLA 3C8EA 1U3IA 3WGXA 4EDZA 4OD7A 1PFOA 2IPAA 3EVIA 19GSA 2VCTA 2K18A 1QMVA 2H6XA 3W8JA 5J9CA 1HNBA 5DVBA 3N5OA 3M9KA 2GQMA 3CSJA 4GWRA 3O76A 4AF2A 1X9WB 2OKAA 2WS2A 2QGVA 1EP7A 3IK9A 2GZPA 1XWGA 4YKFA 3US3A 5ENUA 4J56E 2DLXA 2WCIA 1AC1A 1ZOFA 1SKWB 1ZYPA 3TOTA 2R3XA 1MDJA 3QFAC 4BL7B 3ERFA 1THOA 3PINA 5IMCA 3ZITA 4MJCA 4L5OA 4YAPA 2A2PA 3ZREA 4BWQA 3F4TA 1JLWA 4Z7XA 4K2XA 4OFMA 4NXIA 4TXVA 3LORA 5DQSA 4P3YB 5G5FA 1BJXA 1GLQA 2KOKA 2PMTA 3G7JA 3HCZA 5KEJA 2YV9A 2I4AA 3GV1A 3IK7A 3O6TA 2PVOC 6GSXA 3ZTLA 3MYDA 4JEDA 5ID2A 1WMJA 1GTUA 1DE2A 1T4ZA 1MDIA 1SJZA 1E2YA 2VLTA 3FHKA 4OWYA 1R26A 2MMNA 3ZL5A 1YEPA 3D4MA 1UN2A 3KM6A 1SJIA 1AQWA 4YQUA 1LU4A 4K0NA 4DVCA 5F8BA 4ZIJA 2LQQA 4LMWA 1PQNA 2PU9C 3EMPA 4HUAA 3EINA 3GH9A 5IO0A 1BG5A 5J5NA 2B7KA 3LFLA 5ECLB 3GFKA 4GXZA 5ECKB 3NZNA 2XC2A 1KNGA 1QUWA 2H73A 2VCWA 3QAGA 3FZAA 3LW9A 1GUKA 4MPFA 5CNWA 1WPIA 5AIVA 5HFGA 1SD9A 2YOIA 1U3AA 1O8XA 1A2JA 2HLSA 3NIVA 4I6XA 3WT2A 2IJYA 1JZRA 2H30A 4KDYA 1GRXA 4O32A 4N30A 2GQLA 2ZNMA 2KHPA 2OE0A 4FO5A 2WZ9A 4E8HA 4NWYA 5IMVA 4ZL9A 1U87A 3HXSA 2DKIA 3FRCA 2A2RA 2WDUA 4CDOA 4WF5A 1EWXA 2HZEA 1NM3A 1Z6MA 3FZ5A 2VUPA 1SU9A 3V1WA 2DJ1A 1S3CA 5A5KA 2R0PA 1Z3EA 2H1DA 5D96A 2ZCTA 1AIUA 4G19A 4NV5A 2C4JA 4F0BA 4G0KA 2IFQA 2MZCA 2GT5A 2MBSA 2ZUPA 3KXOA 1V98A 2E0QA 5GAPD 5IPGA 3HZ4A 3CYNA 3CTFA 2L6DA 3LJRA 3HJPA 2H0IA 2MYGA 4N0VA 3TKSA 1J0FA 1DSBA 5KN0A 4KCEA 1OVNA 3KD0A 1RK4A 1A2LA 3PR8A 4PQHA 3CXGA 4XRAA 2CT6A 2CVKA 1WIKA 5DAKA 1M7TA 4YQMA 3PPUA 1QXHA 4WR4A 3TJBA 3AY8A 2C0DA 5J9BA 3L9SA 2DJJA 1N2AA 4GQFA 2IMDA 5DCHA 5HR0A 2WJUA 1SKSB 1K0BA 2J23A 1M9BA 5DQYA 1PL1A 1ST9A 1V57A 17GSA 1WWJA 1ZYNA 4J2FA 6GSVA 1UA5A 3C71A 1K0AA 2EIOA 4TOPA 4GRFA 4HOJA 1OYJA 5CAXA 4EO3A 5D73A 4HZ4A 2HNLA 1MTCA 1SL0B 4NHWA 2HRNA 1OC9A 3A5IA 3CBUA 3GL3A 2LRTA 3IAS2 2VL9A 1SL2B 5FWGA 5G1LA 2KLXA 2EIRA 3WT1A 3BD2A 4ML1A 4MH2A 3QOUA 5B6MA 4OO5A 3UAPA 3E3EA 5HFIA 4POKA 3PH9A 1G6WA 1FOVA 3UBKA 1M2BA 3D22A 3SWLA 2LJAA 1X5EA 5J4UA 3JCML 2GGTA 1SJ6A 4JRRA 2YWIA 4KNDA 4ECJA 3UEMA 2H6ZA 1JZDA 1B4PA 3FZ4A 4I2TA 1BQ7A 5G5EA 3FR6A 3CSIA 2GZYA 3QAVA 5HR2A 4O5QA 2I3YA 5GSSA 3WD6A 4TR4A 3BCIA 4KH7A 5ECIB 3DVXA 1JZOA 3I43A 2JZSA 3GL5A 3QAWA 2H75A 2FLSA 5ECRB 2LJKA 3D6IA 3TRXA 1F3BA 4HJMA 2NDOA 3PGTA 1H75A 2VO4A 3TKQA 2REMA 1C72A 2PPTA 3GKKA 1EV4A 1U88A 2DIYA 2X99A 3VWUA 1EGOA 3F0IA 3LEFA 5J41A 5H5QA 2H66A 2I9HA 3VI7A 1JHBA 2L4CA 1TP9A 3IV4A 1SK0A 2GDRA 5G31A 2G0FA 2LNSA 4AJ6A 5JWQB 4I8BA 4XCSA 2K8SA 3H8QA 3IXRA 1VGLA 4BL7A 1PA3A 2YV7A 2H0HA 3KIJA 1O7UA 1VF4A 3VK9A 4K9ZA 3S9FA 3QPMA 2B7JA 2WRTA 4OFTA 4JZQA 4BVXB 1AUCA 4WEYA 2MMZA 1TRSA 4AJ7A 1PGTA 4I97A 14GSA 2RM6A 4G0IA 3GH6A 2GS3A 5F05A 3KMOA 1EEMA 2VLUA 3LSZA 5HR3A 3KP9A 5AIXA 1V9WA 3QFBC 1GNWA 2V1MA 1QQ2A 4KA0A 1ZL9A 3RHBA 4XS6A 1YKCA 2HRFA 4TXOB 3VWXA 1ABAA 4IVFA 2WULA 1A2MA 4FYCA 2AYTA 2LRCA 16GSA 1FB0A 5E59A 2B1KA 2DIZA 3GTUA 3A2WA 2EIQA 4KDXA 4WF4A 3KH7A 5COHA 4EE0A 3K8NA 4DSRA 4PXOA 2C0GA 3IPZA 1A8LA 2YWMA 3KMNA 2R0GA 2VCZA
chains in the Genus database with same CATH topology
1VF2A 3KEBA 1OKDA 4YH2A 1YEXA 4JR6A 3F6FA 2DMLA 4MNNA 4WETA 3F4RA 1WP0A 4Q5NA 3KJYA 4IJIA 3RPPA 1PL2A 1GNEA 4XS1A 1HQOA 1YF1A 4NPBA 1JLVA 3BCKA 4I2UA 3WGEA 2A2SA 3CRUA 1F2EA 4YKGA 3HKRA 22GSA 2H0GA 5ECPB 1G7EA 1UC7A 3FZ9A 3IBHA 4BA7A 1PN0A 1PX7A 2IWTA 1RW1A 4EIQA 1NHOA 3KCMA 5G1KA 3FMWA 4NV2A 1WOUA 3I6AA 1EEJA 4GSNA 5FHIA 3FY7A 3M8NA 2CAIA 4PQ1A 2H01A 2IIYA 2KP2A 3I69A 3UVTA 5D9TA 4XRDA 5G2ZA 2FD3A 4LL1B 1ILOA 1ON4A 2DC5A 1M9AA 1GSSA 1E6BA 4XS4A 2F8AA 4L8EA 1VF1A 3MWHA 1K0CA 2K6VA 4KCAA 3CSHA 1XFLA 5B6NA 1GSUA 3F8UA 3DGQA 5DALB 2F9SA 3IC8A 4DSSA 3I9V2 4K2DA 3M1GA 2NBSA 3GX8A 2B5YA 4IN0A 4DSQA 1B4QA 1K0DA 2DJKA 2PUKC 4KGIA 5JCGA 2PN8A 4X0XA 5CRGA 4FH8A 1XOBA 1ACVA 3MNGA 3P2AA 3VPTA 4CY8A 3HZ8A 3MAKA 2V2GA 3P90A 18GSA 1GTBA 5F0GA 3FW2A 4EVMA 2MBTA 2HRAA 3LWAA 1GTAA 4PQIA 1LBKA 4ECIA 3L0HA 2C1YA 3HHVA 2BMXA 4G10A 5AGYA 4HQZA 2VD0A 5ECQB 5H5RA 1DBYA 3GA4A 2L57A 5HR1A 3LG6A 1FB6A 2I81A 1F37A 3HYPA 9GSSA 1YF0A 2E2GA 3DXBA 3E9JB 2NPBA 3ZIJA 2IMKA 3HY2A 4MH3A 3A3TA 3HDCA 1K3OA 3LYKA 4IGJA 4V1Ap 1Z5YE 3F6DA 2LSTA 3IAM2 5IMAA 2L59A 3LXTA 4IP1A 1TJDA 4GQCA 4HS1A 7GSSA 2FHEA 1A8YA 1M2DA 5IOXA 3DEXA 4IQ1A 2CZ2A 3LXZA 4OCFA 3DYRA 4TVEA 4RQRA 1XVWA 2ALBA 2CZ3A 3MIXA 1N8JA 5CRDA 4ZB8A 3WYWA 2IMEA 3LYPA 1XIYA 1XW9A 2X4AA 3FR9A 5IIZA 4KAEA 5CO3A 4V1Ag 2A4HA 4HZ2A 2C0FA 2VOCA 2YJ7A 4QL9A 3GYKA 1ZCPA 3ZVJD 1V58A 1GH2A 1R7HA 4ZL8A 2R37A 1J9BA 2B5EA 1FVJA 1Y6EA 4IELA 1YJ6A 5CYYA 2L6CA 1CQHA 3G7IA 1ZYEA 4GCIA 1TK5B 5DCGA 1XCCA 1T8EB 3F3RA 3TJKA 2YWOA 1U6TA 3Q18A 2H71A 2VIMA 1GWCA 4PURA 4HU9A 4MK3A 1OE8A 5EVOA 4D73B 3FR3A 5B8BA 4ZL7A 5IQYA 3ZFBA 4RI6A 2HSHA 4LMVA 2HI7A 5B8AA 4MP4A 1TI1A 2CVBA 1WJKA 3Q19A 3D21A 4MF5A 2G2QA 2YCDA 2H1GA 1GTIA 1Y25A 1A24A 5BRTA 3EMXA 2GVPA 2YNXA 1EOHA 1QK8A 2JADA 1SKRB 2HRKA 3ERWA 2O85A 1X5CA 3TGZA 2VAFA 2VL2A 3IC4A 4XHMA 4LL4B 2X8GA 3P7XA 3ZMKA 1SD8A 4ACSA 4BVXA 3DIEA 2C3QA 1HYUA 3J7Yk 4BVYB 1Z7PA 3RPNA 1FW1A 2FWFA 4QL7A 3APQA 4O7HA 3CTGA 4TR0A 1Z7RA 1K0OA 3M3MA 4RQXA 3GKNA 5GZZB 3KGKA 2V41A 2GSTA 3GSSA 4ZB9A 3LGCA 3OR5A 5KN3A 1K3YA 2VCQA 1M0UA 2VLVA 3TKPA 4CHSA 1OC8A 3HVVA 4TXOA 3E0UA 4PNGA 5B7CA 4IKHA 2CV4A 2VM2A 2AHEA 3VFIA 3F3QA 4AGSA 4Z2TA 4OO4A 4ECBA 3CMIA 5JWOB 3D5JA 1UVZA 4FQUA 2AAWA 4YQVA 1BAYA 3EC3A 4DEJA 3M0FA 2JSZA 3IRAA 4EUYA 4HI7A 3SBCA 2RUEA 5INYA 2X49A 1OC3A 2YP6A 2QA2A 5F07A 4WBRD 3W8SA 2F51A 4KF9A 3J7Yb 2OBIA 2JU5A 1AAZA 2GZZA 5CP1A 1O8WA 4TW5A 2HZEB 1XWKA 4ULXA 1OE7A 2DJ3A 3HVXA 3UMAA 4K7NA 2E7PA 6GSUA 2PWJA 2WGRA 3DD3A 5ECHB 1A0FA 3EU3A 4MF7A 2IN3A 2AJQB 2LEGA 5CRHA 2H6YA 1SYXA 4GLTA 1TDIA 3LQ7A 1FHEA 4CY6A 5DBQA 1DUGA 1M2AA 1TK8B 4KSMA 4Z2UA 3MDKA 2TRCP 6GSWA 3KTLA 4LA1A 3IA1A 3GKXA 1ERTA 4KUNA 4HDEA 1IYIA 4TR1B 2XBQA 5G30A 4MCUA 1FO5A 13GSA 2P31A 3H1NA 1I9DA 2N5AA 3RBTA 4BWSA 2HYXA 2P5RA 5ELAA 3F9UA 2A4VA 5DDLA 4A5PA 4GSTA 1MEKA 5DALA 3EE2A 1THXA 3ZIVA 2VL3A 2I1UA 2RLIA 1QGVA 3ED3A 2KP1A 4IP6A 3TB2A 5J3RA 2RUFA 2BJXA 1T4YA 3UBLA 1TOFA 2VD1A 3L9UA 5AISA 1R4WA 4EC0A 4V2NA 1EOGA 5D9WA 1J08A 1VRSD 3IHGA 3GMFA 2FCHA 4F03A 3GUSA 1HNAA 1GSFA 3TDGA 2M46A 2AB6A 1AXDA 2VL2C 4Q5QA 3FK8A 2GSQA 1O6JA 1ML6A 1TRUA 1OKTA 5BMUA 5KN1A 3FKFA 3QDNA 3VI5A 20GSA 1EV9A 1KEBA 2YN1A 4ID0A 3UJ1A 2LJRA 5EY6A 1Z9HA 1PX6A 3ZYWA 3C1SA 1X5DA 2X8CA 3M9JA 5LNKe 5E4WA 2AV4A 1TXXA 2B5XA 3A2VA 4I5QA 2RIIA 1YZXA 4K5RA 4HJ2A 3IDVA 2V32A 4KDUA 1GUMA 4GSSA 4BPYA 5DJLA 3D4TA 1YQ1A 1CQGA 4GF0A 2K8VA 3BBYA 3U5RE 4POLA 1AW9A 2R0CA 3GIXA 1GSYA 2P0GA 1YKAA 1Q98A 4MZBA 2GLRA 5HFKA 3TKRA 5C04A 4Q5FA 3TOUA 2ON5A 1W89A 4WKWA 4EIPA 3QD9A 1EZKA 4RUVA 1G6YA 3GN3A 1Q4JA 3ME7A 4K5SA 1TK0B 4PX1A 3TUEA 4KB3A 5IMZA 4N11A 4MA9A 5IO2A 2LTKA 1TTZA 1PSQA 4H86A 3Q74A 1PKZA 1Z6NA 4MF6A 1ERUA 2B3SA 2PVQA 4IQAA 5ELGA 1GL8A 1WRYA 2Z9SA 3DVWA 4V2MA 2DBCA 3RDWA 2FY6A 4MLYA 3R2QA 2JZRA 4F2IA 4D73A 1FG4A 4K8MA 1XBSA 2N5FA 3DRNA 2XHFA 4AJ8A 2E2MA 4OCEA 2KUCA 4N0ZA 5IM9A 3VURA 2HE3A 2JSYA 4K1FA 1AQVA 1AQXA 4E8EA 2GTUA 5A4VA 1MD4A 1S3AA 5KOWA 3TKSE 1KBNA 2OA7A 1LJRA 2H19A 2YWNA 4OFNA 3FEUA 1YDKA 4MDCA 1SYRA 3UL3A 1SK1A 1XZOA 2X8HA 2YPMA 2O8VB 3C1RA 1ERVA 1GUHA 2DSAA 3QR6A 4L0WA 4K7OA 1PN9A 1F3AA 2H1AA 4QQ7A 4BVYA 4IBPA 4HU7A 1FVKA 3P8WA 2HSMA 3ME8A 2CAQA 3ZFLA 3C73A 5JCWA 2XBIA 1ZYQB 5KOXA 2LRNA 2R6KA 2H70A 2TRXA 2JACA 2R5GA 2H72A 2O89A 3GTUB 4MJBA 3WGDA 1TU8A 1F9MA 1XWAA 3FYGA 1T00A 4JR4A 2OE1A 3TJJA 5D8IA 4WR5A 1WE0A 4V2LA 3GURA 4TRXA 2B6MA 4G2EA 4USSA 3GNJA 4KX4A 3TJFA 4MZCA 11GSA 3N9JA 3HD5A 3KTBA 1USBA 2CX3A 1MDKA 2C8UA 4ICYA 2BTOT 3NOFA 1T3BA 1JZWA 1BEDA 2DMMA 3UARA 2L5OA 2JL4A 4KE3A 1XOAA 3HJOA 5ABRA 1TU7A 1XW5A 2O7KA 4X4JA 2V6KA 2IMIA 4EKZA 2FUG2 1K0NA 3Q6OA 4POBA 4JBBA 1A23A 4EF0A 1TRVA 2UZ8A 1B9XC 1B8XA 1K0MA 1S3DA 5LD0A 1X9MB 2J9HA 1NW2A 3L4NA 4G0LA 4NHZA 1O73A 2AUVA 12GSA 3TRPA 5LCZA 2LS5A 4O5RA 4XS4B 4TR3A 3F4SA 3HVSA 2PBJA 1EP8A 5HQPA 2WFCA 2LUSA 3QCPA 1GSQA 1XXUA 4J57E 3BJ5A 2NVLA 4TR1A 5EPFA 4DSSB 5A4WA 1SENA 8GSSA 5D9XA 1XPVA 4ZBDA 3VPQA 2HXKA 5IOWA 3A2XA 1A0RP 1FOHA 1XVQA 4JU5A 1PD21 2YANA 1R5AA 2CVDA 3GSTA 2MMAA 5IMFA 3UOMA 4EDYA 3TCOA 4ILFA 2DJ2A 1GSEA 5ECMB 3UIWA 4OMVA 5ID2B 5A4UA 2PERA 1GLPA 3IE3A 3APSA 3ZRDA 5L71A 4O92A 3QMXA 3GRXA 3F63A 1XWCA 4ZB6A 6GSTA 1B48A 1V2AA 3G9BA 3DKSA 3DMLA 3RHCA 2M80A 1NHYA 2CX4A 5CRWA 4N10A 4O5UA 3EYTA 3MSZA 1GULA 2VCVA 3A5WA 1O85A 1ZZYA 6GSSA 2HSYA 2C0EA 4IW9A 3TJGA 4FYUA 1HNCA 2OJLA 3VWWA 2HFDA 1H4OA 3ISOA 3H79A 2HT9A 5ECSA 2NTOA 1PKWA 3GKMA 6GSYA 5ECOB 2OBKA 4F82A 1MD3A 2LKUA 1XW6A 5EL8A 4F0CA 2FA8A 4K6XA 2H8LA 2YZHA 2VCXA 1XWBA 3R3EA 4IJ3A 4TN8A 2F8FA 4ZBBA 4Q5RA 1W4VA 1G0TA 2LQOA 1QFNA 2GSSA 2IMFA 2LNTA 4HQSA 2LV3A 1OAZA 1PRXA 4WXTA 3U6VA 3ZVJA 4X1UA 2X64A 4K0GA 5F06A 5GSTA 5JWRB 1V40A 4PGTA 1M99A 4HEA2 4ZBAA 4FIWA 4XTSA 1RQMA 5C00A 2RM5A 4CW9A 1TW9A 5KN2A 2DKHA 1GSDA 4X43A 3TRQA 2D2ZA 2L4QA 4RI7A 4MABA 5JCUA 4G9HA 4ZXGA 2IFQB 2FGXA 3EPTA 2C3TA 2HZFA 4EXJA 4IHUA 2CQ9A 1ZMAA 4F9ZA 4YAVA 5D9VA 2ES7A 5IPHA 4JE1A 4IS0A 1B9YC 3W6GA 2EC4A 2FNOA 2M72A 4L5LA 5IMDA 2TIRA 2CA8A 4ZILA 1IYHA 2ON7A 4NAXA 1NSWA 1G7OA 2GQKA 2DJ0A 1EGRA 1X0RA 4Z2RA 5DAKB 4K7IA 4MJEA 5D93A 1ERWA 4FYBA 2H74A 3EURA 3L78A 1R5PA 2XPDA 2FWGA 3KP8A 4LLRA 2FWHA 2H76A 3RAZA 1JFUA 4TKYA 1I5GA 2VM1A 1URMA 2FWEA 4MMMA 3TKSC 3L9VA 4KW6A 2R4VA 3H93A 2H1BA 2O87A 3GHAA 4XIHA 4ML6A 5H5SA 1SL1B 2IL3A 1DE1A 5FT3A 4L0UA 4MJAA 2N5BA 5CREA 3GX0A 4POMA 3O3TA 3H4KA 2QC7A 2WB9A 2FA4A 3HA9A 1VF3A 1T7PB 3UVHA 1FAAA 2B1LA 10GSA 2OE3A 2QA1A 2XPEA 4KSOA 1OC9B 3APOA 2QKEA 1YY7A 1HD2A 3D0ZA 1BX9A 1F6MC 2V6OA 1TKDB 2MMOA 1TI3A 4PNFA 1SK2A 1KTEA 2F3MA 2P5QA 1X9SB 1O81A 4PUAA 2C80A 2QSIA 1ZGNA 2OACA 2PGTA 2YJHA 1BYEA 3C7MA 3IOSA 1K3LA 3ZZXA 5AN1A 2GSRA 2L5LA 2YZUA 4PTSA 4MPGA 3KZQA 3CRTA 4PUFC 2K9FA 5DJMA 3KH9A 4ISDA 1PMTA 2C3NA 3HJMA 3VLNA 2OADA 4NMUA 3EWLA 3DWVA 4ECCA 3ERGA 2JZTA 3G7YA 5GAND 1TRWA 3BOAA 3VWVA 3ZLPA 4GTUA 4MZWA 2R2JA 5ECNB 4EL1A 3IHQA 4WBJA 1T1VA 3IR4A 2GT6A 3EU4A 1GP1A 3ZMLA 3C8EA 1U3IA 3WGXA 4EDZA 4OD7A 2IPAA 3EVIA 19GSA 2VCTA 2K18A 1QMVA 2H6XA 3W8JA 5J9CA 1HNBA 5DVBA 3N5OA 3M9KA 2GQMA 3CSJA 4GWRA 3O76A 4AF2A 1X9WB 2OKAA 2WS2A 2QGVA 1EP7A 3IK9A 2GZPA 1XWGA 4YKFA 3US3A 5ENUA 4J56E 2DLXA 2WCIA 1AC1A 1ZOFA 1SKWB 1ZYPA 3TOTA 2R3XA 1MDJA 3QFAC 4BL7B 3ERFA 1THOA 3PINA 5IMCA 3ZITA 4MJCA 4L5OA 4YAPA 2A2PA 3ZREA 4BWQA 3F4TA 1JLWA 4Z7XA 4K2XA 4OFMA 4NXIA 4TXVA 3LORA 5DQSA 4P3YB 5G5FA 1BJXA 1GLQA 2KOKA 2PMTA 3G7JA 3HCZA 5KEJA 2YV9A 2I4AA 3GV1A 3IK7A 3O6TA 2PVOC 6GSXA 3ZTLA 3MYDA 4JEDA 5ID2A 1WMJA 1GTUA 1DE2A 1T4ZA 1MDIA 1SJZA 1E2YA 2VLTA 3FHKA 4OWYA 1R26A 2MMNA 3ZL5A 1YEPA 3D4MA 1UN2A 3KM6A 1SJIA 1AQWA 4YQUA 1LU4A 4K0NA 4DVCA 5F8BA 4ZIJA 2LQQA 4LMWA 1PQNA 2PU9C 3EMPA 4HUAA 3EINA 3GH9A 5IO0A 1BG5A 5J5NA 2B7KA 3LFLA 5ECLB 3GFKA 4GXZA 5ECKB 3NZNA 2XC2A 1KNGA 1QUWA 2H73A 2VCWA 3QAGA 3FZAA 3LW9A 1GUKA 4MPFA 5CNWA 1WPIA 5AIVA 5HFGA 1SD9A 2YOIA 1U3AA 1O8XA 1A2JA 2HLSA 3NIVA 4I6XA 3WT2A 2IJYA 1JZRA 2H30A 4KDYA 1GRXA 4O32A 4N30A 2GQLA 2ZNMA 2KHPA 2OE0A 4FO5A 2WZ9A 4E8HA 4NWYA 5IMVA 4ZL9A 1U87A 3HXSA 2DKIA 3FRCA 2A2RA 2WDUA 4CDOA 4WF5A 1EWXA 2HZEA 1NM3A 1Z6MA 3FZ5A 2VUPA 1SU9A 3V1WA 2DJ1A 1S3CA 5A5KA 2R0PA 1Z3EA 2H1DA 5D96A 2ZCTA 1AIUA 4G19A 4NV5A 2C4JA 4F0BA 4G0KA 2IFQA 2MZCA 2GT5A 2MBSA 2ZUPA 3KXOA 1V98A 2E0QA 5GAPD 5IPGA 3HZ4A 3CYNA 3CTFA 2L6DA 3LJRA 3HJPA 2H0IA 2MYGA 4N0VA 3TKSA 1J0FA 1DSBA 5KN0A 4KCEA 1OVNA 3KD0A 1RK4A 1A2LA 3PR8A 4PQHA 3CXGA 4XRAA 2CT6A 2CVKA 1WIKA 5DAKA 1M7TA 4YQMA 3PPUA 1QXHA 4WR4A 3TJBA 3AY8A 2C0DA 5J9BA 3L9SA 2DJJA 1N2AA 4GQFA 2IMDA 5DCHA 5HR0A 2WJUA 1SKSB 1K0BA 2J23A 1M9BA 5DQYA 1PL1A 1ST9A 1V57A 17GSA 1WWJA 1ZYNA 4J2FA 6GSVA 1UA5A 3C71A 1K0AA 2EIOA 4TOPA 4GRFA 4HOJA 1OYJA 5CAXA 4EO3A 5D73A 4HZ4A 2HNLA 1MTCA 1SL0B 4NHWA 2HRNA 1OC9A 3A5IA 3CBUA 3GL3A 2LRTA 3IAS2 2VL9A 1SL2B 5FWGA 5G1LA 2KLXA 2EIRA 3WT1A 3BD2A 4ML1A 4MH2A 3QOUA 5B6MA 4OO5A 3UAPA 3E3EA 5HFIA 4POKA 3PH9A 1G6WA 1FOVA 3UBKA 1M2BA 3D22A 3SWLA 2LJAA 1X5EA 5J4UA 3JCML 2GGTA 1SJ6A 4JRRA 2YWIA 4KNDA 4ECJA 3UEMA 2H6ZA 1JZDA 1B4PA 3FZ4A 4I2TA 1BQ7A 5G5EA 3FR6A 3CSIA 2GZYA 3QAVA 5HR2A 4O5QA 2I3YA 5GSSA 3WD6A 4TR4A 3BCIA 4KH7A 5ECIB 3DVXA 1JZOA 3I43A 2JZSA 3GL5A 3QAWA 2H75A 2FLSA 5ECRB 2LJKA 3D6IA 3TRXA 1F3BA 4HJMA 2NDOA 3PGTA 1H75A 2VO4A 3TKQA 2REMA 1C72A 2PPTA 3GKKA 1EV4A 1U88A 2DIYA 2X99A 3VWUA 1EGOA 3F0IA 3LEFA 5J41A 5H5QA 2H66A 2I9HA 3VI7A 1JHBA 2L4CA 1TP9A 3IV4A 1SK0A 2GDRA 5G31A 2G0FA 2LNSA 4AJ6A 5JWQB 4I8BA 4XCSA 2K8SA 3H8QA 3IXRA 1VGLA 4BL7A 1PA3A 2YV7A 2H0HA 3KIJA 1O7UA 1VF4A 3VK9A 4K9ZA 3S9FA 3QPMA 2B7JA 2WRTA 4OFTA 4JZQA 4BVXB 1AUCA 4WEYA 2MMZA 1TRSA 4AJ7A 1PGTA 4I97A 14GSA 2RM6A 4G0IA 3GH6A 2GS3A 5F05A 3KMOA 1EEMA 2VLUA 3LSZA 5HR3A 3KP9A 5AIXA 1V9WA 3QFBC 1GNWA 2V1MA 1QQ2A 4KA0A 1ZL9A 3RHBA 4XS6A 1YKCA 2HRFA 4TXOB 3VWXA 1ABAA 4IVFA 2WULA 1A2MA 4FYCA 2AYTA 2LRCA 16GSA 1FB0A 5E59A 2B1KA 2DIZA 3GTUA 3A2WA 2EIQA 4KDXA 4WF4A 3KH7A 5COHA 4EE0A 3K8NA 4DSRA 4PXOA 2C0GA 3IPZA 1A8LA 2YWMA 3KMNA 2R0GA 2VCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF2 A;  3KEB A;  1OKD A;  4YH2 A;  1YEX A;  4JR6 A;  3F6F A;  2DML A;  4WET A;  3F4R A;  1WP0 A;  4Q5N A;  3KJY A;  4IJI A;  3RPP A;  1PL2 A;  1GNE A;  4XS1 A;  1HQO A;  1YF1 A;  4NPB A;  1JLV A;  3BCK A;  4I2U A;  3WGE A;  2A2S A;  3CRU A;  1F2E A;  3HKR A;  22GS A;  2H0G A;  5ECP B;  1G7E A;  1UC7 A;  3FZ9 A;  3IBH A;  4BA7 A;  1PX7 A;  2IWT A;  1RW1 A;  1NHO A;  3KCM A;  5G1K A;  4NV2 A;  1WOU A;  3I6A A;  1EEJ A;  4GSN A;  5FHI A;  3FY7 A;  3M8N A;  2CAI A;  4PQ1 A;  2H01 A;  2IIY A;  2KP2 A;  3I69 A;  3UVT A;  5D9T A;  4XRD A;  5G2Z A;  2FD3 A;  4LL1 B;  1ILO A;  1ON4 A;  2DC5 A;  1M9A A;  1GSS A;  1E6B A;  4XS4 A;  2F8A A;  4L8E A;  1VF1 A;  3MWH A;  1K0C A;  2K6V A;  4KCA A;  3CSH A;  1XFL A;  5B6N A;  1GSU A;  3F8U A;  3DGQ A;  5DAL B;  2F9S A;  4DSS A;  3I9V 2;  4K2D A;  3M1G A;  2NBS A;  3GX8 A;  2B5Y A;  4IN0 A;  4DSQ A;  1B4Q A;  1K0D A;  2DJK A;  2PUK C;  4KGI A;  5JCG A;  2PN8 A;  4X0X A;  5CRG A;  4FH8 A;  1XOB A;  1ACV A;  3MNG A;  3P2A A;  3VPT A;  3HZ8 A;  3MAK A;  2V2G A;  3P90 A;  18GS A;  1GTB A;  5F0G A;  3FW2 A;  4EVM A;  2MBT A;  3LWA A;  1GTA A;  4PQI A;  1LBK A;  4ECI A;  3L0H A;  2C1Y A;  3HHV A;  2BMX A;  4G10 A;  5AGY A;  4HQZ A;  2VD0 A;  5ECQ B;  5H5R A;  1DBY A;  3GA4 A;  2L57 A;  5HR1 A;  3LG6 A;  1FB6 A;  2I81 A;  1F37 A;  3HYP A;  9GSS A;  1YF0 A;  2E2G A;  3DXB A;  3E9J B;  2NPB A;  3ZIJ A;  2IMK A;  3HY2 A;  4MH3 A;  3A3T A;  3HDC A;  1K3O A;  3LYK A;  4IGJ A;  4V1A p;  1Z5Y E;  3F6D A;  2LST A;  3IAM 2;  5IMA A;  2L59 A;  3LXT A;  4IP1 A;  1TJD A;  4GQC A;  4HS1 A;  7GSS A;  2FHE A;  1A8Y A;  1M2D A;  5IOX A;  3DEX A;  4IQ1 A;  2CZ2 A;  3LXZ A;  4OCF A;  3DYR A;  4TVE A;  4RQR A;  1XVW A;  2ALB A;  2CZ3 A;  1N8J A;  5CRD A;  4ZB8 A;  3WYW A;  2IME A;  3LYP A;  1XIY A;  1XW9 A;  3FR9 A;  5IIZ A;  4KAE A;  5CO3 A;  4V1A g;  4HZ2 A;  2C0F A;  2VOC A;  2YJ7 A;  4QL9 A;  3GYK A;  1ZCP A;  3ZVJ D;  1V58 A;  1GH2 A;  1R7H A;  4ZL8 A;  2R37 A;  1J9B A;  2B5E A;  1FVJ A;  1Y6E A;  4IEL A;  1YJ6 A;  5CYY A;  2L6C A;  1CQH A;  3G7I A;  1ZYE A;  4GCI A;  1TK5 B;  5DCG A;  1XCC A;  1T8E B;  3F3R A;  3TJK A;  2YWO A;  1U6T A;  3Q18 A;  2H71 A;  2VIM A;  1GWC A;  4PUR A;  4HU9 A;  4MK3 A;  1OE8 A;  5EVO A;  4D73 B;  3FR3 A;  5B8B A;  4ZL7 A;  5IQY A;  3ZFB A;  4RI6 A;  2HSH A;  4LMV A;  2HI7 A;  5B8A A;  4MP4 A;  1TI1 A;  2CVB A;  1WJK A;  3Q19 A;  3D21 A;  4MF5 A;  2G2Q A;  2YCD A;  2H1G A;  1GTI A;  1Y25 A;  1A24 A;  3EMX A;  2GVP A;  2YNX A;  1EOH A;  1QK8 A;  2JAD A;  1SKR B;  3ERW A;  2O85 A;  1X5C A;  3TGZ A;  2VAF A;  2VL2 A;  3IC4 A;  4XHM A;  4LL4 B;  2X8G A;  3P7X A;  3ZMK A;  1SD8 A;  4ACS A;  4BVX A;  3DIE A;  2C3Q A;  1HYU A;  3J7Y k;  1Z7P A;  3RPN A;  1FW1 A;  2FWF A;  4QL7 A;  3APQ A;  4O7H A;  3CTG A;  4TR0 A;  1Z7R A;  1K0O A;  3M3M A;  4RQX A;  3GKN A;  5GZZ B;  3KGK A;  2V41 A;  2GST A;  3GSS A;  4ZB9 A;  3LGC A;  3OR5 A;  5KN3 A;  1K3Y A;  2VCQ A;  1M0U A;  2VLV A;  3TKP A;  4CHS A;  1OC8 A;  3HVV A;  4TXO A;  3E0U A;  4PNG A;  5B7C A;  4IKH A;  2CV4 A;  2VM2 A;  2AHE A;  3VFI A;  3F3Q A;  4AGS A;  4OO4 A;  4ECB A;  3CMI A;  5JWO B;  3D5J A;  1UVZ A;  2AAW A;  4YQV A;  1BAY A;  3EC3 A;  4DEJ A;  3M0F A;  2JSZ A;  3IRA A;  4EUY A;  4HI7 A;  3SBC A;  2RUE A;  5INY A;  1OC3 A;  2YP6 A;  5F07 A;  4WBR D;  3W8S A;  2F51 A;  3J7Y b;  2OBI A;  2JU5 A;  1AAZ A;  2GZZ A;  5CP1 A;  1O8W A;  4TW5 A;  2HZE B;  1XWK A;  4ULX A;  1OE7 A;  2DJ3 A;  3HVX A;  3UMA A;  4K7N A;  2E7P A;  6GSU A;  2PWJ A;  2WGR A;  3DD3 A;  5ECH B;  1A0F A;  3EU3 A;  4MF7 A;  2IN3 A;  2AJQ B;  2LEG A;  5CRH A;  2H6Y A;  1SYX A;  4GLT A;  1TDI A;  3LQ7 A;  1FHE A;  5DBQ A;  1DUG A;  1M2A A;  1TK8 B;  4KSM A;  3MDK A;  2TRC P;  6GSW A;  3KTL A;  4LA1 A;  3IA1 A;  3GKX A;  1ERT A;  4KUN A;  4HDE A;  1IYI A;  4TR1 B;  2XBQ A;  5G30 A;  4MCU A;  1FO5 A;  13GS A;  2P31 A;  3H1N A;  1I9D A;  2N5A A;  3RBT A;  4BWS A;  2HYX A;  2P5R A;  5ELA A;  3F9U A;  2A4V A;  5DDL A;  4GST A;  1MEK A;  5DAL A;  3EE2 A;  1THX A;  3ZIV A;  2VL3 A;  2I1U A;  2RLI A;  1QGV A;  3ED3 A;  2KP1 A;  4IP6 A;  3TB2 A;  5J3R A;  2RUF A;  2BJX A;  1T4Y A;  3UBL A;  1TOF A;  2VD1 A;  3L9U A;  5AIS A;  1R4W A;  4EC0 A;  4V2N A;  1EOG A;  5D9W A;  1J08 A;  1VRS D;  3GMF A;  2FCH A;  4F03 A;  3GUS A;  1HNA A;  1GSF A;  3TDG A;  2M46 A;  2AB6 A;  1AXD A;  2VL2 C;  4Q5Q A;  3FK8 A;  2GSQ A;  1O6J A;  1ML6 A;  1TRU A;  1OKT A;  5KN1 A;  3FKF A;  3QDN A;  3VI5 A;  20GS A;  1EV9 A;  1KEB A;  2YN1 A;  4ID0 A;  3UJ1 A;  2LJR A;  5EY6 A;  1Z9H A;  1PX6 A;  3ZYW A;  3C1S A;  1X5D A;  2X8C A;  3M9J A;  5LNK e;  5E4W A;  2AV4 A;  1TXX A;  2B5X A;  3A2V A;  4I5Q A;  2RII A;  1YZX A;  4HJ2 A;  3IDV A;  2V32 A;  4KDU A;  1GUM A;  4GSS A;  4BPY A;  5DJL A;  3D4T A;  1YQ1 A;  1CQG A;  4GF0 A;  2K8V A;  3BBY A;  3U5R E;  4POL A;  1AW9 A;  3GIX A;  1GSY A;  2P0G A;  1YKA A;  1Q98 A;  4MZB A;  2GLR A;  5HFK A;  3TKR A;  5C04 A;  4Q5F A;  3TOU A;  2ON5 A;  1W89 A;  4WKW A;  3QD9 A;  1EZK A;  4RUV A;  1G6Y A;  3GN3 A;  1Q4J A;  3ME7 A;  1TK0 B;  4PX1 A;  3TUE A;  4KB3 A;  5IMZ A;  4N11 A;  4MA9 A;  5IO2 A;  2LTK A;  1TTZ A;  1PSQ A;  4H86 A;  3Q74 A;  1PKZ A;  1Z6N A;  4MF6 A;  1ERU A;  2B3S A;  2PVQ A;  4IQA A;  5ELG A;  1GL8 A;  1WRY A;  2Z9S A;  3DVW A;  4V2M A;  2DBC A;  3RDW A;  2FY6 A;  4MLY A;  3R2Q A;  2JZR A;  4F2I A;  4D73 A;  1FG4 A;  4K8M A;  1XBS A;  2N5F A;  3DRN A;  2XHF A;  4AJ8 A;  2E2M A;  4OCE A;  2KUC A;  4N0Z A;  5IM9 A;  3VUR A;  2HE3 A;  2JSY A;  4K1F A;  1AQV A;  1AQX A;  4E8E A;  2GTU A;  5A4V A;  1MD4 A;  1S3A A;  3TKS E;  1KBN A;  2OA7 A;  1LJR A;  2H19 A;  2YWN A;  4OFN A;  3FEU A;  1YDK A;  4MDC A;  1SYR A;  3UL3 A;  1SK1 A;  1XZO A;  2X8H A;  2YPM A;  2O8V B;  3C1R A;  1ERV A;  1GUH A;  2DSA A;  3QR6 A;  4L0W A;  4K7O A;  1PN9 A;  1F3A A;  2H1A A;  4QQ7 A;  4BVY A;  4IBP A;  4HU7 A;  1FVK A;  3P8W A;  3ME8 A;  2CAQ A;  3ZFL A;  3C73 A;  5JCW A;  2XBI A;  1ZYQ B;  2LRN A;  2R6K A;  2H70 A;  2TRX A;  2JAC A;  2R5G A;  2H72 A;  2O89 A;  3GTU B;  4MJB A;  3WGD A;  1TU8 A;  1F9M A;  1XWA A;  3FYG A;  1T00 A;  4JR4 A;  2OE1 A;  3TJJ A;  5D8I A;  4WR5 A;  1WE0 A;  4V2L A;  3GUR A;  4TRX A;  2B6M A;  4G2E A;  3GNJ A;  4KX4 A;  3TJF A;  4MZC A;  11GS A;  3N9J A;  3HD5 A;  3KTB A;  1USB A;  2CX3 A;  1MDK A;  2C8U A;  2BTO T;  3NOF A;  1T3B A;  1JZW A;  1BED A;  2DMM A;  3UAR A;  2L5O A;  2JL4 A;  4KE3 A;  1XOA A;  3HJO A;  5ABR A;  1TU7 A;  1XW5 A;  2O7K A;  2V6K A;  2IMI A;  4EKZ A;  2FUG 2;  1K0N A;  3Q6O A;  4POB A;  4JBB A;  1A23 A;  4EF0 A;  1TRV A;  1B9X C;  1B8X A;  1K0M A;  1S3D A;  5LD0 A;  1X9M B;  2J9H A;  1NW2 A;  3L4N A;  4NHZ A;  1O73 A;  2AUV A;  12GS A;  3TRP A;  5LCZ A;  2LS5 A;  4O5R A;  4XS4 B;  4TR3 A;  3F4S A;  3HVS A;  2PBJ A;  1EP8 A;  5HQP A;  2WFC A;  2LUS A;  3QCP A;  1GSQ A;  1XXU A;  4J57 E;  3BJ5 A;  2NVL A;  4TR1 A;  5EPF A;  4DSS B;  5A4W A;  1SEN A;  8GSS A;  5D9X A;  1XPV A;  4ZBD A;  3VPQ A;  2HXK A;  5IOW A;  3A2X A;  1A0R P;  1XVQ A;  4JU5 A;  1PD2 1;  2YAN A;  1R5A A;  2CVD A;  3GST A;  2MMA A;  5IMF A;  3UOM A;  4EDY A;  3TCO A;  4ILF A;  2DJ2 A;  1GSE A;  5ECM B;  3UIW A;  4OMV A;  5ID2 B;  5A4U A;  2PER A;  1GLP A;  3IE3 A;  3APS A;  3ZRD A;  5L71 A;  4O92 A;  3QMX A;  3GRX A;  3F63 A;  1XWC A;  4ZB6 A;  6GST A;  1B48 A;  1V2A A;  3G9B A;  3DKS A;  3DML A;  3RHC A;  2M80 A;  1NHY A;  2CX4 A;  5CRW A;  4N10 A;  3EYT A;  3MSZ A;  1GUL A;  2VCV A;  3A5W A;  1O85 A;  1ZZY A;  6GSS A;  2HSY A;  2C0E A;  4IW9 A;  3TJG A;  4FYU A;  1HNC A;  2OJL A;  3VWW A;  2HFD A;  1H4O A;  3ISO A;  3H79 A;  2HT9 A;  5ECS A;  2NTO A;  1PKW A;  3GKM A;  6GSY A;  5ECO B;  2OBK A;  4F82 A;  1MD3 A;  2LKU A;  1XW6 A;  5EL8 A;  4F0C A;  2FA8 A;  4K6X A;  2H8L A;  2YZH A;  2VCX A;  1XWB A;  4IJ3 A;  4TN8 A;  2F8F A;  4ZBB A;  4Q5R A;  1W4V A;  1G0T A;  2LQO A;  1QFN A;  2GSS A;  2IMF A;  2LNT A;  4HQS A;  2LV3 A;  1OAZ A;  1PRX A;  4WXT A;  3U6V A;  3ZVJ A;  4X1U A;  2X64 A;  4K0G A;  5F06 A;  5GST A;  5JWR B;  1V40 A;  4PGT A;  1M99 A;  4HEA 2;  4ZBA A;  4FIW A;  4XTS A;  1RQM A;  5C00 A;  2RM5 A;  4CW9 A;  1TW9 A;  5KN2 A;  4X43 A;  1GSD A;  3TRQ A;  2D2Z A;  2L4Q A;  4RI7 A;  4MAB A;  5JCU A;  4G9H A;  4ZXG A;  2IFQ B;  2FGX A;  2C3T A;  2HZF A;  4EXJ A;  4IHU A;  2CQ9 A;  1ZMA A;  4F9Z A;  4YAV A;  5D9V A;  2ES7 A;  5IPH A;  4JE1 A;  4IS0 A;  1B9Y C;  3W6G A;  2EC4 A;  2FNO A;  2M72 A;  4L5L A;  5IMD A;  2TIR A;  2CA8 A;  4ZIL A;  1IYH A;  2ON7 A;  4NAX A;  1NSW A;  1G7O A;  2GQK A;  2DJ0 A;  1EGR A;  1X0R A;  5DAK B;  4K7I A;  4MJE A;  5D93 A;  1ERW A;  4FYB A;  2H74 A;  3EUR A;  3L78 A;  1R5P A;  2XPD A;  2FWG A;  3KP8 A;  4LLR A;  2FWH A;  2H76 A;  3RAZ A;  1JFU A;  4TKY A;  1I5G A;  2VM1 A;  1URM A;  2FWE A;  4MMM A;  3TKS C;  3L9V A;  4KW6 A;  2R4V A;  3H93 A;  2H1B A;  2O87 A;  3GHA A;  4XIH A;  4ML6 A;  5H5S A;  1SL1 B;  2IL3 A;  1DE1 A;  5FT3 A;  4L0U A;  4MJA A;  2N5B A;  5CRE A;  3GX0 A;  4POM A;  3O3T A;  3H4K A;  2QC7 A;  2WB9 A;  2FA4 A;  3HA9 A;  1VF3 A;  1T7P B;  3UVH A;  1FAA A;  2B1L A;  10GS A;  2OE3 A;  2XPE A;  4KSO A;  1OC9 B;  3APO A;  2QKE A;  1YY7 A;  1HD2 A;  3D0Z A;  1BX9 A;  1F6M C;  2V6O A;  1TKD B;  2MMO A;  1TI3 A;  4PNF A;  1SK2 A;  1KTE A;  2F3M A;  2P5Q A;  1X9S B;  1O81 A;  4PUA A;  2C80 A;  2QSI A;  1ZGN A;  2OAC A;  2PGT A;  2YJH A;  1BYE A;  3C7M A;  3IOS A;  1K3L A;  3ZZX A;  5AN1 A;  2GSR A;  2L5L A;  2YZU A;  4MPG A;  3KZQ A;  3CRT A;  4PUF C;  2K9F A;  5DJM A;  3KH9 A;  4ISD A;  1PMT A;  2C3N A;  3HJM A;  3VLN A;  2OAD A;  4NMU A;  3EWL A;  3DWV A;  4ECC A;  3ERG A;  2JZT A;  3G7Y A;  5GAN D;  1TRW A;  3BOA A;  3VWV A;  3ZLP A;  4GTU A;  4MZW A;  2R2J A;  5ECN B;  4EL1 A;  3IHQ A;  4WBJ A;  1T1V A;  3IR4 A;  2GT6 A;  3EU4 A;  1GP1 A;  3ZML A;  3C8E A;  1U3I A;  3WGX A;  4EDZ A;  4OD7 A;  2IPA A;  3EVI A;  19GS A;  2VCT A;  2K18 A;  1QMV A;  2H6X A;  3W8J A;  5J9C A;  1HNB A;  5DVB A;  3N5O A;  3M9K A;  2GQM A;  3CSJ A;  4GWR A;  3O76 A;  4AF2 A;  1X9W B;  2OKA A;  2WS2 A;  2QGV A;  1EP7 A;  3IK9 A;  2GZP A;  1XWG A;  3US3 A;  5ENU A;  4J56 E;  2DLX A;  2WCI A;  1AC1 A;  1ZOF A;  1SKW B;  3TOT A;  2R3X A;  1MDJ A;  3QFA C;  3ERF A;  1THO A;  3PIN A;  5IMC A;  3ZIT A;  4MJC A;  4L5O A;  4YAP A;  3ZRE A;  4BWQ A;  3F4T A;  1JLW A;  4Z7X A;  4OFM A;  4NXI A;  4TXV A;  3LOR A;  5DQS A;  4P3Y B;  5G5F A;  1BJX A;  1GLQ A;  2KOK A;  2PMT A;  3G7J A;  3HCZ A;  5KEJ A;  2YV9 A;  2I4A A;  3GV1 A;  3IK7 A;  3O6T A;  2PVO C;  6GSX A;  3ZTL A;  4JED A;  5ID2 A;  1WMJ A;  1GTU A;  1DE2 A;  1T4Z A;  1MDI A;  1SJZ A;  1E2Y A;  2VLT A;  3FHK A;  4OWY A;  1R26 A;  2MMN A;  3ZL5 A;  1YEP A;  3D4M A;  1UN2 A;  3KM6 A;  1SJI A;  1AQW A;  4YQU A;  1LU4 A;  4K0N A;  4DVC A;  5F8B A;  4ZIJ A;  2LQQ A;  4LMW A;  1PQN A;  2PU9 C;  3EMP A;  4HUA A;  3EIN A;  3GH9 A;  5IO0 A;  1BG5 A;  5J5N A;  2B7K A;  3LFL A;  5ECL B;  3GFK A;  4GXZ A;  5ECK B;  3NZN A;  2XC2 A;  1KNG A;  1QUW A;  2H73 A;  2VCW A;  3QAG A;  3FZA A;  1GUK A;  4MPF A;  5CNW A;  1WPI A;  5AIV A;  5HFG A;  1SD9 A;  2YOI A;  1U3A A;  1O8X A;  1A2J A;  2HLS A;  3NIV A;  4I6X A;  3WT2 A;  2IJY A;  1JZR A;  2H30 A;  4KDY A;  1GRX A;  4O32 A;  4N30 A;  2GQL A;  2ZNM A;  2KHP A;  2OE0 A;  4FO5 A;  2WZ9 A;  4E8H A;  4NWY A;  5IMV A;  4ZL9 A;  1U87 A;  3HXS A;  3FRC A;  2A2R A;  2WDU A;  4CDO A;  4WF5 A;  1EWX A;  2HZE A;  1NM3 A;  1Z6M A;  3FZ5 A;  2VUP A;  1SU9 A;  3V1W A;  2DJ1 A;  1S3C A;  5A5K A;  1Z3E A;  2H1D A;  5D96 A;  2ZCT A;  1AIU A;  4G19 A;  4NV5 A;  2C4J A;  4F0B A;  2IFQ A;  2MZC A;  2GT5 A;  2MBS A;  2ZUP A;  3KXO A;  1V98 A;  2E0Q A;  5GAP D;  5IPG A;  3HZ4 A;  3CYN A;  3CTF A;  2L6D A;  3LJR A;  3HJP A;  2H0I A;  2MYG A;  4N0V A;  3TKS A;  1J0F A;  1DSB A;  5KN0 A;  4KCE A;  1OVN A;  3KD0 A;  1RK4 A;  1A2L A;  3PR8 A;  4PQH A;  3CXG A;  4XRA A;  2CT6 A;  2CVK A;  1WIK A;  5DAK A;  1M7T A;  4YQM A;  1QXH A;  4WR4 A;  3TJB A;  3AY8 A;  2C0D A;  5J9B A;  3L9S A;  2DJJ A;  1N2A A;  4GQF A;  2IMD A;  5DCH A;  5HR0 A;  2WJU A;  1SKS B;  1K0B A;  2J23 A;  1M9B A;  5DQY A;  1PL1 A;  1ST9 A;  1V57 A;  17GS A;  1WWJ A;  4J2F A;  6GSV A;  1UA5 A;  3C71 A;  1K0A A;  2EIO A;  4TOP A;  4GRF A;  4HOJ A;  1OYJ A;  5CAX A;  4EO3 A;  5D73 A;  4HZ4 A;  2HNL A;  1MTC A;  1SL0 B;  4NHW A;  2HRN A;  1OC9 A;  3CBU A;  3GL3 A;  2LRT A;  3IAS 2;  2VL9 A;  1SL2 B;  5FWG A;  5G1L A;  2KLX A;  2EIR A;  3WT1 A;  3BD2 A;  4ML1 A;  4MH2 A;  3QOU A;  5B6M A;  4OO5 A;  3UAP A;  3E3E A;  5HFI A;  4POK A;  3PH9 A;  1G6W A;  1FOV A;  3UBK A;  1M2B A;  3D22 A;  3SWL A;  2LJA A;  1X5E A;  5J4U A;  3JCM L;  2GGT A;  1SJ6 A;  4JRR A;  2YWI A;  4KND A;  4ECJ A;  3UEM A;  2H6Z A;  1JZD A;  1B4P A;  3FZ4 A;  4I2T A;  1BQ7 A;  5G5E A;  3FR6 A;  3CSI A;  2GZY A;  3QAV A;  5HR2 A;  2I3Y A;  5GSS A;  3WD6 A;  4TR4 A;  3BCI A;  4KH7 A;  5ECI B;  3DVX A;  1JZO A;  3I43 A;  2JZS A;  3GL5 A;  3QAW A;  2H75 A;  2FLS A;  5ECR B;  2LJK A;  3D6I A;  3TRX A;  1F3B A;  4HJM A;  2NDO A;  3PGT A;  1H75 A;  2VO4 A;  3TKQ A;  2REM A;  1C72 A;  2PPT A;  3GKK A;  1EV4 A;  1U88 A;  2DIY A;  2X99 A;  3VWU A;  1EGO A;  3F0I A;  3LEF A;  5J41 A;  5H5Q A;  2H66 A;  2I9H A;  3VI7 A;  1JHB A;  2L4C A;  1TP9 A;  3IV4 A;  1SK0 A;  2GDR A;  5G31 A;  2G0F A;  2LNS A;  4AJ6 A;  5JWQ B;  4I8B A;  4XCS A;  2K8S A;  3H8Q A;  3IXR A;  1VGL A;  4BL7 A;  1PA3 A;  2YV7 A;  2H0H A;  3KIJ A;  1O7U A;  1VF4 A;  3VK9 A;  4K9Z A;  3S9F A;  3QPM A;  2B7J A;  2WRT A;  4OFT A;  4JZQ A;  1AUC A;  4WEY A;  2MMZ A;  1TRS A;  4AJ7 A;  1PGT A;  4I97 A;  14GS A;  2RM6 A;  3GH6 A;  2GS3 A;  5F05 A;  3KMO A;  1EEM A;  2VLU A;  3LSZ A;  5HR3 A;  3KP9 A;  5AIX A;  1V9W A;  3QFB C;  1GNW A;  2V1M A;  1QQ2 A;  4KA0 A;  1ZL9 A;  3RHB A;  4XS6 A;  1YKC A;  2HRF A;  4TXO B;  3VWX A;  1ABA A;  4IVF A;  2WUL A;  1A2M A;  4FYC A;  2AYT A;  2LRC A;  16GS A;  1FB0 A;  5E59 A;  2B1K A;  2DIZ A;  3GTU A;  3A2W A;  2EIQ A;  4KDX A;  4WF4 A;  3KH7 A;  5COH A;  4EE0 A;  3K8N A;  4DSR A;  4PXO A;  2C0G A;  3IPZ A;  1A8L A;  2YWM A;  3KMN A;  2VCZ A; 
#chains in the Genus database with same CATH topology
 1VF2 A;  3KEB A;  1OKD A;  4YH2 A;  1YEX A;  4JR6 A;  3F6F A;  2DML A;  4MNN A;  4WET A;  3F4R A;  1WP0 A;  4Q5N A;  3KJY A;  4IJI A;  3RPP A;  1PL2 A;  1GNE A;  4XS1 A;  1HQO A;  1YF1 A;  4NPB A;  1JLV A;  3BCK A;  4I2U A;  3WGE A;  2A2S A;  3CRU A;  1F2E A;  4YKG A;  3HKR A;  22GS A;  2H0G A;  5ECP B;  1G7E A;  1UC7 A;  3FZ9 A;  3IBH A;  4BA7 A;  1PN0 A;  1PX7 A;  2IWT A;  1RW1 A;  4EIQ A;  1NHO A;  3KCM A;  5G1K A;  3FMW A;  4NV2 A;  1WOU A;  3I6A A;  1EEJ A;  4GSN A;  5FHI A;  3FY7 A;  3M8N A;  2CAI A;  4PQ1 A;  2H01 A;  2IIY A;  2KP2 A;  3I69 A;  3UVT A;  5D9T A;  4XRD A;  5G2Z A;  2FD3 A;  4LL1 B;  1ILO A;  1ON4 A;  2DC5 A;  1M9A A;  1GSS A;  1E6B A;  4XS4 A;  2F8A A;  4L8E A;  1VF1 A;  3MWH A;  1K0C A;  2K6V A;  4KCA A;  3CSH A;  1XFL A;  5B6N A;  1GSU A;  3F8U A;  3DGQ A;  5DAL B;  2F9S A;  3IC8 A;  4DSS A;  3I9V 2;  4K2D A;  3M1G A;  2NBS A;  3GX8 A;  2B5Y A;  4IN0 A;  4DSQ A;  1B4Q A;  1K0D A;  2DJK A;  2PUK C;  4KGI A;  5JCG A;  2PN8 A;  4X0X A;  5CRG A;  4FH8 A;  1XOB A;  1ACV A;  3MNG A;  3P2A A;  3VPT A;  4CY8 A;  3HZ8 A;  3MAK A;  2V2G A;  3P90 A;  18GS A;  1GTB A;  5F0G A;  3FW2 A;  4EVM A;  2MBT A;  2HRA A;  3LWA A;  1GTA A;  4PQI A;  1LBK A;  4ECI A;  3L0H A;  2C1Y A;  3HHV A;  2BMX A;  4G10 A;  5AGY A;  4HQZ A;  2VD0 A;  5ECQ B;  5H5R A;  1DBY A;  3GA4 A;  2L57 A;  5HR1 A;  3LG6 A;  1FB6 A;  2I81 A;  1F37 A;  3HYP A;  9GSS A;  1YF0 A;  2E2G A;  3DXB A;  3E9J B;  2NPB A;  3ZIJ A;  2IMK A;  3HY2 A;  4MH3 A;  3A3T A;  3HDC A;  1K3O A;  3LYK A;  4IGJ A;  4V1A p;  1Z5Y E;  3F6D A;  2LST A;  3IAM 2;  5IMA A;  2L59 A;  3LXT A;  4IP1 A;  1TJD A;  4GQC A;  4HS1 A;  7GSS A;  2FHE A;  1A8Y A;  1M2D A;  5IOX A;  3DEX A;  4IQ1 A;  2CZ2 A;  3LXZ A;  4OCF A;  3DYR A;  4TVE A;  4RQR A;  1XVW A;  2ALB A;  2CZ3 A;  3MIX A;  1N8J A;  5CRD A;  4ZB8 A;  3WYW A;  2IME A;  3LYP A;  1XIY A;  1XW9 A;  2X4A A;  3FR9 A;  5IIZ A;  4KAE A;  5CO3 A;  4V1A g;  2A4H A;  4HZ2 A;  2C0F A;  2VOC A;  2YJ7 A;  4QL9 A;  3GYK A;  1ZCP A;  3ZVJ D;  1V58 A;  1GH2 A;  1R7H A;  4ZL8 A;  2R37 A;  1J9B A;  2B5E A;  1FVJ A;  1Y6E A;  4IEL A;  1YJ6 A;  5CYY A;  2L6C A;  1CQH A;  3G7I A;  1ZYE A;  4GCI A;  1TK5 B;  5DCG A;  1XCC A;  1T8E B;  3F3R A;  3TJK A;  2YWO A;  1U6T A;  3Q18 A;  2H71 A;  2VIM A;  1GWC A;  4PUR A;  4HU9 A;  4MK3 A;  1OE8 A;  5EVO A;  4D73 B;  3FR3 A;  5B8B A;  4ZL7 A;  5IQY A;  3ZFB A;  4RI6 A;  2HSH A;  4LMV A;  4HSC X;  2HI7 A;  5B8A A;  4MP4 A;  1TI1 A;  2CVB A;  1WJK A;  3Q19 A;  3D21 A;  4MF5 A;  2G2Q A;  2YCD A;  2H1G A;  1GTI A;  1Y25 A;  1A24 A;  5BRT A;  3EMX A;  2GVP A;  2YNX A;  1EOH A;  1QK8 A;  2JAD A;  1SKR B;  2HRK A;  3ERW A;  2O85 A;  1X5C A;  3TGZ A;  2VAF A;  2VL2 A;  3IC4 A;  4XHM A;  4LL4 B;  2X8G A;  3P7X A;  3ZMK A;  1SD8 A;  4ACS A;  4BVX A;  3DIE A;  2C3Q A;  1HYU A;  3J7Y k;  4BVY B;  1Z7P A;  3RPN A;  1FW1 A;  2FWF A;  4QL7 A;  3APQ A;  4O7H A;  3CTG A;  4TR0 A;  1Z7R A;  1K0O A;  3M3M A;  4RQX A;  3GKN A;  5GZZ B;  3KGK A;  2V41 A;  2GST A;  3GSS A;  4ZB9 A;  3LGC A;  3OR5 A;  5KN3 A;  1K3Y A;  2VCQ A;  1M0U A;  2VLV A;  3TKP A;  4CHS A;  1OC8 A;  3HVV A;  4TXO A;  3E0U A;  4PNG A;  5B7C A;  4IKH A;  2CV4 A;  2VM2 A;  2AHE A;  3VFI A;  3F3Q A;  4AGS A;  4Z2T A;  4OO4 A;  4ECB A;  3CMI A;  5JWO B;  3D5J A;  1UVZ A;  4FQU A;  2AAW A;  4YQV A;  1BAY A;  3EC3 A;  4DEJ A;  3M0F A;  2JSZ A;  3IRA A;  4EUY A;  4HI7 A;  3SBC A;  2RUE A;  5INY A;  2X49 A;  1OC3 A;  2YP6 A;  2QA2 A;  5F07 A;  4WBR D;  3W8S A;  2F51 A;  4KF9 A;  3J7Y b;  2OBI A;  2JU5 A;  1AAZ A;  2GZZ A;  5CP1 A;  1O8W A;  4TW5 A;  2HZE B;  1XWK A;  4ULX A;  1OE7 A;  2DJ3 A;  3HVX A;  3UMA A;  4K7N A;  2E7P A;  6GSU A;  2PWJ A;  2WGR A;  3DD3 A;  5ECH B;  1A0F A;  3EU3 A;  4MF7 A;  2IN3 A;  2AJQ B;  2LEG A;  5CRH A;  2H6Y A;  1SYX A;  4GLT A;  1TDI A;  3LQ7 A;  1FHE A;  4CY6 A;  5DBQ A;  1DUG A;  1M2A A;  1TK8 B;  4KSM A;  4Z2U A;  3MDK A;  2TRC P;  6GSW A;  3KTL A;  4LA1 A;  3IA1 A;  3GKX A;  1ERT A;  4KUN A;  4HDE A;  1IYI A;  4TR1 B;  2XBQ A;  5G30 A;  4MCU A;  1FO5 A;  13GS A;  2P31 A;  3H1N A;  1I9D A;  2N5A A;  3RBT A;  4BWS A;  2HYX A;  1M3J A;  2P5R A;  5ELA A;  3F9U A;  2A4V A;  5DDL A;  4A5P A;  4GST A;  1MEK A;  5DAL A;  3EE2 A;  1THX A;  3ZIV A;  2VL3 A;  2I1U A;  2RLI A;  1QGV A;  3ED3 A;  2KP1 A;  4IP6 A;  3TB2 A;  5J3R A;  2RUF A;  2BJX A;  1T4Y A;  3UBL A;  1TOF A;  1S3R A;  2VD1 A;  3L9U A;  5AIS A;  1R4W A;  4EC0 A;  4V2N A;  1EOG A;  5D9W A;  1J08 A;  1VRS D;  3IHG A;  3GMF A;  2FCH A;  4F03 A;  3GUS A;  1HNA A;  1GSF A;  3TDG A;  2M46 A;  2AB6 A;  1AXD A;  2VL2 C;  4Q5Q A;  3FK8 A;  2GSQ A;  1O6J A;  1ML6 A;  1TRU A;  1OKT A;  5BMU A;  5KN1 A;  3FKF A;  3QDN A;  3VI5 A;  20GS A;  1EV9 A;  1KEB A;  2YN1 A;  4ID0 A;  3UJ1 A;  2LJR A;  5EY6 A;  1Z9H A;  1PX6 A;  3ZYW A;  3C1S A;  1X5D A;  2X8C A;  3M9J A;  5LNK e;  5E4W A;  2AV4 A;  1TXX A;  2B5X A;  3A2V A;  4I5Q A;  2RII A;  1YZX A;  4K5R A;  4HJ2 A;  3IDV A;  2V32 A;  4KDU A;  1GUM A;  4GSS A;  4BPY A;  5DJL A;  3D4T A;  1YQ1 A;  1CQG A;  4GF0 A;  2K8V A;  3BBY A;  3U5R E;  4POL A;  1AW9 A;  2R0C A;  3GIX A;  1GSY A;  2P0G A;  1YKA A;  1Q98 A;  3CQF A;  4MZB A;  2GLR A;  5HFK A;  3TKR A;  5C04 A;  4Q5F A;  3TOU A;  2ON5 A;  1W89 A;  4WKW A;  4EIP A;  3QD9 A;  1EZK A;  4RUV A;  1G6Y A;  3GN3 A;  1Q4J A;  3ME7 A;  4K5S A;  1TK0 B;  4PX1 A;  3TUE A;  4KB3 A;  5IMZ A;  4N11 A;  4MA9 A;  5IO2 A;  2LTK A;  1TTZ A;  1PSQ A;  4H86 A;  3Q74 A;  1PKZ A;  1Z6N A;  4MF6 A;  1ERU A;  2B3S A;  2PVQ A;  4IQA A;  5ELG A;  1GL8 A;  1WRY A;  2Z9S A;  3DVW A;  4V2M A;  2DBC A;  3RDW A;  2FY6 A;  4MLY A;  3R2Q A;  2JZR A;  4F2I A;  4D73 A;  1FG4 A;  4K8M A;  1XBS A;  2N5F A;  3DRN A;  2XHF A;  4AJ8 A;  2E2M A;  4OCE A;  2KUC A;  4N0Z A;  5IM9 A;  3VUR A;  2HE3 A;  2JSY A;  4K1F A;  1AQV A;  1AQX A;  4E8E A;  2GTU A;  5A4V A;  1MD4 A;  1S3A A;  5KOW A;  3TKS E;  1KBN A;  2OA7 A;  1LJR A;  2H19 A;  2YWN A;  4OFN A;  3FEU A;  1YDK A;  4MDC A;  1SYR A;  3UL3 A;  1SK1 A;  1XZO A;  2X8H A;  2YPM A;  2O8V B;  3C1R A;  1ERV A;  1GUH A;  2DSA A;  3QR6 A;  4L0W A;  4K7O A;  1PN9 A;  1F3A A;  2H1A A;  4QQ7 A;  4BVY A;  4IBP A;  4HU7 A;  1FVK A;  3P8W A;  2HSM A;  3ME8 A;  2CAQ A;  3ZFL A;  3C73 A;  5JCW A;  2XBI A;  1ZYQ B;  5KOX A;  2LRN A;  2R6K A;  2H70 A;  2TRX A;  2JAC A;  2R5G A;  2H72 A;  2O89 A;  3GTU B;  4MJB A;  3WGD A;  1TU8 A;  1F9M A;  1XWA A;  3FYG A;  1T00 A;  4JR4 A;  2OE1 A;  3TJJ A;  5D8I A;  4WR5 A;  1WE0 A;  4V2L A;  3GUR A;  4TRX A;  2B6M A;  4G2E A;  4USS A;  3GNJ A;  4KX4 A;  3TJF A;  4MZC A;  11GS A;  3N9J A;  3HD5 A;  3KTB A;  1USB A;  2CX3 A;  1MDK A;  2C8U A;  4ICY A;  2BTO T;  3NOF A;  1T3B A;  1JZW A;  1BED A;  2DMM A;  3UAR A;  2L5O A;  2JL4 A;  4KE3 A;  1XOA A;  3HJO A;  5ABR A;  1TU7 A;  1XW5 A;  2O7K A;  4X4J A;  2V6K A;  2IMI A;  4EKZ A;  2FUG 2;  1K0N A;  3Q6O A;  4POB A;  4JBB A;  1A23 A;  4EF0 A;  1TRV A;  2UZ8 A;  1B9X C;  1B8X A;  1K0M A;  1S3D A;  5LD0 A;  1X9M B;  2J9H A;  1NW2 A;  3L4N A;  4G0L A;  4NHZ A;  1O73 A;  2AUV A;  12GS A;  3TRP A;  5LCZ A;  2LS5 A;  4O5R A;  4XS4 B;  4TR3 A;  3F4S A;  3HVS A;  2PBJ A;  1EP8 A;  5HQP A;  2WFC A;  2LUS A;  3QCP A;  1GSQ A;  1XXU A;  4J57 E;  3BJ5 A;  2NVL A;  4TR1 A;  5EPF A;  4DSS B;  5A4W A;  1SEN A;  8GSS A;  5D9X A;  1XPV A;  4ZBD A;  3VPQ A;  2HXK A;  5IOW A;  3A2X A;  1A0R P;  1FOH A;  1XVQ A;  4JU5 A;  1PD2 1;  2YAN A;  1R5A A;  2CVD A;  3GST A;  2MMA A;  5IMF A;  3UOM A;  4EDY A;  3TCO A;  4ILF A;  2DJ2 A;  1GSE A;  5ECM B;  3UIW A;  4OMV A;  5ID2 B;  5A4U A;  2PER A;  1GLP A;  3IE3 A;  3APS A;  3ZRD A;  5L71 A;  1M3I A;  4O92 A;  3QMX A;  3GRX A;  3F63 A;  1XWC A;  4ZB6 A;  6GST A;  1B48 A;  1V2A A;  3G9B A;  3DKS A;  3DML A;  3HVN A;  3RHC A;  2M80 A;  1NHY A;  2CX4 A;  5CRW A;  4N10 A;  4O5U A;  3EYT A;  3MSZ A;  1GUL A;  2VCV A;  3A5W A;  1O85 A;  1ZZY A;  6GSS A;  2HSY A;  2C0E A;  4IW9 A;  3TJG A;  4FYU A;  1HNC A;  2OJL A;  3VWW A;  2HFD A;  1H4O A;  3ISO A;  3H79 A;  2HT9 A;  5ECS A;  2NTO A;  1PKW A;  3GKM A;  6GSY A;  5ECO B;  2OBK A;  4F82 A;  1MD3 A;  2LKU A;  1XW6 A;  5EL8 A;  4F0C A;  2FA8 A;  4K6X A;  2H8L A;  2YZH A;  2VCX A;  1XWB A;  3R3E A;  4IJ3 A;  4TN8 A;  2F8F A;  4ZBB A;  4Q5R A;  1W4V A;  1G0T A;  2LQO A;  1QFN A;  2GSS A;  2IMF A;  2LNT A;  4HQS A;  2LV3 A;  1OAZ A;  1PRX A;  4WXT A;  3U6V A;  3ZVJ A;  4X1U A;  2X64 A;  4K0G A;  5F06 A;  5GST A;  5JWR B;  1V40 A;  4PGT A;  1M99 A;  4HEA 2;  4ZBA A;  4FIW A;  4XTS A;  1RQM A;  5C00 A;  2RM5 A;  4CW9 A;  1TW9 A;  5KN2 A;  2DKH A;  1GSD A;  4X43 A;  3TRQ A;  2D2Z A;  2L4Q A;  4RI7 A;  4MAB A;  5JCU A;  4G9H A;  4ZXG A;  2IFQ B;  2FGX A;  3EPT A;  2C3T A;  2HZF A;  4EXJ A;  4IHU A;  2CQ9 A;  1ZMA A;  4F9Z A;  4YAV A;  5D9V A;  2ES7 A;  5IPH A;  4JE1 A;  4IS0 A;  1B9Y C;  3W6G A;  2EC4 A;  2FNO A;  2M72 A;  4L5L A;  5IMD A;  2TIR A;  2CA8 A;  4ZIL A;  1IYH A;  2ON7 A;  4NAX A;  1NSW A;  1G7O A;  2GQK A;  2DJ0 A;  1EGR A;  1X0R A;  4Z2R A;  5DAK B;  4K7I A;  4MJE A;  5D93 A;  1ERW A;  4FYB A;  2H74 A;  3EUR A;  3L78 A;  1R5P A;  2XPD A;  2FWG A;  3KP8 A;  4LLR A;  2FWH A;  2H76 A;  3RAZ A;  1JFU A;  4TKY A;  1I5G A;  2VM1 A;  1URM A;  2FWE A;  4MMM A;  3TKS C;  3L9V A;  4KW6 A;  2R4V A;  3H93 A;  2H1B A;  2O87 A;  3GHA A;  4XIH A;  4ML6 A;  5H5S A;  1SL1 B;  2IL3 A;  1DE1 A;  5FT3 A;  4L0U A;  4MJA A;  2N5B A;  5CRE A;  3GX0 A;  4POM A;  3O3T A;  3H4K A;  2QC7 A;  2WB9 A;  2FA4 A;  3HA9 A;  1VF3 A;  1T7P B;  3UVH A;  1FAA A;  2B1L A;  10GS A;  2OE3 A;  2QA1 A;  2XPE A;  4KSO A;  1OC9 B;  3APO A;  2QKE A;  1YY7 A;  1HD2 A;  3D0Z A;  1BX9 A;  1F6M C;  2V6O A;  1TKD B;  2MMO A;  1TI3 A;  4PNF A;  1SK2 A;  1KTE A;  2F3M A;  2P5Q A;  1X9S B;  1O81 A;  4PUA A;  2C80 A;  2QSI A;  1ZGN A;  2OAC A;  2PGT A;  2YJH A;  1BYE A;  3C7M A;  3IOS A;  1K3L A;  1XG8 A;  3ZZX A;  5AN1 A;  2GSR A;  2L5L A;  2YZU A;  4PTS A;  4MPG A;  3KZQ A;  4BIK A;  3CRT A;  4PUF C;  2K9F A;  5DJM A;  3KH9 A;  4ISD A;  1PMT A;  2C3N A;  3HJM A;  3VLN A;  2OAD A;  4NMU A;  3EWL A;  3DWV A;  4ECC A;  3ERG A;  2JZT A;  3G7Y A;  5GAN D;  1TRW A;  3BOA A;  3VWV A;  3ZLP A;  4GTU A;  4MZW A;  2R2J A;  5ECN B;  4EL1 A;  3IHQ A;  4WBJ A;  1T1V A;  3IR4 A;  2GT6 A;  3EU4 A;  1GP1 A;  3ZML A;  3C8E A;  1U3I A;  3WGX A;  4EDZ A;  4OD7 A;  1PFO A;  2IPA A;  3EVI A;  19GS A;  2VCT A;  2K18 A;  1QMV A;  2H6X A;  3W8J A;  5J9C A;  1HNB A;  5DVB A;  3N5O A;  3M9K A;  2GQM A;  3CSJ A;  4GWR A;  3O76 A;  4AF2 A;  1X9W B;  2OKA A;  2WS2 A;  2QGV A;  1EP7 A;  3IK9 A;  2GZP A;  1XWG A;  4YKF A;  3US3 A;  5ENU A;  4J56 E;  2DLX A;  2WCI A;  1AC1 A;  1ZOF A;  1SKW B;  1ZYP A;  3TOT A;  2R3X A;  1MDJ A;  3QFA C;  4BL7 B;  3ERF A;  1THO A;  3PIN A;  5IMC A;  3ZIT A;  4MJC A;  4L5O A;  4YAP A;  2A2P A;  3ZRE A;  4BWQ A;  3F4T A;  1JLW A;  4Z7X A;  4K2X A;  4OFM A;  4NXI A;  4TXV A;  3LOR A;  5DQS A;  4P3Y B;  5G5F A;  1BJX A;  1GLQ A;  2KOK A;  2PMT A;  3G7J A;  3HCZ A;  5KEJ A;  2YV9 A;  2I4A A;  3GV1 A;  3IK7 A;  3O6T A;  2PVO C;  6GSX A;  3ZTL A;  3MYD A;  4JED A;  5ID2 A;  1WMJ A;  1GTU A;  1DE2 A;  1T4Z A;  1MDI A;  1SJZ A;  1E2Y A;  2VLT A;  3FHK A;  4OWY A;  1R26 A;  2MMN A;  3ZL5 A;  1YEP A;  3D4M A;  1UN2 A;  3KM6 A;  1SJI A;  1AQW A;  4YQU A;  1LU4 A;  4K0N A;  4DVC A;  5F8B A;  4ZIJ A;  2LQQ A;  4LMW A;  1PQN A;  2PU9 C;  3EMP A;  4HUA A;  3EIN A;  3GH9 A;  5IO0 A;  1BG5 A;  5J5N A;  2B7K A;  3LFL A;  5ECL B;  3GFK A;  4GXZ A;  5ECK B;  3NZN A;  2XC2 A;  1KNG A;  1QUW A;  2H73 A;  2VCW A;  3QAG A;  3FZA A;  3LW9 A;  1GUK A;  4MPF A;  5CNW A;  1WPI A;  5AIV A;  5HFG A;  1SD9 A;  2YOI A;  1U3A A;  1O8X A;  1A2J A;  2HLS A;  3NIV A;  4I6X A;  3WT2 A;  2IJY A;  1JZR A;  2H30 A;  4KDY A;  1GRX A;  4O32 A;  4N30 A;  2GQL A;  2ZNM A;  2KHP A;  2OE0 A;  4FO5 A;  2WZ9 A;  4E8H A;  4NWY A;  5IMV A;  4ZL9 A;  1U87 A;  3HXS A;  2DKI A;  3FRC A;  2A2R A;  2WDU A;  4CDO A;  4WF5 A;  1EWX A;  2HZE A;  1NM3 A;  1Z6M A;  3FZ5 A;  2VUP A;  1SU9 A;  3V1W A;  2DJ1 A;  1S3C A;  5A5K A;  2R0P A;  1Z3E A;  2H1D A;  5D96 A;  2ZCT A;  1AIU A;  4G19 A;  4NV5 A;  2C4J A;  4F0B A;  4G0K A;  2IFQ A;  2MZC A;  2GT5 A;  2MBS A;  2ZUP A;  3KXO A;  1V98 A;  2E0Q A;  5GAP D;  5IPG A;  3HZ4 A;  3CYN A;  3CTF A;  2L6D A;  3LJR A;  3HJP A;  2H0I A;  2MYG A;  4N0V A;  3TKS A;  1J0F A;  1DSB A;  5KN0 A;  4KCE A;  1OVN A;  3KD0 A;  1RK4 A;  1A2L A;  3PR8 A;  4PQH A;  3CXG A;  4XRA A;  2CT6 A;  2CVK A;  1WIK A;  5DAK A;  1M7T A;  4YQM A;  3PPU A;  1QXH A;  4WR4 A;  3TJB A;  3AY8 A;  2C0D A;  5J9B A;  3L9S A;  2DJJ A;  1N2A A;  4GQF A;  2IMD A;  5DCH A;  5HR0 A;  2WJU A;  1SKS B;  1K0B A;  2J23 A;  1M9B A;  5DQY A;  1PL1 A;  1ST9 A;  1V57 A;  17GS A;  1WWJ A;  1ZYN A;  4J2F A;  6GSV A;  1UA5 A;  3C71 A;  1K0A A;  2EIO A;  4TOP A;  4GRF A;  4HOJ A;  1OYJ A;  5CAX A;  4EO3 A;  5D73 A;  4HZ4 A;  2HNL A;  1MTC A;  1SL0 B;  4NHW A;  2HRN A;  1OC9 A;  3A5I A;  3CBU A;  3GL3 A;  2LRT A;  3IAS 2;  2VL9 A;  1SL2 B;  5FWG A;  5G1L A;  2KLX A;  2EIR A;  3WT1 A;  3BD2 A;  4ML1 A;  4MH2 A;  3QOU A;  5B6M A;  4OO5 A;  3UAP A;  3E3E A;  5HFI A;  4POK A;  3PH9 A;  1G6W A;  1FOV A;  3UBK A;  1M2B A;  3D22 A;  3SWL A;  2LJA A;  1X5E A;  5J4U A;  3JCM L;  2GGT A;  1SJ6 A;  4JRR A;  2YWI A;  4KND A;  4ECJ A;  3UEM A;  2H6Z A;  1JZD A;  1B4P A;  3FZ4 A;  4I2T A;  1BQ7 A;  5G5E A;  3FR6 A;  3CSI A;  2GZY A;  3QAV A;  5HR2 A;  4O5Q A;  2I3Y A;  5GSS A;  3WD6 A;  4TR4 A;  3BCI A;  4KH7 A;  5ECI B;  3DVX A;  1JZO A;  3I43 A;  2JZS A;  3GL5 A;  3QAW A;  2H75 A;  2FLS A;  5ECR B;  2LJK A;  3D6I A;  3TRX A;  1F3B A;  4HJM A;  2NDO A;  3PGT A;  1H75 A;  2VO4 A;  3TKQ A;  2REM A;  1C72 A;  2PPT A;  3GKK A;  1EV4 A;  1U88 A;  2DIY A;  2X99 A;  3VWU A;  1EGO A;  3F0I A;  3LEF A;  5J41 A;  5H5Q A;  2H66 A;  2I9H A;  3VI7 A;  1JHB A;  2L4C A;  1TP9 A;  3IV4 A;  1SK0 A;  2GDR A;  5G31 A;  2G0F A;  2LNS A;  4AJ6 A;  5JWQ B;  4I8B A;  4XCS A;  2K8S A;  3H8Q A;  3IXR A;  1VGL A;  4BL7 A;  1PA3 A;  2YV7 A;  2H0H A;  3KIJ A;  1O7U A;  1VF4 A;  3VK9 A;  4K9Z A;  3S9F A;  3QPM A;  2B7J A;  2WRT A;  4OFT A;  4JZQ A;  4BVX B;  1AUC A;  4WEY A;  2MMZ A;  1TRS A;  4AJ7 A;  1PGT A;  4I97 A;  14GS A;  2RM6 A;  4G0I A;  3GH6 A;  2GS3 A;  5F05 A;  3KMO A;  1EEM A;  2VLU A;  3LSZ A;  5HR3 A;  3KP9 A;  5AIX A;  1V9W A;  3QFB C;  1GNW A;  2V1M A;  1QQ2 A;  4KA0 A;  1ZL9 A;  3RHB A;  4XS6 A;  1YKC A;  2HRF A;  4TXO B;  3VWX A;  1ABA A;  4IVF A;  2WUL A;  1A2M A;  4FYC A;  2AYT A;  2LRC A;  16GS A;  1FB0 A;  5E59 A;  2B1K A;  2DIZ A;  3GTU A;  3A2W A;  2EIQ A;  4KDX A;  4WF4 A;  3KH7 A;  5COH A;  4EE0 A;  3K8N A;  4DSR A;  4PXO A;  2C0G A;  3IPZ A;  1A8L A;  2YWM A;  3KMN A;  2R0G A;  2VCZ A; 
#chains in the Genus database with same CATH homology
 1VF2 A;  3KEB A;  1OKD A;  4YH2 A;  1YEX A;  4JR6 A;  3F6F A;  2DML A;  4MNN A;  4WET A;  3F4R A;  1WP0 A;  4Q5N A;  3KJY A;  4IJI A;  3RPP A;  1PL2 A;  1GNE A;  4XS1 A;  1HQO A;  1YF1 A;  4NPB A;  1JLV A;  3BCK A;  4I2U A;  3WGE A;  2A2S A;  3CRU A;  1F2E A;  4YKG A;  3HKR A;  22GS A;  2H0G A;  5ECP B;  1G7E A;  1UC7 A;  3FZ9 A;  3IBH A;  4BA7 A;  1PN0 A;  1PX7 A;  2IWT A;  1RW1 A;  4EIQ A;  1NHO A;  3KCM A;  5G1K A;  3FMW A;  4NV2 A;  1WOU A;  3I6A A;  1EEJ A;  4GSN A;  5FHI A;  3FY7 A;  3M8N A;  2CAI A;  4PQ1 A;  2H01 A;  2IIY A;  2KP2 A;  3I69 A;  3UVT A;  5D9T A;  4XRD A;  5G2Z A;  2FD3 A;  4LL1 B;  1ILO A;  1ON4 A;  2DC5 A;  1M9A A;  1GSS A;  1E6B A;  4XS4 A;  2F8A A;  4L8E A;  1VF1 A;  3MWH A;  1K0C A;  2K6V A;  4KCA A;  3CSH A;  1XFL A;  5B6N A;  1GSU A;  3F8U A;  3DGQ A;  5DAL B;  2F9S A;  3IC8 A;  4DSS A;  3I9V 2;  4K2D A;  3M1G A;  2NBS A;  3GX8 A;  2B5Y A;  4IN0 A;  4DSQ A;  1B4Q A;  1K0D A;  2DJK A;  2PUK C;  4KGI A;  5JCG A;  2PN8 A;  4X0X A;  5CRG A;  4FH8 A;  1XOB A;  1ACV A;  3MNG A;  3P2A A;  3VPT A;  4CY8 A;  3HZ8 A;  3MAK A;  2V2G A;  3P90 A;  18GS A;  1GTB A;  5F0G A;  3FW2 A;  4EVM A;  2MBT A;  2HRA A;  3LWA A;  1GTA A;  4PQI A;  1LBK A;  4ECI A;  3L0H A;  2C1Y A;  3HHV A;  2BMX A;  4G10 A;  5AGY A;  4HQZ A;  2VD0 A;  5ECQ B;  5H5R A;  1DBY A;  3GA4 A;  2L57 A;  5HR1 A;  3LG6 A;  1FB6 A;  2I81 A;  1F37 A;  3HYP A;  9GSS A;  1YF0 A;  2E2G A;  3DXB A;  3E9J B;  2NPB A;  3ZIJ A;  2IMK A;  3HY2 A;  4MH3 A;  3A3T A;  3HDC A;  1K3O A;  3LYK A;  4IGJ A;  4V1A p;  1Z5Y E;  3F6D A;  2LST A;  3IAM 2;  5IMA A;  2L59 A;  3LXT A;  4IP1 A;  1TJD A;  4GQC A;  4HS1 A;  7GSS A;  2FHE A;  1A8Y A;  1M2D A;  5IOX A;  3DEX A;  4IQ1 A;  2CZ2 A;  3LXZ A;  4OCF A;  3DYR A;  4TVE A;  4RQR A;  1XVW A;  2ALB A;  2CZ3 A;  3MIX A;  1N8J A;  5CRD A;  4ZB8 A;  3WYW A;  2IME A;  3LYP A;  1XIY A;  1XW9 A;  2X4A A;  3FR9 A;  5IIZ A;  4KAE A;  5CO3 A;  4V1A g;  2A4H A;  4HZ2 A;  2C0F A;  2VOC A;  2YJ7 A;  4QL9 A;  3GYK A;  1ZCP A;  3ZVJ D;  1V58 A;  1GH2 A;  1R7H A;  4ZL8 A;  2R37 A;  1J9B A;  2B5E A;  1FVJ A;  1Y6E A;  4IEL A;  1YJ6 A;  5CYY A;  2L6C A;  1CQH A;  3G7I A;  1ZYE A;  4GCI A;  1TK5 B;  5DCG A;  1XCC A;  1T8E B;  3F3R A;  3TJK A;  2YWO A;  1U6T A;  3Q18 A;  2H71 A;  2VIM A;  1GWC A;  4PUR A;  4HU9 A;  4MK3 A;  1OE8 A;  5EVO A;  4D73 B;  3FR3 A;  5B8B A;  4ZL7 A;  5IQY A;  3ZFB A;  4RI6 A;  2HSH A;  4LMV A;  2HI7 A;  5B8A A;  4MP4 A;  1TI1 A;  2CVB A;  1WJK A;  3Q19 A;  3D21 A;  4MF5 A;  2G2Q A;  2YCD A;  2H1G A;  1GTI A;  1Y25 A;  1A24 A;  5BRT A;  3EMX A;  2GVP A;  2YNX A;  1EOH A;  1QK8 A;  2JAD A;  1SKR B;  2HRK A;  3ERW A;  2O85 A;  1X5C A;  3TGZ A;  2VAF A;  2VL2 A;  3IC4 A;  4XHM A;  4LL4 B;  2X8G A;  3P7X A;  3ZMK A;  1SD8 A;  4ACS A;  4BVX A;  3DIE A;  2C3Q A;  1HYU A;  3J7Y k;  4BVY B;  1Z7P A;  3RPN A;  1FW1 A;  2FWF A;  4QL7 A;  3APQ A;  4O7H A;  3CTG A;  4TR0 A;  1Z7R A;  1K0O A;  3M3M A;  4RQX A;  3GKN A;  5GZZ B;  3KGK A;  2V41 A;  2GST A;  3GSS A;  4ZB9 A;  3LGC A;  3OR5 A;  5KN3 A;  1K3Y A;  2VCQ A;  1M0U A;  2VLV A;  3TKP A;  4CHS A;  1OC8 A;  3HVV A;  4TXO A;  3E0U A;  4PNG A;  5B7C A;  4IKH A;  2CV4 A;  2VM2 A;  2AHE A;  3VFI A;  3F3Q A;  4AGS A;  4Z2T A;  4OO4 A;  4ECB A;  3CMI A;  5JWO B;  3D5J A;  1UVZ A;  4FQU A;  2AAW A;  4YQV A;  1BAY A;  3EC3 A;  4DEJ A;  3M0F A;  2JSZ A;  3IRA A;  4EUY A;  4HI7 A;  3SBC A;  2RUE A;  5INY A;  2X49 A;  1OC3 A;  2YP6 A;  2QA2 A;  5F07 A;  4WBR D;  3W8S A;  2F51 A;  4KF9 A;  3J7Y b;  2OBI A;  2JU5 A;  1AAZ A;  2GZZ A;  5CP1 A;  1O8W A;  4TW5 A;  2HZE B;  1XWK A;  4ULX A;  1OE7 A;  2DJ3 A;  3HVX A;  3UMA A;  4K7N A;  2E7P A;  6GSU A;  2PWJ A;  2WGR A;  3DD3 A;  5ECH B;  1A0F A;  3EU3 A;  4MF7 A;  2IN3 A;  2AJQ B;  2LEG A;  5CRH A;  2H6Y A;  1SYX A;  4GLT A;  1TDI A;  3LQ7 A;  1FHE A;  4CY6 A;  5DBQ A;  1DUG A;  1M2A A;  1TK8 B;  4KSM A;  4Z2U A;  3MDK A;  2TRC P;  6GSW A;  3KTL A;  4LA1 A;  3IA1 A;  3GKX A;  1ERT A;  4KUN A;  4HDE A;  1IYI A;  4TR1 B;  2XBQ A;  5G30 A;  4MCU A;  1FO5 A;  13GS A;  2P31 A;  3H1N A;  1I9D A;  2N5A A;  3RBT A;  4BWS A;  2HYX A;  2P5R A;  5ELA A;  3F9U A;  2A4V A;  5DDL A;  4A5P A;  4GST A;  1MEK A;  5DAL A;  3EE2 A;  1THX A;  3ZIV A;  2VL3 A;  2I1U A;  2RLI A;  1QGV A;  3ED3 A;  2KP1 A;  4IP6 A;  3TB2 A;  5J3R A;  2RUF A;  2BJX A;  1T4Y A;  3UBL A;  1TOF A;  2VD1 A;  3L9U A;  5AIS A;  1R4W A;  4EC0 A;  4V2N A;  1EOG A;  5D9W A;  1J08 A;  1VRS D;  3IHG A;  3GMF A;  2FCH A;  4F03 A;  3GUS A;  1HNA A;  1GSF A;  3TDG A;  2M46 A;  2AB6 A;  1AXD A;  2VL2 C;  4Q5Q A;  3FK8 A;  2GSQ A;  1O6J A;  1ML6 A;  1TRU A;  1OKT A;  5BMU A;  5KN1 A;  3FKF A;  3QDN A;  3VI5 A;  20GS A;  1EV9 A;  1KEB A;  2YN1 A;  4ID0 A;  3UJ1 A;  2LJR A;  5EY6 A;  1Z9H A;  1PX6 A;  3ZYW A;  3C1S A;  1X5D A;  2X8C A;  3M9J A;  5LNK e;  5E4W A;  2AV4 A;  1TXX A;  2B5X A;  3A2V A;  4I5Q A;  2RII A;  1YZX A;  4K5R A;  4HJ2 A;  3IDV A;  2V32 A;  4KDU A;  1GUM A;  4GSS A;  4BPY A;  5DJL A;  3D4T A;  1YQ1 A;  1CQG A;  4GF0 A;  2K8V A;  3BBY A;  3U5R E;  4POL A;  1AW9 A;  2R0C A;  3GIX A;  1GSY A;  2P0G A;  1YKA A;  1Q98 A;  4MZB A;  2GLR A;  5HFK A;  3TKR A;  5C04 A;  4Q5F A;  3TOU A;  2ON5 A;  1W89 A;  4WKW A;  4EIP A;  3QD9 A;  1EZK A;  4RUV A;  1G6Y A;  3GN3 A;  1Q4J A;  3ME7 A;  4K5S A;  1TK0 B;  4PX1 A;  3TUE A;  4KB3 A;  5IMZ A;  4N11 A;  4MA9 A;  5IO2 A;  2LTK A;  1TTZ A;  1PSQ A;  4H86 A;  3Q74 A;  1PKZ A;  1Z6N A;  4MF6 A;  1ERU A;  2B3S A;  2PVQ A;  4IQA A;  5ELG A;  1GL8 A;  1WRY A;  2Z9S A;  3DVW A;  4V2M A;  2DBC A;  3RDW A;  2FY6 A;  4MLY A;  3R2Q A;  2JZR A;  4F2I A;  4D73 A;  1FG4 A;  4K8M A;  1XBS A;  2N5F A;  3DRN A;  2XHF A;  4AJ8 A;  2E2M A;  4OCE A;  2KUC A;  4N0Z A;  5IM9 A;  3VUR A;  2HE3 A;  2JSY A;  4K1F A;  1AQV A;  1AQX A;  4E8E A;  2GTU A;  5A4V A;  1MD4 A;  1S3A A;  5KOW A;  3TKS E;  1KBN A;  2OA7 A;  1LJR A;  2H19 A;  2YWN A;  4OFN A;  3FEU A;  1YDK A;  4MDC A;  1SYR A;  3UL3 A;  1SK1 A;  1XZO A;  2X8H A;  2YPM A;  2O8V B;  3C1R A;  1ERV A;  1GUH A;  2DSA A;  3QR6 A;  4L0W A;  4K7O A;  1PN9 A;  1F3A A;  2H1A A;  4QQ7 A;  4BVY A;  4IBP A;  4HU7 A;  1FVK A;  3P8W A;  2HSM A;  3ME8 A;  2CAQ A;  3ZFL A;  3C73 A;  5JCW A;  2XBI A;  1ZYQ B;  5KOX A;  2LRN A;  2R6K A;  2H70 A;  2TRX A;  2JAC A;  2R5G A;  2H72 A;  2O89 A;  3GTU B;  4MJB A;  3WGD A;  1TU8 A;  1F9M A;  1XWA A;  3FYG A;  1T00 A;  4JR4 A;  2OE1 A;  3TJJ A;  5D8I A;  4WR5 A;  1WE0 A;  4V2L A;  3GUR A;  4TRX A;  2B6M A;  4G2E A;  4USS A;  3GNJ A;  4KX4 A;  3TJF A;  4MZC A;  11GS A;  3N9J A;  3HD5 A;  3KTB A;  1USB A;  2CX3 A;  1MDK A;  2C8U A;  4ICY A;  2BTO T;  3NOF A;  1T3B A;  1JZW A;  1BED A;  2DMM A;  3UAR A;  2L5O A;  2JL4 A;  4KE3 A;  1XOA A;  3HJO A;  5ABR A;  1TU7 A;  1XW5 A;  2O7K A;  4X4J A;  2V6K A;  2IMI A;  4EKZ A;  2FUG 2;  1K0N A;  3Q6O A;  4POB A;  4JBB A;  1A23 A;  4EF0 A;  1TRV A;  2UZ8 A;  1B9X C;  1B8X A;  1K0M A;  1S3D A;  5LD0 A;  1X9M B;  2J9H A;  1NW2 A;  3L4N A;  4G0L A;  4NHZ A;  1O73 A;  2AUV A;  12GS A;  3TRP A;  5LCZ A;  2LS5 A;  4O5R A;  4XS4 B;  4TR3 A;  3F4S A;  3HVS A;  2PBJ A;  1EP8 A;  5HQP A;  2WFC A;  2LUS A;  3QCP A;  1GSQ A;  1XXU A;  4J57 E;  3BJ5 A;  2NVL A;  4TR1 A;  5EPF A;  4DSS B;  5A4W A;  1SEN A;  8GSS A;  5D9X A;  1XPV A;  4ZBD A;  3VPQ A;  2HXK A;  5IOW A;  3A2X A;  1A0R P;  1FOH A;  1XVQ A;  4JU5 A;  1PD2 1;  2YAN A;  1R5A A;  2CVD A;  3GST A;  2MMA A;  5IMF A;  3UOM A;  4EDY A;  3TCO A;  4ILF A;  2DJ2 A;  1GSE A;  5ECM B;  3UIW A;  4OMV A;  5ID2 B;  5A4U A;  2PER A;  1GLP A;  3IE3 A;  3APS A;  3ZRD A;  5L71 A;  4O92 A;  3QMX A;  3GRX A;  3F63 A;  1XWC A;  4ZB6 A;  6GST A;  1B48 A;  1V2A A;  3G9B A;  3DKS A;  3DML A;  3RHC A;  2M80 A;  1NHY A;  2CX4 A;  5CRW A;  4N10 A;  4O5U A;  3EYT A;  3MSZ A;  1GUL A;  2VCV A;  3A5W A;  1O85 A;  1ZZY A;  6GSS A;  2HSY A;  2C0E A;  4IW9 A;  3TJG A;  4FYU A;  1HNC A;  2OJL A;  3VWW A;  2HFD A;  1H4O A;  3ISO A;  3H79 A;  2HT9 A;  5ECS A;  2NTO A;  1PKW A;  3GKM A;  6GSY A;  5ECO B;  2OBK A;  4F82 A;  1MD3 A;  2LKU A;  1XW6 A;  5EL8 A;  4F0C A;  2FA8 A;  4K6X A;  2H8L A;  2YZH A;  2VCX A;  1XWB A;  3R3E A;  4IJ3 A;  4TN8 A;  2F8F A;  4ZBB A;  4Q5R A;  1W4V A;  1G0T A;  2LQO A;  1QFN A;  2GSS A;  2IMF A;  2LNT A;  4HQS A;  2LV3 A;  1OAZ A;  1PRX A;  4WXT A;  3U6V A;  3ZVJ A;  4X1U A;  2X64 A;  4K0G A;  5F06 A;  5GST A;  5JWR B;  1V40 A;  4PGT A;  1M99 A;  4HEA 2;  4ZBA A;  4FIW A;  4XTS A;  1RQM A;  5C00 A;  2RM5 A;  4CW9 A;  1TW9 A;  5KN2 A;  2DKH A;  1GSD A;  4X43 A;  3TRQ A;  2D2Z A;  2L4Q A;  4RI7 A;  4MAB A;  5JCU A;  4G9H A;  4ZXG A;  2IFQ B;  2FGX A;  3EPT A;  2C3T A;  2HZF A;  4EXJ A;  4IHU A;  2CQ9 A;  1ZMA A;  4F9Z A;  4YAV A;  5D9V A;  2ES7 A;  5IPH A;  4JE1 A;  4IS0 A;  1B9Y C;  3W6G A;  2EC4 A;  2FNO A;  2M72 A;  4L5L A;  5IMD A;  2TIR A;  2CA8 A;  4ZIL A;  1IYH A;  2ON7 A;  4NAX A;  1NSW A;  1G7O A;  2GQK A;  2DJ0 A;  1EGR A;  1X0R A;  4Z2R A;  5DAK B;  4K7I A;  4MJE A;  5D93 A;  1ERW A;  4FYB A;  2H74 A;  3EUR A;  3L78 A;  1R5P A;  2XPD A;  2FWG A;  3KP8 A;  4LLR A;  2FWH A;  2H76 A;  3RAZ A;  1JFU A;  4TKY A;  1I5G A;  2VM1 A;  1URM A;  2FWE A;  4MMM A;  3TKS C;  3L9V A;  4KW6 A;  2R4V A;  3H93 A;  2H1B A;  2O87 A;  3GHA A;  4XIH A;  4ML6 A;  5H5S A;  1SL1 B;  2IL3 A;  1DE1 A;  5FT3 A;  4L0U A;  4MJA A;  2N5B A;  5CRE A;  3GX0 A;  4POM A;  3O3T A;  3H4K A;  2QC7 A;  2WB9 A;  2FA4 A;  3HA9 A;  1VF3 A;  1T7P B;  3UVH A;  1FAA A;  2B1L A;  10GS A;  2OE3 A;  2QA1 A;  2XPE A;  4KSO A;  1OC9 B;  3APO A;  2QKE A;  1YY7 A;  1HD2 A;  3D0Z A;  1BX9 A;  1F6M C;  2V6O A;  1TKD B;  2MMO A;  1TI3 A;  4PNF A;  1SK2 A;  1KTE A;  2F3M A;  2P5Q A;  1X9S B;  1O81 A;  4PUA A;  2C80 A;  2QSI A;  1ZGN A;  2OAC A;  2PGT A;  2YJH A;  1BYE A;  3C7M A;  3IOS A;  1K3L A;  3ZZX A;  5AN1 A;  2GSR A;  2L5L A;  2YZU A;  4PTS A;  4MPG A;  3KZQ A;  3CRT A;  4PUF C;  2K9F A;  5DJM A;  3KH9 A;  4ISD A;  1PMT A;  2C3N A;  3HJM A;  3VLN A;  2OAD A;  4NMU A;  3EWL A;  3DWV A;  4ECC A;  3ERG A;  2JZT A;  3G7Y A;  5GAN D;  1TRW A;  3BOA A;  3VWV A;  3ZLP A;  4GTU A;  4MZW A;  2R2J A;  5ECN B;  4EL1 A;  3IHQ A;  4WBJ A;  1T1V A;  3IR4 A;  2GT6 A;  3EU4 A;  1GP1 A;  3ZML A;  3C8E A;  1U3I A;  3WGX A;  4EDZ A;  4OD7 A;  2IPA A;  3EVI A;  19GS A;  2VCT A;  2K18 A;  1QMV A;  2H6X A;  3W8J A;  5J9C A;  1HNB A;  5DVB A;  3N5O A;  3M9K A;  2GQM A;  3CSJ A;  4GWR A;  3O76 A;  4AF2 A;  1X9W B;  2OKA A;  2WS2 A;  2QGV A;  1EP7 A;  3IK9 A;  2GZP A;  1XWG A;  4YKF A;  3US3 A;  5ENU A;  4J56 E;  2DLX A;  2WCI A;  1AC1 A;  1ZOF A;  1SKW B;  1ZYP A;  3TOT A;  2R3X A;  1MDJ A;  3QFA C;  4BL7 B;  3ERF A;  1THO A;  3PIN A;  5IMC A;  3ZIT A;  4MJC A;  4L5O A;  4YAP A;  2A2P A;  3ZRE A;  4BWQ A;  3F4T A;  1JLW A;  4Z7X A;  4K2X A;  4OFM A;  4NXI A;  4TXV A;  3LOR A;  5DQS A;  4P3Y B;  5G5F A;  1BJX A;  1GLQ A;  2KOK A;  2PMT A;  3G7J A;  3HCZ A;  5KEJ A;  2YV9 A;  2I4A A;  3GV1 A;  3IK7 A;  3O6T A;  2PVO C;  6GSX A;  3ZTL A;  3MYD A;  4JED A;  5ID2 A;  1WMJ A;  1GTU A;  1DE2 A;  1T4Z A;  1MDI A;  1SJZ A;  1E2Y A;  2VLT A;  3FHK A;  4OWY A;  1R26 A;  2MMN A;  3ZL5 A;  1YEP A;  3D4M A;  1UN2 A;  3KM6 A;  1SJI A;  1AQW A;  4YQU A;  1LU4 A;  4K0N A;  4DVC A;  5F8B A;  4ZIJ A;  2LQQ A;  4LMW A;  1PQN A;  2PU9 C;  3EMP A;  4HUA A;  3EIN A;  3GH9 A;  5IO0 A;  1BG5 A;  5J5N A;  2B7K A;  3LFL A;  5ECL B;  3GFK A;  4GXZ A;  5ECK B;  3NZN A;  2XC2 A;  1KNG A;  1QUW A;  2H73 A;  2VCW A;  3QAG A;  3FZA A;  3LW9 A;  1GUK A;  4MPF A;  5CNW A;  1WPI A;  5AIV A;  5HFG A;  1SD9 A;  2YOI A;  1U3A A;  1O8X A;  1A2J A;  2HLS A;  3NIV A;  4I6X A;  3WT2 A;  2IJY A;  1JZR A;  2H30 A;  4KDY A;  1GRX A;  4O32 A;  4N30 A;  2GQL A;  2ZNM A;  2KHP A;  2OE0 A;  4FO5 A;  2WZ9 A;  4E8H A;  4NWY A;  5IMV A;  4ZL9 A;  1U87 A;  3HXS A;  2DKI A;  3FRC A;  2A2R A;  2WDU A;  4CDO A;  4WF5 A;  1EWX A;  2HZE A;  1NM3 A;  1Z6M A;  3FZ5 A;  2VUP A;  1SU9 A;  3V1W A;  2DJ1 A;  1S3C A;  5A5K A;  2R0P A;  1Z3E A;  2H1D A;  5D96 A;  2ZCT A;  1AIU A;  4G19 A;  4NV5 A;  2C4J A;  4F0B A;  4G0K A;  2IFQ A;  2MZC A;  2GT5 A;  2MBS A;  2ZUP A;  3KXO A;  1V98 A;  2E0Q A;  5GAP D;  5IPG A;  3HZ4 A;  3CYN A;  3CTF A;  2L6D A;  3LJR A;  3HJP A;  2H0I A;  2MYG A;  4N0V A;  3TKS A;  1J0F A;  1DSB A;  5KN0 A;  4KCE A;  1OVN A;  3KD0 A;  1RK4 A;  1A2L A;  3PR8 A;  4PQH A;  3CXG A;  4XRA A;  2CT6 A;  2CVK A;  1WIK A;  5DAK A;  1M7T A;  4YQM A;  3PPU A;  1QXH A;  4WR4 A;  3TJB A;  3AY8 A;  2C0D A;  5J9B A;  3L9S A;  2DJJ A;  1N2A A;  4GQF A;  2IMD A;  5DCH A;  5HR0 A;  2WJU A;  1SKS B;  1K0B A;  2J23 A;  1M9B A;  5DQY A;  1PL1 A;  1ST9 A;  1V57 A;  17GS A;  1WWJ A;  1ZYN A;  4J2F A;  6GSV A;  1UA5 A;  3C71 A;  1K0A A;  2EIO A;  4TOP A;  4GRF A;  4HOJ A;  1OYJ A;  5CAX A;  4EO3 A;  5D73 A;  4HZ4 A;  2HNL A;  1MTC A;  1SL0 B;  4NHW A;  2HRN A;  1OC9 A;  3A5I A;  3CBU A;  3GL3 A;  2LRT A;  3IAS 2;  2VL9 A;  1SL2 B;  5FWG A;  5G1L A;  2KLX A;  2EIR A;  3WT1 A;  3BD2 A;  4ML1 A;  4MH2 A;  3QOU A;  5B6M A;  4OO5 A;  3UAP A;  3E3E A;  5HFI A;  4POK A;  3PH9 A;  1G6W A;  1FOV A;  3UBK A;  1M2B A;  3D22 A;  3SWL A;  2LJA A;  1X5E A;  5J4U A;  3JCM L;  2GGT A;  1SJ6 A;  4JRR A;  2YWI A;  4KND A;  4ECJ A;  3UEM A;  2H6Z A;  1JZD A;  1B4P A;  3FZ4 A;  4I2T A;  1BQ7 A;  5G5E A;  3FR6 A;  3CSI A;  2GZY A;  3QAV A;  5HR2 A;  4O5Q A;  2I3Y A;  5GSS A;  3WD6 A;  4TR4 A;  3BCI A;  4KH7 A;  5ECI B;  3DVX A;  1JZO A;  3I43 A;  2JZS A;  3GL5 A;  3QAW A;  2H75 A;  2FLS A;  5ECR B;  2LJK A;  3D6I A;  3TRX A;  1F3B A;  4HJM A;  2NDO A;  3PGT A;  1H75 A;  2VO4 A;  3TKQ A;  2REM A;  1C72 A;  2PPT A;  3GKK A;  1EV4 A;  1U88 A;  2DIY A;  2X99 A;  3VWU A;  1EGO A;  3F0I A;  3LEF A;  5J41 A;  5H5Q A;  2H66 A;  2I9H A;  3VI7 A;  1JHB A;  2L4C A;  1TP9 A;  3IV4 A;  1SK0 A;  2GDR A;  5G31 A;  2G0F A;  2LNS A;  4AJ6 A;  5JWQ B;  4I8B A;  4XCS A;  2K8S A;  3H8Q A;  3IXR A;  1VGL A;  4BL7 A;  1PA3 A;  2YV7 A;  2H0H A;  3KIJ A;  1O7U A;  1VF4 A;  3VK9 A;  4K9Z A;  3S9F A;  3QPM A;  2B7J A;  2WRT A;  4OFT A;  4JZQ A;  4BVX B;  1AUC A;  4WEY A;  2MMZ A;  1TRS A;  4AJ7 A;  1PGT A;  4I97 A;  14GS A;  2RM6 A;  4G0I A;  3GH6 A;  2GS3 A;  5F05 A;  3KMO A;  1EEM A;  2VLU A;  3LSZ A;  5HR3 A;  3KP9 A;  5AIX A;  1V9W A;  3QFB C;  1GNW A;  2V1M A;  1QQ2 A;  4KA0 A;  1ZL9 A;  3RHB A;  4XS6 A;  1YKC A;  2HRF A;  4TXO B;  3VWX A;  1ABA A;  4IVF A;  2WUL A;  1A2M A;  4FYC A;  2AYT A;  2LRC A;  16GS A;  1FB0 A;  5E59 A;  2B1K A;  2DIZ A;  3GTU A;  3A2W A;  2EIQ A;  4KDX A;  4WF4 A;  3KH7 A;  5COH A;  4EE0 A;  3K8N A;  4DSR A;  4PXO A;  2C0G A;  3IPZ A;  1A8L A;  2YWM A;  3KMN A;  2R0G A;  2VCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...