2VL9A

Oxidized form of human peroxiredoxin 5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
161
structure length
161
Chain Sequence
b'APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVASLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN-5
publication title The Crystal Structures of Oxidized Forms of Human Peroxiredoxin 5 with an Intramolecular Disulfide Bond Confirm the Proposed Enzymatic Mechanism for Atypical 2-Cys Peroxiredoxins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 23
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vl9A00
2WJUA 1OKTA 1WE0A 1AQXA 1ZYEA 3IHQA 3KTBA 4EUYA 2IJYA 1SD8A 2YN1A 5J4UA 1F3BA 1A2JA 1VF3A 4AJ8A 4HU7A 2V32A 1YY7A 4IQAA 4FH8A 2LRTA 3C7MA 3HHVA 3TUEA 2QSIA 2XPEA 1YDKA 3TKSC 3ZREA 2R3XA 5IMVA 3ZFBA 2KP2A 2F8AA 1JLWA 2DBCA 1SU9A 2N5AA 1UN2A 2ON5A 1NSWA 4GSNA 2OBKA 1HNBA 5IPHA 1M99A 3UVTA 2B7JA 5DQSA 2F8FA 2HE3A 3GTUA 3KD0A 4V2LA 4HZ2A 2K18A 3HJPA 3BOAA 3NOFA 1DSBA 4CHSA 4LA1A 1HQOA 2PERA 3Q74A 3N5OA 4QL7A 5LNKe 4BL7A 2I81A 1PQNA 3GUSA 1M2AA 3LG6A 3VK9A 3U6VA 2ON7A 5B8BA 5ECRB 1XWKA 1A24A 4KE3A 1HNAA 1YEPA 4LL4B 1NW2A 5HR0A 5HR3A 3Q19A 1G6WA 1V58A 4XS4A 1J0FA 1X9SB 4F9ZA 1ABAA 3EVIA 3ZZXA 1TRUA 4JU5A 4EO3A 3TDGA 4MF7A 4ECJA 3TJBA 1V57A 2AV4A 1XWGA 5HFKA 4GLTA 2HRFA 4L8EA 1XCCA 1ERWA 2E0QA 4I6XA 4EXJA 2DJ1A 3IR4A 1OYJA 3G9BA 2MMZA 3GKMA 2MMAA 2P0GA 5GSSA 1B4PA 4WR4A 1LBKA 2GGTA 1OKDA 2FWHA 2JADA 1OC9B 2EIRA 1K0BA 2VLUA 3WT1A 5D9VA 5ECMB 2C0FA 2F3MA 4N10A 3IAS2 4FIWA 4HU9A 4DEJA 3A2VA 1OE7A 5F06A 1EGRA 2FWFA 3IXRA 3O6TA 4NHZA 3F6DA 3KTLA 2IFQB 3DMLA 2K8SA 3GSSA 2DJJA 2C4JA 4FO5A 1EEJA 1X9MB 5G1LA 4BA7A 1O7UA 2DIZA 2G0FA 4K7IA 2H0GA 2LRCA 1Q98A 2VIMA 3CSHA 2CAIA 2O85A 4F0CA 2GDRA 3CMIA 1V98A 3DYRA 1A2MA 1EV4A 4ILFA 3GURA 6GSXA 1DE1A 5JWRB 3UBKA 5HFIA 2HXKA 3WGXA 5DALB 2CA8A 3UL3A 5CRDA 3Q18A 2CVBA 4F03A 3HKRA 3D22A 4HEA2 3QD9A 1A8LA 3LSZA 2LEGA 1FVJA 1TK0B 2RM5A 1JZDA 3TJJA 13GSA 2H1GA 7GSSA 1USBA 3MWHA 2MZCA 3DD3A 4MZWA 5A4VA 1M2BA 2YWMA 4QL9A 5HQPA 3VWXA 5LD0A 4ECIA 3I43A 2C0EA 3GV1A 3QCPA 1A8YA 2PN8A 3TKSE 4MCUA 5EY6A 3PINA 3L0HA 1B48A 2X8CA 4IP6A 4HUAA 2C80A 3ZVJA 3ZL5A 2H0HA 4J57E 4KDUA 3C8EA 3E9JB 5IPGA 5JCGA 3TJFA 1SKSB 3MNGA 4MZCA 2YCDA 1T8EB 1G0TA 4EKZA 3LEFA 3DEXA 3W8SA 2LRNA 2L4CA 2WRTA 4P3YB 4TN8A 3GTUB 1SK2A 4JR6A 4AJ6A 4X1UA 2VL3A 4POBA 3MAKA 1UC7A 1VF4A 4I5QA 3P2AA 2YWOA 4L5OA 4KDXA 4XTSA 4WKWA 3FRCA 1N2AA 3IDVA 1BJXA 1LU4A 2WULA 1M2DA 3A5WA 1TDIA 1URMA 2X99A 5AGYA 1SKWB 1O81A 4KB3A 2N5FA 5CAXA 2H0IA 4KCAA 4EF0A 4XS4B 4G10A 3L9SA 4BVYA 4ACSA 3HXSA 3UMAA 4IVFA 1GTUA 1A23A 1GNEA 3VPTA 1OE8A 2K9FA 1T4YA 4MPFA 4H86A 4EC0A 3IOSA 2OACA 2PVQA 1PRXA 4MMMA 3KH9A 2MBSA 4ZL8A 2FA4A 2KLXA 5G2ZA 5KN1A 1MDJA 3PH9A 2YOIA 4GTUA 14GSA 3HZ8A 2H1AA 3FHKA 2IN3A 3GL3A 4GSSA 3KJYA 3TKPA 5CRHA 5DCGA 4Q5QA 3GIXA 2DJ3A 5A5KA 5JWOB 2XBIA 4RI6A 4J2FA 2H76A 2JZTA 1GUHA 2FY6A 1H4OA 2QGVA 3HVSA 2E2GA 3P90A 4XS6A 5DJMA 3APQA 3TKQA 2ZUPA 1Z3EA 4NAXA 3M1GA 2AUVA 3TB2A 1I9DA 2IWTA 2LJAA 3A2XA 5CRWA 3LORA 4ZBBA 1DBYA 4XRDA 1U87A 2A4VA 5F05A 4GQCA 3J7Yk 1SJ6A 3LQ7A 1UVZA 1S3AA 4OFMA 2I9HA 1ON4A 3KXOA 1TXXA 4PXOA 1PL1A 2B1LA 4OO4A 3HDCA 4ZILA 5JWQB 1OAZA 2B7KA 1BG5A 5ECKB 5JCWA 1SJZA 1U6TA 2K8VA 2CZ3A 4I97A 2R37A 1J08A 3KZQA 3GX8A 1YJ6A 3CSJA 20GSA 3BBYA 2GSSA 4Q5NA 2VCWA 1FOVA 1TRVA 2C3TA 2FUG2 3FZ5A 4ZL9A 1XVQA 5IMDA 4BWQA 5IIZA 3IAM2 3KH7A 4E8HA 4PUAA 1XXUA 2EC4A 2KOKA 2JSYA 1Z7PA 1F3AA 2OA7A 2FD3A 1EOGA 1MD3A 2RIIA 4KCEA 4IBPA 1M9BA 1T3BA 1O6JA 2R5GA 4HQSA 1DUGA 1XIYA 2I3YA 1X5DA 1VRSD 2MMNA 3A3TA 3BJ5A 3KMOA 1ZCPA 4ML1A 5D93A 2B5EA 5IOXA 5ECSA 2N5BA 2J9HA 2F51A 4K0GA 1XWBA 3M0FA 2PMTA 3GX0A 2VUPA 4EVMA 2HI7A 1PX6A 3DIEA 5F07A 1XPVA 2DC5A 4TW5A 4KH7A 4HS1A 3ZVJD 3LWAA 1KEBA 1K0AA 4N30A 2YNXA 2VD1A 1O8XA 2NVLA 2X8GA 2GSRA 3H8QA 4NPBA 1JZOA 3FW2A 3D6IA 2IMIA 5ECNB 2GZPA 5ELGA 1JZRA 1A0FA 2YV7A 3FR3A 2HZFA 2GQLA 2AB6A 3EC3A 1K0DA 2M46A 2LQQA 3HCZA 1E6BA 3HVXA 4OWYA 4FYUA 2V2GA 2DJKA 3CTFA 1X5CA 4RI7A 2FA8A 4D73A 3O3TA 4BPYA 3F3QA 1GP1A 1M7TA 1TRSA 3TOUA 3L9VA 1B9XC 2H75A 1F9MA 1SENA 2MYGA 2J23A 2H66A 1K0CA 1PX7A 4FYCA 2FHEA 1PN9A 2C3QA 1N8JA 3ZFLA 4I8BA 1C72A 2L5OA 1EEMA 4XRAA 1GLPA 2XC2A 3M9JA 1U88A 1EGOA 1K3YA 1IYIA 1XOBA 2LQOA 2RUEA 4ZB9A 3A2WA 2NPBA 2JL4A 4K7OA 4GCIA 2VCTA 1JZWA 4JRRA 1W89A 2YJ7A 4IJIA 4WEYA 1PMTA 2E7PA 1TP9A 3FZ9A 3KM6A 3FYGA 1Q4JA 3FR9A 1GSDA 1YZXA 1X5EA 3D4TA 4ID0A 2P5QA 1Y25A 2VL2C 5H5QA 3HZ4A 1YKAA 5ECHB 1VF1A 4TVEA 3TKSA 3J7Yb 3HYPA 2VM1A 4GRFA 2C0GA 4OCEA 5DBQA 5CYYA 2NTOA 2YWNA 3HD5A 5ECOB 4L0UA 2YWIA 1CQGA 1MD4A 3TGZA 4Z7XA 1SJIA 1YEXA 1XWAA 1WJKA 3G7YA 1XVWA 1IYHA 2G2QA 2DLXA 4WBRD 4HQZA 3ZITA 3QFBC 1XW9A 4KUNA 4NWYA 4AGSA 4XS1A 2CQ9A 1GSUA 2EIOA 3GL5A 4TR0A 5AIXA 2O89A 1BQ7A 2DSAA 2VLTA 1F2EA 3FZ4A 2MBTA 1TRWA 6GSYA 4WR5A 1O8WA 3FR6A 3TRPA 4JZQA 5IOWA 2LV3A 3D0ZA 1TU8A 5G5FA 3RBTA 3EU3A 5ELAA 3US3A 2GT6A 1CQHA 3SBCA 5G5EA 4ISDA 1NHYA 4ZIJA 2B6MA 2H71A 4JEDA 2LTKA 2HNLA 4F0BA 3CXGA 5ENUA 1ZYQB 1ZZYA 2LNSA 5D8IA 1ZOFA 4ML6A 1XZOA 2AJQB 1OC8A 4L0WA 3H79A 5EL8A 5DAKA 3DWVA 5ECQB 1E2YA 2YV9A 5CO3A 3G7IA 5FHIA 5GZZB 16GSA 3EE2A 2FLSA 1G6YA 2DMLA 4ZB8A 3EINA 2V41A 4D73B 5A4UA 4K7NA 3WGEA 2YZHA 2GSQA 3GKXA 4L5LA 1TTZA 3BCKA 4TOPA 4MJBA 2I1UA 2LNTA 4PNFA 1K0MA 3U5RE 4FYBA 1WRYA 4AJ7A 2BTOT 3TRXA 18GSA 1VF2A 3D4MA 2V6KA 5IMCA 5GSTA 1WWJA 1T1VA 4PX1A 3BD2A 4K8MA 4V2MA 3O76A 4KSMA 1GTBA 4EDZA 2DJ2A 4WETA 5JCUA 2VCQA 2ZCTA 6GSWA 3KMNA 5HR1A 3EU4A 1S3DA 4G9HA 2KHPA 4NMUA 5EPFA 3BCIA 4MABA 3F8UA 5A4WA 2L6CA 3EMXA 3QAGA 3ZLPA 2JU5A 4OD7A 5CNWA 4PQIA 4AF2A 2RLIA 1X0RA 4X43A 1Z5YE 1GULA 1XFLA 4O92A 4TR1A 3QMXA 1SKRB 5ECPB 3F4SA 3LXZA 3GHAA 10GSA 1O85A 1BAYA 4MK3A 3ME8A 2YANA 2C1YA 4MP4A 1KNGA 4HOJA 3HY2A 1TI1A 2CZ2A 2FNOA 2LSTA 1T7PB 2BMXA 3VI7A 5IQYA 3H4KA 2H1DA 5IMFA 1XOAA 2GVPA 3DRNA 2L5LA 1EWXA 3NZNA 2H01A 4JBBA 1PL2A 1W4VA 1Z9HA 2LJKA 3UVHA 5HR2A 2RM6A 1ZGNA 3LYKA 2K6VA 1U3AA 2CX3A 5KN2A 1PKWA 4RQXA 1HNCA 3TJKA 1PKZA 2B3SA 4YQVA 1PSQA 4V1Ag 2FWGA 3GKNA 1R5AA 3H1NA 3W6GA 4F2IA 2PWJA 4LL1B 5IO2A 2R4VA 1T00A 4TXVA 1FHEA 3IRAA 3I6AA 3G7JA 3K8NA 5L71A 3CBUA 4TXOA 4K1FA 3KP8A 3M3MA 1THXA 1ERVA 3I69A 5INYA 4YAPA 1UA5A 5IO0A 3QAWA 5D9XA 2NDOA 2PBJA 3HJOA 4V1Ap 12GSA 1BEDA 4ZXGA 5C04A 1SK1A 4DSSA 4HDEA 1GSEA 1HD2A 2MMOA 3FKFA 1H75A 3RHBA 3APOA 4G2EA 3UOMA 2L57A 1QGVA 2B5XA 5LCZA 4MJCA 1SL0B 1AQWA 4MH3A 3DVXA 2NBSA 3P7XA 1F37A 5J3RA 3FK8A 3ZMKA 1GLQA 4TRXA 3F6FA 2FWEA 4OFNA 2CVKA 1QFNA 5D9TA 3CTGA 2L6DA 2LJRA 1V9WA 3CYNA 5J41A 3GMFA 5COHA 4IS0A 5KN3A 3C1SA 2H6YA 1M0UA 5DAKB 5HFGA 2GQKA 2VL9A 4HJMA 5FT3A 5J9CA 3TRQA 22GSA 4IJ3A 4POMA 3GN3A 1XBSA 2HZEA 17GSA 4KDYA 3EYTA 1OVNA 2VCZA 4OMVA 2WZ9A 4IELA 2X8HA 5G31A 3R2QA 3EMPA 2FCHA 3ERWA 3L9UA 3DGQA 3IK9A 2EIQA 3RPPA 2XHFA 4DSQA 3UAPA 2IMDA 2O7KA 5GAND 5DDLA 1TW9A 3KEBA 1EV9A 3VFIA 1ZL9A 2WS2A 2HT9A 5DJLA 2F9SA 5IM9A 3W8JA 1OC3A 4MF6A 2M80A 2GT5A 4CW9A 2P31A 2QC7A 2BJXA 3VWVA 3QR6A 4N0ZA 4IKHA 1YKCA 3UEMA 4IQ1A 3VWUA 1SYRA 2VAFA 4ZL7A 1AW9A 1EZKA 4JR4A 3GH9A 4LMWA 3ZYWA 2CAQA 2TRXA 2YPMA 4LMVA 4WF5A 3CSIA 1QK8A 1ZMAA 3JCML 4MA9A 3TCOA 4KA0A 1YF0A 3IC4A 2AHEA 2IIYA 3D21A 1KTEA 2LUSA 1J9BA 4TR1B 3APSA 2GS3A 4EE0A 5B6MA 3KIJA 2WDUA 2DIYA 3OR5A 4POKA 3TJGA 1PD21 2M72A 1R4WA 2OE3A 2CV4A 4HJ2A 1GRXA 4GXZA 3EURA 4PNGA 3SWLA 3RHCA 2XPDA 3F4RA 3IK7A 1TJDA 4E8EA 1HYUA 4I2UA 2PU9C 2C8UA 2TIRA 2V1MA 2HSHA 4PQHA 3C73A 3HVVA 3FY7A 4MDCA 3F3RA 2GQMA 4ECCA 3RPNA 4KGIA 4OO5A 2B1KA 5H5SA 1QQ2A 1PGTA 4XCSA 1RK4A 3IBHA 3VPQA 3GH6A 1TU7A 1SYXA 4EDYA 1GL8A 1TI3A 4HZ4A 4PQ1A 4XHMA 2CVDA 3IE3A 1FG4A 1Z6MA 1ILOA 3LXTA 4LLRA 2OE1A 4YQUA 3L78A 3LYPA 2AAWA 4V2NA 4BWSA 3LGCA 4RUVA 4PURA 2DJ0A 5D9WA 3E0UA 4TXOB 3QOUA 8GSSA 1GH2A 1EOHA 3I9V2 4N0VA 5ECLB 1DE2A 1S3CA 2JZSA 5C00A 1FW1A 3VWWA 4CDOA 3TKRA 3AY8A 4MJAA 5ID2A 3VI5A 4F82A 2ES7A 3KGKA 1KBNA 2YJHA 4NXIA 3HJMA 4HI7A 3EWLA 2VCXA 4DSRA 5CP1A 2H19A 3QFAC 2H73A 4XIHA 4PUFC 4DSSB 2OKAA 3GFKA 4YQMA 3QPMA 5E59A 2KP1A 4ECBA 2L59A 5KN0A 1G7EA 2IMFA 1FO5A 6GSTA 1M9AA 3E3EA 4TR3A 1Z7RA 3V1WA 1JHBA 1FB0A 2H74A 1GSSA 1A0RP 1AQVA 2KUCA 5IMZA 2HFDA 1AXDA 3D5JA 4NV2A 1R26A 4BVXA 3S9FA 9GSSA 1RW1A 2HZEB 1AC1A 4K0NA 2WFCA 3M9KA 3CRTA 1MEKA 1GUKA 4O5RA 1A2LA 4Q5FA 2R6KA 4K6XA 2CT6A 19GSA 1TK5B 2L4QA 3TOTA 4IGJA 1EP7A 5D96A 4TR4A 2VD0A 2VOCA 4J56E 3IPZA 4MLYA 5ABRA 1YQ1A 1FAAA 3MSZA 2VL2A 1K0NA 1V2AA 1R5PA 3ZRDA 2ALBA 2H1BA 2JZRA 2VCVA 2IPAA 1K3LA 5G1KA 3IV4A 4GSTA 4DVCA 4JE1A 3PGTA 1U3IA 5DCHA 3IA1A 2X64A 3CRUA 3GNJA 1QXHA 11GSA 1FB6A 1GSQA 3F9UA 1JLVA 4MZBA 4NHWA 1MTCA 2WCIA 1G7OA 2OADA 3ZMLA 5DVBA 4YAVA 4ZBDA 1PA3A 2E2MA 1GSFA 1SL1B 2IMKA 3DXBA 2TRCP 1K0OA 2LS5A 5D73A 4O7HA 1XWCA 3F0IA 2HSYA 4MH2A 5J9BA 5AN1A 4OCFA 1V40A 2XBQA 4NV5A 4G19A 1B4QA 3NIVA 3VURA 4WF4A 1AAZA 2HRNA 2YP6A 2GSTA 3DKSA 4YH2A 4KX4A 2Z9SA 1WP0A 5ECIB 2OJLA 1GNWA 3L4NA 1QUWA 2GTUA 1GTIA 2H72A 2VM2A 4N11A 5E4WA 5GAPD 2RUFA 4QQ7A 1WMJA 1SD9A 1NHOA 4K9ZA 1XW6A 1SK0A 2PVOC 3KCMA 4KSOA 6GSSA 2QKEA 5CRGA 4IHUA 1GUMA 5DQYA 5B7CA 1XW5A 5B6NA 5IMAA 2HLSA 4ZB6A 3C71A 4KNDA 1B9YC 1FVKA 2OBIA 5J5NA 3GA4A 2FGXA 2H8LA 2H30A 1JFUA 5F0GA 4OFTA 1EP8A 2PPTA 5F8BA 3ZTLA 3WT2A 1MDIA 2CX4A 1YF1A 3F4TA 1T4ZA 5ID2B 3LJRA 2WB9A 1GWCA 2DMMA 2PGTA 2B5YA 2A2SA 1Z6NA 4Q5RA 3ZIJA 1ML6A 2REMA 3PR8A 3ERFA 3C1RA 1Y6EA 4KAEA 1AIUA 3ISOA 1GTAA 3QAVA 4ZBAA 1NM3A 4O32A 3WYWA 1K3OA 3RDWA 1SL2B 1O73A 5FWGA 3FZAA 4IW9A 3ZIVA 2IMEA 1AUCA 5EVOA 4GF0A 3WD6A 3ME7A 3MDKA 4MPGA 4IN0A 2GLRA 2LKUA 1F6MC 3GSTA 2C0DA 5AIVA 4EL1A 1ERUA 2WGRA 2I4AA 3KP9A 1R7HA 4WBJA 3UIWA 2IL3A 1ERTA 1GSYA 3UJ1A 2P5RA 4MF5A 1I5GA 1WOUA 4GWRA 4PGTA 1BX9A 4ULXA 5G30A 2D2ZA 3UBLA 2OE0A 2GZZA 3N9JA 3M8NA 2HYXA 2YZUA 4K2DA 3GRXA 3Q6OA 5CREA 1B8XA 2A2RA 1BYEA 2V6OA 2JACA 6GSUA 2O8VB 4RQRA 4MJEA 1OC9A 3ED3A 3H93A 1WPIA 3P8WA 4I2TA 5B8AA 5KEJA 5AISA 4POLA 1RQMA 2GZYA 1TK8B 1VGLA 1LJRA 3VLNA 1ST9A 1MDKA 3QDNA 1THOA 2IFQA 4KW6A 5H5RA 3GYKA 4TKYA 4WXTA 2H6ZA 2C3NA 3LFLA 1TOFA 2VO4A 2H6XA 2O87A 1ACVA 6GSVA 2H70A 2ZNMA 4IP1A 1TKDB 2R2JA 3F63A 3UARA 1WIKA 3HA9A 4X0XA 3WGDA 4GQFA 3FEUA 1QMVA 2VLVA 3DVWA 1X9WB 3RAZA 2AYTA 2JSZA 2PUKC 3GKKA 5DALA 3ERGA
chains in the Genus database with same CATH superfamily
2WJUA 1OKTA 1WE0A 1AQXA 1ZYEA 3IHQA 3KTBA 4EUYA 2IJYA 2QA2A 1SD8A 2YN1A 5J4UA 1F3BA 1A2JA 1VF3A 4AJ8A 4HU7A 2V32A 1YY7A 4IQAA 4FH8A 2LRTA 3C7MA 3HHVA 4EIPA 3TUEA 2QSIA 2XPEA 3PPUA 1YDKA 3TKSC 3ZREA 2R3XA 5KOWA 5IMVA 3ZFBA 2KP2A 2F8AA 1JLWA 2DBCA 1SU9A 2N5AA 1UN2A 2ON5A 1NSWA 1S3RA 4GSNA 2OBKA 1HNBA 5IPHA 1M99A 3UVTA 2B7JA 5DQSA 3EPTA 2F8FA 2HE3A 5KOXA 3GTUA 3KD0A 4V2LA 4HZ2A 2K18A 3HJPA 3BOAA 3NOFA 1DSBA 4CHSA 4LA1A 1HQOA 2PERA 3Q74A 3N5OA 4QL7A 5LNKe 4BL7A 2I81A 1PQNA 3GUSA 1M2AA 3LG6A 3VK9A 3U6VA 2ON7A 5B8BA 5ECRB 1XWKA 1A24A 4KE3A 1HNAA 1YEPA 4LL4B 1NW2A 5HR0A 5HR3A 3Q19A 4MNNA 1G6WA 1V58A 4XS4A 1J0FA 1X9SB 4F9ZA 1ABAA 3EVIA 3ZZXA 1TRUA 4JU5A 4EO3A 3TDGA 4MF7A 3MIXA 3TJBA 4ECJA 1V57A 2AV4A 1XWGA 5HFKA 4GLTA 2HRFA 4L8EA 1XCCA 1ERWA 2E0QA 4I6XA 4EXJA 2DJ1A 3IR4A 1OYJA 3G9BA 2MMZA 3GKMA 2MMAA 2P0GA 5GSSA 1B4PA 4WR4A 1LBKA 2GGTA 1OKDA 2FWHA 2JADA 1OC9B 2EIRA 1K0BA 2VLUA 3WT1A 5D9VA 5ECMB 2C0FA 2F3MA 4N10A 3IAS2 4FIWA 4HU9A 4DEJA 3A2VA 1OE7A 5F06A 1EGRA 2FWFA 3IXRA 3O6TA 4NHZA 3F6DA 3KTLA 2IFQB 3DMLA 2K8SA 3GSSA 2DJJA 2C4JA 4FO5A 1EEJA 2A2PA 1X9MB 5G1LA 4BA7A 1O7UA 2DIZA 2G0FA 4K7IA 2H0GA 2LRCA 1Q98A 2VIMA 3CSHA 2CAIA 2O85A 4F0CA 2GDRA 3CMIA 1V98A 3DYRA 1A2MA 1EV4A 4ILFA 1PFOA 3GURA 6GSXA 1DE1A 5JWRB 4PTSA 3UBKA 5HFIA 2HXKA 3WGXA 5DALB 2CA8A 3UL3A 5CRDA 3Q18A 2CVBA 4F03A 3HKRA 3D22A 4HEA2 3QD9A 1A8LA 3LSZA 2LEGA 1FVJA 1TK0B 2RM5A 1JZDA 3TJJA 13GSA 2H1GA 7GSSA 1USBA 3MWHA 2MZCA 3DD3A 4MZWA 5A4VA 1M2BA 2YWMA 4QL9A 5HQPA 3VWXA 5LD0A 4ECIA 3I43A 2C0EA 3GV1A 3QCPA 1A8YA 2PN8A 3TKSE 4MCUA 5EY6A 3PINA 3L0HA 1B48A 2X8CA 4IP6A 4HUAA 2C80A 3ZVJA 3ZL5A 2H0HA 4J57E 4KDUA 3C8EA 3E9JB 5IPGA 5JCGA 3TJFA 1SKSB 3MNGA 4MZCA 2YCDA 1T8EB 1G0TA 4EKZA 3LEFA 3DEXA 3W8SA 2LRNA 2L4CA 2WRTA 5BRTA 4P3YB 4TN8A 3GTUB 1SK2A 4JR6A 4AJ6A 4X1UA 2VL3A 2HSMA 4YKGA 4POBA 3MAKA 1UC7A 1VF4A 4I5QA 3P2AA 2YWOA 4L5OA 4KDXA 4XTSA 4WKWA 3FRCA 1N2AA 4BL7B 3IDVA 1BJXA 1LU4A 2WULA 1M2DA 3A5WA 1TDIA 1URMA 2X99A 5AGYA 1SKWB 1O81A 4KB3A 2N5FA 5CAXA 2H0IA 4KCAA 4EF0A 4XS4B 4G10A 3L9SA 4BVYA 4ACSA 3HXSA 3UMAA 4IVFA 1GTUA 1A23A 1GNEA 3VPTA 1OE8A 2K9FA 1T4YA 4MPFA 4H86A 4EC0A 3IOSA 2OACA 2PVQA 1PRXA 4MMMA 3KH9A 2MBSA 4ZL8A 2FA4A 2KLXA 5G2ZA 5KN1A 4CY6A 1MDJA 3PH9A 2YOIA 4GTUA 14GSA 3HZ8A 2H1AA 3FHKA 2IN3A 3GL3A 4GSSA 3KJYA 3TKPA 5CRHA 4HSCX 5DCGA 4K5SA 4Q5QA 3GIXA 2DJ3A 5A5KA 5JWOB 2XBIA 4RI6A 4J2FA 2H76A 2JZTA 1GUHA 2FY6A 1H4OA 2QGVA 3HVSA 2E2GA 3P90A 4XS6A 5DJMA 3APQA 3TKQA 2ZUPA 1Z3EA 4NAXA 3M1GA 2AUVA 3TB2A 1I9DA 2IWTA 2LJAA 3A2XA 5CRWA 3LORA 4ZBBA 1DBYA 4XRDA 1U87A 2A4VA 5F05A 4GQCA 3J7Yk 1SJ6A 3LQ7A 1UVZA 1S3AA 4OFMA 2I9HA 1ON4A 3KXOA 1TXXA 4PXOA 1PL1A 2B1LA 4OO4A 3HDCA 4ZILA 5JWQB 1OAZA 2B7KA 1BG5A 5ECKB 3R3EA 5JCWA 1SJZA 1U6TA 2K8VA 2CZ3A 4I97A 2R37A 1J08A 3KZQA 3GX8A 1YJ6A 3CSJA 20GSA 3BBYA 2GSSA 4Q5NA 2VCWA 4X4JA 1FOVA 1TRVA 2C3TA 2FUG2 3FZ5A 4ZL9A 1XVQA 5IMDA 4BWQA 5IIZA 3IAM2 3KH7A 4E8HA 4PUAA 1XXUA 2EC4A 2KOKA 2JSYA 1Z7PA 1F3AA 2OA7A 2FD3A 1EOGA 1MD3A 2RIIA 4KCEA 4IBPA 1M9BA 1T3BA 1O6JA 2R5GA 4HQSA 1DUGA 1XIYA 2I3YA 4CY8A 1X5DA 1VRSD 2MMNA 3A3TA 3BJ5A 3KMOA 1ZCPA 4ML1A 5D93A 2B5EA 5IOXA 5ECSA 2N5BA 2J9HA 2F51A 4K0GA 1XWBA 3M0FA 2PMTA 2A4HA 3GX0A 2VUPA 4EVMA 2HI7A 1PX6A 3DIEA 5F07A 1XPVA 2DC5A 4TW5A 4KH7A 4HS1A 3ZVJD 3LWAA 1KEBA 1K0AA 4N30A 2YNXA 2VD1A 1O8XA 2NVLA 2X8GA 2GSRA 3H8QA 4NPBA 1JZOA 3FW2A 3D6IA 2IMIA 5ECNB 2GZPA 5ELGA 1JZRA 1A0FA 2YV7A 3FR3A 2R0PA 2HZFA 2GQLA 4FQUA 4BVYB 2AB6A 3EC3A 1K0DA 2M46A 2LQQA 3HCZA 1E6BA 3HVXA 4OWYA 4FYUA 4Z2RA 2V2GA 2DJKA 3CTFA 1X5CA 4RI7A 2FA8A 4D73A 3O3TA 4BPYA 3F3QA 1GP1A 1M7TA 1TRSA 3TOUA 3L9VA 1B9XC 2H75A 1F9MA 1SENA 2MYGA 2J23A 2H66A 1K0CA 1PX7A 4FYCA 1ZYNA 2FHEA 1PN9A 2C3QA 1N8JA 3ZFLA 4I8BA 1ZYPA 1C72A 2L5OA 4Z2TA 1EEMA 4XRAA 1GLPA 2XC2A 3M9JA 1U88A 1EGOA 1K3YA 1IYIA 1XOBA 2LQOA 2RUEA 4ZB9A 3A2WA 2NPBA 2JL4A 4K7OA 4GCIA 2VCTA 1JZWA 4JRRA 1W89A 2YJ7A 4IJIA 4WEYA 1PMTA 2E7PA 1TP9A 3FZ9A 3KM6A 3FYGA 1Q4JA 3FR9A 1GSDA 1YZXA 1X5EA 3D4TA 4ID0A 2P5QA 1Y25A 2VL2C 3HVNA 5H5QA 3HZ4A 1YKAA 5ECHB 1VF1A 4EIQA 4TVEA 3TKSA 3J7Yb 3HYPA 2VM1A 4GRFA 2C0GA 4OCEA 5DBQA 5CYYA 2NTOA 2YWNA 3HD5A 5ECOB 4L0UA 2YWIA 1CQGA 1MD4A 3TGZA 4Z7XA 1SJIA 1YEXA 1XWAA 1WJKA 3G7YA 1XVWA 1IYHA 2G2QA 2DLXA 4WBRD 4O5UA 4HQZA 3ZITA 4BIKA 3QFBC 1XW9A 4KUNA 4NWYA 4AGSA 4XS1A 2CQ9A 4ICYA 1GSUA 2EIOA 3GL5A 3IHGA 4TR0A 5AIXA 2O89A 1BQ7A 2DSAA 2VLTA 1F2EA 3FZ4A 2MBTA 1TRWA 6GSYA 4WR5A 1O8WA 3FR6A 3TRPA 4JZQA 5IOWA 2LV3A 3D0ZA 1TU8A 5G5FA 3RBTA 3EU3A 5ELAA 3US3A 2GT6A 4Z2UA 1CQHA 3SBCA 5G5EA 4ISDA 1NHYA 4ZIJA 2B6MA 2H71A 4JEDA 2LTKA 2HNLA 4F0BA 3CXGA 5ENUA 2DKHA 1ZYQB 1ZZYA 2LNSA 5D8IA 1ZOFA 4ML6A 1XZOA 2AJQB 1OC8A 4L0WA 3H79A 4A5PA 5EL8A 5DAKA 3DWVA 5ECQB 2X49A 1E2YA 2YV9A 5CO3A 3G7IA 5FHIA 5GZZB 16GSA 3EE2A 2FLSA 1G6YA 2DMLA 4ZB8A 2R0GA 3EINA 2V41A 4D73B 5A4UA 4K7NA 3WGEA 2YZHA 2GSQA 3GKXA 4L5LA 1TTZA 3BCKA 4TOPA 4MJBA 2I1UA 2LNTA 4PNFA 1K0MA 3U5RE 4FYBA 1WRYA 4AJ7A 2BTOT 3TRXA 18GSA 1VF2A 3D4MA 2V6KA 5IMCA 5GSTA 1WWJA 1T1VA 4PX1A 3BD2A 4K8MA 4V2MA 3O76A 4KSMA 1GTBA 4EDZA 2DJ2A 4WETA 5JCUA 2VCQA 2ZCTA 1M3IA 6GSWA 3KMNA 5HR1A 3EU4A 1S3DA 4G9HA 2KHPA 4NMUA 5EPFA 3BCIA 4MABA 3F8UA 5A4WA 2L6CA 3EMXA 3QAGA 3ZLPA 2JU5A 4OD7A 5CNWA 4PQIA 4AF2A 2RLIA 1X0RA 4X43A 1Z5YE 1GULA 1XFLA 4O92A 4TR1A 3QMXA 1SKRB 5ECPB 3F4SA 3LXZA 3GHAA 10GSA 1O85A 1BAYA 4MK3A 3ME8A 2YANA 2C1YA 4MP4A 1KNGA 4HOJA 3HY2A 1TI1A 2CZ2A 2FNOA 2LSTA 1T7PB 2BMXA 3VI7A 5IQYA 3H4KA 2H1DA 5IMFA 1XOAA 2GVPA 3DRNA 2L5LA 1EWXA 3NZNA 2H01A 4JBBA 1PL2A 1W4VA 1Z9HA 2LJKA 3UVHA 5HR2A 2RM6A 1ZGNA 3LYKA 2K6VA 1U3AA 2CX3A 5KN2A 1PKWA 4RQXA 1HNCA 3TJKA 1PKZA 2B3SA 4YQVA 1PSQA 4V1Ag 2FWGA 3GKNA 1R5AA 3H1NA 3LW9A 3W6GA 4F2IA 2PWJA 4LL1B 5IO2A 2R4VA 1T00A 4TXVA 1FHEA 3IRAA 3I6AA 3G7JA 5BMUA 3K8NA 5L71A 3CBUA 4TXOA 4K1FA 3KP8A 3M3MA 1THXA 1ERVA 2UZ8A 3I69A 5INYA 4YAPA 1UA5A 5IO0A 3QAWA 5D9XA 2NDOA 2PBJA 3HJOA 4V1Ap 12GSA 1BEDA 4ZXGA 5C04A 1SK1A 4DSSA 4HDEA 1GSEA 1HD2A 2MMOA 3FKFA 1H75A 3RHBA 3APOA 4G2EA 3UOMA 2L57A 1QGVA 2B5XA 5LCZA 4MJCA 1SL0B 1AQWA 4MH3A 3DVXA 2NBSA 3P7XA 1F37A 5J3RA 3FK8A 3ZMKA 1GLQA 4TRXA 3F6FA 2FWEA 4OFNA 2CVKA 1QFNA 5D9TA 3CTGA 2L6DA 2LJRA 1V9WA 3CYNA 5J41A 3GMFA 5COHA 4IS0A 5KN3A 3C1SA 2H6YA 1M0UA 5DAKB 5HFGA 2GQKA 2VL9A 4HJMA 5FT3A 5J9CA 3TRQA 22GSA 4IJ3A 4POMA 3GN3A 1XBSA 2HZEA 17GSA 4KDYA 3EYTA 1OVNA 2VCZA 4OMVA 2WZ9A 4IELA 2X8HA 5G31A 3R2QA 3EMPA 2FCHA 3ERWA 3L9UA 3DGQA 3IK9A 2EIQA 3RPPA 2XHFA 4DSQA 3UAPA 2IMDA 2O7KA 5GAND 5DDLA 1TW9A 3KEBA 1EV9A 3VFIA 1ZL9A 2WS2A 2HT9A 5DJLA 2F9SA 5IM9A 3W8JA 1OC3A 4MF6A 2M80A 2GT5A 4CW9A 4USSA 2P31A 2QC7A 2BJXA 3VWVA 3QR6A 4N0ZA 4IKHA 1YKCA 3UEMA 4IQ1A 3VWUA 1SYRA 2VAFA 4ZL7A 1AW9A 1EZKA 4JR4A 3GH9A 4LMWA 3ZYWA 2CAQA 2TRXA 2YPMA 4LMVA 4WF5A 3CSIA 1QK8A 1ZMAA 3JCML 4MA9A 3TCOA 4KA0A 1YF0A 3IC4A 2AHEA 2IIYA 3D21A 1KTEA 2LUSA 1J9BA 4TR1B 3APSA 2GS3A 4EE0A 5B6MA 3KIJA 2WDUA 2DIYA 3OR5A 4POKA 3TJGA 1PD21 2M72A 1R4WA 2OE3A 2CV4A 4HJ2A 1GRXA 4GXZA 3EURA 4PNGA 3SWLA 3RHCA 2XPDA 3F4RA 3IK7A 1TJDA 4E8EA 1HYUA 2HRAA 4I2UA 2PU9C 2C8UA 2TIRA 2V1MA 2HSHA 4PQHA 3C73A 3HVVA 3FY7A 4MDCA 3F3RA 2GQMA 4ECCA 3RPNA 4KGIA 4OO5A 2B1KA 5H5SA 1QQ2A 1PGTA 4XCSA 1RK4A 3IBHA 3VPQA 3GH6A 1TU7A 3CQFA 1SYXA 4EDYA 1GL8A 1TI3A 4HZ4A 4PQ1A 4XHMA 2CVDA 3IE3A 3A5IA 1FG4A 1Z6MA 1ILOA 3LXTA 4LLRA 2OE1A 4YQUA 3L78A 3LYPA 2AAWA 4V2NA 4BWSA 3LGCA 4RUVA 4PURA 2DJ0A 5D9WA 3E0UA 4TXOB 3QOUA 8GSSA 1GH2A 1EOHA 3I9V2 4N0VA 5ECLB 1DE2A 1S3CA 2JZSA 5C00A 1FW1A 3VWWA 2DKIA 4CDOA 3TKRA 3AY8A 4MJAA 5ID2A 3VI5A 4F82A 2ES7A 4G0IA 3KGKA 1KBNA 2YJHA 4NXIA 3HJMA 4HI7A 3EWLA 2VCXA 4DSRA 5CP1A 2H19A 3QFAC 2H73A 4XIHA 4PUFC 4DSSB 2OKAA 3GFKA 4YQMA 3QPMA 5E59A 2KP1A 4ECBA 2L59A 5KN0A 1G7EA 2IMFA 1FO5A 6GSTA 1M9AA 3E3EA 4TR3A 1Z7RA 3V1WA 1JHBA 1FB0A 2H74A 1GSSA 1FOHA 1A0RP 1AQVA 2KUCA 5IMZA 2HFDA 1AXDA 3D5JA 4NV2A 1R26A 3MYDA 4BVXA 3S9FA 9GSSA 1RW1A 2HZEB 1AC1A 4K0NA 2WFCA 3M9KA 3CRTA 1MEKA 1GUKA 4O5RA 1A2LA 4Q5FA 2R6KA 4K6XA 2CT6A 19GSA 1TK5B 2L4QA 3TOTA 4IGJA 1EP7A 5D96A 4TR4A 2VD0A 2VOCA 4J56E 3IPZA 4MLYA 5ABRA 1YQ1A 1FAAA 3MSZA 2VL2A 1K0NA 1V2AA 1R5PA 3ZRDA 2ALBA 2H1BA 2JZRA 2VCVA 2IPAA 1K3LA 5G1KA 3IV4A 4GSTA 4DVCA 4JE1A 3PGTA 1U3IA 5DCHA 3IA1A 2X64A 3CRUA 3GNJA 1QXHA 11GSA 1FB6A 1GSQA 3F9UA 1JLVA 4MZBA 4NHWA 1MTCA 2WCIA 1G7OA 2OADA 3ZMLA 5DVBA 4YAVA 4ZBDA 1PA3A 2E2MA 1GSFA 1SL1B 2IMKA 3DXBA 2TRCP 1K0OA 2LS5A 5D73A 4O7HA 1XWCA 3F0IA 2HSYA 4MH2A 5J9BA 5AN1A 4OCFA 1V40A 2XBQA 4NV5A 4G19A 1B4QA 3NIVA 2QA1A 3VURA 4WF4A 1AAZA 2HRNA 2YP6A 2GSTA 3DKSA 4YH2A 4KX4A 2Z9SA 1WP0A 2X4AA 5ECIB 2OJLA 1GNWA 3L4NA 1QUWA 2GTUA 1GTIA 2H72A 2VM2A 4N11A 5E4WA 2R0CA 5GAPD 2RUFA 4QQ7A 1WMJA 1SD9A 1NHOA 4K9ZA 1XW6A 1SK0A 1XG8A 2PVOC 4KF9A 3KCMA 4KSOA 6GSSA 2QKEA 5CRGA 4IHUA 1GUMA 5DQYA 5B7CA 1XW5A 5B6NA 5IMAA 2HLSA 4ZB6A 3C71A 4KNDA 1B9YC 1FVKA 2OBIA 5J5NA 3GA4A 2FGXA 2H8LA 2H30A 1JFUA 5F0GA 4OFTA 1EP8A 2PPTA 5F8BA 3ZTLA 3WT2A 1MDIA 2CX4A 1YF1A 3F4TA 1T4ZA 5ID2B 3LJRA 2WB9A 1GWCA 2DMMA 2PGTA 2B5YA 2A2SA 1Z6NA 4Q5RA 3ZIJA 3IC8A 1ML6A 2REMA 3PR8A 3ERFA 3C1RA 1Y6EA 4KAEA 1AIUA 3ISOA 1GTAA 3QAVA 4ZBAA 1NM3A 4O32A 3WYWA 1K3OA 3RDWA 1SL2B 1O73A 5FWGA 3FZAA 4IW9A 3ZIVA 2IMEA 1AUCA 5EVOA 4GF0A 3WD6A 3ME7A 3MDKA 4MPGA 4IN0A 2GLRA 2LKUA 1F6MC 3GSTA 2C0DA 5AIVA 4EL1A 4BVXB 1ERUA 2WGRA 2I4AA 3KP9A 1R7HA 4WBJA 3UIWA 2IL3A 1ERTA 1GSYA 3UJ1A 2P5RA 4MF5A 4K2XA 1I5GA 1WOUA 4GWRA 4PGTA 1BX9A 4ULXA 5G30A 2D2ZA 3UBLA 2OE0A 2GZZA 3N9JA 3M8NA 2HYXA 2YZUA 4G0LA 4K2DA 4O5QA 3GRXA 3Q6OA 5CREA 1B8XA 2A2RA 1BYEA 2V6OA 2JACA 1M3JA 6GSUA 2O8VB 4RQRA 4MJEA 1OC9A 3ED3A 3H93A 1WPIA 3P8WA 2HRKA 4I2TA 5B8AA 5KEJA 5AISA 4POLA 1RQMA 2GZYA 1TK8B 1VGLA 1LJRA 3VLNA 4G0KA 1ST9A 1MDKA 3QDNA 1THOA 2IFQA 4KW6A 5H5RA 3GYKA 4TKYA 4WXTA 2H6ZA 2C3NA 3LFLA 4K5RA 1TOFA 2VO4A 2H6XA 2O87A 1ACVA 6GSVA 2H70A 2ZNMA 4IP1A 1TKDB 2R2JA 3F63A 3FMWA 3UARA 1WIKA 1PN0A 3HA9A 4X0XA 3WGDA 4YKFA 4GQFA 3FEUA 1QMVA 2VLVA 3DVWA 1X9WB 3RAZA 2AYTA 2JSZA 2PUKC 3GKKA 5DALA 3ERGA
chains in the Genus database with same CATH topology
2WJUA 1OKTA 1WE0A 1AQXA 1ZYEA 3IHQA 3KTBA 4EUYA 2IJYA 2QA2A 1SD8A 2YN1A 5J4UA 1F3BA 1A2JA 1VF3A 4AJ8A 4HU7A 2V32A 1YY7A 4IQAA 4FH8A 2LRTA 3C7MA 3HHVA 4EIPA 3TUEA 2QSIA 2XPEA 3PPUA 1YDKA 3TKSC 3ZREA 2R3XA 5KOWA 5IMVA 3ZFBA 2KP2A 2F8AA 1JLWA 2DBCA 1SU9A 2N5AA 1UN2A 2ON5A 1NSWA 4GSNA 2OBKA 1HNBA 5IPHA 1M99A 3UVTA 2B7JA 5DQSA 3EPTA 2F8FA 2HE3A 5KOXA 3GTUA 3KD0A 4V2LA 4HZ2A 2K18A 3HJPA 3BOAA 3NOFA 1DSBA 4CHSA 4LA1A 1HQOA 2PERA 3Q74A 3N5OA 4QL7A 5LNKe 4BL7A 2I81A 1PQNA 3GUSA 1M2AA 3LG6A 3VK9A 3U6VA 2ON7A 5B8BA 5ECRB 1XWKA 1A24A 4KE3A 1HNAA 1YEPA 4LL4B 1NW2A 5HR0A 5HR3A 3Q19A 4MNNA 1G6WA 1V58A 4XS4A 1J0FA 1X9SB 4F9ZA 1ABAA 3EVIA 3ZZXA 1TRUA 4JU5A 4EO3A 3TDGA 4MF7A 3MIXA 3TJBA 4ECJA 1V57A 2AV4A 1XWGA 5HFKA 4GLTA 2HRFA 4L8EA 1XCCA 1ERWA 2E0QA 4I6XA 4EXJA 2DJ1A 3IR4A 1OYJA 3G9BA 2MMZA 3GKMA 2MMAA 2P0GA 5GSSA 1B4PA 4WR4A 1LBKA 2GGTA 1OKDA 2FWHA 2JADA 1OC9B 2EIRA 1K0BA 2VLUA 3WT1A 5D9VA 5ECMB 2C0FA 2F3MA 4N10A 3IAS2 4FIWA 4HU9A 4DEJA 3A2VA 1OE7A 5F06A 1EGRA 2FWFA 3IXRA 3O6TA 4NHZA 3F6DA 3KTLA 2IFQB 3DMLA 2K8SA 3GSSA 2DJJA 2C4JA 4FO5A 1EEJA 2A2PA 1X9MB 5G1LA 4BA7A 1O7UA 2DIZA 2G0FA 4K7IA 2H0GA 2LRCA 1Q98A 2VIMA 3CSHA 2CAIA 2O85A 4F0CA 2GDRA 3CMIA 1V98A 3DYRA 1A2MA 1EV4A 4ILFA 3GURA 6GSXA 1DE1A 5JWRB 4PTSA 3UBKA 5HFIA 2HXKA 3WGXA 5DALB 2CA8A 3UL3A 5CRDA 3Q18A 2CVBA 4F03A 3HKRA 3D22A 4HEA2 3QD9A 1A8LA 3LSZA 2LEGA 1FVJA 1TK0B 2RM5A 1JZDA 3TJJA 13GSA 2H1GA 7GSSA 1USBA 3MWHA 2MZCA 3DD3A 4MZWA 5A4VA 1M2BA 2YWMA 4QL9A 5HQPA 3VWXA 5LD0A 4ECIA 3I43A 2C0EA 3GV1A 3QCPA 1A8YA 2PN8A 3TKSE 4MCUA 5EY6A 3PINA 3L0HA 1B48A 2X8CA 4IP6A 4HUAA 2C80A 3ZVJA 3ZL5A 2H0HA 4J57E 4KDUA 3C8EA 3E9JB 5IPGA 5JCGA 3TJFA 1SKSB 3MNGA 4MZCA 2YCDA 1T8EB 1G0TA 4EKZA 3LEFA 3DEXA 3W8SA 2LRNA 2L4CA 2WRTA 5BRTA 4P3YB 4TN8A 3GTUB 1SK2A 4JR6A 4AJ6A 4X1UA 2VL3A 2HSMA 4YKGA 4POBA 3MAKA 1UC7A 1VF4A 4I5QA 3P2AA 2YWOA 4L5OA 4KDXA 4XTSA 4WKWA 3FRCA 1N2AA 4BL7B 3IDVA 1BJXA 1LU4A 2WULA 1M2DA 3A5WA 1TDIA 1URMA 2X99A 5AGYA 1SKWB 1O81A 4KB3A 2N5FA 5CAXA 2H0IA 4KCAA 4EF0A 4XS4B 4G10A 3L9SA 4BVYA 4ACSA 3HXSA 3UMAA 4IVFA 1GTUA 1A23A 1GNEA 3VPTA 1OE8A 2K9FA 1T4YA 4MPFA 4H86A 4EC0A 3IOSA 2OACA 2PVQA 1PRXA 4MMMA 3KH9A 2MBSA 4ZL8A 2FA4A 2KLXA 5G2ZA 5KN1A 4CY6A 1MDJA 3PH9A 2YOIA 4GTUA 14GSA 3HZ8A 2H1AA 3FHKA 2IN3A 3GL3A 4GSSA 3KJYA 3TKPA 5CRHA 5DCGA 4K5SA 4Q5QA 3GIXA 2DJ3A 5A5KA 5JWOB 2XBIA 4RI6A 4J2FA 2H76A 2JZTA 1GUHA 2FY6A 1H4OA 2QGVA 3HVSA 2E2GA 3P90A 4XS6A 5DJMA 3APQA 3TKQA 2ZUPA 1Z3EA 4NAXA 3M1GA 2AUVA 3TB2A 1I9DA 2IWTA 2LJAA 3A2XA 5CRWA 3LORA 4ZBBA 1DBYA 4XRDA 1U87A 2A4VA 5F05A 4GQCA 3J7Yk 1SJ6A 3LQ7A 1UVZA 1S3AA 4OFMA 2I9HA 1ON4A 3KXOA 1TXXA 4PXOA 1PL1A 2B1LA 4OO4A 3HDCA 4ZILA 5JWQB 1OAZA 2B7KA 1BG5A 5ECKB 3R3EA 5JCWA 1SJZA 1U6TA 2K8VA 2CZ3A 4I97A 2R37A 1J08A 3KZQA 3GX8A 1YJ6A 3CSJA 20GSA 3BBYA 2GSSA 4Q5NA 2VCWA 4X4JA 1FOVA 1TRVA 2C3TA 2FUG2 3FZ5A 4ZL9A 1XVQA 5IMDA 4BWQA 5IIZA 3IAM2 3KH7A 4E8HA 4PUAA 1XXUA 2EC4A 2KOKA 2JSYA 1Z7PA 1F3AA 2OA7A 2FD3A 1EOGA 1MD3A 2RIIA 4KCEA 4IBPA 1M9BA 1T3BA 1O6JA 2R5GA 4HQSA 1DUGA 1XIYA 2I3YA 4CY8A 1X5DA 1VRSD 2MMNA 3A3TA 3BJ5A 3KMOA 1ZCPA 4ML1A 5D93A 2B5EA 5IOXA 5ECSA 2N5BA 2J9HA 2F51A 4K0GA 1XWBA 3M0FA 2PMTA 2A4HA 3GX0A 2VUPA 4EVMA 2HI7A 1PX6A 3DIEA 5F07A 1XPVA 2DC5A 4TW5A 4KH7A 4HS1A 3ZVJD 3LWAA 1KEBA 1K0AA 4N30A 2YNXA 2VD1A 1O8XA 2NVLA 2X8GA 2GSRA 3H8QA 4NPBA 1JZOA 3FW2A 3D6IA 2IMIA 5ECNB 2GZPA 5ELGA 1JZRA 1A0FA 2YV7A 3FR3A 2R0PA 2HZFA 2GQLA 4FQUA 4BVYB 2AB6A 3EC3A 1K0DA 2M46A 2LQQA 3HCZA 1E6BA 3HVXA 4OWYA 4FYUA 4Z2RA 2V2GA 2DJKA 3CTFA 1X5CA 4RI7A 2FA8A 4D73A 3O3TA 4BPYA 3F3QA 1GP1A 1M7TA 1TRSA 3TOUA 3L9VA 1B9XC 2H75A 1F9MA 1SENA 2MYGA 2J23A 2H66A 1K0CA 1PX7A 4FYCA 1ZYNA 2FHEA 1PN9A 2C3QA 1N8JA 3ZFLA 4I8BA 1ZYPA 1C72A 2L5OA 4Z2TA 1EEMA 4XRAA 1GLPA 2XC2A 3M9JA 1U88A 1EGOA 1K3YA 1IYIA 1XOBA 2LQOA 2RUEA 4ZB9A 3A2WA 2NPBA 2JL4A 4K7OA 4GCIA 2VCTA 1JZWA 4JRRA 1W89A 2YJ7A 4IJIA 4WEYA 1PMTA 2E7PA 1TP9A 3FZ9A 3KM6A 3FYGA 1Q4JA 3FR9A 1GSDA 1YZXA 1X5EA 3D4TA 4ID0A 2P5QA 1Y25A 2VL2C 5H5QA 3HZ4A 1YKAA 5ECHB 1VF1A 4EIQA 4TVEA 3TKSA 3J7Yb 3HYPA 2VM1A 4GRFA 2C0GA 4OCEA 5DBQA 5CYYA 2NTOA 2YWNA 3HD5A 5ECOB 4L0UA 2YWIA 1CQGA 1MD4A 3TGZA 4Z7XA 1SJIA 1YEXA 1XWAA 1WJKA 3G7YA 1XVWA 1IYHA 2G2QA 2DLXA 4WBRD 4O5UA 4HQZA 3ZITA 3QFBC 1XW9A 4KUNA 4NWYA 4AGSA 4XS1A 2CQ9A 4ICYA 1GSUA 2EIOA 3GL5A 3IHGA 4TR0A 5AIXA 2O89A 1BQ7A 2DSAA 2VLTA 1F2EA 3FZ4A 2MBTA 1TRWA 6GSYA 4WR5A 1O8WA 3FR6A 3TRPA 4JZQA 5IOWA 2LV3A 3D0ZA 1TU8A 5G5FA 3RBTA 3EU3A 5ELAA 3US3A 2GT6A 4Z2UA 1CQHA 3SBCA 5G5EA 4ISDA 1NHYA 4ZIJA 2B6MA 2H71A 4JEDA 2LTKA 2HNLA 4F0BA 3CXGA 5ENUA 2DKHA 1ZYQB 1ZZYA 2LNSA 5D8IA 1ZOFA 4ML6A 1XZOA 2AJQB 1OC8A 4L0WA 3H79A 4A5PA 5EL8A 5DAKA 3DWVA 5ECQB 2X49A 1E2YA 2YV9A 5CO3A 3G7IA 5FHIA 5GZZB 16GSA 3EE2A 2FLSA 1G6YA 2DMLA 4ZB8A 2R0GA 3EINA 2V41A 4D73B 5A4UA 4K7NA 3WGEA 2YZHA 2GSQA 3GKXA 4L5LA 1TTZA 3BCKA 4TOPA 4MJBA 2I1UA 2LNTA 4PNFA 1K0MA 3U5RE 4FYBA 1WRYA 4AJ7A 2BTOT 3TRXA 18GSA 1VF2A 3D4MA 2V6KA 5IMCA 5GSTA 1WWJA 1T1VA 4PX1A 3BD2A 4K8MA 4V2MA 3O76A 4KSMA 1GTBA 4EDZA 2DJ2A 4WETA 5JCUA 2VCQA 2ZCTA 6GSWA 3KMNA 5HR1A 3EU4A 1S3DA 4G9HA 2KHPA 4NMUA 5EPFA 3BCIA 4MABA 3F8UA 5A4WA 2L6CA 3EMXA 3QAGA 3ZLPA 2JU5A 4OD7A 5CNWA 4PQIA 4AF2A 2RLIA 1X0RA 4X43A 1Z5YE 1GULA 1XFLA 4O92A 4TR1A 3QMXA 1SKRB 5ECPB 3F4SA 3LXZA 3GHAA 10GSA 1O85A 1BAYA 4MK3A 3ME8A 2YANA 2C1YA 4MP4A 1KNGA 4HOJA 3HY2A 1TI1A 2CZ2A 2FNOA 2LSTA 1T7PB 2BMXA 3VI7A 5IQYA 3H4KA 2H1DA 5IMFA 1XOAA 2GVPA 3DRNA 2L5LA 1EWXA 3NZNA 2H01A 4JBBA 1PL2A 1W4VA 1Z9HA 2LJKA 3UVHA 5HR2A 2RM6A 1ZGNA 3LYKA 2K6VA 1U3AA 2CX3A 5KN2A 1PKWA 4RQXA 1HNCA 3TJKA 1PKZA 2B3SA 4YQVA 1PSQA 4V1Ag 2FWGA 3GKNA 1R5AA 3H1NA 3LW9A 3W6GA 4F2IA 2PWJA 4LL1B 5IO2A 2R4VA 1T00A 4TXVA 1FHEA 3IRAA 3I6AA 3G7JA 5BMUA 3K8NA 5L71A 3CBUA 4TXOA 4K1FA 3KP8A 3M3MA 1THXA 1ERVA 2UZ8A 3I69A 5INYA 4YAPA 1UA5A 5IO0A 3QAWA 5D9XA 2NDOA 2PBJA 3HJOA 4V1Ap 12GSA 1BEDA 4ZXGA 5C04A 1SK1A 4DSSA 4HDEA 1GSEA 1HD2A 2MMOA 3FKFA 1H75A 3RHBA 3APOA 4G2EA 3UOMA 2L57A 1QGVA 2B5XA 5LCZA 4MJCA 1SL0B 1AQWA 4MH3A 3DVXA 2NBSA 3P7XA 1F37A 5J3RA 3FK8A 3ZMKA 1GLQA 4TRXA 3F6FA 2FWEA 4OFNA 2CVKA 1QFNA 5D9TA 3CTGA 2L6DA 2LJRA 1V9WA 3CYNA 5J41A 3GMFA 5COHA 4IS0A 5KN3A 3C1SA 2H6YA 1M0UA 5DAKB 5HFGA 2GQKA 2VL9A 4HJMA 5FT3A 5J9CA 3TRQA 22GSA 4IJ3A 4POMA 3GN3A 1XBSA 2HZEA 17GSA 4KDYA 3EYTA 1OVNA 2VCZA 4OMVA 2WZ9A 4IELA 2X8HA 5G31A 3R2QA 3EMPA 2FCHA 3ERWA 3L9UA 3DGQA 3IK9A 2EIQA 3RPPA 2XHFA 4DSQA 3UAPA 2IMDA 2O7KA 5GAND 5DDLA 1TW9A 3KEBA 1EV9A 3VFIA 1ZL9A 2WS2A 2HT9A 5DJLA 2F9SA 5IM9A 3W8JA 1OC3A 4MF6A 2M80A 2GT5A 4CW9A 4USSA 2P31A 2QC7A 2BJXA 3VWVA 3QR6A 4N0ZA 4IKHA 1YKCA 3UEMA 4IQ1A 3VWUA 1SYRA 2VAFA 4ZL7A 1AW9A 1EZKA 4JR4A 3GH9A 4LMWA 3ZYWA 2CAQA 2TRXA 2YPMA 4LMVA 4WF5A 3CSIA 1QK8A 1ZMAA 3JCML 4MA9A 3TCOA 4KA0A 1YF0A 3IC4A 2AHEA 2IIYA 3D21A 1KTEA 2LUSA 1J9BA 4TR1B 3APSA 2GS3A 4EE0A 5B6MA 3KIJA 2WDUA 2DIYA 3OR5A 4POKA 3TJGA 1PD21 2M72A 1R4WA 2OE3A 2CV4A 4HJ2A 1GRXA 4GXZA 3EURA 4PNGA 3SWLA 3RHCA 2XPDA 3F4RA 3IK7A 1TJDA 4E8EA 1HYUA 2HRAA 4I2UA 2PU9C 2C8UA 2TIRA 2V1MA 2HSHA 4PQHA 3C73A 3HVVA 3FY7A 4MDCA 3F3RA 2GQMA 4ECCA 3RPNA 4KGIA 4OO5A 2B1KA 5H5SA 1QQ2A 1PGTA 4XCSA 1RK4A 3IBHA 3VPQA 3GH6A 1TU7A 1SYXA 4EDYA 1GL8A 1TI3A 4HZ4A 4PQ1A 4XHMA 2CVDA 3IE3A 3A5IA 1FG4A 1Z6MA 1ILOA 3LXTA 4LLRA 2OE1A 4YQUA 3L78A 3LYPA 2AAWA 4V2NA 4BWSA 3LGCA 4RUVA 4PURA 2DJ0A 5D9WA 3E0UA 4TXOB 3QOUA 8GSSA 1GH2A 1EOHA 3I9V2 4N0VA 5ECLB 1DE2A 1S3CA 2JZSA 5C00A 1FW1A 3VWWA 2DKIA 4CDOA 3TKRA 3AY8A 4MJAA 5ID2A 3VI5A 4F82A 2ES7A 4G0IA 3KGKA 1KBNA 2YJHA 4NXIA 3HJMA 4HI7A 3EWLA 2VCXA 4DSRA 5CP1A 2H19A 3QFAC 2H73A 4XIHA 4PUFC 4DSSB 2OKAA 3GFKA 4YQMA 3QPMA 5E59A 2KP1A 4ECBA 2L59A 5KN0A 1G7EA 2IMFA 1FO5A 6GSTA 1M9AA 3E3EA 4TR3A 1Z7RA 3V1WA 1JHBA 1FB0A 2H74A 1GSSA 1FOHA 1A0RP 1AQVA 2KUCA 5IMZA 2HFDA 1AXDA 3D5JA 4NV2A 1R26A 3MYDA 4BVXA 3S9FA 9GSSA 1RW1A 2HZEB 1AC1A 4K0NA 2WFCA 3M9KA 3CRTA 1MEKA 1GUKA 4O5RA 1A2LA 4Q5FA 2R6KA 4K6XA 2CT6A 19GSA 1TK5B 2L4QA 3TOTA 4IGJA 1EP7A 5D96A 4TR4A 2VD0A 2VOCA 4J56E 3IPZA 4MLYA 5ABRA 1YQ1A 1FAAA 3MSZA 2VL2A 1K0NA 1V2AA 1R5PA 3ZRDA 2ALBA 2H1BA 2JZRA 2VCVA 2IPAA 1K3LA 5G1KA 3IV4A 4GSTA 4DVCA 4JE1A 3PGTA 1U3IA 5DCHA 3IA1A 2X64A 3CRUA 3GNJA 1QXHA 11GSA 1FB6A 1GSQA 3F9UA 1JLVA 4MZBA 4NHWA 1MTCA 2WCIA 1G7OA 2OADA 3ZMLA 5DVBA 4YAVA 4ZBDA 1PA3A 2E2MA 1GSFA 1SL1B 2IMKA 3DXBA 2TRCP 1K0OA 2LS5A 5D73A 4O7HA 1XWCA 3F0IA 2HSYA 4MH2A 5J9BA 5AN1A 4OCFA 1V40A 2XBQA 4NV5A 4G19A 1B4QA 3NIVA 2QA1A 3VURA 4WF4A 1AAZA 2HRNA 2YP6A 2GSTA 3DKSA 4YH2A 4KX4A 2Z9SA 1WP0A 2X4AA 5ECIB 2OJLA 1GNWA 3L4NA 1QUWA 2GTUA 1GTIA 2H72A 2VM2A 4N11A 5E4WA 2R0CA 5GAPD 2RUFA 4QQ7A 1WMJA 1SD9A 1NHOA 4K9ZA 1XW6A 1SK0A 2PVOC 4KF9A 3KCMA 4KSOA 6GSSA 2QKEA 5CRGA 4IHUA 1GUMA 5DQYA 5B7CA 1XW5A 5B6NA 5IMAA 2HLSA 4ZB6A 3C71A 4KNDA 1B9YC 1FVKA 2OBIA 5J5NA 3GA4A 2FGXA 2H8LA 2H30A 1JFUA 5F0GA 4OFTA 1EP8A 2PPTA 5F8BA 3ZTLA 3WT2A 1MDIA 2CX4A 1YF1A 3F4TA 1T4ZA 5ID2B 3LJRA 2WB9A 1GWCA 2DMMA 2PGTA 2B5YA 2A2SA 1Z6NA 4Q5RA 3ZIJA 3IC8A 1ML6A 2REMA 3PR8A 3ERFA 3C1RA 1Y6EA 4KAEA 1AIUA 3ISOA 1GTAA 3QAVA 4ZBAA 1NM3A 4O32A 3WYWA 1K3OA 3RDWA 1SL2B 1O73A 5FWGA 3FZAA 4IW9A 3ZIVA 2IMEA 1AUCA 5EVOA 4GF0A 3WD6A 3ME7A 3MDKA 4MPGA 4IN0A 2GLRA 2LKUA 1F6MC 3GSTA 2C0DA 5AIVA 4EL1A 4BVXB 1ERUA 2WGRA 2I4AA 3KP9A 1R7HA 4WBJA 3UIWA 2IL3A 1ERTA 1GSYA 3UJ1A 2P5RA 4MF5A 4K2XA 1I5GA 1WOUA 4GWRA 4PGTA 1BX9A 4ULXA 5G30A 2D2ZA 3UBLA 2OE0A 2GZZA 3N9JA 3M8NA 2HYXA 2YZUA 4G0LA 4K2DA 4O5QA 3GRXA 3Q6OA 5CREA 1B8XA 2A2RA 1BYEA 2V6OA 2JACA 6GSUA 2O8VB 4RQRA 4MJEA 1OC9A 3ED3A 3H93A 1WPIA 3P8WA 2HRKA 4I2TA 5B8AA 5KEJA 5AISA 4POLA 1RQMA 2GZYA 1TK8B 1VGLA 1LJRA 3VLNA 4G0KA 1ST9A 1MDKA 3QDNA 1THOA 2IFQA 4KW6A 5H5RA 3GYKA 4TKYA 4WXTA 2H6ZA 2C3NA 3LFLA 4K5RA 1TOFA 2VO4A 2H6XA 2O87A 1ACVA 6GSVA 2H70A 2ZNMA 4IP1A 1TKDB 2R2JA 3F63A 3FMWA 3UARA 1WIKA 1PN0A 3HA9A 4X0XA 3WGDA 4YKFA 4GQFA 3FEUA 1QMVA 2VLVA 3DVWA 1X9WB 3RAZA 2AYTA 2JSZA 2PUKC 3GKKA 5DALA 3ERGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WJU A;  1OKT A;  1WE0 A;  1AQX A;  1ZYE A;  3IHQ A;  3KTB A;  4EUY A;  2IJY A;  1SD8 A;  2YN1 A;  5J4U A;  1F3B A;  1A2J A;  1VF3 A;  4AJ8 A;  4HU7 A;  2V32 A;  1YY7 A;  4IQA A;  4FH8 A;  2LRT A;  3C7M A;  3HHV A;  3TUE A;  2QSI A;  2XPE A;  1YDK A;  3TKS C;  3ZRE A;  2R3X A;  5IMV A;  3ZFB A;  2KP2 A;  2F8A A;  1JLW A;  2DBC A;  1SU9 A;  2N5A A;  1UN2 A;  2ON5 A;  1NSW A;  4GSN A;  2OBK A;  1HNB A;  5IPH A;  1M99 A;  3UVT A;  2B7J A;  5DQS A;  2F8F A;  2HE3 A;  3GTU A;  3KD0 A;  4V2L A;  4HZ2 A;  2K18 A;  3HJP A;  3BOA A;  3NOF A;  1DSB A;  4CHS A;  4LA1 A;  1HQO A;  2PER A;  3Q74 A;  3N5O A;  4QL7 A;  5LNK e;  4BL7 A;  2I81 A;  1PQN A;  3GUS A;  1M2A A;  3LG6 A;  3VK9 A;  3U6V A;  2ON7 A;  5B8B A;  5ECR B;  1XWK A;  1A24 A;  4KE3 A;  1HNA A;  1YEP A;  4LL4 B;  1NW2 A;  5HR0 A;  5HR3 A;  3Q19 A;  1G6W A;  1V58 A;  4XS4 A;  1J0F A;  1X9S B;  4F9Z A;  1ABA A;  3EVI A;  3ZZX A;  1TRU A;  4JU5 A;  4EO3 A;  3TDG A;  4MF7 A;  4ECJ A;  3TJB A;  1V57 A;  2AV4 A;  1XWG A;  5HFK A;  4GLT A;  2HRF A;  4L8E A;  1XCC A;  1ERW A;  2E0Q A;  4I6X A;  4EXJ A;  2DJ1 A;  3IR4 A;  1OYJ A;  3G9B A;  2MMZ A;  3GKM A;  2MMA A;  2P0G A;  5GSS A;  1B4P A;  4WR4 A;  1LBK A;  2GGT A;  1OKD A;  2FWH A;  2JAD A;  1OC9 B;  2EIR A;  1K0B A;  2VLU A;  3WT1 A;  5D9V A;  5ECM B;  2C0F A;  2F3M A;  4N10 A;  3IAS 2;  4FIW A;  4HU9 A;  4DEJ A;  3A2V A;  1OE7 A;  5F06 A;  1EGR A;  2FWF A;  3IXR A;  3O6T A;  4NHZ A;  3F6D A;  3KTL A;  2IFQ B;  3DML A;  2K8S A;  3GSS A;  2DJJ A;  2C4J A;  4FO5 A;  1EEJ A;  1X9M B;  5G1L A;  4BA7 A;  1O7U A;  2DIZ A;  2G0F A;  4K7I A;  2H0G A;  2LRC A;  1Q98 A;  2VIM A;  3CSH A;  2CAI A;  2O85 A;  4F0C A;  2GDR A;  3CMI A;  1V98 A;  3DYR A;  1A2M A;  1EV4 A;  4ILF A;  3GUR A;  6GSX A;  1DE1 A;  5JWR B;  3UBK A;  5HFI A;  2HXK A;  3WGX A;  5DAL B;  2CA8 A;  3UL3 A;  5CRD A;  3Q18 A;  2CVB A;  4F03 A;  3HKR A;  3D22 A;  4HEA 2;  3QD9 A;  1A8L A;  3LSZ A;  2LEG A;  1FVJ A;  1TK0 B;  2RM5 A;  1JZD A;  3TJJ A;  13GS A;  2H1G A;  7GSS A;  1USB A;  3MWH A;  2MZC A;  3DD3 A;  4MZW A;  5A4V A;  1M2B A;  2YWM A;  4QL9 A;  5HQP A;  3VWX A;  5LD0 A;  4ECI A;  3I43 A;  2C0E A;  3GV1 A;  3QCP A;  1A8Y A;  2PN8 A;  3TKS E;  4MCU A;  5EY6 A;  3PIN A;  3L0H A;  1B48 A;  2X8C A;  4IP6 A;  4HUA A;  2C80 A;  3ZVJ A;  3ZL5 A;  2H0H A;  4J57 E;  4KDU A;  3C8E A;  3E9J B;  5IPG A;  5JCG A;  3TJF A;  1SKS B;  3MNG A;  4MZC A;  2YCD A;  1T8E B;  1G0T A;  4EKZ A;  3LEF A;  3DEX A;  3W8S A;  2LRN A;  2L4C A;  2WRT A;  4P3Y B;  4TN8 A;  3GTU B;  1SK2 A;  4JR6 A;  4AJ6 A;  4X1U A;  2VL3 A;  4POB A;  3MAK A;  1UC7 A;  1VF4 A;  4I5Q A;  3P2A A;  2YWO A;  4L5O A;  4KDX A;  4XTS A;  4WKW A;  3FRC A;  1N2A A;  3IDV A;  1BJX A;  1LU4 A;  2WUL A;  1M2D A;  3A5W A;  1TDI A;  1URM A;  2X99 A;  5AGY A;  1SKW B;  1O81 A;  4KB3 A;  2N5F A;  5CAX A;  2H0I A;  4KCA A;  4EF0 A;  4XS4 B;  4G10 A;  3L9S A;  4BVY A;  4ACS A;  3HXS A;  3UMA A;  4IVF A;  1GTU A;  1A23 A;  1GNE A;  3VPT A;  1OE8 A;  2K9F A;  1T4Y A;  4MPF A;  4H86 A;  4EC0 A;  3IOS A;  2OAC A;  2PVQ A;  1PRX A;  4MMM A;  3KH9 A;  2MBS A;  4ZL8 A;  2FA4 A;  2KLX A;  5G2Z A;  5KN1 A;  1MDJ A;  3PH9 A;  2YOI A;  4GTU A;  14GS A;  3HZ8 A;  2H1A A;  3FHK A;  2IN3 A;  3GL3 A;  4GSS A;  3KJY A;  3TKP A;  5CRH A;  5DCG A;  4Q5Q A;  3GIX A;  2DJ3 A;  5A5K A;  5JWO B;  2XBI A;  4RI6 A;  4J2F A;  2H76 A;  2JZT A;  1GUH A;  2FY6 A;  1H4O A;  2QGV A;  3HVS A;  2E2G A;  3P90 A;  4XS6 A;  5DJM A;  3APQ A;  3TKQ A;  2ZUP A;  1Z3E A;  4NAX A;  3M1G A;  2AUV A;  3TB2 A;  1I9D A;  2IWT A;  2LJA A;  3A2X A;  5CRW A;  3LOR A;  4ZBB A;  1DBY A;  4XRD A;  1U87 A;  2A4V A;  5F05 A;  4GQC A;  3J7Y k;  1SJ6 A;  3LQ7 A;  1UVZ A;  1S3A A;  4OFM A;  2I9H A;  1ON4 A;  3KXO A;  1TXX A;  4PXO A;  1PL1 A;  2B1L A;  4OO4 A;  3HDC A;  4ZIL A;  5JWQ B;  1OAZ A;  2B7K A;  1BG5 A;  5ECK B;  5JCW A;  1SJZ A;  1U6T A;  2K8V A;  2CZ3 A;  4I97 A;  2R37 A;  1J08 A;  3KZQ A;  3GX8 A;  1YJ6 A;  3CSJ A;  20GS A;  3BBY A;  2GSS A;  4Q5N A;  2VCW A;  1FOV A;  1TRV A;  2C3T A;  2FUG 2;  3FZ5 A;  4ZL9 A;  1XVQ A;  5IMD A;  4BWQ A;  5IIZ A;  3IAM 2;  3KH7 A;  4E8H A;  4PUA A;  1XXU A;  2EC4 A;  2KOK A;  2JSY A;  1Z7P A;  1F3A A;  2OA7 A;  2FD3 A;  1EOG A;  1MD3 A;  2RII A;  4KCE A;  4IBP A;  1M9B A;  1T3B A;  1O6J A;  2R5G A;  4HQS A;  1DUG A;  1XIY A;  2I3Y A;  1X5D A;  1VRS D;  2MMN A;  3A3T A;  3BJ5 A;  3KMO A;  1ZCP A;  4ML1 A;  5D93 A;  2B5E A;  5IOX A;  5ECS A;  2N5B A;  2J9H A;  2F51 A;  4K0G A;  1XWB A;  3M0F A;  2PMT A;  3GX0 A;  2VUP A;  4EVM A;  2HI7 A;  1PX6 A;  3DIE A;  5F07 A;  1XPV A;  2DC5 A;  4TW5 A;  4KH7 A;  4HS1 A;  3ZVJ D;  3LWA A;  1KEB A;  1K0A A;  4N30 A;  2YNX A;  2VD1 A;  1O8X A;  2NVL A;  2X8G A;  2GSR A;  3H8Q A;  4NPB A;  1JZO A;  3FW2 A;  3D6I A;  2IMI A;  5ECN B;  2GZP A;  5ELG A;  1JZR A;  1A0F A;  2YV7 A;  3FR3 A;  2HZF A;  2GQL A;  2AB6 A;  3EC3 A;  1K0D A;  2M46 A;  2LQQ A;  3HCZ A;  1E6B A;  3HVX A;  4OWY A;  4FYU A;  2V2G A;  2DJK A;  3CTF A;  1X5C A;  4RI7 A;  2FA8 A;  4D73 A;  3O3T A;  4BPY A;  3F3Q A;  1GP1 A;  1M7T A;  1TRS A;  3TOU A;  3L9V A;  1B9X C;  2H75 A;  1F9M A;  1SEN A;  2MYG A;  2J23 A;  2H66 A;  1K0C A;  1PX7 A;  4FYC A;  2FHE A;  1PN9 A;  2C3Q A;  1N8J A;  3ZFL A;  4I8B A;  1C72 A;  2L5O A;  1EEM A;  4XRA A;  1GLP A;  2XC2 A;  3M9J A;  1U88 A;  1EGO A;  1K3Y A;  1IYI A;  1XOB A;  2LQO A;  2RUE A;  4ZB9 A;  3A2W A;  2NPB A;  2JL4 A;  4K7O A;  4GCI A;  2VCT A;  1JZW A;  4JRR A;  1W89 A;  2YJ7 A;  4IJI A;  4WEY A;  1PMT A;  2E7P A;  1TP9 A;  3FZ9 A;  3KM6 A;  3FYG A;  1Q4J A;  3FR9 A;  1GSD A;  1YZX A;  1X5E A;  3D4T A;  4ID0 A;  2P5Q A;  1Y25 A;  2VL2 C;  5H5Q A;  3HZ4 A;  1YKA A;  5ECH B;  1VF1 A;  4TVE A;  3TKS A;  3J7Y b;  3HYP A;  2VM1 A;  4GRF A;  2C0G A;  4OCE A;  5DBQ A;  5CYY A;  2NTO A;  2YWN A;  3HD5 A;  5ECO B;  4L0U A;  2YWI A;  1CQG A;  1MD4 A;  3TGZ A;  4Z7X A;  1SJI A;  1YEX A;  1XWA A;  1WJK A;  3G7Y A;  1XVW A;  1IYH A;  2G2Q A;  2DLX A;  4WBR D;  4HQZ A;  3ZIT A;  3QFB C;  1XW9 A;  4KUN A;  4NWY A;  4AGS A;  4XS1 A;  2CQ9 A;  1GSU A;  2EIO A;  3GL5 A;  4TR0 A;  5AIX A;  2O89 A;  1BQ7 A;  2DSA A;  2VLT A;  1F2E A;  3FZ4 A;  2MBT A;  1TRW A;  6GSY A;  4WR5 A;  1O8W A;  3FR6 A;  3TRP A;  4JZQ A;  5IOW A;  2LV3 A;  3D0Z A;  1TU8 A;  5G5F A;  3RBT A;  3EU3 A;  5ELA A;  3US3 A;  2GT6 A;  1CQH A;  3SBC A;  5G5E A;  4ISD A;  1NHY A;  4ZIJ A;  2B6M A;  2H71 A;  4JED A;  2LTK A;  2HNL A;  4F0B A;  3CXG A;  5ENU A;  1ZYQ B;  1ZZY A;  2LNS A;  5D8I A;  1ZOF A;  4ML6 A;  1XZO A;  2AJQ B;  1OC8 A;  4L0W A;  3H79 A;  5EL8 A;  5DAK A;  3DWV A;  5ECQ B;  1E2Y A;  2YV9 A;  5CO3 A;  3G7I A;  5FHI A;  5GZZ B;  16GS A;  3EE2 A;  2FLS A;  1G6Y A;  2DML A;  4ZB8 A;  3EIN A;  2V41 A;  4D73 B;  5A4U A;  4K7N A;  3WGE A;  2YZH A;  2GSQ A;  3GKX A;  4L5L A;  1TTZ A;  3BCK A;  4TOP A;  4MJB A;  2I1U A;  2LNT A;  4PNF A;  1K0M A;  3U5R E;  4FYB A;  1WRY A;  4AJ7 A;  2BTO T;  3TRX A;  18GS A;  1VF2 A;  3D4M A;  2V6K A;  5IMC A;  5GST A;  1WWJ A;  1T1V A;  4PX1 A;  3BD2 A;  4K8M A;  4V2M A;  3O76 A;  4KSM A;  1GTB A;  4EDZ A;  2DJ2 A;  4WET A;  5JCU A;  2VCQ A;  2ZCT A;  6GSW A;  3KMN A;  5HR1 A;  3EU4 A;  1S3D A;  4G9H A;  2KHP A;  4NMU A;  5EPF A;  3BCI A;  4MAB A;  3F8U A;  5A4W A;  2L6C A;  3EMX A;  3QAG A;  3ZLP A;  2JU5 A;  4OD7 A;  5CNW A;  4PQI A;  4AF2 A;  2RLI A;  1X0R A;  4X43 A;  1Z5Y E;  1GUL A;  1XFL A;  4O92 A;  4TR1 A;  3QMX A;  1SKR B;  5ECP B;  3F4S A;  3LXZ A;  3GHA A;  10GS A;  1O85 A;  1BAY A;  4MK3 A;  3ME8 A;  2YAN A;  2C1Y A;  4MP4 A;  1KNG A;  4HOJ A;  3HY2 A;  1TI1 A;  2CZ2 A;  2FNO A;  2LST A;  1T7P B;  2BMX A;  3VI7 A;  5IQY A;  3H4K A;  2H1D A;  5IMF A;  1XOA A;  2GVP A;  3DRN A;  2L5L A;  1EWX A;  3NZN A;  2H01 A;  4JBB A;  1PL2 A;  1W4V A;  1Z9H A;  2LJK A;  3UVH A;  5HR2 A;  2RM6 A;  1ZGN A;  3LYK A;  2K6V A;  1U3A A;  2CX3 A;  5KN2 A;  1PKW A;  4RQX A;  1HNC A;  3TJK A;  1PKZ A;  2B3S A;  4YQV A;  1PSQ A;  4V1A g;  2FWG A;  3GKN A;  1R5A A;  3H1N A;  3W6G A;  4F2I A;  2PWJ A;  4LL1 B;  5IO2 A;  2R4V A;  1T00 A;  4TXV A;  1FHE A;  3IRA A;  3I6A A;  3G7J A;  3K8N A;  5L71 A;  3CBU A;  4TXO A;  4K1F A;  3KP8 A;  3M3M A;  1THX A;  1ERV A;  3I69 A;  5INY A;  4YAP A;  1UA5 A;  5IO0 A;  3QAW A;  5D9X A;  2NDO A;  2PBJ A;  3HJO A;  4V1A p;  12GS A;  1BED A;  4ZXG A;  5C04 A;  1SK1 A;  4DSS A;  4HDE A;  1GSE A;  1HD2 A;  2MMO A;  3FKF A;  1H75 A;  3RHB A;  3APO A;  4G2E A;  3UOM A;  2L57 A;  1QGV A;  2B5X A;  5LCZ A;  4MJC A;  1SL0 B;  1AQW A;  4MH3 A;  3DVX A;  2NBS A;  3P7X A;  1F37 A;  5J3R A;  3FK8 A;  3ZMK A;  1GLQ A;  4TRX A;  3F6F A;  2FWE A;  4OFN A;  2CVK A;  1QFN A;  5D9T A;  3CTG A;  2L6D A;  2LJR A;  1V9W A;  3CYN A;  5J41 A;  3GMF A;  5COH A;  4IS0 A;  5KN3 A;  3C1S A;  2H6Y A;  1M0U A;  5DAK B;  5HFG A;  2GQK A;  2VL9 A;  4HJM A;  5FT3 A;  5J9C A;  3TRQ A;  22GS A;  4IJ3 A;  4POM A;  3GN3 A;  1XBS A;  2HZE A;  17GS A;  4KDY A;  3EYT A;  1OVN A;  2VCZ A;  4OMV A;  2WZ9 A;  4IEL A;  2X8H A;  5G31 A;  3R2Q A;  3EMP A;  2FCH A;  3ERW A;  3L9U A;  3DGQ A;  3IK9 A;  2EIQ A;  3RPP A;  2XHF A;  4DSQ A;  3UAP A;  2IMD A;  2O7K A;  5GAN D;  5DDL A;  1TW9 A;  3KEB A;  1EV9 A;  3VFI A;  1ZL9 A;  2WS2 A;  2HT9 A;  5DJL A;  2F9S A;  5IM9 A;  3W8J A;  1OC3 A;  4MF6 A;  2M80 A;  2GT5 A;  4CW9 A;  2P31 A;  2QC7 A;  2BJX A;  3VWV A;  3QR6 A;  4N0Z A;  4IKH A;  1YKC A;  3UEM A;  4IQ1 A;  3VWU A;  1SYR A;  2VAF A;  4ZL7 A;  1AW9 A;  1EZK A;  4JR4 A;  3GH9 A;  4LMW A;  3ZYW A;  2CAQ A;  2TRX A;  2YPM A;  4LMV A;  4WF5 A;  3CSI A;  1QK8 A;  1ZMA A;  3JCM L;  4MA9 A;  3TCO A;  4KA0 A;  1YF0 A;  3IC4 A;  2AHE A;  2IIY A;  3D21 A;  1KTE A;  2LUS A;  1J9B A;  4TR1 B;  3APS A;  2GS3 A;  4EE0 A;  5B6M A;  3KIJ A;  2WDU A;  2DIY A;  3OR5 A;  4POK A;  3TJG A;  1PD2 1;  2M72 A;  1R4W A;  2OE3 A;  2CV4 A;  4HJ2 A;  1GRX A;  4GXZ A;  3EUR A;  4PNG A;  3SWL A;  3RHC A;  2XPD A;  3F4R A;  3IK7 A;  1TJD A;  4E8E A;  1HYU A;  4I2U A;  2PU9 C;  2C8U A;  2TIR A;  2V1M A;  2HSH A;  4PQH A;  3C73 A;  3HVV A;  3FY7 A;  4MDC A;  3F3R A;  2GQM A;  4ECC A;  3RPN A;  4KGI A;  4OO5 A;  2B1K A;  5H5S A;  1QQ2 A;  1PGT A;  4XCS A;  1RK4 A;  3IBH A;  3VPQ A;  3GH6 A;  1TU7 A;  1SYX A;  4EDY A;  1GL8 A;  1TI3 A;  4HZ4 A;  4PQ1 A;  4XHM A;  2CVD A;  3IE3 A;  1FG4 A;  1Z6M A;  1ILO A;  3LXT A;  4LLR A;  2OE1 A;  4YQU A;  3L78 A;  3LYP A;  2AAW A;  4V2N A;  4BWS A;  3LGC A;  4RUV A;  4PUR A;  2DJ0 A;  5D9W A;  3E0U A;  4TXO B;  3QOU A;  8GSS A;  1GH2 A;  1EOH A;  3I9V 2;  4N0V A;  5ECL B;  1DE2 A;  1S3C A;  2JZS A;  5C00 A;  1FW1 A;  3VWW A;  4CDO A;  3TKR A;  3AY8 A;  4MJA A;  5ID2 A;  3VI5 A;  4F82 A;  2ES7 A;  3KGK A;  1KBN A;  2YJH A;  4NXI A;  3HJM A;  4HI7 A;  3EWL A;  2VCX A;  4DSR A;  5CP1 A;  2H19 A;  3QFA C;  2H73 A;  4XIH A;  4PUF C;  4DSS B;  2OKA A;  3GFK A;  4YQM A;  3QPM A;  5E59 A;  2KP1 A;  4ECB A;  2L59 A;  5KN0 A;  1G7E A;  2IMF A;  1FO5 A;  6GST A;  1M9A A;  3E3E A;  4TR3 A;  1Z7R A;  3V1W A;  1JHB A;  1FB0 A;  2H74 A;  1GSS A;  1A0R P;  1AQV A;  2KUC A;  5IMZ A;  2HFD A;  1AXD A;  3D5J A;  4NV2 A;  1R26 A;  4BVX A;  3S9F A;  9GSS A;  1RW1 A;  2HZE B;  1AC1 A;  4K0N A;  2WFC A;  3M9K A;  3CRT A;  1MEK A;  1GUK A;  4O5R A;  1A2L A;  4Q5F A;  2R6K A;  4K6X A;  2CT6 A;  19GS A;  1TK5 B;  2L4Q A;  3TOT A;  4IGJ A;  1EP7 A;  5D96 A;  4TR4 A;  2VD0 A;  2VOC A;  4J56 E;  3IPZ A;  4MLY A;  5ABR A;  1YQ1 A;  1FAA A;  3MSZ A;  2VL2 A;  1K0N A;  1V2A A;  1R5P A;  3ZRD A;  2ALB A;  2H1B A;  2JZR A;  2VCV A;  2IPA A;  1K3L A;  5G1K A;  3IV4 A;  4GST A;  4DVC A;  4JE1 A;  3PGT A;  1U3I A;  5DCH A;  3IA1 A;  2X64 A;  3CRU A;  3GNJ A;  1QXH A;  11GS A;  1FB6 A;  1GSQ A;  3F9U A;  1JLV A;  4MZB A;  4NHW A;  1MTC A;  2WCI A;  1G7O A;  2OAD A;  3ZML A;  5DVB A;  4YAV A;  4ZBD A;  1PA3 A;  2E2M A;  1GSF A;  1SL1 B;  2IMK A;  3DXB A;  2TRC P;  1K0O A;  2LS5 A;  5D73 A;  4O7H A;  1XWC A;  3F0I A;  2HSY A;  4MH2 A;  5J9B A;  5AN1 A;  4OCF A;  1V40 A;  2XBQ A;  4NV5 A;  4G19 A;  1B4Q A;  3NIV A;  3VUR A;  4WF4 A;  1AAZ A;  2HRN A;  2YP6 A;  2GST A;  3DKS A;  4YH2 A;  4KX4 A;  2Z9S A;  1WP0 A;  5ECI B;  2OJL A;  1GNW A;  3L4N A;  1QUW A;  2GTU A;  1GTI A;  2H72 A;  2VM2 A;  4N11 A;  5E4W A;  5GAP D;  2RUF A;  4QQ7 A;  1WMJ A;  1SD9 A;  1NHO A;  4K9Z A;  1XW6 A;  1SK0 A;  2PVO C;  3KCM A;  4KSO A;  6GSS A;  2QKE A;  5CRG A;  4IHU A;  1GUM A;  5DQY A;  5B7C A;  1XW5 A;  5B6N A;  5IMA A;  2HLS A;  4ZB6 A;  3C71 A;  4KND A;  1B9Y C;  1FVK A;  2OBI A;  5J5N A;  3GA4 A;  2FGX A;  2H8L A;  2H30 A;  1JFU A;  5F0G A;  4OFT A;  1EP8 A;  2PPT A;  5F8B A;  3ZTL A;  3WT2 A;  1MDI A;  2CX4 A;  1YF1 A;  3F4T A;  1T4Z A;  5ID2 B;  3LJR A;  2WB9 A;  1GWC A;  2DMM A;  2PGT A;  2B5Y A;  2A2S A;  1Z6N A;  4Q5R A;  3ZIJ A;  1ML6 A;  2REM A;  3PR8 A;  3ERF A;  3C1R A;  1Y6E A;  4KAE A;  1AIU A;  3ISO A;  1GTA A;  3QAV A;  4ZBA A;  1NM3 A;  4O32 A;  3WYW A;  1K3O A;  3RDW A;  1SL2 B;  1O73 A;  5FWG A;  3FZA A;  4IW9 A;  3ZIV A;  2IME A;  1AUC A;  5EVO A;  4GF0 A;  3WD6 A;  3ME7 A;  3MDK A;  4MPG A;  4IN0 A;  2GLR A;  2LKU A;  1F6M C;  3GST A;  2C0D A;  5AIV A;  4EL1 A;  1ERU A;  2WGR A;  2I4A A;  3KP9 A;  1R7H A;  4WBJ A;  3UIW A;  2IL3 A;  1ERT A;  1GSY A;  3UJ1 A;  2P5R A;  4MF5 A;  1I5G A;  1WOU A;  4GWR A;  4PGT A;  1BX9 A;  4ULX A;  5G30 A;  2D2Z A;  3UBL A;  2OE0 A;  2GZZ A;  3N9J A;  3M8N A;  2HYX A;  2YZU A;  4K2D A;  3GRX A;  3Q6O A;  5CRE A;  1B8X A;  2A2R A;  1BYE A;  2V6O A;  2JAC A;  6GSU A;  2O8V B;  4RQR A;  4MJE A;  1OC9 A;  3ED3 A;  3H93 A;  1WPI A;  3P8W A;  4I2T A;  5B8A A;  5KEJ A;  5AIS A;  4POL A;  1RQM A;  2GZY A;  1TK8 B;  1VGL A;  1LJR A;  3VLN A;  1ST9 A;  1MDK A;  3QDN A;  1THO A;  2IFQ A;  4KW6 A;  5H5R A;  3GYK A;  4TKY A;  4WXT A;  2H6Z A;  2C3N A;  3LFL A;  1TOF A;  2VO4 A;  2H6X A;  2O87 A;  1ACV A;  6GSV A;  2H70 A;  2ZNM A;  4IP1 A;  1TKD B;  2R2J A;  3F63 A;  3UAR A;  1WIK A;  3HA9 A;  4X0X A;  3WGD A;  4GQF A;  3FEU A;  1QMV A;  2VLV A;  3DVW A;  1X9W B;  3RAZ A;  2AYT A;  2JSZ A;  2PUK C;  3GKK A;  5DAL A;  3ERG A; 
#chains in the Genus database with same CATH topology
 2WJU A;  1OKT A;  1WE0 A;  1AQX A;  1ZYE A;  3IHQ A;  3KTB A;  4EUY A;  2IJY A;  2QA2 A;  1SD8 A;  2YN1 A;  5J4U A;  1F3B A;  1A2J A;  1VF3 A;  4AJ8 A;  4HU7 A;  2V32 A;  1YY7 A;  4IQA A;  4FH8 A;  2LRT A;  3C7M A;  3HHV A;  4EIP A;  3TUE A;  2QSI A;  2XPE A;  3PPU A;  1YDK A;  3TKS C;  3ZRE A;  2R3X A;  5KOW A;  5IMV A;  3ZFB A;  2KP2 A;  2F8A A;  1JLW A;  2DBC A;  1SU9 A;  2N5A A;  1UN2 A;  2ON5 A;  1NSW A;  1S3R A;  4GSN A;  2OBK A;  1HNB A;  5IPH A;  1M99 A;  3UVT A;  2B7J A;  5DQS A;  3EPT A;  2F8F A;  2HE3 A;  5KOX A;  3GTU A;  3KD0 A;  4V2L A;  4HZ2 A;  2K18 A;  3HJP A;  3BOA A;  3NOF A;  1DSB A;  4CHS A;  4LA1 A;  1HQO A;  2PER A;  3Q74 A;  3N5O A;  4QL7 A;  5LNK e;  4BL7 A;  2I81 A;  1PQN A;  3GUS A;  1M2A A;  3LG6 A;  3VK9 A;  3U6V A;  2ON7 A;  5B8B A;  5ECR B;  1XWK A;  1A24 A;  4KE3 A;  1HNA A;  1YEP A;  4LL4 B;  1NW2 A;  5HR0 A;  5HR3 A;  3Q19 A;  4MNN A;  1G6W A;  1V58 A;  4XS4 A;  1J0F A;  1X9S B;  4F9Z A;  1ABA A;  3EVI A;  3ZZX A;  1TRU A;  4JU5 A;  4EO3 A;  3TDG A;  4MF7 A;  3MIX A;  3TJB A;  4ECJ A;  1V57 A;  2AV4 A;  1XWG A;  5HFK A;  4GLT A;  2HRF A;  4L8E A;  1XCC A;  1ERW A;  2E0Q A;  4I6X A;  4EXJ A;  2DJ1 A;  3IR4 A;  1OYJ A;  3G9B A;  2MMZ A;  3GKM A;  2MMA A;  2P0G A;  5GSS A;  1B4P A;  4WR4 A;  1LBK A;  2GGT A;  1OKD A;  2FWH A;  2JAD A;  1OC9 B;  2EIR A;  1K0B A;  2VLU A;  3WT1 A;  5D9V A;  5ECM B;  2C0F A;  2F3M A;  4N10 A;  3IAS 2;  4FIW A;  4HU9 A;  4DEJ A;  3A2V A;  1OE7 A;  5F06 A;  1EGR A;  2FWF A;  3IXR A;  3O6T A;  4NHZ A;  3F6D A;  3KTL A;  2IFQ B;  3DML A;  2K8S A;  3GSS A;  2DJJ A;  2C4J A;  4FO5 A;  1EEJ A;  2A2P A;  1X9M B;  5G1L A;  4BA7 A;  1O7U A;  2DIZ A;  2G0F A;  4K7I A;  2H0G A;  2LRC A;  1Q98 A;  2VIM A;  3CSH A;  2CAI A;  2O85 A;  4F0C A;  2GDR A;  3CMI A;  1V98 A;  3DYR A;  1A2M A;  1EV4 A;  4ILF A;  1PFO A;  3GUR A;  6GSX A;  1DE1 A;  5JWR B;  4PTS A;  3UBK A;  5HFI A;  2HXK A;  3WGX A;  5DAL B;  2CA8 A;  3UL3 A;  5CRD A;  3Q18 A;  2CVB A;  4F03 A;  3HKR A;  3D22 A;  4HEA 2;  3QD9 A;  1A8L A;  3LSZ A;  2LEG A;  1FVJ A;  1TK0 B;  2RM5 A;  1JZD A;  3TJJ A;  13GS A;  2H1G A;  7GSS A;  1USB A;  3MWH A;  2MZC A;  3DD3 A;  4MZW A;  5A4V A;  1M2B A;  2YWM A;  4QL9 A;  5HQP A;  3VWX A;  5LD0 A;  4ECI A;  3I43 A;  2C0E A;  3GV1 A;  3QCP A;  1A8Y A;  2PN8 A;  3TKS E;  4MCU A;  5EY6 A;  3PIN A;  3L0H A;  1B48 A;  2X8C A;  4IP6 A;  4HUA A;  2C80 A;  3ZVJ A;  3ZL5 A;  2H0H A;  4J57 E;  4KDU A;  3C8E A;  3E9J B;  5IPG A;  5JCG A;  3TJF A;  1SKS B;  3MNG A;  4MZC A;  2YCD A;  1T8E B;  1G0T A;  4EKZ A;  3LEF A;  3DEX A;  3W8S A;  2LRN A;  2L4C A;  2WRT A;  5BRT A;  4P3Y B;  4TN8 A;  3GTU B;  1SK2 A;  4JR6 A;  4AJ6 A;  4X1U A;  2VL3 A;  2HSM A;  4YKG A;  4POB A;  3MAK A;  1UC7 A;  1VF4 A;  4I5Q A;  3P2A A;  2YWO A;  4L5O A;  4KDX A;  4XTS A;  4WKW A;  3FRC A;  1N2A A;  4BL7 B;  3IDV A;  1BJX A;  1LU4 A;  2WUL A;  1M2D A;  3A5W A;  1TDI A;  1URM A;  2X99 A;  5AGY A;  1SKW B;  1O81 A;  4KB3 A;  2N5F A;  5CAX A;  2H0I A;  4KCA A;  4EF0 A;  4XS4 B;  4G10 A;  3L9S A;  4BVY A;  4ACS A;  3HXS A;  3UMA A;  4IVF A;  1GTU A;  1A23 A;  1GNE A;  3VPT A;  1OE8 A;  2K9F A;  1T4Y A;  4MPF A;  4H86 A;  4EC0 A;  3IOS A;  2OAC A;  2PVQ A;  1PRX A;  4MMM A;  3KH9 A;  2MBS A;  4ZL8 A;  2FA4 A;  2KLX A;  5G2Z A;  5KN1 A;  4CY6 A;  1MDJ A;  3PH9 A;  2YOI A;  4GTU A;  14GS A;  3HZ8 A;  2H1A A;  3FHK A;  2IN3 A;  3GL3 A;  4GSS A;  3KJY A;  3TKP A;  5CRH A;  4HSC X;  5DCG A;  4K5S A;  4Q5Q A;  3GIX A;  2DJ3 A;  5A5K A;  5JWO B;  2XBI A;  4RI6 A;  4J2F A;  2H76 A;  2JZT A;  1GUH A;  2FY6 A;  1H4O A;  2QGV A;  3HVS A;  2E2G A;  3P90 A;  4XS6 A;  5DJM A;  3APQ A;  3TKQ A;  2ZUP A;  1Z3E A;  4NAX A;  3M1G A;  2AUV A;  3TB2 A;  1I9D A;  2IWT A;  2LJA A;  3A2X A;  5CRW A;  3LOR A;  4ZBB A;  1DBY A;  4XRD A;  1U87 A;  2A4V A;  5F05 A;  4GQC A;  3J7Y k;  1SJ6 A;  3LQ7 A;  1UVZ A;  1S3A A;  4OFM A;  2I9H A;  1ON4 A;  3KXO A;  1TXX A;  4PXO A;  1PL1 A;  2B1L A;  4OO4 A;  3HDC A;  4ZIL A;  5JWQ B;  1OAZ A;  2B7K A;  1BG5 A;  5ECK B;  3R3E A;  5JCW A;  1SJZ A;  1U6T A;  2K8V A;  2CZ3 A;  4I97 A;  2R37 A;  1J08 A;  3KZQ A;  3GX8 A;  1YJ6 A;  3CSJ A;  20GS A;  3BBY A;  2GSS A;  4Q5N A;  2VCW A;  4X4J A;  1FOV A;  1TRV A;  2C3T A;  2FUG 2;  3FZ5 A;  4ZL9 A;  1XVQ A;  5IMD A;  4BWQ A;  5IIZ A;  3IAM 2;  3KH7 A;  4E8H A;  4PUA A;  1XXU A;  2EC4 A;  2KOK A;  2JSY A;  1Z7P A;  1F3A A;  2OA7 A;  2FD3 A;  1EOG A;  1MD3 A;  2RII A;  4KCE A;  4IBP A;  1M9B A;  1T3B A;  1O6J A;  2R5G A;  4HQS A;  1DUG A;  1XIY A;  2I3Y A;  4CY8 A;  1X5D A;  1VRS D;  2MMN A;  3A3T A;  3BJ5 A;  3KMO A;  1ZCP A;  4ML1 A;  5D93 A;  2B5E A;  5IOX A;  5ECS A;  2N5B A;  2J9H A;  2F51 A;  4K0G A;  1XWB A;  3M0F A;  2PMT A;  2A4H A;  3GX0 A;  2VUP A;  4EVM A;  2HI7 A;  1PX6 A;  3DIE A;  5F07 A;  1XPV A;  2DC5 A;  4TW5 A;  4KH7 A;  4HS1 A;  3ZVJ D;  3LWA A;  1KEB A;  1K0A A;  4N30 A;  2YNX A;  2VD1 A;  1O8X A;  2NVL A;  2X8G A;  2GSR A;  3H8Q A;  4NPB A;  1JZO A;  3FW2 A;  3D6I A;  2IMI A;  5ECN B;  2GZP A;  5ELG A;  1JZR A;  1A0F A;  2YV7 A;  3FR3 A;  2R0P A;  2HZF A;  2GQL A;  4FQU A;  4BVY B;  2AB6 A;  3EC3 A;  1K0D A;  2M46 A;  2LQQ A;  3HCZ A;  1E6B A;  3HVX A;  4OWY A;  4FYU A;  4Z2R A;  2V2G A;  2DJK A;  3CTF A;  1X5C A;  4RI7 A;  2FA8 A;  4D73 A;  3O3T A;  4BPY A;  3F3Q A;  1GP1 A;  1M7T A;  1TRS A;  3TOU A;  3L9V A;  1B9X C;  2H75 A;  1F9M A;  1SEN A;  2MYG A;  2J23 A;  2H66 A;  1K0C A;  1PX7 A;  4FYC A;  1ZYN A;  2FHE A;  1PN9 A;  2C3Q A;  1N8J A;  3ZFL A;  4I8B A;  1ZYP A;  1C72 A;  2L5O A;  4Z2T A;  1EEM A;  4XRA A;  1GLP A;  2XC2 A;  3M9J A;  1U88 A;  1EGO A;  1K3Y A;  1IYI A;  1XOB A;  2LQO A;  2RUE A;  4ZB9 A;  3A2W A;  2NPB A;  2JL4 A;  4K7O A;  4GCI A;  2VCT A;  1JZW A;  4JRR A;  1W89 A;  2YJ7 A;  4IJI A;  4WEY A;  1PMT A;  2E7P A;  1TP9 A;  3FZ9 A;  3KM6 A;  3FYG A;  1Q4J A;  3FR9 A;  1GSD A;  1YZX A;  1X5E A;  3D4T A;  4ID0 A;  2P5Q A;  1Y25 A;  2VL2 C;  3HVN A;  5H5Q A;  3HZ4 A;  1YKA A;  5ECH B;  1VF1 A;  4EIQ A;  4TVE A;  3TKS A;  3J7Y b;  3HYP A;  2VM1 A;  4GRF A;  2C0G A;  4OCE A;  5DBQ A;  5CYY A;  2NTO A;  2YWN A;  3HD5 A;  5ECO B;  4L0U A;  2YWI A;  1CQG A;  1MD4 A;  3TGZ A;  4Z7X A;  1SJI A;  1YEX A;  1XWA A;  1WJK A;  3G7Y A;  1XVW A;  1IYH A;  2G2Q A;  2DLX A;  4WBR D;  4O5U A;  4HQZ A;  3ZIT A;  4BIK A;  3QFB C;  1XW9 A;  4KUN A;  4NWY A;  4AGS A;  4XS1 A;  2CQ9 A;  4ICY A;  1GSU A;  2EIO A;  3GL5 A;  3IHG A;  4TR0 A;  5AIX A;  2O89 A;  1BQ7 A;  2DSA A;  2VLT A;  1F2E A;  3FZ4 A;  2MBT A;  1TRW A;  6GSY A;  4WR5 A;  1O8W A;  3FR6 A;  3TRP A;  4JZQ A;  5IOW A;  2LV3 A;  3D0Z A;  1TU8 A;  5G5F A;  3RBT A;  3EU3 A;  5ELA A;  3US3 A;  2GT6 A;  4Z2U A;  1CQH A;  3SBC A;  5G5E A;  4ISD A;  1NHY A;  4ZIJ A;  2B6M A;  2H71 A;  4JED A;  2LTK A;  2HNL A;  4F0B A;  3CXG A;  5ENU A;  2DKH A;  1ZYQ B;  1ZZY A;  2LNS A;  5D8I A;  1ZOF A;  4ML6 A;  1XZO A;  2AJQ B;  1OC8 A;  4L0W A;  3H79 A;  4A5P A;  5EL8 A;  5DAK A;  3DWV A;  5ECQ B;  2X49 A;  1E2Y A;  2YV9 A;  5CO3 A;  3G7I A;  5FHI A;  5GZZ B;  16GS A;  3EE2 A;  2FLS A;  1G6Y A;  2DML A;  4ZB8 A;  2R0G A;  3EIN A;  2V41 A;  4D73 B;  5A4U A;  4K7N A;  3WGE A;  2YZH A;  2GSQ A;  3GKX A;  4L5L A;  1TTZ A;  3BCK A;  4TOP A;  4MJB A;  2I1U A;  2LNT A;  4PNF A;  1K0M A;  3U5R E;  4FYB A;  1WRY A;  4AJ7 A;  2BTO T;  3TRX A;  18GS A;  1VF2 A;  3D4M A;  2V6K A;  5IMC A;  5GST A;  1WWJ A;  1T1V A;  4PX1 A;  3BD2 A;  4K8M A;  4V2M A;  3O76 A;  4KSM A;  1GTB A;  4EDZ A;  2DJ2 A;  4WET A;  5JCU A;  2VCQ A;  2ZCT A;  1M3I A;  6GSW A;  3KMN A;  5HR1 A;  3EU4 A;  1S3D A;  4G9H A;  2KHP A;  4NMU A;  5EPF A;  3BCI A;  4MAB A;  3F8U A;  5A4W A;  2L6C A;  3EMX A;  3QAG A;  3ZLP A;  2JU5 A;  4OD7 A;  5CNW A;  4PQI A;  4AF2 A;  2RLI A;  1X0R A;  4X43 A;  1Z5Y E;  1GUL A;  1XFL A;  4O92 A;  4TR1 A;  3QMX A;  1SKR B;  5ECP B;  3F4S A;  3LXZ A;  3GHA A;  10GS A;  1O85 A;  1BAY A;  4MK3 A;  3ME8 A;  2YAN A;  2C1Y A;  4MP4 A;  1KNG A;  4HOJ A;  3HY2 A;  1TI1 A;  2CZ2 A;  2FNO A;  2LST A;  1T7P B;  2BMX A;  3VI7 A;  5IQY A;  3H4K A;  2H1D A;  5IMF A;  1XOA A;  2GVP A;  3DRN A;  2L5L A;  1EWX A;  3NZN A;  2H01 A;  4JBB A;  1PL2 A;  1W4V A;  1Z9H A;  2LJK A;  3UVH A;  5HR2 A;  2RM6 A;  1ZGN A;  3LYK A;  2K6V A;  1U3A A;  2CX3 A;  5KN2 A;  1PKW A;  4RQX A;  1HNC A;  3TJK A;  1PKZ A;  2B3S A;  4YQV A;  1PSQ A;  4V1A g;  2FWG A;  3GKN A;  1R5A A;  3H1N A;  3LW9 A;  3W6G A;  4F2I A;  2PWJ A;  4LL1 B;  5IO2 A;  2R4V A;  1T00 A;  4TXV A;  1FHE A;  3IRA A;  3I6A A;  3G7J A;  5BMU A;  3K8N A;  5L71 A;  3CBU A;  4TXO A;  4K1F A;  3KP8 A;  3M3M A;  1THX A;  1ERV A;  2UZ8 A;  3I69 A;  5INY A;  4YAP A;  1UA5 A;  5IO0 A;  3QAW A;  5D9X A;  2NDO A;  2PBJ A;  3HJO A;  4V1A p;  12GS A;  1BED A;  4ZXG A;  5C04 A;  1SK1 A;  4DSS A;  4HDE A;  1GSE A;  1HD2 A;  2MMO A;  3FKF A;  1H75 A;  3RHB A;  3APO A;  4G2E A;  3UOM A;  2L57 A;  1QGV A;  2B5X A;  5LCZ A;  4MJC A;  1SL0 B;  1AQW A;  4MH3 A;  3DVX A;  2NBS A;  3P7X A;  1F37 A;  5J3R A;  3FK8 A;  3ZMK A;  1GLQ A;  4TRX A;  3F6F A;  2FWE A;  4OFN A;  2CVK A;  1QFN A;  5D9T A;  3CTG A;  2L6D A;  2LJR A;  1V9W A;  3CYN A;  5J41 A;  3GMF A;  5COH A;  4IS0 A;  5KN3 A;  3C1S A;  2H6Y A;  1M0U A;  5DAK B;  5HFG A;  2GQK A;  2VL9 A;  4HJM A;  5FT3 A;  5J9C A;  3TRQ A;  22GS A;  4IJ3 A;  4POM A;  3GN3 A;  1XBS A;  2HZE A;  17GS A;  4KDY A;  3EYT A;  1OVN A;  2VCZ A;  4OMV A;  2WZ9 A;  4IEL A;  2X8H A;  5G31 A;  3R2Q A;  3EMP A;  2FCH A;  3ERW A;  3L9U A;  3DGQ A;  3IK9 A;  2EIQ A;  3RPP A;  2XHF A;  4DSQ A;  3UAP A;  2IMD A;  2O7K A;  5GAN D;  5DDL A;  1TW9 A;  3KEB A;  1EV9 A;  3VFI A;  1ZL9 A;  2WS2 A;  2HT9 A;  5DJL A;  2F9S A;  5IM9 A;  3W8J A;  1OC3 A;  4MF6 A;  2M80 A;  2GT5 A;  4CW9 A;  4USS A;  2P31 A;  2QC7 A;  2BJX A;  3VWV A;  3QR6 A;  4N0Z A;  4IKH A;  1YKC A;  3UEM A;  4IQ1 A;  3VWU A;  1SYR A;  2VAF A;  4ZL7 A;  1AW9 A;  1EZK A;  4JR4 A;  3GH9 A;  4LMW A;  3ZYW A;  2CAQ A;  2TRX A;  2YPM A;  4LMV A;  4WF5 A;  3CSI A;  1QK8 A;  1ZMA A;  3JCM L;  4MA9 A;  3TCO A;  4KA0 A;  1YF0 A;  3IC4 A;  2AHE A;  2IIY A;  3D21 A;  1KTE A;  2LUS A;  1J9B A;  4TR1 B;  3APS A;  2GS3 A;  4EE0 A;  5B6M A;  3KIJ A;  2WDU A;  2DIY A;  3OR5 A;  4POK A;  3TJG A;  1PD2 1;  2M72 A;  1R4W A;  2OE3 A;  2CV4 A;  4HJ2 A;  1GRX A;  4GXZ A;  3EUR A;  4PNG A;  3SWL A;  3RHC A;  2XPD A;  3F4R A;  3IK7 A;  1TJD A;  4E8E A;  1HYU A;  2HRA A;  4I2U A;  2PU9 C;  2C8U A;  2TIR A;  2V1M A;  2HSH A;  4PQH A;  3C73 A;  3HVV A;  3FY7 A;  4MDC A;  3F3R A;  2GQM A;  4ECC A;  3RPN A;  4KGI A;  4OO5 A;  2B1K A;  5H5S A;  1QQ2 A;  1PGT A;  4XCS A;  1RK4 A;  3IBH A;  3VPQ A;  3GH6 A;  1TU7 A;  3CQF A;  1SYX A;  4EDY A;  1GL8 A;  1TI3 A;  4HZ4 A;  4PQ1 A;  4XHM A;  2CVD A;  3IE3 A;  3A5I A;  1FG4 A;  1Z6M A;  1ILO A;  3LXT A;  4LLR A;  2OE1 A;  4YQU A;  3L78 A;  3LYP A;  2AAW A;  4V2N A;  4BWS A;  3LGC A;  4RUV A;  4PUR A;  2DJ0 A;  5D9W A;  3E0U A;  4TXO B;  3QOU A;  8GSS A;  1GH2 A;  1EOH A;  3I9V 2;  4N0V A;  5ECL B;  1DE2 A;  1S3C A;  2JZS A;  5C00 A;  1FW1 A;  3VWW A;  2DKI A;  4CDO A;  3TKR A;  3AY8 A;  4MJA A;  5ID2 A;  3VI5 A;  4F82 A;  2ES7 A;  4G0I A;  3KGK A;  1KBN A;  2YJH A;  4NXI A;  3HJM A;  4HI7 A;  3EWL A;  2VCX A;  4DSR A;  5CP1 A;  2H19 A;  3QFA C;  2H73 A;  4XIH A;  4PUF C;  4DSS B;  2OKA A;  3GFK A;  4YQM A;  3QPM A;  5E59 A;  2KP1 A;  4ECB A;  2L59 A;  5KN0 A;  1G7E A;  2IMF A;  1FO5 A;  6GST A;  1M9A A;  3E3E A;  4TR3 A;  1Z7R A;  3V1W A;  1JHB A;  1FB0 A;  2H74 A;  1GSS A;  1FOH A;  1A0R P;  1AQV A;  2KUC A;  5IMZ A;  2HFD A;  1AXD A;  3D5J A;  4NV2 A;  1R26 A;  3MYD A;  4BVX A;  3S9F A;  9GSS A;  1RW1 A;  2HZE B;  1AC1 A;  4K0N A;  2WFC A;  3M9K A;  3CRT A;  1MEK A;  1GUK A;  4O5R A;  1A2L A;  4Q5F A;  2R6K A;  4K6X A;  2CT6 A;  19GS A;  1TK5 B;  2L4Q A;  3TOT A;  4IGJ A;  1EP7 A;  5D96 A;  4TR4 A;  2VD0 A;  2VOC A;  4J56 E;  3IPZ A;  4MLY A;  5ABR A;  1YQ1 A;  1FAA A;  3MSZ A;  2VL2 A;  1K0N A;  1V2A A;  1R5P A;  3ZRD A;  2ALB A;  2H1B A;  2JZR A;  2VCV A;  2IPA A;  1K3L A;  5G1K A;  3IV4 A;  4GST A;  4DVC A;  4JE1 A;  3PGT A;  1U3I A;  5DCH A;  3IA1 A;  2X64 A;  3CRU A;  3GNJ A;  1QXH A;  11GS A;  1FB6 A;  1GSQ A;  3F9U A;  1JLV A;  4MZB A;  4NHW A;  1MTC A;  2WCI A;  1G7O A;  2OAD A;  3ZML A;  5DVB A;  4YAV A;  4ZBD A;  1PA3 A;  2E2M A;  1GSF A;  1SL1 B;  2IMK A;  3DXB A;  2TRC P;  1K0O A;  2LS5 A;  5D73 A;  4O7H A;  1XWC A;  3F0I A;  2HSY A;  4MH2 A;  5J9B A;  5AN1 A;  4OCF A;  1V40 A;  2XBQ A;  4NV5 A;  4G19 A;  1B4Q A;  3NIV A;  2QA1 A;  3VUR A;  4WF4 A;  1AAZ A;  2HRN A;  2YP6 A;  2GST A;  3DKS A;  4YH2 A;  4KX4 A;  2Z9S A;  1WP0 A;  2X4A A;  5ECI B;  2OJL A;  1GNW A;  3L4N A;  1QUW A;  2GTU A;  1GTI A;  2H72 A;  2VM2 A;  4N11 A;  5E4W A;  2R0C A;  5GAP D;  2RUF A;  4QQ7 A;  1WMJ A;  1SD9 A;  1NHO A;  4K9Z A;  1XW6 A;  1SK0 A;  1XG8 A;  2PVO C;  4KF9 A;  3KCM A;  4KSO A;  6GSS A;  2QKE A;  5CRG A;  4IHU A;  1GUM A;  5DQY A;  5B7C A;  1XW5 A;  5B6N A;  5IMA A;  2HLS A;  4ZB6 A;  3C71 A;  4KND A;  1B9Y C;  1FVK A;  2OBI A;  5J5N A;  3GA4 A;  2FGX A;  2H8L A;  2H30 A;  1JFU A;  5F0G A;  4OFT A;  1EP8 A;  2PPT A;  5F8B A;  3ZTL A;  3WT2 A;  1MDI A;  2CX4 A;  1YF1 A;  3F4T A;  1T4Z A;  5ID2 B;  3LJR A;  2WB9 A;  1GWC A;  2DMM A;  2PGT A;  2B5Y A;  2A2S A;  1Z6N A;  4Q5R A;  3ZIJ A;  3IC8 A;  1ML6 A;  2REM A;  3PR8 A;  3ERF A;  3C1R A;  1Y6E A;  4KAE A;  1AIU A;  3ISO A;  1GTA A;  3QAV A;  4ZBA A;  1NM3 A;  4O32 A;  3WYW A;  1K3O A;  3RDW A;  1SL2 B;  1O73 A;  5FWG A;  3FZA A;  4IW9 A;  3ZIV A;  2IME A;  1AUC A;  5EVO A;  4GF0 A;  3WD6 A;  3ME7 A;  3MDK A;  4MPG A;  4IN0 A;  2GLR A;  2LKU A;  1F6M C;  3GST A;  2C0D A;  5AIV A;  4EL1 A;  4BVX B;  1ERU A;  2WGR A;  2I4A A;  3KP9 A;  1R7H A;  4WBJ A;  3UIW A;  2IL3 A;  1ERT A;  1GSY A;  3UJ1 A;  2P5R A;  4MF5 A;  4K2X A;  1I5G A;  1WOU A;  4GWR A;  4PGT A;  1BX9 A;  4ULX A;  5G30 A;  2D2Z A;  3UBL A;  2OE0 A;  2GZZ A;  3N9J A;  3M8N A;  2HYX A;  2YZU A;  4G0L A;  4K2D A;  4O5Q A;  3GRX A;  3Q6O A;  5CRE A;  1B8X A;  2A2R A;  1BYE A;  2V6O A;  2JAC A;  1M3J A;  6GSU A;  2O8V B;  4RQR A;  4MJE A;  1OC9 A;  3ED3 A;  3H93 A;  1WPI A;  3P8W A;  2HRK A;  4I2T A;  5B8A A;  5KEJ A;  5AIS A;  4POL A;  1RQM A;  2GZY A;  1TK8 B;  1VGL A;  1LJR A;  3VLN A;  4G0K A;  1ST9 A;  1MDK A;  3QDN A;  1THO A;  2IFQ A;  4KW6 A;  5H5R A;  3GYK A;  4TKY A;  4WXT A;  2H6Z A;  2C3N A;  3LFL A;  4K5R A;  1TOF A;  2VO4 A;  2H6X A;  2O87 A;  1ACV A;  6GSV A;  2H70 A;  2ZNM A;  4IP1 A;  1TKD B;  2R2J A;  3F63 A;  3FMW A;  3UAR A;  1WIK A;  1PN0 A;  3HA9 A;  4X0X A;  3WGD A;  4YKF A;  4GQF A;  3FEU A;  1QMV A;  2VLV A;  3DVW A;  1X9W B;  3RAZ A;  2AYT A;  2JSZ A;  2PUK C;  3GKK A;  5DAL A;  3ERG A; 
#chains in the Genus database with same CATH homology
 2WJU A;  1OKT A;  1WE0 A;  1AQX A;  1ZYE A;  3IHQ A;  3KTB A;  4EUY A;  2IJY A;  2QA2 A;  1SD8 A;  2YN1 A;  5J4U A;  1F3B A;  1A2J A;  1VF3 A;  4AJ8 A;  4HU7 A;  2V32 A;  1YY7 A;  4IQA A;  4FH8 A;  2LRT A;  3C7M A;  3HHV A;  4EIP A;  3TUE A;  2QSI A;  2XPE A;  3PPU A;  1YDK A;  3TKS C;  3ZRE A;  2R3X A;  5KOW A;  5IMV A;  3ZFB A;  2KP2 A;  2F8A A;  1JLW A;  2DBC A;  1SU9 A;  2N5A A;  1UN2 A;  2ON5 A;  1NSW A;  4GSN A;  2OBK A;  1HNB A;  5IPH A;  1M99 A;  3UVT A;  2B7J A;  5DQS A;  3EPT A;  2F8F A;  2HE3 A;  5KOX A;  3GTU A;  3KD0 A;  4V2L A;  4HZ2 A;  2K18 A;  3HJP A;  3BOA A;  3NOF A;  1DSB A;  4CHS A;  4LA1 A;  1HQO A;  2PER A;  3Q74 A;  3N5O A;  4QL7 A;  5LNK e;  4BL7 A;  2I81 A;  1PQN A;  3GUS A;  1M2A A;  3LG6 A;  3VK9 A;  3U6V A;  2ON7 A;  5B8B A;  5ECR B;  1XWK A;  1A24 A;  4KE3 A;  1HNA A;  1YEP A;  4LL4 B;  1NW2 A;  5HR0 A;  5HR3 A;  3Q19 A;  4MNN A;  1G6W A;  1V58 A;  4XS4 A;  1J0F A;  1X9S B;  4F9Z A;  1ABA A;  3EVI A;  3ZZX A;  1TRU A;  4JU5 A;  4EO3 A;  3TDG A;  4MF7 A;  3MIX A;  3TJB A;  4ECJ A;  1V57 A;  2AV4 A;  1XWG A;  5HFK A;  4GLT A;  2HRF A;  4L8E A;  1XCC A;  1ERW A;  2E0Q A;  4I6X A;  4EXJ A;  2DJ1 A;  3IR4 A;  1OYJ A;  3G9B A;  2MMZ A;  3GKM A;  2MMA A;  2P0G A;  5GSS A;  1B4P A;  4WR4 A;  1LBK A;  2GGT A;  1OKD A;  2FWH A;  2JAD A;  1OC9 B;  2EIR A;  1K0B A;  2VLU A;  3WT1 A;  5D9V A;  5ECM B;  2C0F A;  2F3M A;  4N10 A;  3IAS 2;  4FIW A;  4HU9 A;  4DEJ A;  3A2V A;  1OE7 A;  5F06 A;  1EGR A;  2FWF A;  3IXR A;  3O6T A;  4NHZ A;  3F6D A;  3KTL A;  2IFQ B;  3DML A;  2K8S A;  3GSS A;  2DJJ A;  2C4J A;  4FO5 A;  1EEJ A;  2A2P A;  1X9M B;  5G1L A;  4BA7 A;  1O7U A;  2DIZ A;  2G0F A;  4K7I A;  2H0G A;  2LRC A;  1Q98 A;  2VIM A;  3CSH A;  2CAI A;  2O85 A;  4F0C A;  2GDR A;  3CMI A;  1V98 A;  3DYR A;  1A2M A;  1EV4 A;  4ILF A;  3GUR A;  6GSX A;  1DE1 A;  5JWR B;  4PTS A;  3UBK A;  5HFI A;  2HXK A;  3WGX A;  5DAL B;  2CA8 A;  3UL3 A;  5CRD A;  3Q18 A;  2CVB A;  4F03 A;  3HKR A;  3D22 A;  4HEA 2;  3QD9 A;  1A8L A;  3LSZ A;  2LEG A;  1FVJ A;  1TK0 B;  2RM5 A;  1JZD A;  3TJJ A;  13GS A;  2H1G A;  7GSS A;  1USB A;  3MWH A;  2MZC A;  3DD3 A;  4MZW A;  5A4V A;  1M2B A;  2YWM A;  4QL9 A;  5HQP A;  3VWX A;  5LD0 A;  4ECI A;  3I43 A;  2C0E A;  3GV1 A;  3QCP A;  1A8Y A;  2PN8 A;  3TKS E;  4MCU A;  5EY6 A;  3PIN A;  3L0H A;  1B48 A;  2X8C A;  4IP6 A;  4HUA A;  2C80 A;  3ZVJ A;  3ZL5 A;  2H0H A;  4J57 E;  4KDU A;  3C8E A;  3E9J B;  5IPG A;  5JCG A;  3TJF A;  1SKS B;  3MNG A;  4MZC A;  2YCD A;  1T8E B;  1G0T A;  4EKZ A;  3LEF A;  3DEX A;  3W8S A;  2LRN A;  2L4C A;  2WRT A;  5BRT A;  4P3Y B;  4TN8 A;  3GTU B;  1SK2 A;  4JR6 A;  4AJ6 A;  4X1U A;  2VL3 A;  2HSM A;  4YKG A;  4POB A;  3MAK A;  1UC7 A;  1VF4 A;  4I5Q A;  3P2A A;  2YWO A;  4L5O A;  4KDX A;  4XTS A;  4WKW A;  3FRC A;  1N2A A;  4BL7 B;  3IDV A;  1BJX A;  1LU4 A;  2WUL A;  1M2D A;  3A5W A;  1TDI A;  1URM A;  2X99 A;  5AGY A;  1SKW B;  1O81 A;  4KB3 A;  2N5F A;  5CAX A;  2H0I A;  4KCA A;  4EF0 A;  4XS4 B;  4G10 A;  3L9S A;  4BVY A;  4ACS A;  3HXS A;  3UMA A;  4IVF A;  1GTU A;  1A23 A;  1GNE A;  3VPT A;  1OE8 A;  2K9F A;  1T4Y A;  4MPF A;  4H86 A;  4EC0 A;  3IOS A;  2OAC A;  2PVQ A;  1PRX A;  4MMM A;  3KH9 A;  2MBS A;  4ZL8 A;  2FA4 A;  2KLX A;  5G2Z A;  5KN1 A;  4CY6 A;  1MDJ A;  3PH9 A;  2YOI A;  4GTU A;  14GS A;  3HZ8 A;  2H1A A;  3FHK A;  2IN3 A;  3GL3 A;  4GSS A;  3KJY A;  3TKP A;  5CRH A;  5DCG A;  4K5S A;  4Q5Q A;  3GIX A;  2DJ3 A;  5A5K A;  5JWO B;  2XBI A;  4RI6 A;  4J2F A;  2H76 A;  2JZT A;  1GUH A;  2FY6 A;  1H4O A;  2QGV A;  3HVS A;  2E2G A;  3P90 A;  4XS6 A;  5DJM A;  3APQ A;  3TKQ A;  2ZUP A;  1Z3E A;  4NAX A;  3M1G A;  2AUV A;  3TB2 A;  1I9D A;  2IWT A;  2LJA A;  3A2X A;  5CRW A;  3LOR A;  4ZBB A;  1DBY A;  4XRD A;  1U87 A;  2A4V A;  5F05 A;  4GQC A;  3J7Y k;  1SJ6 A;  3LQ7 A;  1UVZ A;  1S3A A;  4OFM A;  2I9H A;  1ON4 A;  3KXO A;  1TXX A;  4PXO A;  1PL1 A;  2B1L A;  4OO4 A;  3HDC A;  4ZIL A;  5JWQ B;  1OAZ A;  2B7K A;  1BG5 A;  5ECK B;  3R3E A;  5JCW A;  1SJZ A;  1U6T A;  2K8V A;  2CZ3 A;  4I97 A;  2R37 A;  1J08 A;  3KZQ A;  3GX8 A;  1YJ6 A;  3CSJ A;  20GS A;  3BBY A;  2GSS A;  4Q5N A;  2VCW A;  4X4J A;  1FOV A;  1TRV A;  2C3T A;  2FUG 2;  3FZ5 A;  4ZL9 A;  1XVQ A;  5IMD A;  4BWQ A;  5IIZ A;  3IAM 2;  3KH7 A;  4E8H A;  4PUA A;  1XXU A;  2EC4 A;  2KOK A;  2JSY A;  1Z7P A;  1F3A A;  2OA7 A;  2FD3 A;  1EOG A;  1MD3 A;  2RII A;  4KCE A;  4IBP A;  1M9B A;  1T3B A;  1O6J A;  2R5G A;  4HQS A;  1DUG A;  1XIY A;  2I3Y A;  4CY8 A;  1X5D A;  1VRS D;  2MMN A;  3A3T A;  3BJ5 A;  3KMO A;  1ZCP A;  4ML1 A;  5D93 A;  2B5E A;  5IOX A;  5ECS A;  2N5B A;  2J9H A;  2F51 A;  4K0G A;  1XWB A;  3M0F A;  2PMT A;  2A4H A;  3GX0 A;  2VUP A;  4EVM A;  2HI7 A;  1PX6 A;  3DIE A;  5F07 A;  1XPV A;  2DC5 A;  4TW5 A;  4KH7 A;  4HS1 A;  3ZVJ D;  3LWA A;  1KEB A;  1K0A A;  4N30 A;  2YNX A;  2VD1 A;  1O8X A;  2NVL A;  2X8G A;  2GSR A;  3H8Q A;  4NPB A;  1JZO A;  3FW2 A;  3D6I A;  2IMI A;  5ECN B;  2GZP A;  5ELG A;  1JZR A;  1A0F A;  2YV7 A;  3FR3 A;  2R0P A;  2HZF A;  2GQL A;  4FQU A;  4BVY B;  2AB6 A;  3EC3 A;  1K0D A;  2M46 A;  2LQQ A;  3HCZ A;  1E6B A;  3HVX A;  4OWY A;  4FYU A;  4Z2R A;  2V2G A;  2DJK A;  3CTF A;  1X5C A;  4RI7 A;  2FA8 A;  4D73 A;  3O3T A;  4BPY A;  3F3Q A;  1GP1 A;  1M7T A;  1TRS A;  3TOU A;  3L9V A;  1B9X C;  2H75 A;  1F9M A;  1SEN A;  2MYG A;  2J23 A;  2H66 A;  1K0C A;  1PX7 A;  4FYC A;  1ZYN A;  2FHE A;  1PN9 A;  2C3Q A;  1N8J A;  3ZFL A;  4I8B A;  1ZYP A;  1C72 A;  2L5O A;  4Z2T A;  1EEM A;  4XRA A;  1GLP A;  2XC2 A;  3M9J A;  1U88 A;  1EGO A;  1K3Y A;  1IYI A;  1XOB A;  2LQO A;  2RUE A;  4ZB9 A;  3A2W A;  2NPB A;  2JL4 A;  4K7O A;  4GCI A;  2VCT A;  1JZW A;  4JRR A;  1W89 A;  2YJ7 A;  4IJI A;  4WEY A;  1PMT A;  2E7P A;  1TP9 A;  3FZ9 A;  3KM6 A;  3FYG A;  1Q4J A;  3FR9 A;  1GSD A;  1YZX A;  1X5E A;  3D4T A;  4ID0 A;  2P5Q A;  1Y25 A;  2VL2 C;  5H5Q A;  3HZ4 A;  1YKA A;  5ECH B;  1VF1 A;  4EIQ A;  4TVE A;  3TKS A;  3J7Y b;  3HYP A;  2VM1 A;  4GRF A;  2C0G A;  4OCE A;  5DBQ A;  5CYY A;  2NTO A;  2YWN A;  3HD5 A;  5ECO B;  4L0U A;  2YWI A;  1CQG A;  1MD4 A;  3TGZ A;  4Z7X A;  1SJI A;  1YEX A;  1XWA A;  1WJK A;  3G7Y A;  1XVW A;  1IYH A;  2G2Q A;  2DLX A;  4WBR D;  4O5U A;  4HQZ A;  3ZIT A;  3QFB C;  1XW9 A;  4KUN A;  4NWY A;  4AGS A;  4XS1 A;  2CQ9 A;  4ICY A;  1GSU A;  2EIO A;  3GL5 A;  3IHG A;  4TR0 A;  5AIX A;  2O89 A;  1BQ7 A;  2DSA A;  2VLT A;  1F2E A;  3FZ4 A;  2MBT A;  1TRW A;  6GSY A;  4WR5 A;  1O8W A;  3FR6 A;  3TRP A;  4JZQ A;  5IOW A;  2LV3 A;  3D0Z A;  1TU8 A;  5G5F A;  3RBT A;  3EU3 A;  5ELA A;  3US3 A;  2GT6 A;  4Z2U A;  1CQH A;  3SBC A;  5G5E A;  4ISD A;  1NHY A;  4ZIJ A;  2B6M A;  2H71 A;  4JED A;  2LTK A;  2HNL A;  4F0B A;  3CXG A;  5ENU A;  2DKH A;  1ZYQ B;  1ZZY A;  2LNS A;  5D8I A;  1ZOF A;  4ML6 A;  1XZO A;  2AJQ B;  1OC8 A;  4L0W A;  3H79 A;  4A5P A;  5EL8 A;  5DAK A;  3DWV A;  5ECQ B;  2X49 A;  1E2Y A;  2YV9 A;  5CO3 A;  3G7I A;  5FHI A;  5GZZ B;  16GS A;  3EE2 A;  2FLS A;  1G6Y A;  2DML A;  4ZB8 A;  2R0G A;  3EIN A;  2V41 A;  4D73 B;  5A4U A;  4K7N A;  3WGE A;  2YZH A;  2GSQ A;  3GKX A;  4L5L A;  1TTZ A;  3BCK A;  4TOP A;  4MJB A;  2I1U A;  2LNT A;  4PNF A;  1K0M A;  3U5R E;  4FYB A;  1WRY A;  4AJ7 A;  2BTO T;  3TRX A;  18GS A;  1VF2 A;  3D4M A;  2V6K A;  5IMC A;  5GST A;  1WWJ A;  1T1V A;  4PX1 A;  3BD2 A;  4K8M A;  4V2M A;  3O76 A;  4KSM A;  1GTB A;  4EDZ A;  2DJ2 A;  4WET A;  5JCU A;  2VCQ A;  2ZCT A;  6GSW A;  3KMN A;  5HR1 A;  3EU4 A;  1S3D A;  4G9H A;  2KHP A;  4NMU A;  5EPF A;  3BCI A;  4MAB A;  3F8U A;  5A4W A;  2L6C A;  3EMX A;  3QAG A;  3ZLP A;  2JU5 A;  4OD7 A;  5CNW A;  4PQI A;  4AF2 A;  2RLI A;  1X0R A;  4X43 A;  1Z5Y E;  1GUL A;  1XFL A;  4O92 A;  4TR1 A;  3QMX A;  1SKR B;  5ECP B;  3F4S A;  3LXZ A;  3GHA A;  10GS A;  1O85 A;  1BAY A;  4MK3 A;  3ME8 A;  2YAN A;  2C1Y A;  4MP4 A;  1KNG A;  4HOJ A;  3HY2 A;  1TI1 A;  2CZ2 A;  2FNO A;  2LST A;  1T7P B;  2BMX A;  3VI7 A;  5IQY A;  3H4K A;  2H1D A;  5IMF A;  1XOA A;  2GVP A;  3DRN A;  2L5L A;  1EWX A;  3NZN A;  2H01 A;  4JBB A;  1PL2 A;  1W4V A;  1Z9H A;  2LJK A;  3UVH A;  5HR2 A;  2RM6 A;  1ZGN A;  3LYK A;  2K6V A;  1U3A A;  2CX3 A;  5KN2 A;  1PKW A;  4RQX A;  1HNC A;  3TJK A;  1PKZ A;  2B3S A;  4YQV A;  1PSQ A;  4V1A g;  2FWG A;  3GKN A;  1R5A A;  3H1N A;  3LW9 A;  3W6G A;  4F2I A;  2PWJ A;  4LL1 B;  5IO2 A;  2R4V A;  1T00 A;  4TXV A;  1FHE A;  3IRA A;  3I6A A;  3G7J A;  5BMU A;  3K8N A;  5L71 A;  3CBU A;  4TXO A;  4K1F A;  3KP8 A;  3M3M A;  1THX A;  1ERV A;  2UZ8 A;  3I69 A;  5INY A;  4YAP A;  1UA5 A;  5IO0 A;  3QAW A;  5D9X A;  2NDO A;  2PBJ A;  3HJO A;  4V1A p;  12GS A;  1BED A;  4ZXG A;  5C04 A;  1SK1 A;  4DSS A;  4HDE A;  1GSE A;  1HD2 A;  2MMO A;  3FKF A;  1H75 A;  3RHB A;  3APO A;  4G2E A;  3UOM A;  2L57 A;  1QGV A;  2B5X A;  5LCZ A;  4MJC A;  1SL0 B;  1AQW A;  4MH3 A;  3DVX A;  2NBS A;  3P7X A;  1F37 A;  5J3R A;  3FK8 A;  3ZMK A;  1GLQ A;  4TRX A;  3F6F A;  2FWE A;  4OFN A;  2CVK A;  1QFN A;  5D9T A;  3CTG A;  2L6D A;  2LJR A;  1V9W A;  3CYN A;  5J41 A;  3GMF A;  5COH A;  4IS0 A;  5KN3 A;  3C1S A;  2H6Y A;  1M0U A;  5DAK B;  5HFG A;  2GQK A;  2VL9 A;  4HJM A;  5FT3 A;  5J9C A;  3TRQ A;  22GS A;  4IJ3 A;  4POM A;  3GN3 A;  1XBS A;  2HZE A;  17GS A;  4KDY A;  3EYT A;  1OVN A;  2VCZ A;  4OMV A;  2WZ9 A;  4IEL A;  2X8H A;  5G31 A;  3R2Q A;  3EMP A;  2FCH A;  3ERW A;  3L9U A;  3DGQ A;  3IK9 A;  2EIQ A;  3RPP A;  2XHF A;  4DSQ A;  3UAP A;  2IMD A;  2O7K A;  5GAN D;  5DDL A;  1TW9 A;  3KEB A;  1EV9 A;  3VFI A;  1ZL9 A;  2WS2 A;  2HT9 A;  5DJL A;  2F9S A;  5IM9 A;  3W8J A;  1OC3 A;  4MF6 A;  2M80 A;  2GT5 A;  4CW9 A;  4USS A;  2P31 A;  2QC7 A;  2BJX A;  3VWV A;  3QR6 A;  4N0Z A;  4IKH A;  1YKC A;  3UEM A;  4IQ1 A;  3VWU A;  1SYR A;  2VAF A;  4ZL7 A;  1AW9 A;  1EZK A;  4JR4 A;  3GH9 A;  4LMW A;  3ZYW A;  2CAQ A;  2TRX A;  2YPM A;  4LMV A;  4WF5 A;  3CSI A;  1QK8 A;  1ZMA A;  3JCM L;  4MA9 A;  3TCO A;  4KA0 A;  1YF0 A;  3IC4 A;  2AHE A;  2IIY A;  3D21 A;  1KTE A;  2LUS A;  1J9B A;  4TR1 B;  3APS A;  2GS3 A;  4EE0 A;  5B6M A;  3KIJ A;  2WDU A;  2DIY A;  3OR5 A;  4POK A;  3TJG A;  1PD2 1;  2M72 A;  1R4W A;  2OE3 A;  2CV4 A;  4HJ2 A;  1GRX A;  4GXZ A;  3EUR A;  4PNG A;  3SWL A;  3RHC A;  2XPD A;  3F4R A;  3IK7 A;  1TJD A;  4E8E A;  1HYU A;  2HRA A;  4I2U A;  2PU9 C;  2C8U A;  2TIR A;  2V1M A;  2HSH A;  4PQH A;  3C73 A;  3HVV A;  3FY7 A;  4MDC A;  3F3R A;  2GQM A;  4ECC A;  3RPN A;  4KGI A;  4OO5 A;  2B1K A;  5H5S A;  1QQ2 A;  1PGT A;  4XCS A;  1RK4 A;  3IBH A;  3VPQ A;  3GH6 A;  1TU7 A;  1SYX A;  4EDY A;  1GL8 A;  1TI3 A;  4HZ4 A;  4PQ1 A;  4XHM A;  2CVD A;  3IE3 A;  3A5I A;  1FG4 A;  1Z6M A;  1ILO A;  3LXT A;  4LLR A;  2OE1 A;  4YQU A;  3L78 A;  3LYP A;  2AAW A;  4V2N A;  4BWS A;  3LGC A;  4RUV A;  4PUR A;  2DJ0 A;  5D9W A;  3E0U A;  4TXO B;  3QOU A;  8GSS A;  1GH2 A;  1EOH A;  3I9V 2;  4N0V A;  5ECL B;  1DE2 A;  1S3C A;  2JZS A;  5C00 A;  1FW1 A;  3VWW A;  2DKI A;  4CDO A;  3TKR A;  3AY8 A;  4MJA A;  5ID2 A;  3VI5 A;  4F82 A;  2ES7 A;  4G0I A;  3KGK A;  1KBN A;  2YJH A;  4NXI A;  3HJM A;  4HI7 A;  3EWL A;  2VCX A;  4DSR A;  5CP1 A;  2H19 A;  3QFA C;  2H73 A;  4XIH A;  4PUF C;  4DSS B;  2OKA A;  3GFK A;  4YQM A;  3QPM A;  5E59 A;  2KP1 A;  4ECB A;  2L59 A;  5KN0 A;  1G7E A;  2IMF A;  1FO5 A;  6GST A;  1M9A A;  3E3E A;  4TR3 A;  1Z7R A;  3V1W A;  1JHB A;  1FB0 A;  2H74 A;  1GSS A;  1FOH A;  1A0R P;  1AQV A;  2KUC A;  5IMZ A;  2HFD A;  1AXD A;  3D5J A;  4NV2 A;  1R26 A;  3MYD A;  4BVX A;  3S9F A;  9GSS A;  1RW1 A;  2HZE B;  1AC1 A;  4K0N A;  2WFC A;  3M9K A;  3CRT A;  1MEK A;  1GUK A;  4O5R A;  1A2L A;  4Q5F A;  2R6K A;  4K6X A;  2CT6 A;  19GS A;  1TK5 B;  2L4Q A;  3TOT A;  4IGJ A;  1EP7 A;  5D96 A;  4TR4 A;  2VD0 A;  2VOC A;  4J56 E;  3IPZ A;  4MLY A;  5ABR A;  1YQ1 A;  1FAA A;  3MSZ A;  2VL2 A;  1K0N A;  1V2A A;  1R5P A;  3ZRD A;  2ALB A;  2H1B A;  2JZR A;  2VCV A;  2IPA A;  1K3L A;  5G1K A;  3IV4 A;  4GST A;  4DVC A;  4JE1 A;  3PGT A;  1U3I A;  5DCH A;  3IA1 A;  2X64 A;  3CRU A;  3GNJ A;  1QXH A;  11GS A;  1FB6 A;  1GSQ A;  3F9U A;  1JLV A;  4MZB A;  4NHW A;  1MTC A;  2WCI A;  1G7O A;  2OAD A;  3ZML A;  5DVB A;  4YAV A;  4ZBD A;  1PA3 A;  2E2M A;  1GSF A;  1SL1 B;  2IMK A;  3DXB A;  2TRC P;  1K0O A;  2LS5 A;  5D73 A;  4O7H A;  1XWC A;  3F0I A;  2HSY A;  4MH2 A;  5J9B A;  5AN1 A;  4OCF A;  1V40 A;  2XBQ A;  4NV5 A;  4G19 A;  1B4Q A;  3NIV A;  2QA1 A;  3VUR A;  4WF4 A;  1AAZ A;  2HRN A;  2YP6 A;  2GST A;  3DKS A;  4YH2 A;  4KX4 A;  2Z9S A;  1WP0 A;  2X4A A;  5ECI B;  2OJL A;  1GNW A;  3L4N A;  1QUW A;  2GTU A;  1GTI A;  2H72 A;  2VM2 A;  4N11 A;  5E4W A;  2R0C A;  5GAP D;  2RUF A;  4QQ7 A;  1WMJ A;  1SD9 A;  1NHO A;  4K9Z A;  1XW6 A;  1SK0 A;  2PVO C;  4KF9 A;  3KCM A;  4KSO A;  6GSS A;  2QKE A;  5CRG A;  4IHU A;  1GUM A;  5DQY A;  5B7C A;  1XW5 A;  5B6N A;  5IMA A;  2HLS A;  4ZB6 A;  3C71 A;  4KND A;  1B9Y C;  1FVK A;  2OBI A;  5J5N A;  3GA4 A;  2FGX A;  2H8L A;  2H30 A;  1JFU A;  5F0G A;  4OFT A;  1EP8 A;  2PPT A;  5F8B A;  3ZTL A;  3WT2 A;  1MDI A;  2CX4 A;  1YF1 A;  3F4T A;  1T4Z A;  5ID2 B;  3LJR A;  2WB9 A;  1GWC A;  2DMM A;  2PGT A;  2B5Y A;  2A2S A;  1Z6N A;  4Q5R A;  3ZIJ A;  3IC8 A;  1ML6 A;  2REM A;  3PR8 A;  3ERF A;  3C1R A;  1Y6E A;  4KAE A;  1AIU A;  3ISO A;  1GTA A;  3QAV A;  4ZBA A;  1NM3 A;  4O32 A;  3WYW A;  1K3O A;  3RDW A;  1SL2 B;  1O73 A;  5FWG A;  3FZA A;  4IW9 A;  3ZIV A;  2IME A;  1AUC A;  5EVO A;  4GF0 A;  3WD6 A;  3ME7 A;  3MDK A;  4MPG A;  4IN0 A;  2GLR A;  2LKU A;  1F6M C;  3GST A;  2C0D A;  5AIV A;  4EL1 A;  4BVX B;  1ERU A;  2WGR A;  2I4A A;  3KP9 A;  1R7H A;  4WBJ A;  3UIW A;  2IL3 A;  1ERT A;  1GSY A;  3UJ1 A;  2P5R A;  4MF5 A;  4K2X A;  1I5G A;  1WOU A;  4GWR A;  4PGT A;  1BX9 A;  4ULX A;  5G30 A;  2D2Z A;  3UBL A;  2OE0 A;  2GZZ A;  3N9J A;  3M8N A;  2HYX A;  2YZU A;  4G0L A;  4K2D A;  4O5Q A;  3GRX A;  3Q6O A;  5CRE A;  1B8X A;  2A2R A;  1BYE A;  2V6O A;  2JAC A;  6GSU A;  2O8V B;  4RQR A;  4MJE A;  1OC9 A;  3ED3 A;  3H93 A;  1WPI A;  3P8W A;  2HRK A;  4I2T A;  5B8A A;  5KEJ A;  5AIS A;  4POL A;  1RQM A;  2GZY A;  1TK8 B;  1VGL A;  1LJR A;  3VLN A;  4G0K A;  1ST9 A;  1MDK A;  3QDN A;  1THO A;  2IFQ A;  4KW6 A;  5H5R A;  3GYK A;  4TKY A;  4WXT A;  2H6Z A;  2C3N A;  3LFL A;  4K5R A;  1TOF A;  2VO4 A;  2H6X A;  2O87 A;  1ACV A;  6GSV A;  2H70 A;  2ZNM A;  4IP1 A;  1TKD B;  2R2J A;  3F63 A;  3FMW A;  3UAR A;  1WIK A;  1PN0 A;  3HA9 A;  4X0X A;  3WGD A;  4YKF A;  4GQF A;  3FEU A;  1QMV A;  2VLV A;  3DVW A;  1X9W B;  3RAZ A;  2AYT A;  2JSZ A;  2PUK C;  3GKK A;  5DAL A;  3ERG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...