2VLTA

Crystal structure of barley thioredoxin h isoform 2 in the oxidized state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
AEVISVHSLEQWTMQIEEANTAKKLVVIDFTASWCGPCRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN H ISOFORM 2.
publication title Crystal Structures of Barley Thioredoxin H Isoforms Hvtrxh1 and Hvtrxh2 Reveal Features Involved in Protein Recognition and Possibly in Discriminating the Isoform Specificity.
pubmed doi rcsb
source organism Hordeum vulgare var. distichum
molecule tags Oxidoreductase
total genus 32
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vltA01
1OAZA 2FWEA 2ALBA 4OCFA 3GL5A 1AQWA 4TR0A 1K0BA 3O6TA 3QOUA 4MF5A 1YQ1A 2YPMA 3BOAA 1EWXA 5D9XA 1R4WA 2LQOA 2J9HA 5IPHA 2LJAA 2JZRA 3L4NA 4I97A 1K3OA 2YNXA 2H66A 1B48A 4K0NA 4HQZA 1XW6A 1NSWA 1T4YA 3QFAC 2I4AA 1RW1A 1I9DA 2OA7A 1SYRA 4OO5A 3BCKA 1C72A 1XVQA 3GN3A 1M0UA 3C71A 6GSVA 4MABA 3HD5A 1JZWA 5DBQA 2P0GA 4J57E 1Z3EA 3EMXA 3LG6A 5E4WA 1PKZA 5IM9A 1JZRA 3D5JA 3D4TA 3KH7A 3VURA 4EC0A 4I5QA 1ACVA 2K9FA 4MLYA 4KUNA 1UVZA 2VL9A 1BEDA 1WRYA 4MZBA 2DIYA 1T00A 1SKWB 4FO5A 1X9MB 1O7UA 2GVPA 2KHPA 3GX0A 4IW9A 4KB3A 2RM5A 3CTGA 1K3YA 2V1MA 3IPZA 1TP9A 4BPYA 3IBHA 1XWKA 5IIZA 4HS1A 1GSSA 3VWUA 5KN2A 2IL3A 1TI3A 3HVSA 1X5EA 2NBSA 4HU7A 2OACA 3CSHA 4MMMA 4DVCA 1NW2A 2PPTA 1F2EA 2XPEA 1KBNA 4EXJA 3WT1A 2LJRA 4JEDA 2REMA 2JL4A 1OC9B 4IP1A 2C0EA 4EDZA 1SD9A 2PBJA 1SK1A 4OFMA 3CRTA 3MAKA 5HR1A 1EOGA 5ECIB 1X5DA 1G7EA 2R6KA 2MBSA 2LNSA 2VM1A 1ZYQB 2H76A 3IE3A 3CTFA 3D21A 4KH7A 2CX4A 4AF2A 4NAXA 2LS5A 3EE2A 3DIEA 5GSTA 4GSTA 1GSQA 4IN0A 1SJIA 1JZOA 4NHZA 3ZZXA 3H8QA 4ECIA 1GNEA 5IOXA 3RDWA 1MEKA 4IJIA 4CDOA 5A4WA 2H19A 2G0FA 4BVYA 4HI7A 2DIZA 3S9FA 1GNWA 3FR9A 3UOMA 4YH2A 2CA8A 3WGXA 2O7KA 2CT6A 3A2WA 3ZRDA 2FHEA 5D93A 2M80A 5HFGA 2V6OA 5KN0A 2JSYA 3GL3A 4MZWA 1A0RP 1QQ2A 5J9CA 1O6JA 4NPBA 3CSIA 1GLQA 2V6KA 3DGQA 1ZZYA 4HQSA 2J23A 1T4ZA 4WR5A 1XVWA 3F8UA 5GZZB 4G9HA 2F51A 3M3MA 1TDIA 2OE3A 3KMOA 5JWOB 3UARA 1ERTA 3IK9A 4KAEA 4ULXA 3A3TA 4G10A 4O32A 4GCIA 3CXGA 3N9JA 4F2IA 3C1RA 3H79A 5COHA 2IMIA 1SKRB 4J56E 2H0HA 5LD0A 2EIQA 3HKRA 1M9AA 1ML6A 4ZL8A 2E0QA 5EY6A 4AJ7A 5IMVA 4Z7XA 2OKAA 4RUVA 2OE0A 4HDEA 1R7HA 3TKQA 4NV5A 1YKAA 2HZEA 1J9BA 2L59A 3LJRA 2H0GA 2GZZA 2H01A 4ECCA 2M46A 2B1KA 10GSA 5ECHB 2LRTA 5JCWA 2X8CA 3ZREA 2N5AA 4EF0A 2LUSA 4MP4A 3ED3A 4F0BA 1XW9A 5F07A 4POBA 4XRAA 2P5QA 5EVOA 5G31A 1OVNA 2LKUA 1A2JA 4QQ7A 2E2GA 5IQYA 4TVEA 4TR1A 2EIOA 2VOCA 3IR4A 3HY2A 1TJDA 4L8EA 4HJMA 1GLPA 5E59A 2DLXA 4BWQA 3F6FA 4EDYA 2CAIA 4EL1A 2FWFA 1K0OA 4L0UA 5CRGA 1XOAA 2DJJA 4MDCA 4HOJA 2H71A 1CQHA 2L57A 1BJXA 3TJFA 3HA9A 3TB2A 6GSSA 1XCCA 2MZCA 3H93A 1Z5YE 1UA5A 1K0AA 3DXBA 3KP9A 1WOUA 5J4UA 2P5RA 1PL1A 1V58A 4HUAA 1V98A 2LEGA 1EEMA 1PGTA 3GH6A 3LGCA 3ME8A 1ZL9A 2VCQA 3J7Yb 4RQRA 3IXRA 1KNGA 2AB6A 1EP7A 2V2GA 3ZIVA 1HYUA 1EV9A 4OO4A 2YWNA 1NM3A 1TOFA 2FUG2 4GQFA 2LQQA 4MJEA 1MTCA 5HFKA 3UVHA 3GIXA 3RHBA 4FYUA 2GSTA 2H75A 13GSA 1V9WA 1W89A 4TR4A 4ZBAA 4V1Ap 2E2MA 2P31A 3GYKA 2HNLA 2QGVA 1M2AA 3IA1A 1HNAA 3HJOA 1LJRA 2JU5A 3LFLA 6GSUA 4TXVA 3QD9A 2YWOA 2PVOC 5ECLB 1HQOA 3IDVA 3ZFLA 1V57A 3IAS2 4QL7A 3IC4A 5CNWA 1A0FA 2H1GA 5KEJA 2HZFA 2YOIA 1G7OA 1O73A 4Q5QA 1SYXA 4E8HA 2GLRA 3BBYA 3TRPA 2H0IA 2DC5A 4ECBA 1O8XA 1Y6EA 1XWCA 2F3MA 3GKNA 3Q74A 1XWGA 4X1UA 4FYBA 1U3AA 5J3RA 1QXHA 2CZ3A 4IVFA 2X8GA 4TXOB 2CZ2A 4ZL7A 3ZITA 5D9WA 5AIXA 3DD3A 1WMJA 4N30A 2PWJA 3Q19A 1AUCA 4HU9A 3TKSC 1OC3A 1TKDB 3UIWA 3D0ZA 4YQUA 5ECQB 1LBKA 4MH3A 3M9JA 3APOA 1U88A 3L9SA 3K8NA 6GSTA 1O81A 2HI7A 1B4QA 4BVXA 3LWAA 2H74A 4IQAA 2L6DA 3CRUA 1TI1A 2IMFA 2CVKA 3QPMA 3EMPA 1A2LA 4DEJA 2GQLA 4WEYA 3KTLA 5DALB 2GZYA 4LL1B 2O8VB 3HVVA 5HFIA 3FRCA 5CRDA 3GKKA 3US3A 1W4VA 16GSA 4XHMA 1HD2A 3ZVJA 2JZTA 3NIVA 3LYPA 1XIYA 4DSSB 3G7JA 3FY7A 4KCEA 4WKWA 1Q98A 5DAKB 1ST9A 3R2QA 2MMZA 4KA0A 4WBJA 5ECMB 4HZ2A 1SK0A 4TOPA 2VD1A 4IHUA 4EKZA 14GSA 4NHWA 3TJKA 5D9VA 3VFIA 2PVQA 1SKSB 2H8LA 4TKYA 4TW5A 4K7OA 2RUFA 3MDKA 3L9UA 2B1LA 4MJBA 2H1DA 2HRNA 3BCIA 4Q5RA 5DVBA 1A8YA 9GSSA 1SL2B 3PINA 4N0ZA 1MD4A 1B9YC 4IQ1A 4V2NA 6GSWA 1YY7A 4DSQA 1DSBA 1AC1A 4L5LA 1SU9A 4H86A 4LL4B 4GTUA 5IMZA 1YZXA 3QAGA 4MPGA 1YF1A 4POMA 3F4SA 1OC9A 1PA3A 4L0WA 1NHYA 1DBYA 4LMVA 4MJAA 4PGTA 3E0UA 1VGLA 4JZQA 17GSA 3F9UA 3MSZA 4HJ2A 4MJCA 3EINA 4MPFA 2JACA 1MD3A 2H6YA 3D22A 3UBKA 3GMFA 5B8BA 2FNOA 2DJ1A 1OYJA 1PX7A 1OE7A 2VAFA 2K18A 3FR6A 3G7IA 4ML1A 5CRWA 5GAPD 3GTUB 2VCWA 2GT6A 3ZFBA 5GSSA 2HE3A 5DCHA 3VWXA 2YANA 5F0GA 3MNGA 4IP6A 3IK7A 1GTUA 4TR3A 2LTKA 4NXIA 3FW2A 5JCGA 1B8XA 2L4CA 1FB6A 5JCUA 1QMVA 1EEJA 1TK5B 2AUVA 1M2BA 4Q5FA 1PQNA 2GSSA 4LMWA 3UEMA 5IO2A 2CVDA 4MH2A 1PN9A 2FCHA 1EZKA 1YEXA 2AYTA 1FOVA 4EE0A 19GSA 5IOWA 1LU4A 2LRNA 4N10A 4EO3A 1GSYA 2EIRA 4ACSA 3GFKA 1ERUA 2HLSA 4N0VA 1R5PA 2R5GA 2VL2A 1TRUA 3LXTA 1IYHA 4N11A 2QKEA 2KP2A 3D6IA 3CMIA 1GSEA 4MF7A 4BWSA 1EV4A 1CQGA 3LORA 8GSSA 3FK8A 2VCTA 3H1NA 5LNKe 1URMA 1EOHA 4P3YB 3TOTA 2RM6A 2PU9C 1AAZA 4I2UA 4KDXA 4G19A 1TU7A 4O5RA 2RUEA 3F63A 1R26A 3EU4A 2L5LA 5ECSA 3FZ4A 2I3YA 5B6MA 1ABAA 2L4QA 1GUKA 5AIVA 2DJ3A 4PURA 1HNCA 4ILFA 4ID0A 4WF4A 1V2AA 1S3CA 4FH8A 2B5YA 5ECRB 1K0NA 1PRXA 2EC4A 2F9SA 1PSQA 2R2JA 4F9ZA 3ZLPA 3WT2A 3UJ1A 4D73B 4F0CA 2YJHA 2OJLA 3HZ8A 2H1BA 2YCDA 1YJ6A 3FKFA 3EC3A 3KD0A 4GSSA 3M1GA 3WYWA 4BA7A 5KN1A 1JLVA 5L71A 2C0GA 1BQ7A 3BJ5A 1XPVA 3LSZA 4XS4A 2XBQA 5G1LA 2YJ7A 4KW6A 4KSMA 1JHBA 1T7PB 1SENA 1QUWA 4X0XA 2WULA 1SL1B 1XBSA 1WE0A 2TIRA 2PUKC 1XXUA 4PNFA 4IS0A 4I8BA 4XCSA 4PQHA 1RQMA 4HEA2 4TRXA 4KCAA 1GUHA 2ZCTA 4OFNA 4X43A 3DWVA 4V2LA 3O76A 3EYTA 3VWWA 1OC8A 2CVBA 5ELAA 3KMNA 2N5FA 4KDYA 1VF4A 4GSNA 3WGEA 3VI5A 1GULA 3RHCA 1BYEA 4XS6A 4KSOA 3TJBA 4IKHA 1FB0A 2H30A 3VWVA 4PQIA 3WGDA 3UL3A 3GSSA 3CBUA 1USBA 2WGRA 3ME7A 4DSRA 3M9KA 1Z6NA 1IYIA 2IN3A 5ID2B 3APQA 3D4MA 1VRSD 1GSUA 4MF6A 3VLNA 2GQKA 1F9MA 1VF3A 12GSA 1F3BA 3KH9A 1OKTA 2WJUA 2V41A 1F6MC 3O3TA 2K8SA 1XZOA 2GSQA 2PGTA 4NWYA 1J08A 4YQMA 2L6CA 2KLXA 1BG5A 5DDLA 3U6VA 2C0FA 1K0CA 1XWAA 1J0FA 1PD21 2FA8A 1KEBA 1NHOA 4K9ZA 2HRFA 2CQ9A 4POLA 2H70A 1T1VA 3FR3A 1ILOA 1TTZA 1FG4A 4TXOA 2VD0A 1QGVA 1AW9A 4GRFA 4PX1A 3FEUA 3W6GA 4OWYA 2BJXA 2GSRA 5IMCA 5CREA 3FHKA 1TK0B 5ENUA 3ZVJD 2V32A 4ZXGA 5HR2A 3TCOA 1I5GA 1JZDA 3M0FA 2WCIA 5J9BA 4K6XA 3HZ4A 3TRXA 2C80A 1AQVA 3PGTA 2VCZA 2WB9A 5G1KA 2QC7A 4GWRA 3C73A 1S3DA 3PH9A 1FW1A 3P8WA 2YWMA 2ON5A 1GL8A 5AN1A 2VCXA 2Z9SA 6GSYA 3L9VA 5B8AA 4BL7A 5LCZA 3G7YA 4PNGA 3JCML 3U5RE 1UC7A 2VM2A 4KE3A 3W8JA 4F82A 5D73A 2AHEA 2D2ZA 3L0HA 2XPDA 3C1SA 4DSSA 3VI7A 3GX8A 4POKA 1TRVA 5CYYA 5DAKA 1H75A 5IMFA 1YEPA 3TKSE 4ISDA 2MBTA 4FIWA 3DEXA 5ECPB 1FVKA 3HJPA 3VPQA 4WXTA 2IFQB 4I2TA 4FYCA 5CAXA 5ECOB 4KGIA 4JR6A 2JSZA 3TJJA 3MWHA 1T3BA 3EVIA 4XIHA 1GH2A 2HT9A 1F3AA 2FWGA 4KNDA 2AV4A 2IMKA 3IV4A 4J2FA 1Z6MA 2GT5A 5D8IA 3N5OA 3HXSA 4IJ3A 1Z7RA 1SJZA 4ZILA 3F4RA 3I69A 2A2SA 5F8BA 3GKXA 1X9WB 3ISOA 5C00A 1XW5A 1OKDA 5FT3A 3QR6A 1K3LA 2E7PA 5DJLA 1M2DA 3EU3A 2HYXA 4V1Ag 2BTOT 3A5WA 1ZCPA 3I43A 5G2ZA 2GTUA 1HNBA 2TRXA 5ELGA 5IMAA 3SWLA 3NOFA 2LRCA 1DE1A 5INYA 1G6YA 2HXKA 18GSA 1T8EB 2K6VA 2IPAA 1ERVA 1QK8A 2WFCA 4JU5A 3QMXA 1YF0A 2DJKA 2IJYA 4PXOA 3FZ9A 3NZNA 3KEBA 1K0MA 2YZHA 2I9HA 3GTUA 3FYGA 3GUSA 1K0DA 2C1YA 5EPFA 2X64A 3F6DA 20GSA 2DSAA 1FAAA 2G2QA 4MCUA 1JLWA 2DJ2A 2C3QA 2C4JA 4ZB9A 1VF1A 3GV1A 3KXOA 22GSA 3APSA 1G6WA 1ZGNA 5HR0A 4QL9A 3I6AA 3V1WA 3HVXA 1FO5A 1B4PA 2HSYA 1DE2A 1WPIA 1EP8A 3KP8A 2VL3A 3GA4A 5ECNB 1GSFA 3KM6A 4ZL9A 3A2XA 4ZIJA 5B7CA 3HCZA 1EGRA 2KP1A 2TRCP 5G30A 1TW9A 2B7JA 1EGOA 2VO4A 5GAND 1G0TA 2OBKA 4EUYA 4GQCA 3J7Yk 3M8NA 3KZQA 5AGYA 2YN1A 3E9JB 3C8EA 2DBCA 2YZUA 4ML6A 3GURA 2IIYA 4K1FA 2QSIA 1GTAA 1ZMAA 4WETA 3HYPA 2F8AA 3P90A 4LA1A 3QAWA 1THXA 2PN8A 3QFBC 5CP1A 2LJKA 1YDKA 3F3RA 5F05A 5JWQB 1Y25A 3AY8A 2X99A 3FZAA 5C04A 5DQSA 4F03A 3KTBA 3IAM2 4HZ4A 2I1UA 3ZTLA 2FA4A 3SBCA 1M9BA 2FGXA 2VLUA 3ERFA 4LLRA 1XOBA 2ZUPA 1WP0A 4ZB8A 1M99A 1XWBA 2B5XA 1GSDA 2A2RA 3QAVA 3DYRA 2XBIA 4D73A 4RQXA 3EWLA 1V40A 2GDRA 1N8JA 2VLTA 1M7TA 2YV9A 1SL0B 2R3XA 1O8WA 1X5CA 3I9V2 2N5BA 2MMOA 1SD8A 4IBPA 1E6BA 1Z9HA 1TXXA 4AJ6A 3UAPA 2WRTA 2KUCA 1U6TA 2LNTA 4PUFC 2HFDA 3C7MA 4JR4A 4YQVA 1U3IA 3VPTA 1WIKA 3GRXA 3ERGA 2C8UA 3GNJA 1MDKA 4G2EA 5CO3A 2WDUA 4RI7A 4CHSA 3G9BA 1WWJA 2GQMA 4GXZA 4PUAA 3QDNA 2FY6A 2OBIA 4MK3A 2M72A 4TN8A 2MMNA 3GH9A 5IPGA 2ON7A 1BAYA 3ZIJA 2H72A 1GP1A 5H5RA 2ZNMA 3OR5A 4GLTA 1N2AA 2KOKA 11GSA 3TKSA 1R5AA 2JADA 1AIUA 5IMDA 4K0GA 2ES7A 3TGZA 3F3QA 3UMAA 5ID2A 1A2MA 4PQ1A 5G5FA 2MYGA 3DKSA 2A4VA 3KGKA 7GSSA 1U87A 1ZYEA 2NPBA 3KIJA 5A5KA 3W8SA 2LV3A 1Q4JA 4OD7A 4XRDA 1FHEA 3RPPA 5A4VA 2NDOA 3HHVA 3LXZA 4EVMA 3F4TA 2O89A 2OE1A 4ZBDA 4MA9A 3TKPA 2VUPA 1GWCA 5FWGA 4MZCA 2C0DA 1F37A 3DVXA 3KCMA 1X9SB 1A24A 2MMAA 3LYKA 2H6ZA 4ZB6A 3KJYA 1TRSA 3FZ5A 4JRRA 2FWHA 4V2MA 3DRNA 3UBLA 1OE8A 5J5NA 2RIIA 2VCVA 2R37A 2B3SA 3H4KA 4KX4A 4OMVA 3PR8A 3P2AA 4XTSA 1GTIA 3QCPA 3DMLA 5ECKB 3E3EA 2PMTA 4XS4B 4RI6A 4IGJA 2GZPA 2H73A 2B7KA 4Q5NA 2DMLA 3ZL5A 2HZEB 5F06A 1FVJA 1A23A 2LSTA 2K8VA 2CX3A 2FD3A 2CAQA 5CRHA 1ZOFA 3GKMA 4AJ8A 5DJMA 5H5QA 3ZMLA 5HQPA 3GSTA 3F0IA 1YKCA 2VL2C 1SJ6A 1QFNA 4TR1B 1SK2A 2VLVA 2PERA 1Z7PA 4IELA 1THOA 4O92A 2IFQA 4NV2A 3DVWA 3ZMKA 3IOSA 4OCEA 5AISA 1GTBA 1WJKA 5G5EA 2WZ9A 1XFLA 1JFUA 1VF2A 3RBTA 5B6NA 2H6XA 5DALA 4XS1A 3EURA 2B5EA 4ZBBA 2NVLA 3BD2A 1GUMA 4YAVA 1KTEA 3WD6A 1H4OA 3RPNA 3P7XA 4I6XA 4L5OA 4CW9A 5DCGA 1GRXA 2RLIA 3TJGA 5D96A 2HSHA 1BX9A 2I81A 2AAWA 3Q6OA 4JE1A 2IWTA 2O87A 5ABRA 5HR3A 1TU8A 2JZSA 3A2VA 3TKRA 2WS2A 1AQXA 2YWIA 3LQ7A 5D9TA 2VIMA 2B6MA 2C3NA 3ZYWA 4NMUA 4GF0A 4WF5A 4JBBA 3TOUA 4WR4A 6GSXA 1ON4A 4OFTA 2DMMA 2NTOA 3GHAA 4AGSA 3Q18A 2H1AA 4K8MA 1PX6A 5KN3A 3CSJA 1PMTA 3RAZA 3TUEA 4K7IA 4K2DA 3HDCA 3IHQA 1UN2A 1A8LA 2OADA 3UVTA 4KDUA 5DQYA 1S3AA 5H5SA 4WBRD 1B9XC 2R4VA 1MDJA 2GS3A 4K7NA 2IMEA 1PKWA 2IMDA 4E8EA 1E2YA 2YP6A 2FLSA 1TK8B 3CYNA 3L78A 4YAPA 2CV4A 2C3TA 3IRAA 5A4UA 5FHIA 5IO0A 2X8HA 1TRWA 2F8FA 3LEFA 5EL8A 5J41A 1RK4A 2XC2A 2AJQB 1O85A 4ECJA 2BMXA 2YV7A 2L5OA 2O85A 1PL2A 2GGTA 3TRQA 2XHFA 5JWRB 1AXDA 3ERWA 3TDGA 1X0RA 1ERWA 1MDIA 4O7HA 3HJMA 1DUGA 2DJ0A 3VK9A
chains in the Genus database with same CATH superfamily
1OAZA 2FWEA 2ALBA 4OCFA 3GL5A 1AQWA 4TR0A 4FQUA 1K0BA 3O6TA 3QOUA 4MF5A 1YQ1A 2YPMA 3BOAA 2DKHA 1EWXA 5D9XA 1R4WA 2LQOA 2J9HA 5IPHA 2LJAA 2JZRA 1ZYNA 3L4NA 4I97A 1K3OA 2YNXA 2H66A 1B48A 4K0NA 4HQZA 1XW6A 1NSWA 1T4YA 3QFAC 2I4AA 1RW1A 1I9DA 2OA7A 1SYRA 4OO5A 3BCKA 1C72A 1XVQA 3GN3A 1M0UA 3LW9A 3C71A 6GSVA 4MABA 3HD5A 1JZWA 1FOHA 5DBQA 2P0GA 4J57E 1Z3EA 3EMXA 3LG6A 5E4WA 1PKZA 5IM9A 1JZRA 3D5JA 3D4TA 3KH7A 3VURA 4EC0A 4I5QA 1ACVA 2K9FA 4MLYA 4KUNA 1UVZA 2VL9A 1BEDA 1WRYA 4MZBA 2DIYA 1T00A 1SKWB 4FO5A 1X9MB 1O7UA 2GVPA 2KHPA 3GX0A 4IW9A 4KB3A 2RM5A 3CTGA 1K3YA 2V1MA 3IPZA 1TP9A 4BPYA 3IBHA 1XWKA 5IIZA 4HS1A 1GSSA 3VWUA 5KN2A 2IL3A 1TI3A 3HVSA 1X5EA 2NBSA 4HU7A 2OACA 3CSHA 4MMMA 4DVCA 1NW2A 2PPTA 1F2EA 2XPEA 1KBNA 4EXJA 3WT1A 2LJRA 4JEDA 2REMA 2JL4A 1OC9B 4IP1A 2C0EA 4EDZA 1SD9A 2PBJA 1SK1A 4OFMA 3CRTA 3MAKA 5HR1A 1EOGA 5ECIB 1X5DA 1G7EA 2R6KA 2MBSA 2LNSA 2VM1A 1ZYQB 2H76A 1XG8A 3IE3A 3CTFA 3D21A 4KH7A 2CX4A 4AF2A 4NAXA 2LS5A 3EE2A 3DIEA 5GSTA 4GSTA 2R0GA 3A5IA 1GSQA 4IN0A 1SJIA 1JZOA 4NHZA 3ZZXA 5KOWA 3H8QA 4ECIA 1GNEA 5IOXA 3RDWA 1MEKA 4IJIA 4CDOA 5A4WA 2H19A 2G0FA 4BVYA 4HI7A 3MIXA 2DIZA 3S9FA 1GNWA 3FR9A 3UOMA 4YH2A 2CA8A 3WGXA 2O7KA 2CT6A 3A2WA 3ZRDA 2FHEA 5D93A 2M80A 5HFGA 2V6OA 5KN0A 2JSYA 3GL3A 4MZWA 1A0RP 1QQ2A 5J9CA 1O6JA 4NPBA 3CSIA 1GLQA 2V6KA 3DGQA 1ZZYA 4HQSA 2J23A 1T4ZA 4WR5A 1XVWA 3F8UA 5GZZB 4G9HA 2F51A 3M3MA 1TDIA 2OE3A 3KMOA 5JWOB 3UARA 1ERTA 3IK9A 4KAEA 4ULXA 3FMWA 3A3TA 4G10A 4O32A 4GCIA 3CXGA 3N9JA 4F2IA 3C1RA 3H79A 5COHA 2IMIA 1SKRB 4J56E 2H0HA 5LD0A 2EIQA 3HKRA 1M9AA 1ML6A 4ZL8A 2E0QA 5EY6A 4AJ7A 5IMVA 4Z7XA 2OKAA 4RUVA 2OE0A 4HDEA 1R7HA 3TKQA 4NV5A 1YKAA 2HZEA 1J9BA 2L59A 3LJRA 2H0GA 2GZZA 2H01A 4ECCA 2M46A 2B1KA 10GSA 5ECHB 2LRTA 5JCWA 2X8CA 4CY6A 3ZREA 2N5AA 4EF0A 2LUSA 4MP4A 3ED3A 4F0BA 1XW9A 5F07A 4POBA 4XRAA 2P5QA 5EVOA 5G31A 1OVNA 2LKUA 4G0LA 1A2JA 4QQ7A 2E2GA 5IQYA 4TVEA 4TR1A 2EIOA 2VOCA 3IR4A 3HY2A 1TJDA 4L8EA 4HJMA 1GLPA 5E59A 2DLXA 4BWQA 3F6FA 4EDYA 2CAIA 4EL1A 2FWFA 1K0OA 4L0UA 5CRGA 1XOAA 2DJJA 4MDCA 4HOJA 2H71A 1CQHA 2L57A 1BJXA 3TJFA 3HA9A 3TB2A 4USSA 6GSSA 1XCCA 2MZCA 3H93A 1Z5YE 1UA5A 1K0AA 3DXBA 3KP9A 1WOUA 5J4UA 2P5RA 1PL1A 1V58A 4HUAA 1V98A 2LEGA 1EEMA 1PGTA 3GH6A 3LGCA 3ME8A 1ZL9A 2VCQA 3J7Yb 4RQRA 3IXRA 1KNGA 2AB6A 4K5RA 1EP7A 2V2GA 3ZIVA 1HYUA 4Z2TA 1EV9A 4OO4A 2YWNA 5BRTA 1NM3A 1TOFA 2FUG2 4GQFA 2LQQA 4MJEA 1MTCA 5HFKA 3UVHA 3GIXA 3RHBA 4FYUA 2GSTA 2H75A 13GSA 1V9WA 1W89A 4TR4A 4ZBAA 4V1Ap 2E2MA 2P31A 3GYKA 2HNLA 2QGVA 1M2AA 1S3RA 3IA1A 1HNAA 3HJOA 1LJRA 2JU5A 3LFLA 6GSUA 4TXVA 3QD9A 2YWOA 2PVOC 5ECLB 1HQOA 3IDVA 3ZFLA 1V57A 3IAS2 4QL7A 3IC4A 5CNWA 1A0FA 2H1GA 5KEJA 2HZFA 2YOIA 1G7OA 1O73A 4Q5QA 1SYXA 4E8HA 2GLRA 3BBYA 3TRPA 2H0IA 2DC5A 4ECBA 1O8XA 1Y6EA 1XWCA 2F3MA 3GKNA 3Q74A 1XWGA 4X1UA 4FYBA 1U3AA 5J3RA 1QXHA 2CZ3A 4IVFA 2X8GA 4TXOB 1PN0A 2CZ2A 4ZL7A 3ZITA 5D9WA 5AIXA 3DD3A 1WMJA 4N30A 2PWJA 4O5UA 3Q19A 1AUCA 4HU9A 3TKSC 1OC3A 1TKDB 3UIWA 3D0ZA 4YQUA 5ECQB 1LBKA 4MH3A 3M9JA 3APOA 1U88A 3L9SA 4O5QA 3K8NA 6GSTA 1O81A 2HI7A 1B4QA 4BVXA 3LWAA 2H74A 4IQAA 2L6DA 3CRUA 4EIPA 1TI1A 2IMFA 2CVKA 3QPMA 3EMPA 1A2LA 4DEJA 2GQLA 4WEYA 2A2PA 3KTLA 5DALB 2GZYA 4LL1B 2O8VB 3HVVA 5HFIA 3FRCA 5CRDA 3GKKA 3US3A 1W4VA 16GSA 4XHMA 1HD2A 3ZVJA 2JZTA 3NIVA 3LYPA 1XIYA 4DSSB 3G7JA 3FY7A 4KCEA 4WKWA 1Q98A 5DAKB 1ST9A 3R2QA 2MMZA 4KA0A 4WBJA 5ECMB 4HZ2A 1SK0A 4TOPA 2VD1A 4IHUA 4EKZA 14GSA 4NHWA 3TJKA 5D9VA 3VFIA 2PVQA 1SKSB 2H8LA 4TKYA 4TW5A 4K7OA 2RUFA 3MDKA 3L9UA 2B1LA 4MJBA 2H1DA 2HRNA 3BCIA 4Q5RA 5DVBA 1A8YA 9GSSA 2QA1A 1SL2B 3PINA 4N0ZA 1MD4A 1B9YC 2A4HA 4IQ1A 4V2NA 6GSWA 1YY7A 4DSQA 2HRAA 1DSBA 3EPTA 1AC1A 4L5LA 1SU9A 4H86A 4LL4B 3MYDA 4GTUA 5IMZA 1YZXA 3QAGA 4MPGA 1YF1A 4POMA 3IC8A 3F4SA 1OC9A 1PA3A 3IHGA 4L0WA 1NHYA 1DBYA 4LMVA 4MJAA 4PGTA 3E0UA 1VGLA 4JZQA 17GSA 3F9UA 3MSZA 4HJ2A 4MJCA 3EINA 4MPFA 2JACA 1MD3A 2H6YA 3D22A 3UBKA 3GMFA 5B8BA 2FNOA 2DJ1A 1OYJA 1PX7A 1OE7A 2VAFA 2K18A 3FR6A 3G7IA 4ML1A 5CRWA 5GAPD 3GTUB 2VCWA 2GT6A 3ZFBA 5GSSA 2HE3A 5DCHA 3VWXA 2YANA 5F0GA 3MNGA 4IP6A 3IK7A 1GTUA 4TR3A 2LTKA 4NXIA 3FW2A 5JCGA 1B8XA 2L4CA 1FB6A 5JCUA 1QMVA 1EEJA 1TK5B 2AUVA 1M2BA 4Q5FA 1PQNA 2GSSA 4LMWA 3UEMA 5IO2A 2CVDA 4MH2A 1PN9A 2FCHA 1EZKA 1YEXA 2AYTA 1FOVA 4EE0A 19GSA 1M3IA 5IOWA 1LU4A 2LRNA 4N10A 4EO3A 1GSYA 2EIRA 4ACSA 3GFKA 1ERUA 2HLSA 4N0VA 1R5PA 2R5GA 2VL2A 1TRUA 3LXTA 1IYHA 4N11A 2QKEA 2KP2A 3D6IA 3CMIA 1GSEA 4MF7A 4BWSA 1EV4A 1CQGA 3LORA 8GSSA 3FK8A 2VCTA 3H1NA 5LNKe 1URMA 1EOHA 4P3YB 3TOTA 2RM6A 2PU9C 4A5PA 1AAZA 4PTSA 4I2UA 4KDXA 4G19A 1TU7A 4O5RA 2RUEA 3F63A 1R26A 3EU4A 2L5LA 5ECSA 3FZ4A 2I3YA 5B6MA 1ABAA 2L4QA 1GUKA 5AIVA 2DJ3A 4PURA 1HNCA 4ILFA 4ID0A 4WF4A 2R0CA 1V2AA 1S3CA 4FH8A 2B5YA 5ECRB 1K0NA 1PRXA 2EC4A 4BIKA 2F9SA 1PSQA 2R2JA 4F9ZA 3ZLPA 3WT2A 3UJ1A 4D73B 4F0CA 2R0PA 4X4JA 1M3JA 2YJHA 2OJLA 3HZ8A 2H1BA 2YCDA 1YJ6A 3FKFA 3EC3A 3KD0A 4GSSA 3M1GA 3WYWA 4BA7A 5KN1A 1JLVA 5BMUA 5L71A 2C0GA 1BQ7A 3BJ5A 1XPVA 3LSZA 4XS4A 2XBQA 5G1LA 2YJ7A 4KW6A 4KSMA 1JHBA 1T7PB 1SENA 1QUWA 4X0XA 2WULA 1SL1B 1XBSA 1WE0A 2TIRA 2PUKC 1XXUA 4PNFA 4IS0A 4BVYB 4I8BA 4XCSA 4PQHA 1RQMA 4HEA2 4TRXA 4KCAA 1GUHA 2ZCTA 4OFNA 4X43A 3DWVA 4V2LA 3O76A 3EYTA 3VWWA 1OC8A 2CVBA 5ELAA 3PPUA 3KMNA 2N5FA 4KDYA 1VF4A 4GSNA 3WGEA 3VI5A 1GULA 3RHCA 1BYEA 4XS6A 4KSOA 3TJBA 4IKHA 1FB0A 2H30A 3VWVA 4PQIA 3WGDA 3UL3A 3GSSA 3CBUA 1USBA 2WGRA 3ME7A 4DSRA 3M9KA 1Z6NA 1IYIA 2IN3A 5ID2B 3APQA 3D4MA 1VRSD 1GSUA 4MF6A 3VLNA 5KOXA 2GQKA 1F9MA 1VF3A 12GSA 1F3BA 3KH9A 1OKTA 2WJUA 2V41A 1F6MC 3O3TA 2K8SA 1XZOA 2GSQA 2PGTA 4NWYA 1J08A 4YQMA 4G0KA 2L6CA 2KLXA 1BG5A 5DDLA 3U6VA 2C0FA 1K0CA 1XWAA 1J0FA 1PD21 2FA8A 1KEBA 1NHOA 4K9ZA 2HRFA 2CQ9A 4POLA 2H70A 1T1VA 3FR3A 1ILOA 1TTZA 1FG4A 4TXOA 2VD0A 1QGVA 1AW9A 4GRFA 4PX1A 3FEUA 3W6GA 4OWYA 2BJXA 2GSRA 5IMCA 5CREA 3FHKA 1TK0B 5ENUA 3ZVJD 2V32A 4ZXGA 5HR2A 3TCOA 3CQFA 1I5GA 1JZDA 3M0FA 2WCIA 5J9BA 4K6XA 3HZ4A 3TRXA 2C80A 1AQVA 3PGTA 2VCZA 2WB9A 5G1KA 2QC7A 4GWRA 3C73A 1S3DA 3PH9A 1FW1A 3P8WA 2YWMA 2ON5A 1GL8A 5AN1A 2VCXA 2Z9SA 6GSYA 3L9VA 5B8AA 4BL7A 5LCZA 3G7YA 4PNGA 3JCML 3U5RE 1UC7A 2VM2A 4KE3A 3W8JA 4F82A 5D73A 2AHEA 2D2ZA 3L0HA 2XPDA 3C1SA 4DSSA 3VI7A 3GX8A 4POKA 1TRVA 5CYYA 5DAKA 1H75A 5IMFA 1YEPA 3TKSE 4ISDA 2MBTA 4FIWA 3DEXA 5ECPB 1FVKA 3R3EA 3HJPA 3VPQA 4WXTA 2IFQB 4I2TA 4FYCA 5CAXA 5ECOB 4KGIA 4JR6A 2JSZA 3TJJA 3MWHA 1T3BA 3EVIA 4XIHA 1GH2A 2HT9A 1F3AA 2FWGA 4KNDA 2AV4A 2IMKA 3IV4A 4J2FA 1Z6MA 2GT5A 5D8IA 3N5OA 3HXSA 4IJ3A 1Z7RA 1SJZA 4ZILA 3F4RA 3I69A 2A2SA 5F8BA 3GKXA 1X9WB 3ISOA 5C00A 1XW5A 1OKDA 5FT3A 3QR6A 1K3LA 2E7PA 5DJLA 1M2DA 3EU3A 2QA2A 2HYXA 4V1Ag 2BTOT 3A5WA 1ZCPA 3I43A 5G2ZA 2GTUA 1HNBA 2TRXA 5ELGA 5IMAA 3SWLA 3NOFA 2LRCA 1DE1A 5INYA 1G6YA 2HXKA 18GSA 1T8EB 2K6VA 2IPAA 1ERVA 1QK8A 2WFCA 4JU5A 3QMXA 1YF0A 2DJKA 2IJYA 4PXOA 3FZ9A 3NZNA 3KEBA 1K0MA 2YZHA 2I9HA 4BVXB 3GTUA 4CY8A 3FYGA 3GUSA 1K0DA 2C1YA 5EPFA 2X64A 3F6DA 20GSA 2DSAA 1FAAA 2G2QA 4MCUA 1JLWA 2DJ2A 2C3QA 2C4JA 4ZB9A 1VF1A 3GV1A 3KXOA 22GSA 3APSA 4G0IA 1G6WA 1ZGNA 4YKGA 5HR0A 4QL9A 3I6AA 3V1WA 2X4AA 3HVXA 1FO5A 1B4PA 2HSYA 1DE2A 1WPIA 1EP8A 3KP8A 2VL3A 3GA4A 5ECNB 1GSFA 3KM6A 4ZL9A 3A2XA 4ZIJA 5B7CA 3HCZA 1EGRA 2KP1A 2TRCP 5G30A 1TW9A 2B7JA 1EGOA 2VO4A 5GAND 1G0TA 2OBKA 4EUYA 4KF9A 4GQCA 3J7Yk 3M8NA 3KZQA 5AGYA 2YN1A 3E9JB 3C8EA 2DBCA 2YZUA 4ML6A 3GURA 2IIYA 4K1FA 2QSIA 1GTAA 1ZMAA 4WETA 3HYPA 2F8AA 3P90A 4LA1A 3QAWA 1THXA 2PN8A 3QFBC 5CP1A 2LJKA 1YDKA 3F3RA 4K2XA 5F05A 5JWQB 1Y25A 3AY8A 2X99A 3FZAA 5C04A 5DQSA 4F03A 3KTBA 3IAM2 4HZ4A 2I1UA 3ZTLA 2FA4A 3SBCA 1M9BA 2FGXA 2VLUA 3ERFA 4LLRA 1XOBA 2ZUPA 1WP0A 4ZB8A 1M99A 1XWBA 2B5XA 1GSDA 2A2RA 3QAVA 3DYRA 2XBIA 4D73A 4RQXA 3EWLA 1V40A 2GDRA 1N8JA 2UZ8A 2VLTA 1M7TA 2YV9A 1SL0B 2R3XA 1O8WA 1X5CA 3I9V2 2N5BA 2MMOA 4YKFA 1SD8A 4IBPA 1E6BA 1Z9HA 1TXXA 4AJ6A 3UAPA 2WRTA 2KUCA 1U6TA 2LNTA 4PUFC 2HFDA 3C7MA 4JR4A 4YQVA 1U3IA 3VPTA 1WIKA 4HSCX 3GRXA 4MNNA 3ERGA 2C8UA 3GNJA 1MDKA 4G2EA 5CO3A 2WDUA 4RI7A 4CHSA 3G9BA 2DKIA 1WWJA 2GQMA 2X49A 4GXZA 4PUAA 3QDNA 2FY6A 2OBIA 4MK3A 2M72A 4TN8A 2MMNA 3GH9A 5IPGA 2ON7A 1BAYA 3ZIJA 2H72A 1GP1A 5H5RA 2ZNMA 3OR5A 2HRKA 2HSMA 4GLTA 1N2AA 2KOKA 11GSA 3TKSA 1R5AA 2JADA 1AIUA 5IMDA 4K0GA 2ES7A 3TGZA 3F3QA 3UMAA 5ID2A 1A2MA 4PQ1A 5G5FA 2MYGA 3DKSA 2A4VA 3KGKA 7GSSA 4ICYA 1U87A 1ZYEA 2NPBA 3KIJA 5A5KA 3W8SA 2LV3A 1Q4JA 4OD7A 4XRDA 1FHEA 3RPPA 5A4VA 2NDOA 3HHVA 3LXZA 4EVMA 3F4TA 2O89A 2OE1A 4ZBDA 4MA9A 3TKPA 2VUPA 1GWCA 5FWGA 4MZCA 2C0DA 1F37A 3DVXA 3KCMA 1X9SB 1A24A 2MMAA 3LYKA 2H6ZA 4ZB6A 3KJYA 1TRSA 3FZ5A 4JRRA 2FWHA 4V2MA 3DRNA 3UBLA 1OE8A 5J5NA 2RIIA 2VCVA 2R37A 2B3SA 3H4KA 4Z2UA 4KX4A 4OMVA 3PR8A 3P2AA 4XTSA 1GTIA 3QCPA 3DMLA 5ECKB 3E3EA 2PMTA 4XS4B 4RI6A 4IGJA 2GZPA 2H73A 2B7KA 4Q5NA 2DMLA 3ZL5A 2HZEB 5F06A 1FVJA 1A23A 2LSTA 2K8VA 2CX3A 2FD3A 2CAQA 5CRHA 1ZOFA 3GKMA 4AJ8A 1ZYPA 5DJMA 5H5QA 3ZMLA 5HQPA 3GSTA 3F0IA 1YKCA 2VL2C 1SJ6A 1QFNA 4TR1B 1PFOA 1SK2A 2VLVA 2PERA 1Z7PA 4IELA 1THOA 4O92A 2IFQA 4NV2A 3DVWA 3ZMKA 3IOSA 4OCEA 5AISA 1GTBA 1WJKA 5G5EA 2WZ9A 1XFLA 1JFUA 1VF2A 3RBTA 5B6NA 2H6XA 5DALA 4K5SA 4XS1A 3EURA 2B5EA 4ZBBA 2NVLA 3BD2A 1GUMA 4YAVA 1KTEA 3WD6A 1H4OA 3RPNA 3P7XA 4I6XA 4L5OA 4CW9A 5DCGA 1GRXA 2RLIA 3TJGA 5D96A 2HSHA 1BX9A 2I81A 2AAWA 3Q6OA 4JE1A 2IWTA 2O87A 5ABRA 5HR3A 1TU8A 2JZSA 3A2VA 3TKRA 2WS2A 1AQXA 2YWIA 3LQ7A 5D9TA 2VIMA 2B6MA 2C3NA 3ZYWA 4NMUA 4GF0A 4WF5A 4JBBA 3TOUA 4WR4A 6GSXA 1ON4A 4OFTA 2DMMA 2NTOA 3GHAA 4AGSA 3Q18A 2H1AA 4K8MA 1PX6A 5KN3A 3CSJA 1PMTA 3RAZA 3TUEA 4K7IA 4K2DA 3HDCA 3IHQA 1UN2A 1A8LA 4BL7B 2OADA 3UVTA 4KDUA 5DQYA 1S3AA 5H5SA 4WBRD 1B9XC 2R4VA 1MDJA 2GS3A 4K7NA 2IMEA 1PKWA 2IMDA 4E8EA 1E2YA 2YP6A 2FLSA 1TK8B 3CYNA 3L78A 4YAPA 2CV4A 4Z2RA 2C3TA 3IRAA 5A4UA 5FHIA 5IO0A 2X8HA 1TRWA 2F8FA 3LEFA 5EL8A 5J41A 1RK4A 2XC2A 2AJQB 1O85A 4ECJA 2BMXA 2YV7A 3HVNA 2L5OA 4EIQA 2O85A 1PL2A 2GGTA 3TRQA 2XHFA 5JWRB 1AXDA 3ERWA 3TDGA 1X0RA 1ERWA 1MDIA 4O7HA 3HJMA 1DUGA 2DJ0A 3VK9A
chains in the Genus database with same CATH topology
1OAZA 2FWEA 2ALBA 4OCFA 3GL5A 1AQWA 4TR0A 4FQUA 1K0BA 3O6TA 3QOUA 4MF5A 1YQ1A 2YPMA 3BOAA 2DKHA 1EWXA 5D9XA 1R4WA 2LQOA 2J9HA 5IPHA 2LJAA 2JZRA 1ZYNA 3L4NA 4I97A 1K3OA 2YNXA 2H66A 1B48A 4K0NA 4HQZA 1XW6A 1NSWA 1T4YA 3QFAC 2I4AA 1RW1A 1I9DA 2OA7A 1SYRA 4OO5A 3BCKA 1C72A 1XVQA 3GN3A 1M0UA 3LW9A 3C71A 6GSVA 4MABA 3HD5A 1JZWA 1FOHA 5DBQA 2P0GA 4J57E 1Z3EA 3EMXA 3LG6A 5E4WA 1PKZA 5IM9A 1JZRA 3D5JA 3D4TA 3KH7A 3VURA 4EC0A 4I5QA 1ACVA 2K9FA 4MLYA 4KUNA 1UVZA 2VL9A 1BEDA 1WRYA 4MZBA 2DIYA 1T00A 1SKWB 4FO5A 1X9MB 1O7UA 2GVPA 2KHPA 3GX0A 4IW9A 4KB3A 2RM5A 3CTGA 1K3YA 2V1MA 3IPZA 1TP9A 4BPYA 3IBHA 1XWKA 5IIZA 4HS1A 1GSSA 3VWUA 5KN2A 2IL3A 1TI3A 3HVSA 1X5EA 2NBSA 4HU7A 2OACA 3CSHA 4MMMA 4DVCA 1NW2A 2PPTA 1F2EA 2XPEA 1KBNA 4EXJA 3WT1A 2LJRA 4JEDA 2REMA 2JL4A 1OC9B 4IP1A 2C0EA 4EDZA 1SD9A 2PBJA 1SK1A 4OFMA 3CRTA 3MAKA 5HR1A 1EOGA 5ECIB 1X5DA 1G7EA 2R6KA 2MBSA 2LNSA 2VM1A 1ZYQB 2H76A 3IE3A 3CTFA 3D21A 4KH7A 2CX4A 4AF2A 4NAXA 2LS5A 3EE2A 3DIEA 5GSTA 4GSTA 2R0GA 3A5IA 1GSQA 4IN0A 1SJIA 1JZOA 4NHZA 3ZZXA 5KOWA 3H8QA 4ECIA 1GNEA 5IOXA 3RDWA 1MEKA 4IJIA 4CDOA 5A4WA 2H19A 2G0FA 4BVYA 4HI7A 3MIXA 2DIZA 3S9FA 1GNWA 3FR9A 3UOMA 4YH2A 2CA8A 3WGXA 2O7KA 2CT6A 3A2WA 3ZRDA 2FHEA 5D93A 2M80A 5HFGA 2V6OA 5KN0A 2JSYA 3GL3A 4MZWA 1A0RP 1QQ2A 5J9CA 1O6JA 4NPBA 3CSIA 1GLQA 2V6KA 3DGQA 1ZZYA 4HQSA 2J23A 1T4ZA 4WR5A 1XVWA 3F8UA 5GZZB 4G9HA 2F51A 3M3MA 1TDIA 2OE3A 3KMOA 5JWOB 3UARA 1ERTA 3IK9A 4KAEA 4ULXA 3FMWA 3A3TA 4G10A 4O32A 4GCIA 3CXGA 3N9JA 4F2IA 3C1RA 3H79A 5COHA 2IMIA 1SKRB 4J56E 2H0HA 5LD0A 2EIQA 3HKRA 1M9AA 1ML6A 4ZL8A 2E0QA 5EY6A 4AJ7A 5IMVA 4Z7XA 2OKAA 4RUVA 2OE0A 4HDEA 1R7HA 3TKQA 4NV5A 1YKAA 2HZEA 1J9BA 2L59A 3LJRA 2H0GA 2GZZA 2H01A 4ECCA 2M46A 2B1KA 10GSA 5ECHB 2LRTA 5JCWA 2X8CA 4CY6A 3ZREA 2N5AA 4EF0A 2LUSA 4MP4A 3ED3A 4F0BA 1XW9A 5F07A 4POBA 4XRAA 2P5QA 5EVOA 5G31A 1OVNA 2LKUA 4G0LA 1A2JA 4QQ7A 2E2GA 5IQYA 4TVEA 4TR1A 2EIOA 2VOCA 3IR4A 3HY2A 1TJDA 4L8EA 4HJMA 1GLPA 5E59A 2DLXA 4BWQA 3F6FA 4EDYA 2CAIA 4EL1A 2FWFA 1K0OA 4L0UA 5CRGA 1XOAA 2DJJA 4MDCA 4HOJA 2H71A 1CQHA 2L57A 1BJXA 3TJFA 3HA9A 3TB2A 4USSA 6GSSA 1XCCA 2MZCA 3H93A 1Z5YE 1UA5A 1K0AA 3DXBA 3KP9A 1WOUA 5J4UA 2P5RA 1PL1A 1V58A 4HUAA 1V98A 2LEGA 1EEMA 1PGTA 3GH6A 3LGCA 3ME8A 1ZL9A 2VCQA 3J7Yb 4RQRA 3IXRA 1KNGA 2AB6A 4K5RA 1EP7A 2V2GA 3ZIVA 1HYUA 4Z2TA 1EV9A 4OO4A 2YWNA 5BRTA 1NM3A 1TOFA 2FUG2 4GQFA 2LQQA 4MJEA 1MTCA 5HFKA 3UVHA 3GIXA 3RHBA 4FYUA 2GSTA 2H75A 13GSA 1V9WA 1W89A 4TR4A 4ZBAA 4V1Ap 2E2MA 2P31A 3GYKA 2HNLA 2QGVA 1M2AA 3IA1A 1HNAA 3HJOA 1LJRA 2JU5A 3LFLA 6GSUA 4TXVA 3QD9A 2YWOA 2PVOC 5ECLB 1HQOA 3IDVA 3ZFLA 1V57A 3IAS2 4QL7A 3IC4A 5CNWA 1A0FA 2H1GA 5KEJA 2HZFA 2YOIA 1G7OA 1O73A 4Q5QA 1SYXA 4E8HA 2GLRA 3BBYA 3TRPA 2H0IA 2DC5A 4ECBA 1O8XA 1Y6EA 1XWCA 2F3MA 3GKNA 3Q74A 1XWGA 4X1UA 4FYBA 1U3AA 5J3RA 1QXHA 2CZ3A 4IVFA 2X8GA 4TXOB 1PN0A 2CZ2A 4ZL7A 3ZITA 5D9WA 5AIXA 3DD3A 1WMJA 4N30A 2PWJA 4O5UA 3Q19A 1AUCA 4HU9A 3TKSC 1OC3A 1TKDB 3UIWA 3D0ZA 4YQUA 5ECQB 1LBKA 4MH3A 3M9JA 3APOA 1U88A 3L9SA 4O5QA 3K8NA 6GSTA 1O81A 2HI7A 1B4QA 4BVXA 3LWAA 2H74A 4IQAA 2L6DA 3CRUA 4EIPA 1TI1A 2IMFA 2CVKA 3QPMA 3EMPA 1A2LA 4DEJA 2GQLA 4WEYA 2A2PA 3KTLA 5DALB 2GZYA 4LL1B 2O8VB 3HVVA 5HFIA 3FRCA 5CRDA 3GKKA 3US3A 1W4VA 16GSA 4XHMA 1HD2A 3ZVJA 2JZTA 3NIVA 3LYPA 1XIYA 4DSSB 3G7JA 3FY7A 4KCEA 4WKWA 1Q98A 5DAKB 1ST9A 3R2QA 2MMZA 4KA0A 4WBJA 5ECMB 4HZ2A 1SK0A 4TOPA 2VD1A 4IHUA 4EKZA 14GSA 4NHWA 3TJKA 5D9VA 3VFIA 2PVQA 1SKSB 2H8LA 4TKYA 4TW5A 4K7OA 2RUFA 3MDKA 3L9UA 2B1LA 4MJBA 2H1DA 2HRNA 3BCIA 4Q5RA 5DVBA 1A8YA 9GSSA 2QA1A 1SL2B 3PINA 4N0ZA 1MD4A 1B9YC 2A4HA 4IQ1A 4V2NA 6GSWA 1YY7A 4DSQA 2HRAA 1DSBA 3EPTA 1AC1A 4L5LA 1SU9A 4H86A 4LL4B 3MYDA 4GTUA 5IMZA 1YZXA 3QAGA 4MPGA 1YF1A 4POMA 3IC8A 3F4SA 1OC9A 1PA3A 3IHGA 4L0WA 1NHYA 1DBYA 4LMVA 4MJAA 4PGTA 3E0UA 1VGLA 4JZQA 17GSA 3F9UA 3MSZA 4HJ2A 4MJCA 3EINA 4MPFA 2JACA 1MD3A 2H6YA 3D22A 3UBKA 3GMFA 5B8BA 2FNOA 2DJ1A 1OYJA 1PX7A 1OE7A 2VAFA 2K18A 3FR6A 3G7IA 4ML1A 5CRWA 5GAPD 3GTUB 2VCWA 2GT6A 3ZFBA 5GSSA 2HE3A 5DCHA 3VWXA 2YANA 5F0GA 3MNGA 4IP6A 3IK7A 1GTUA 4TR3A 2LTKA 4NXIA 3FW2A 5JCGA 1B8XA 2L4CA 1FB6A 5JCUA 1QMVA 1EEJA 1TK5B 2AUVA 1M2BA 4Q5FA 1PQNA 2GSSA 4LMWA 3UEMA 5IO2A 2CVDA 4MH2A 1PN9A 2FCHA 1EZKA 1YEXA 2AYTA 1FOVA 4EE0A 19GSA 5IOWA 1LU4A 2LRNA 4N10A 4EO3A 1GSYA 2EIRA 4ACSA 3GFKA 1ERUA 2HLSA 4N0VA 1R5PA 2R5GA 2VL2A 1TRUA 3LXTA 1IYHA 4N11A 2QKEA 2KP2A 3D6IA 3CMIA 1GSEA 4MF7A 4BWSA 1EV4A 1CQGA 3LORA 8GSSA 3FK8A 2VCTA 3H1NA 5LNKe 1URMA 1EOHA 4P3YB 3TOTA 2RM6A 2PU9C 4A5PA 1AAZA 4PTSA 4I2UA 4KDXA 4G19A 1TU7A 4O5RA 2RUEA 3F63A 1R26A 3EU4A 2L5LA 5ECSA 3FZ4A 2I3YA 5B6MA 1ABAA 2L4QA 1GUKA 5AIVA 2DJ3A 4PURA 1HNCA 4ILFA 4ID0A 4WF4A 2R0CA 1V2AA 1S3CA 4FH8A 2B5YA 5ECRB 1K0NA 1PRXA 2EC4A 2F9SA 1PSQA 2R2JA 4F9ZA 3ZLPA 3WT2A 3UJ1A 4D73B 4F0CA 2R0PA 4X4JA 2YJHA 2OJLA 3HZ8A 2H1BA 2YCDA 1YJ6A 3FKFA 3EC3A 3KD0A 4GSSA 3M1GA 3WYWA 4BA7A 5KN1A 1JLVA 5BMUA 5L71A 2C0GA 1BQ7A 3BJ5A 1XPVA 3LSZA 4XS4A 2XBQA 5G1LA 2YJ7A 4KW6A 4KSMA 1JHBA 1T7PB 1SENA 1QUWA 4X0XA 2WULA 1SL1B 1XBSA 1WE0A 2TIRA 2PUKC 1XXUA 4PNFA 4IS0A 4BVYB 4I8BA 4XCSA 4PQHA 1RQMA 4HEA2 4TRXA 4KCAA 1GUHA 2ZCTA 4OFNA 4X43A 3DWVA 4V2LA 3O76A 3EYTA 3VWWA 1OC8A 2CVBA 5ELAA 3PPUA 3KMNA 2N5FA 4KDYA 1VF4A 4GSNA 3WGEA 3VI5A 1GULA 3RHCA 1BYEA 4XS6A 4KSOA 3TJBA 4IKHA 1FB0A 2H30A 3VWVA 4PQIA 3WGDA 3UL3A 3GSSA 3CBUA 1USBA 2WGRA 3ME7A 4DSRA 3M9KA 1Z6NA 1IYIA 2IN3A 5ID2B 3APQA 3D4MA 1VRSD 1GSUA 4MF6A 3VLNA 5KOXA 2GQKA 1F9MA 1VF3A 12GSA 1F3BA 3KH9A 1OKTA 2WJUA 2V41A 1F6MC 3O3TA 2K8SA 1XZOA 2GSQA 2PGTA 4NWYA 1J08A 4YQMA 4G0KA 2L6CA 2KLXA 1BG5A 5DDLA 3U6VA 2C0FA 1K0CA 1XWAA 1J0FA 1PD21 2FA8A 1KEBA 1NHOA 4K9ZA 2HRFA 2CQ9A 4POLA 2H70A 1T1VA 3FR3A 1ILOA 1TTZA 1FG4A 4TXOA 2VD0A 1QGVA 1AW9A 4GRFA 4PX1A 3FEUA 3W6GA 4OWYA 2BJXA 2GSRA 5IMCA 5CREA 3FHKA 1TK0B 5ENUA 3ZVJD 2V32A 4ZXGA 5HR2A 3TCOA 1I5GA 1JZDA 3M0FA 2WCIA 5J9BA 4K6XA 3HZ4A 3TRXA 2C80A 1AQVA 3PGTA 2VCZA 2WB9A 5G1KA 2QC7A 4GWRA 3C73A 1S3DA 3PH9A 1FW1A 3P8WA 2YWMA 2ON5A 1GL8A 5AN1A 2VCXA 2Z9SA 6GSYA 3L9VA 5B8AA 4BL7A 5LCZA 3G7YA 4PNGA 3JCML 3U5RE 1UC7A 2VM2A 4KE3A 3W8JA 4F82A 5D73A 2AHEA 2D2ZA 3L0HA 2XPDA 3C1SA 4DSSA 3VI7A 3GX8A 4POKA 1TRVA 5CYYA 5DAKA 1H75A 5IMFA 1YEPA 3TKSE 4ISDA 2MBTA 4FIWA 3DEXA 5ECPB 1FVKA 3R3EA 3HJPA 3VPQA 4WXTA 2IFQB 4I2TA 4FYCA 5CAXA 5ECOB 4KGIA 4JR6A 2JSZA 3TJJA 3MWHA 1T3BA 3EVIA 4XIHA 1GH2A 2HT9A 1F3AA 2FWGA 4KNDA 2AV4A 2IMKA 3IV4A 4J2FA 1Z6MA 2GT5A 5D8IA 3N5OA 3HXSA 4IJ3A 1Z7RA 1SJZA 4ZILA 3F4RA 3I69A 2A2SA 5F8BA 3GKXA 1X9WB 3ISOA 5C00A 1XW5A 1OKDA 5FT3A 3QR6A 1K3LA 2E7PA 5DJLA 1M2DA 3EU3A 2QA2A 2HYXA 4V1Ag 2BTOT 3A5WA 1ZCPA 3I43A 5G2ZA 2GTUA 1HNBA 2TRXA 5ELGA 5IMAA 3SWLA 3NOFA 2LRCA 1DE1A 5INYA 1G6YA 2HXKA 18GSA 1T8EB 2K6VA 2IPAA 1ERVA 1QK8A 2WFCA 4JU5A 3QMXA 1YF0A 2DJKA 2IJYA 4PXOA 3FZ9A 3NZNA 3KEBA 1K0MA 2YZHA 2I9HA 4BVXB 3GTUA 4CY8A 3FYGA 3GUSA 1K0DA 2C1YA 5EPFA 2X64A 3F6DA 20GSA 2DSAA 1FAAA 2G2QA 4MCUA 1JLWA 2DJ2A 2C3QA 2C4JA 4ZB9A 1VF1A 3GV1A 3KXOA 22GSA 3APSA 4G0IA 1G6WA 1ZGNA 4YKGA 5HR0A 4QL9A 3I6AA 3V1WA 2X4AA 3HVXA 1FO5A 1B4PA 2HSYA 1DE2A 1WPIA 1EP8A 3KP8A 2VL3A 3GA4A 5ECNB 1GSFA 3KM6A 4ZL9A 3A2XA 4ZIJA 5B7CA 3HCZA 1EGRA 2KP1A 2TRCP 5G30A 1TW9A 2B7JA 1EGOA 2VO4A 5GAND 1G0TA 2OBKA 4EUYA 4KF9A 4GQCA 3J7Yk 3M8NA 3KZQA 5AGYA 2YN1A 3E9JB 3C8EA 2DBCA 2YZUA 4ML6A 3GURA 2IIYA 4K1FA 2QSIA 1GTAA 1ZMAA 4WETA 3HYPA 2F8AA 3P90A 4LA1A 3QAWA 1THXA 2PN8A 3QFBC 5CP1A 2LJKA 1YDKA 3F3RA 4K2XA 5F05A 5JWQB 1Y25A 3AY8A 2X99A 3FZAA 5C04A 5DQSA 4F03A 3KTBA 3IAM2 4HZ4A 2I1UA 3ZTLA 2FA4A 3SBCA 1M9BA 2FGXA 2VLUA 3ERFA 4LLRA 1XOBA 2ZUPA 1WP0A 4ZB8A 1M99A 1XWBA 2B5XA 1GSDA 2A2RA 3QAVA 3DYRA 2XBIA 4D73A 4RQXA 3EWLA 1V40A 2GDRA 1N8JA 2UZ8A 2VLTA 1M7TA 2YV9A 1SL0B 2R3XA 1O8WA 1X5CA 3I9V2 2N5BA 2MMOA 4YKFA 1SD8A 4IBPA 1E6BA 1Z9HA 1TXXA 4AJ6A 3UAPA 2WRTA 2KUCA 1U6TA 2LNTA 4PUFC 2HFDA 3C7MA 4JR4A 4YQVA 1U3IA 3VPTA 1WIKA 3GRXA 4MNNA 3ERGA 2C8UA 3GNJA 1MDKA 4G2EA 5CO3A 2WDUA 4RI7A 4CHSA 3G9BA 2DKIA 1WWJA 2GQMA 2X49A 4GXZA 4PUAA 3QDNA 2FY6A 2OBIA 4MK3A 2M72A 4TN8A 2MMNA 3GH9A 5IPGA 2ON7A 1BAYA 3ZIJA 2H72A 1GP1A 5H5RA 2ZNMA 3OR5A 2HRKA 2HSMA 4GLTA 1N2AA 2KOKA 11GSA 3TKSA 1R5AA 2JADA 1AIUA 5IMDA 4K0GA 2ES7A 3TGZA 3F3QA 3UMAA 5ID2A 1A2MA 4PQ1A 5G5FA 2MYGA 3DKSA 2A4VA 3KGKA 7GSSA 4ICYA 1U87A 1ZYEA 2NPBA 3KIJA 5A5KA 3W8SA 2LV3A 1Q4JA 4OD7A 4XRDA 1FHEA 3RPPA 5A4VA 2NDOA 3HHVA 3LXZA 4EVMA 3F4TA 2O89A 2OE1A 4ZBDA 4MA9A 3TKPA 2VUPA 1GWCA 5FWGA 4MZCA 2C0DA 1F37A 3DVXA 3KCMA 1X9SB 1A24A 2MMAA 3LYKA 2H6ZA 4ZB6A 3KJYA 1TRSA 3FZ5A 4JRRA 2FWHA 4V2MA 3DRNA 3UBLA 1OE8A 5J5NA 2RIIA 2VCVA 2R37A 2B3SA 3H4KA 4Z2UA 4KX4A 4OMVA 3PR8A 3P2AA 4XTSA 1GTIA 3QCPA 3DMLA 5ECKB 3E3EA 2PMTA 4XS4B 4RI6A 4IGJA 2GZPA 2H73A 2B7KA 4Q5NA 2DMLA 3ZL5A 2HZEB 5F06A 1FVJA 1A23A 2LSTA 2K8VA 2CX3A 2FD3A 2CAQA 5CRHA 1ZOFA 3GKMA 4AJ8A 1ZYPA 5DJMA 5H5QA 3ZMLA 5HQPA 3GSTA 3F0IA 1YKCA 2VL2C 1SJ6A 1QFNA 4TR1B 1SK2A 2VLVA 2PERA 1Z7PA 4IELA 1THOA 4O92A 2IFQA 4NV2A 3DVWA 3ZMKA 3IOSA 4OCEA 5AISA 1GTBA 1WJKA 5G5EA 2WZ9A 1XFLA 1JFUA 1VF2A 3RBTA 5B6NA 2H6XA 5DALA 4K5SA 4XS1A 3EURA 2B5EA 4ZBBA 2NVLA 3BD2A 1GUMA 4YAVA 1KTEA 3WD6A 1H4OA 3RPNA 3P7XA 4I6XA 4L5OA 4CW9A 5DCGA 1GRXA 2RLIA 3TJGA 5D96A 2HSHA 1BX9A 2I81A 2AAWA 3Q6OA 4JE1A 2IWTA 2O87A 5ABRA 5HR3A 1TU8A 2JZSA 3A2VA 3TKRA 2WS2A 1AQXA 2YWIA 3LQ7A 5D9TA 2VIMA 2B6MA 2C3NA 3ZYWA 4NMUA 4GF0A 4WF5A 4JBBA 3TOUA 4WR4A 6GSXA 1ON4A 4OFTA 2DMMA 2NTOA 3GHAA 4AGSA 3Q18A 2H1AA 4K8MA 1PX6A 5KN3A 3CSJA 1PMTA 3RAZA 3TUEA 4K7IA 4K2DA 3HDCA 3IHQA 1UN2A 1A8LA 4BL7B 2OADA 3UVTA 4KDUA 5DQYA 1S3AA 5H5SA 4WBRD 1B9XC 2R4VA 1MDJA 2GS3A 4K7NA 2IMEA 1PKWA 2IMDA 4E8EA 1E2YA 2YP6A 2FLSA 1TK8B 3CYNA 3L78A 4YAPA 2CV4A 4Z2RA 2C3TA 3IRAA 5A4UA 5FHIA 5IO0A 2X8HA 1TRWA 2F8FA 3LEFA 5EL8A 5J41A 1RK4A 2XC2A 2AJQB 1O85A 4ECJA 2BMXA 2YV7A 2L5OA 4EIQA 2O85A 1PL2A 2GGTA 3TRQA 2XHFA 5JWRB 1AXDA 3ERWA 3TDGA 1X0RA 1ERWA 1MDIA 4O7HA 3HJMA 1DUGA 2DJ0A 3VK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OAZ A;  2FWE A;  2ALB A;  4OCF A;  3GL5 A;  1AQW A;  4TR0 A;  1K0B A;  3O6T A;  3QOU A;  4MF5 A;  1YQ1 A;  2YPM A;  3BOA A;  1EWX A;  5D9X A;  1R4W A;  2LQO A;  2J9H A;  5IPH A;  2LJA A;  2JZR A;  3L4N A;  4I97 A;  1K3O A;  2YNX A;  2H66 A;  1B48 A;  4K0N A;  4HQZ A;  1XW6 A;  1NSW A;  1T4Y A;  3QFA C;  2I4A A;  1RW1 A;  1I9D A;  2OA7 A;  1SYR A;  4OO5 A;  3BCK A;  1C72 A;  1XVQ A;  3GN3 A;  1M0U A;  3C71 A;  6GSV A;  4MAB A;  3HD5 A;  1JZW A;  5DBQ A;  2P0G A;  4J57 E;  1Z3E A;  3EMX A;  3LG6 A;  5E4W A;  1PKZ A;  5IM9 A;  1JZR A;  3D5J A;  3D4T A;  3KH7 A;  3VUR A;  4EC0 A;  4I5Q A;  1ACV A;  2K9F A;  4MLY A;  4KUN A;  1UVZ A;  2VL9 A;  1BED A;  1WRY A;  4MZB A;  2DIY A;  1T00 A;  1SKW B;  4FO5 A;  1X9M B;  1O7U A;  2GVP A;  2KHP A;  3GX0 A;  4IW9 A;  4KB3 A;  2RM5 A;  3CTG A;  1K3Y A;  2V1M A;  3IPZ A;  1TP9 A;  4BPY A;  3IBH A;  1XWK A;  5IIZ A;  4HS1 A;  1GSS A;  3VWU A;  5KN2 A;  2IL3 A;  1TI3 A;  3HVS A;  1X5E A;  2NBS A;  4HU7 A;  2OAC A;  3CSH A;  4MMM A;  4DVC A;  1NW2 A;  2PPT A;  1F2E A;  2XPE A;  1KBN A;  4EXJ A;  3WT1 A;  2LJR A;  4JED A;  2REM A;  2JL4 A;  1OC9 B;  4IP1 A;  2C0E A;  4EDZ A;  1SD9 A;  2PBJ A;  1SK1 A;  4OFM A;  3CRT A;  3MAK A;  5HR1 A;  1EOG A;  5ECI B;  1X5D A;  1G7E A;  2R6K A;  2MBS A;  2LNS A;  2VM1 A;  1ZYQ B;  2H76 A;  3IE3 A;  3CTF A;  3D21 A;  4KH7 A;  2CX4 A;  4AF2 A;  4NAX A;  2LS5 A;  3EE2 A;  3DIE A;  5GST A;  4GST A;  1GSQ A;  4IN0 A;  1SJI A;  1JZO A;  4NHZ A;  3ZZX A;  3H8Q A;  4ECI A;  1GNE A;  5IOX A;  3RDW A;  1MEK A;  4IJI A;  4CDO A;  5A4W A;  2H19 A;  2G0F A;  4BVY A;  4HI7 A;  2DIZ A;  3S9F A;  1GNW A;  3FR9 A;  3UOM A;  4YH2 A;  2CA8 A;  3WGX A;  2O7K A;  2CT6 A;  3A2W A;  3ZRD A;  2FHE A;  5D93 A;  2M80 A;  5HFG A;  2V6O A;  5KN0 A;  2JSY A;  3GL3 A;  4MZW A;  1A0R P;  1QQ2 A;  5J9C A;  1O6J A;  4NPB A;  3CSI A;  1GLQ A;  2V6K A;  3DGQ A;  1ZZY A;  4HQS A;  2J23 A;  1T4Z A;  4WR5 A;  1XVW A;  3F8U A;  5GZZ B;  4G9H A;  2F51 A;  3M3M A;  1TDI A;  2OE3 A;  3KMO A;  5JWO B;  3UAR A;  1ERT A;  3IK9 A;  4KAE A;  4ULX A;  3A3T A;  4G10 A;  4O32 A;  4GCI A;  3CXG A;  3N9J A;  4F2I A;  3C1R A;  3H79 A;  5COH A;  2IMI A;  1SKR B;  4J56 E;  2H0H A;  5LD0 A;  2EIQ A;  3HKR A;  1M9A A;  1ML6 A;  4ZL8 A;  2E0Q A;  5EY6 A;  4AJ7 A;  5IMV A;  4Z7X A;  2OKA A;  4RUV A;  2OE0 A;  4HDE A;  1R7H A;  3TKQ A;  4NV5 A;  1YKA A;  2HZE A;  1J9B A;  2L59 A;  3LJR A;  2H0G A;  2GZZ A;  2H01 A;  4ECC A;  2M46 A;  2B1K A;  10GS A;  5ECH B;  2LRT A;  5JCW A;  2X8C A;  3ZRE A;  2N5A A;  4EF0 A;  2LUS A;  4MP4 A;  3ED3 A;  4F0B A;  1XW9 A;  5F07 A;  4POB A;  4XRA A;  2P5Q A;  5EVO A;  5G31 A;  1OVN A;  2LKU A;  1A2J A;  4QQ7 A;  2E2G A;  5IQY A;  4TVE A;  4TR1 A;  2EIO A;  2VOC A;  3IR4 A;  3HY2 A;  1TJD A;  4L8E A;  4HJM A;  1GLP A;  5E59 A;  2DLX A;  4BWQ A;  3F6F A;  4EDY A;  2CAI A;  4EL1 A;  2FWF A;  1K0O A;  4L0U A;  5CRG A;  1XOA A;  2DJJ A;  4MDC A;  4HOJ A;  2H71 A;  1CQH A;  2L57 A;  1BJX A;  3TJF A;  3HA9 A;  3TB2 A;  6GSS A;  1XCC A;  2MZC A;  3H93 A;  1Z5Y E;  1UA5 A;  1K0A A;  3DXB A;  3KP9 A;  1WOU A;  5J4U A;  2P5R A;  1PL1 A;  1V58 A;  4HUA A;  1V98 A;  2LEG A;  1EEM A;  1PGT A;  3GH6 A;  3LGC A;  3ME8 A;  1ZL9 A;  2VCQ A;  3J7Y b;  4RQR A;  3IXR A;  1KNG A;  2AB6 A;  1EP7 A;  2V2G A;  3ZIV A;  1HYU A;  1EV9 A;  4OO4 A;  2YWN A;  1NM3 A;  1TOF A;  2FUG 2;  4GQF A;  2LQQ A;  4MJE A;  1MTC A;  5HFK A;  3UVH A;  3GIX A;  3RHB A;  4FYU A;  2GST A;  2H75 A;  13GS A;  1V9W A;  1W89 A;  4TR4 A;  4ZBA A;  4V1A p;  2E2M A;  2P31 A;  3GYK A;  2HNL A;  2QGV A;  1M2A A;  3IA1 A;  1HNA A;  3HJO A;  1LJR A;  2JU5 A;  3LFL A;  6GSU A;  4TXV A;  3QD9 A;  2YWO A;  2PVO C;  5ECL B;  1HQO A;  3IDV A;  3ZFL A;  1V57 A;  3IAS 2;  4QL7 A;  3IC4 A;  5CNW A;  1A0F A;  2H1G A;  5KEJ A;  2HZF A;  2YOI A;  1G7O A;  1O73 A;  4Q5Q A;  1SYX A;  4E8H A;  2GLR A;  3BBY A;  3TRP A;  2H0I A;  2DC5 A;  4ECB A;  1O8X A;  1Y6E A;  1XWC A;  2F3M A;  3GKN A;  3Q74 A;  1XWG A;  4X1U A;  4FYB A;  1U3A A;  5J3R A;  1QXH A;  2CZ3 A;  4IVF A;  2X8G A;  4TXO B;  2CZ2 A;  4ZL7 A;  3ZIT A;  5D9W A;  5AIX A;  3DD3 A;  1WMJ A;  4N30 A;  2PWJ A;  3Q19 A;  1AUC A;  4HU9 A;  3TKS C;  1OC3 A;  1TKD B;  3UIW A;  3D0Z A;  4YQU A;  5ECQ B;  1LBK A;  4MH3 A;  3M9J A;  3APO A;  1U88 A;  3L9S A;  3K8N A;  6GST A;  1O81 A;  2HI7 A;  1B4Q A;  4BVX A;  3LWA A;  2H74 A;  4IQA A;  2L6D A;  3CRU A;  1TI1 A;  2IMF A;  2CVK A;  3QPM A;  3EMP A;  1A2L A;  4DEJ A;  2GQL A;  4WEY A;  3KTL A;  5DAL B;  2GZY A;  4LL1 B;  2O8V B;  3HVV A;  5HFI A;  3FRC A;  5CRD A;  3GKK A;  3US3 A;  1W4V A;  16GS A;  4XHM A;  1HD2 A;  3ZVJ A;  2JZT A;  3NIV A;  3LYP A;  1XIY A;  4DSS B;  3G7J A;  3FY7 A;  4KCE A;  4WKW A;  1Q98 A;  5DAK B;  1ST9 A;  3R2Q A;  2MMZ A;  4KA0 A;  4WBJ A;  5ECM B;  4HZ2 A;  1SK0 A;  4TOP A;  2VD1 A;  4IHU A;  4EKZ A;  14GS A;  4NHW A;  3TJK A;  5D9V A;  3VFI A;  2PVQ A;  1SKS B;  2H8L A;  4TKY A;  4TW5 A;  4K7O A;  2RUF A;  3MDK A;  3L9U A;  2B1L A;  4MJB A;  2H1D A;  2HRN A;  3BCI A;  4Q5R A;  5DVB A;  1A8Y A;  9GSS A;  1SL2 B;  3PIN A;  4N0Z A;  1MD4 A;  1B9Y C;  4IQ1 A;  4V2N A;  6GSW A;  1YY7 A;  4DSQ A;  1DSB A;  1AC1 A;  4L5L A;  1SU9 A;  4H86 A;  4LL4 B;  4GTU A;  5IMZ A;  1YZX A;  3QAG A;  4MPG A;  1YF1 A;  4POM A;  3F4S A;  1OC9 A;  1PA3 A;  4L0W A;  1NHY A;  1DBY A;  4LMV A;  4MJA A;  4PGT A;  3E0U A;  1VGL A;  4JZQ A;  17GS A;  3F9U A;  3MSZ A;  4HJ2 A;  4MJC A;  3EIN A;  4MPF A;  2JAC A;  1MD3 A;  2H6Y A;  3D22 A;  3UBK A;  3GMF A;  5B8B A;  2FNO A;  2DJ1 A;  1OYJ A;  1PX7 A;  1OE7 A;  2VAF A;  2K18 A;  3FR6 A;  3G7I A;  4ML1 A;  5CRW A;  5GAP D;  3GTU B;  2VCW A;  2GT6 A;  3ZFB A;  5GSS A;  2HE3 A;  5DCH A;  3VWX A;  2YAN A;  5F0G A;  3MNG A;  4IP6 A;  3IK7 A;  1GTU A;  4TR3 A;  2LTK A;  4NXI A;  3FW2 A;  5JCG A;  1B8X A;  2L4C A;  1FB6 A;  5JCU A;  1QMV A;  1EEJ A;  1TK5 B;  2AUV A;  1M2B A;  4Q5F A;  1PQN A;  2GSS A;  4LMW A;  3UEM A;  5IO2 A;  2CVD A;  4MH2 A;  1PN9 A;  2FCH A;  1EZK A;  1YEX A;  2AYT A;  1FOV A;  4EE0 A;  19GS A;  5IOW A;  1LU4 A;  2LRN A;  4N10 A;  4EO3 A;  1GSY A;  2EIR A;  4ACS A;  3GFK A;  1ERU A;  2HLS A;  4N0V A;  1R5P A;  2R5G A;  2VL2 A;  1TRU A;  3LXT A;  1IYH A;  4N11 A;  2QKE A;  2KP2 A;  3D6I A;  3CMI A;  1GSE A;  4MF7 A;  4BWS A;  1EV4 A;  1CQG A;  3LOR A;  8GSS A;  3FK8 A;  2VCT A;  3H1N A;  5LNK e;  1URM A;  1EOH A;  4P3Y B;  3TOT A;  2RM6 A;  2PU9 C;  1AAZ A;  4I2U A;  4KDX A;  4G19 A;  1TU7 A;  4O5R A;  2RUE A;  3F63 A;  1R26 A;  3EU4 A;  2L5L A;  5ECS A;  3FZ4 A;  2I3Y A;  5B6M A;  1ABA A;  2L4Q A;  1GUK A;  5AIV A;  2DJ3 A;  4PUR A;  1HNC A;  4ILF A;  4ID0 A;  4WF4 A;  1V2A A;  1S3C A;  4FH8 A;  2B5Y A;  5ECR B;  1K0N A;  1PRX A;  2EC4 A;  2F9S A;  1PSQ A;  2R2J A;  4F9Z A;  3ZLP A;  3WT2 A;  3UJ1 A;  4D73 B;  4F0C A;  2YJH A;  2OJL A;  3HZ8 A;  2H1B A;  2YCD A;  1YJ6 A;  3FKF A;  3EC3 A;  3KD0 A;  4GSS A;  3M1G A;  3WYW A;  4BA7 A;  5KN1 A;  1JLV A;  5L71 A;  2C0G A;  1BQ7 A;  3BJ5 A;  1XPV A;  3LSZ A;  4XS4 A;  2XBQ A;  5G1L A;  2YJ7 A;  4KW6 A;  4KSM A;  1JHB A;  1T7P B;  1SEN A;  1QUW A;  4X0X A;  2WUL A;  1SL1 B;  1XBS A;  1WE0 A;  2TIR A;  2PUK C;  1XXU A;  4PNF A;  4IS0 A;  4I8B A;  4XCS A;  4PQH A;  1RQM A;  4HEA 2;  4TRX A;  4KCA A;  1GUH A;  2ZCT A;  4OFN A;  4X43 A;  3DWV A;  4V2L A;  3O76 A;  3EYT A;  3VWW A;  1OC8 A;  2CVB A;  5ELA A;  3KMN A;  2N5F A;  4KDY A;  1VF4 A;  4GSN A;  3WGE A;  3VI5 A;  1GUL A;  3RHC A;  1BYE A;  4XS6 A;  4KSO A;  3TJB A;  4IKH A;  1FB0 A;  2H30 A;  3VWV A;  4PQI A;  3WGD A;  3UL3 A;  3GSS A;  3CBU A;  1USB A;  2WGR A;  3ME7 A;  4DSR A;  3M9K A;  1Z6N A;  1IYI A;  2IN3 A;  5ID2 B;  3APQ A;  3D4M A;  1VRS D;  1GSU A;  4MF6 A;  3VLN A;  2GQK A;  1F9M A;  1VF3 A;  12GS A;  1F3B A;  3KH9 A;  1OKT A;  2WJU A;  2V41 A;  1F6M C;  3O3T A;  2K8S A;  1XZO A;  2GSQ A;  2PGT A;  4NWY A;  1J08 A;  4YQM A;  2L6C A;  2KLX A;  1BG5 A;  5DDL A;  3U6V A;  2C0F A;  1K0C A;  1XWA A;  1J0F A;  1PD2 1;  2FA8 A;  1KEB A;  1NHO A;  4K9Z A;  2HRF A;  2CQ9 A;  4POL A;  2H70 A;  1T1V A;  3FR3 A;  1ILO A;  1TTZ A;  1FG4 A;  4TXO A;  2VD0 A;  1QGV A;  1AW9 A;  4GRF A;  4PX1 A;  3FEU A;  3W6G A;  4OWY A;  2BJX A;  2GSR A;  5IMC A;  5CRE A;  3FHK A;  1TK0 B;  5ENU A;  3ZVJ D;  2V32 A;  4ZXG A;  5HR2 A;  3TCO A;  1I5G A;  1JZD A;  3M0F A;  2WCI A;  5J9B A;  4K6X A;  3HZ4 A;  3TRX A;  2C80 A;  1AQV A;  3PGT A;  2VCZ A;  2WB9 A;  5G1K A;  2QC7 A;  4GWR A;  3C73 A;  1S3D A;  3PH9 A;  1FW1 A;  3P8W A;  2YWM A;  2ON5 A;  1GL8 A;  5AN1 A;  2VCX A;  2Z9S A;  6GSY A;  3L9V A;  5B8A A;  4BL7 A;  5LCZ A;  3G7Y A;  4PNG A;  3JCM L;  3U5R E;  1UC7 A;  2VM2 A;  4KE3 A;  3W8J A;  4F82 A;  5D73 A;  2AHE A;  2D2Z A;  3L0H A;  2XPD A;  3C1S A;  4DSS A;  3VI7 A;  3GX8 A;  4POK A;  1TRV A;  5CYY A;  5DAK A;  1H75 A;  5IMF A;  1YEP A;  3TKS E;  4ISD A;  2MBT A;  4FIW A;  3DEX A;  5ECP B;  1FVK A;  3HJP A;  3VPQ A;  4WXT A;  2IFQ B;  4I2T A;  4FYC A;  5CAX A;  5ECO B;  4KGI A;  4JR6 A;  2JSZ A;  3TJJ A;  3MWH A;  1T3B A;  3EVI A;  4XIH A;  1GH2 A;  2HT9 A;  1F3A A;  2FWG A;  4KND A;  2AV4 A;  2IMK A;  3IV4 A;  4J2F A;  1Z6M A;  2GT5 A;  5D8I A;  3N5O A;  3HXS A;  4IJ3 A;  1Z7R A;  1SJZ A;  4ZIL A;  3F4R A;  3I69 A;  2A2S A;  5F8B A;  3GKX A;  1X9W B;  3ISO A;  5C00 A;  1XW5 A;  1OKD A;  5FT3 A;  3QR6 A;  1K3L A;  2E7P A;  5DJL A;  1M2D A;  3EU3 A;  2HYX A;  4V1A g;  2BTO T;  3A5W A;  1ZCP A;  3I43 A;  5G2Z A;  2GTU A;  1HNB A;  2TRX A;  5ELG A;  5IMA A;  3SWL A;  3NOF A;  2LRC A;  1DE1 A;  5INY A;  1G6Y A;  2HXK A;  18GS A;  1T8E B;  2K6V A;  2IPA A;  1ERV A;  1QK8 A;  2WFC A;  4JU5 A;  3QMX A;  1YF0 A;  2DJK A;  2IJY A;  4PXO A;  3FZ9 A;  3NZN A;  3KEB A;  1K0M A;  2YZH A;  2I9H A;  3GTU A;  3FYG A;  3GUS A;  1K0D A;  2C1Y A;  5EPF A;  2X64 A;  3F6D A;  20GS A;  2DSA A;  1FAA A;  2G2Q A;  4MCU A;  1JLW A;  2DJ2 A;  2C3Q A;  2C4J A;  4ZB9 A;  1VF1 A;  3GV1 A;  3KXO A;  22GS A;  3APS A;  1G6W A;  1ZGN A;  5HR0 A;  4QL9 A;  3I6A A;  3V1W A;  3HVX A;  1FO5 A;  1B4P A;  2HSY A;  1DE2 A;  1WPI A;  1EP8 A;  3KP8 A;  2VL3 A;  3GA4 A;  5ECN B;  1GSF A;  3KM6 A;  4ZL9 A;  3A2X A;  4ZIJ A;  5B7C A;  3HCZ A;  1EGR A;  2KP1 A;  2TRC P;  5G30 A;  1TW9 A;  2B7J A;  1EGO A;  2VO4 A;  5GAN D;  1G0T A;  2OBK A;  4EUY A;  4GQC A;  3J7Y k;  3M8N A;  3KZQ A;  5AGY A;  2YN1 A;  3E9J B;  3C8E A;  2DBC A;  2YZU A;  4ML6 A;  3GUR A;  2IIY A;  4K1F A;  2QSI A;  1GTA A;  1ZMA A;  4WET A;  3HYP A;  2F8A A;  3P90 A;  4LA1 A;  3QAW A;  1THX A;  2PN8 A;  3QFB C;  5CP1 A;  2LJK A;  1YDK A;  3F3R A;  5F05 A;  5JWQ B;  1Y25 A;  3AY8 A;  2X99 A;  3FZA A;  5C04 A;  5DQS A;  4F03 A;  3KTB A;  3IAM 2;  4HZ4 A;  2I1U A;  3ZTL A;  2FA4 A;  3SBC A;  1M9B A;  2FGX A;  2VLU A;  3ERF A;  4LLR A;  1XOB A;  2ZUP A;  1WP0 A;  4ZB8 A;  1M99 A;  1XWB A;  2B5X A;  1GSD A;  2A2R A;  3QAV A;  3DYR A;  2XBI A;  4D73 A;  4RQX A;  3EWL A;  1V40 A;  2GDR A;  1N8J A;  2VLT A;  1M7T A;  2YV9 A;  1SL0 B;  2R3X A;  1O8W A;  1X5C A;  3I9V 2;  2N5B A;  2MMO A;  1SD8 A;  4IBP A;  1E6B A;  1Z9H A;  1TXX A;  4AJ6 A;  3UAP A;  2WRT A;  2KUC A;  1U6T A;  2LNT A;  4PUF C;  2HFD A;  3C7M A;  4JR4 A;  4YQV A;  1U3I A;  3VPT A;  1WIK A;  3GRX A;  3ERG A;  2C8U A;  3GNJ A;  1MDK A;  4G2E A;  5CO3 A;  2WDU A;  4RI7 A;  4CHS A;  3G9B A;  1WWJ A;  2GQM A;  4GXZ A;  4PUA A;  3QDN A;  2FY6 A;  2OBI A;  4MK3 A;  2M72 A;  4TN8 A;  2MMN A;  3GH9 A;  5IPG A;  2ON7 A;  1BAY A;  3ZIJ A;  2H72 A;  1GP1 A;  5H5R A;  2ZNM A;  3OR5 A;  4GLT A;  1N2A A;  2KOK A;  11GS A;  3TKS A;  1R5A A;  2JAD A;  1AIU A;  5IMD A;  4K0G A;  2ES7 A;  3TGZ A;  3F3Q A;  3UMA A;  5ID2 A;  1A2M A;  4PQ1 A;  5G5F A;  2MYG A;  3DKS A;  2A4V A;  3KGK A;  7GSS A;  1U87 A;  1ZYE A;  2NPB A;  3KIJ A;  5A5K A;  3W8S A;  2LV3 A;  1Q4J A;  4OD7 A;  4XRD A;  1FHE A;  3RPP A;  5A4V A;  2NDO A;  3HHV A;  3LXZ A;  4EVM A;  3F4T A;  2O89 A;  2OE1 A;  4ZBD A;  4MA9 A;  3TKP A;  2VUP A;  1GWC A;  5FWG A;  4MZC A;  2C0D A;  1F37 A;  3DVX A;  3KCM A;  1X9S B;  1A24 A;  2MMA A;  3LYK A;  2H6Z A;  4ZB6 A;  3KJY A;  1TRS A;  3FZ5 A;  4JRR A;  2FWH A;  4V2M A;  3DRN A;  3UBL A;  1OE8 A;  5J5N A;  2RII A;  2VCV A;  2R37 A;  2B3S A;  3H4K A;  4KX4 A;  4OMV A;  3PR8 A;  3P2A A;  4XTS A;  1GTI A;  3QCP A;  3DML A;  5ECK B;  3E3E A;  2PMT A;  4XS4 B;  4RI6 A;  4IGJ A;  2GZP A;  2H73 A;  2B7K A;  4Q5N A;  2DML A;  3ZL5 A;  2HZE B;  5F06 A;  1FVJ A;  1A23 A;  2LST A;  2K8V A;  2CX3 A;  2FD3 A;  2CAQ A;  5CRH A;  1ZOF A;  3GKM A;  4AJ8 A;  5DJM A;  5H5Q A;  3ZML A;  5HQP A;  3GST A;  3F0I A;  1YKC A;  2VL2 C;  1SJ6 A;  1QFN A;  4TR1 B;  1SK2 A;  2VLV A;  2PER A;  1Z7P A;  4IEL A;  1THO A;  4O92 A;  2IFQ A;  4NV2 A;  3DVW A;  3ZMK A;  3IOS A;  4OCE A;  5AIS A;  1GTB A;  1WJK A;  5G5E A;  2WZ9 A;  1XFL A;  1JFU A;  1VF2 A;  3RBT A;  5B6N A;  2H6X A;  5DAL A;  4XS1 A;  3EUR A;  2B5E A;  4ZBB A;  2NVL A;  3BD2 A;  1GUM A;  4YAV A;  1KTE A;  3WD6 A;  1H4O A;  3RPN A;  3P7X A;  4I6X A;  4L5O A;  4CW9 A;  5DCG A;  1GRX A;  2RLI A;  3TJG A;  5D96 A;  2HSH A;  1BX9 A;  2I81 A;  2AAW A;  3Q6O A;  4JE1 A;  2IWT A;  2O87 A;  5ABR A;  5HR3 A;  1TU8 A;  2JZS A;  3A2V A;  3TKR A;  2WS2 A;  1AQX A;  2YWI A;  3LQ7 A;  5D9T A;  2VIM A;  2B6M A;  2C3N A;  3ZYW A;  4NMU A;  4GF0 A;  4WF5 A;  4JBB A;  3TOU A;  4WR4 A;  6GSX A;  1ON4 A;  4OFT A;  2DMM A;  2NTO A;  3GHA A;  4AGS A;  3Q18 A;  2H1A A;  4K8M A;  1PX6 A;  5KN3 A;  3CSJ A;  1PMT A;  3RAZ A;  3TUE A;  4K7I A;  4K2D A;  3HDC A;  3IHQ A;  1UN2 A;  1A8L A;  2OAD A;  3UVT A;  4KDU A;  5DQY A;  1S3A A;  5H5S A;  4WBR D;  1B9X C;  2R4V A;  1MDJ A;  2GS3 A;  4K7N A;  2IME A;  1PKW A;  2IMD A;  4E8E A;  1E2Y A;  2YP6 A;  2FLS A;  1TK8 B;  3CYN A;  3L78 A;  4YAP A;  2CV4 A;  2C3T A;  3IRA A;  5A4U A;  5FHI A;  5IO0 A;  2X8H A;  1TRW A;  2F8F A;  3LEF A;  5EL8 A;  5J41 A;  1RK4 A;  2XC2 A;  2AJQ B;  1O85 A;  4ECJ A;  2BMX A;  2YV7 A;  2L5O A;  2O85 A;  1PL2 A;  2GGT A;  3TRQ A;  2XHF A;  5JWR B;  1AXD A;  3ERW A;  3TDG A;  1X0R A;  1ERW A;  1MDI A;  4O7H A;  3HJM A;  1DUG A;  2DJ0 A;  3VK9 A; 
#chains in the Genus database with same CATH topology
 1OAZ A;  2FWE A;  2ALB A;  4OCF A;  3GL5 A;  1AQW A;  4TR0 A;  4FQU A;  1K0B A;  3O6T A;  3QOU A;  4MF5 A;  1YQ1 A;  2YPM A;  3BOA A;  2DKH A;  1EWX A;  5D9X A;  1R4W A;  2LQO A;  2J9H A;  5IPH A;  2LJA A;  2JZR A;  1ZYN A;  3L4N A;  4I97 A;  1K3O A;  2YNX A;  2H66 A;  1B48 A;  4K0N A;  4HQZ A;  1XW6 A;  1NSW A;  1T4Y A;  3QFA C;  2I4A A;  1RW1 A;  1I9D A;  2OA7 A;  1SYR A;  4OO5 A;  3BCK A;  1C72 A;  1XVQ A;  3GN3 A;  1M0U A;  3LW9 A;  3C71 A;  6GSV A;  4MAB A;  3HD5 A;  1JZW A;  1FOH A;  5DBQ A;  2P0G A;  4J57 E;  1Z3E A;  3EMX A;  3LG6 A;  5E4W A;  1PKZ A;  5IM9 A;  1JZR A;  3D5J A;  3D4T A;  3KH7 A;  3VUR A;  4EC0 A;  4I5Q A;  1ACV A;  2K9F A;  4MLY A;  4KUN A;  1UVZ A;  2VL9 A;  1BED A;  1WRY A;  4MZB A;  2DIY A;  1T00 A;  1SKW B;  4FO5 A;  1X9M B;  1O7U A;  2GVP A;  2KHP A;  3GX0 A;  4IW9 A;  4KB3 A;  2RM5 A;  3CTG A;  1K3Y A;  2V1M A;  3IPZ A;  1TP9 A;  4BPY A;  3IBH A;  1XWK A;  5IIZ A;  4HS1 A;  1GSS A;  3VWU A;  5KN2 A;  2IL3 A;  1TI3 A;  3HVS A;  1X5E A;  2NBS A;  4HU7 A;  2OAC A;  3CSH A;  4MMM A;  4DVC A;  1NW2 A;  2PPT A;  1F2E A;  2XPE A;  1KBN A;  4EXJ A;  3WT1 A;  2LJR A;  4JED A;  2REM A;  2JL4 A;  1OC9 B;  4IP1 A;  2C0E A;  4EDZ A;  1SD9 A;  2PBJ A;  1SK1 A;  4OFM A;  3CRT A;  3MAK A;  5HR1 A;  1EOG A;  5ECI B;  1X5D A;  1G7E A;  2R6K A;  2MBS A;  2LNS A;  2VM1 A;  1ZYQ B;  2H76 A;  1XG8 A;  3IE3 A;  3CTF A;  3D21 A;  4KH7 A;  2CX4 A;  4AF2 A;  4NAX A;  2LS5 A;  3EE2 A;  3DIE A;  5GST A;  4GST A;  2R0G A;  3A5I A;  1GSQ A;  4IN0 A;  1SJI A;  1JZO A;  4NHZ A;  3ZZX A;  5KOW A;  3H8Q A;  4ECI A;  1GNE A;  5IOX A;  3RDW A;  1MEK A;  4IJI A;  4CDO A;  5A4W A;  2H19 A;  2G0F A;  4BVY A;  4HI7 A;  3MIX A;  2DIZ A;  3S9F A;  1GNW A;  3FR9 A;  3UOM A;  4YH2 A;  2CA8 A;  3WGX A;  2O7K A;  2CT6 A;  3A2W A;  3ZRD A;  2FHE A;  5D93 A;  2M80 A;  5HFG A;  2V6O A;  5KN0 A;  2JSY A;  3GL3 A;  4MZW A;  1A0R P;  1QQ2 A;  5J9C A;  1O6J A;  4NPB A;  3CSI A;  1GLQ A;  2V6K A;  3DGQ A;  1ZZY A;  4HQS A;  2J23 A;  1T4Z A;  4WR5 A;  1XVW A;  3F8U A;  5GZZ B;  4G9H A;  2F51 A;  3M3M A;  1TDI A;  2OE3 A;  3KMO A;  5JWO B;  3UAR A;  1ERT A;  3IK9 A;  4KAE A;  4ULX A;  3FMW A;  3A3T A;  4G10 A;  4O32 A;  4GCI A;  3CXG A;  3N9J A;  4F2I A;  3C1R A;  3H79 A;  5COH A;  2IMI A;  1SKR B;  4J56 E;  2H0H A;  5LD0 A;  2EIQ A;  3HKR A;  1M9A A;  1ML6 A;  4ZL8 A;  2E0Q A;  5EY6 A;  4AJ7 A;  5IMV A;  4Z7X A;  2OKA A;  4RUV A;  2OE0 A;  4HDE A;  1R7H A;  3TKQ A;  4NV5 A;  1YKA A;  2HZE A;  1J9B A;  2L59 A;  3LJR A;  2H0G A;  2GZZ A;  2H01 A;  4ECC A;  2M46 A;  2B1K A;  10GS A;  5ECH B;  2LRT A;  5JCW A;  2X8C A;  4CY6 A;  3ZRE A;  2N5A A;  4EF0 A;  2LUS A;  4MP4 A;  3ED3 A;  4F0B A;  1XW9 A;  5F07 A;  4POB A;  4XRA A;  2P5Q A;  5EVO A;  5G31 A;  1OVN A;  2LKU A;  4G0L A;  1A2J A;  4QQ7 A;  2E2G A;  5IQY A;  4TVE A;  4TR1 A;  2EIO A;  2VOC A;  3IR4 A;  3HY2 A;  1TJD A;  4L8E A;  4HJM A;  1GLP A;  5E59 A;  2DLX A;  4BWQ A;  3F6F A;  4EDY A;  2CAI A;  4EL1 A;  2FWF A;  1K0O A;  4L0U A;  5CRG A;  1XOA A;  2DJJ A;  4MDC A;  4HOJ A;  2H71 A;  1CQH A;  2L57 A;  1BJX A;  3TJF A;  3HA9 A;  3TB2 A;  4USS A;  6GSS A;  1XCC A;  2MZC A;  3H93 A;  1Z5Y E;  1UA5 A;  1K0A A;  3DXB A;  3KP9 A;  1WOU A;  5J4U A;  2P5R A;  1PL1 A;  1V58 A;  4HUA A;  1V98 A;  2LEG A;  1EEM A;  1PGT A;  3GH6 A;  3LGC A;  3ME8 A;  1ZL9 A;  2VCQ A;  3J7Y b;  4RQR A;  3IXR A;  1KNG A;  2AB6 A;  4K5R A;  1EP7 A;  2V2G A;  3ZIV A;  1HYU A;  4Z2T A;  1EV9 A;  4OO4 A;  2YWN A;  5BRT A;  1NM3 A;  1TOF A;  2FUG 2;  4GQF A;  2LQQ A;  4MJE A;  1MTC A;  5HFK A;  3UVH A;  3GIX A;  3RHB A;  4FYU A;  2GST A;  2H75 A;  13GS A;  1V9W A;  1W89 A;  4TR4 A;  4ZBA A;  4V1A p;  2E2M A;  2P31 A;  3GYK A;  2HNL A;  2QGV A;  1M2A A;  1S3R A;  3IA1 A;  1HNA A;  3HJO A;  1LJR A;  2JU5 A;  3LFL A;  6GSU A;  4TXV A;  3QD9 A;  2YWO A;  2PVO C;  5ECL B;  1HQO A;  3IDV A;  3ZFL A;  1V57 A;  3IAS 2;  4QL7 A;  3IC4 A;  5CNW A;  1A0F A;  2H1G A;  5KEJ A;  2HZF A;  2YOI A;  1G7O A;  1O73 A;  4Q5Q A;  1SYX A;  4E8H A;  2GLR A;  3BBY A;  3TRP A;  2H0I A;  2DC5 A;  4ECB A;  1O8X A;  1Y6E A;  1XWC A;  2F3M A;  3GKN A;  3Q74 A;  1XWG A;  4X1U A;  4FYB A;  1U3A A;  5J3R A;  1QXH A;  2CZ3 A;  4IVF A;  2X8G A;  4TXO B;  1PN0 A;  2CZ2 A;  4ZL7 A;  3ZIT A;  5D9W A;  5AIX A;  3DD3 A;  1WMJ A;  4N30 A;  2PWJ A;  4O5U A;  3Q19 A;  1AUC A;  4HU9 A;  3TKS C;  1OC3 A;  1TKD B;  3UIW A;  3D0Z A;  4YQU A;  5ECQ B;  1LBK A;  4MH3 A;  3M9J A;  3APO A;  1U88 A;  3L9S A;  4O5Q A;  3K8N A;  6GST A;  1O81 A;  2HI7 A;  1B4Q A;  4BVX A;  3LWA A;  2H74 A;  4IQA A;  2L6D A;  3CRU A;  4EIP A;  1TI1 A;  2IMF A;  2CVK A;  3QPM A;  3EMP A;  1A2L A;  4DEJ A;  2GQL A;  4WEY A;  2A2P A;  3KTL A;  5DAL B;  2GZY A;  4LL1 B;  2O8V B;  3HVV A;  5HFI A;  3FRC A;  5CRD A;  3GKK A;  3US3 A;  1W4V A;  16GS A;  4XHM A;  1HD2 A;  3ZVJ A;  2JZT A;  3NIV A;  3LYP A;  1XIY A;  4DSS B;  3G7J A;  3FY7 A;  4KCE A;  4WKW A;  1Q98 A;  5DAK B;  1ST9 A;  3R2Q A;  2MMZ A;  4KA0 A;  4WBJ A;  5ECM B;  4HZ2 A;  1SK0 A;  4TOP A;  2VD1 A;  4IHU A;  4EKZ A;  14GS A;  4NHW A;  3TJK A;  5D9V A;  3VFI A;  2PVQ A;  1SKS B;  2H8L A;  4TKY A;  4TW5 A;  4K7O A;  2RUF A;  3MDK A;  3L9U A;  2B1L A;  4MJB A;  2H1D A;  2HRN A;  3BCI A;  4Q5R A;  5DVB A;  1A8Y A;  9GSS A;  2QA1 A;  1SL2 B;  3PIN A;  4N0Z A;  1MD4 A;  1B9Y C;  2A4H A;  4IQ1 A;  4V2N A;  6GSW A;  1YY7 A;  4DSQ A;  2HRA A;  1DSB A;  3EPT A;  1AC1 A;  4L5L A;  1SU9 A;  4H86 A;  4LL4 B;  3MYD A;  4GTU A;  5IMZ A;  1YZX A;  3QAG A;  4MPG A;  1YF1 A;  4POM A;  3IC8 A;  3F4S A;  1OC9 A;  1PA3 A;  3IHG A;  4L0W A;  1NHY A;  1DBY A;  4LMV A;  4MJA A;  4PGT A;  3E0U A;  1VGL A;  4JZQ A;  17GS A;  3F9U A;  3MSZ A;  4HJ2 A;  4MJC A;  3EIN A;  4MPF A;  2JAC A;  1MD3 A;  2H6Y A;  3D22 A;  3UBK A;  3GMF A;  5B8B A;  2FNO A;  2DJ1 A;  1OYJ A;  1PX7 A;  1OE7 A;  2VAF A;  2K18 A;  3FR6 A;  3G7I A;  4ML1 A;  5CRW A;  5GAP D;  3GTU B;  2VCW A;  2GT6 A;  3ZFB A;  5GSS A;  2HE3 A;  5DCH A;  3VWX A;  2YAN A;  5F0G A;  3MNG A;  4IP6 A;  3IK7 A;  1GTU A;  4TR3 A;  2LTK A;  4NXI A;  3FW2 A;  5JCG A;  1B8X A;  2L4C A;  1FB6 A;  5JCU A;  1QMV A;  1EEJ A;  1TK5 B;  2AUV A;  1M2B A;  4Q5F A;  1PQN A;  2GSS A;  4LMW A;  3UEM A;  5IO2 A;  2CVD A;  4MH2 A;  1PN9 A;  2FCH A;  1EZK A;  1YEX A;  2AYT A;  1FOV A;  4EE0 A;  19GS A;  1M3I A;  5IOW A;  1LU4 A;  2LRN A;  4N10 A;  4EO3 A;  1GSY A;  2EIR A;  4ACS A;  3GFK A;  1ERU A;  2HLS A;  4N0V A;  1R5P A;  2R5G A;  2VL2 A;  1TRU A;  3LXT A;  1IYH A;  4N11 A;  2QKE A;  2KP2 A;  3D6I A;  3CMI A;  1GSE A;  4MF7 A;  4BWS A;  1EV4 A;  1CQG A;  3LOR A;  8GSS A;  3FK8 A;  2VCT A;  3H1N A;  5LNK e;  1URM A;  1EOH A;  4P3Y B;  3TOT A;  2RM6 A;  2PU9 C;  4A5P A;  1AAZ A;  4PTS A;  4I2U A;  4KDX A;  4G19 A;  1TU7 A;  4O5R A;  2RUE A;  3F63 A;  1R26 A;  3EU4 A;  2L5L A;  5ECS A;  3FZ4 A;  2I3Y A;  5B6M A;  1ABA A;  2L4Q A;  1GUK A;  5AIV A;  2DJ3 A;  4PUR A;  1HNC A;  4ILF A;  4ID0 A;  4WF4 A;  2R0C A;  1V2A A;  1S3C A;  4FH8 A;  2B5Y A;  5ECR B;  1K0N A;  1PRX A;  2EC4 A;  4BIK A;  2F9S A;  1PSQ A;  2R2J A;  4F9Z A;  3ZLP A;  3WT2 A;  3UJ1 A;  4D73 B;  4F0C A;  2R0P A;  4X4J A;  1M3J A;  2YJH A;  2OJL A;  3HZ8 A;  2H1B A;  2YCD A;  1YJ6 A;  3FKF A;  3EC3 A;  3KD0 A;  4GSS A;  3M1G A;  3WYW A;  4BA7 A;  5KN1 A;  1JLV A;  5BMU A;  5L71 A;  2C0G A;  1BQ7 A;  3BJ5 A;  1XPV A;  3LSZ A;  4XS4 A;  2XBQ A;  5G1L A;  2YJ7 A;  4KW6 A;  4KSM A;  1JHB A;  1T7P B;  1SEN A;  1QUW A;  4X0X A;  2WUL A;  1SL1 B;  1XBS A;  1WE0 A;  2TIR A;  2PUK C;  1XXU A;  4PNF A;  4IS0 A;  4BVY B;  4I8B A;  4XCS A;  4PQH A;  1RQM A;  4HEA 2;  4TRX A;  4KCA A;  1GUH A;  2ZCT A;  4OFN A;  4X43 A;  3DWV A;  4V2L A;  3O76 A;  3EYT A;  3VWW A;  1OC8 A;  2CVB A;  5ELA A;  3PPU A;  3KMN A;  2N5F A;  4KDY A;  1VF4 A;  4GSN A;  3WGE A;  3VI5 A;  1GUL A;  3RHC A;  1BYE A;  4XS6 A;  4KSO A;  3TJB A;  4IKH A;  1FB0 A;  2H30 A;  3VWV A;  4PQI A;  3WGD A;  3UL3 A;  3GSS A;  3CBU A;  1USB A;  2WGR A;  3ME7 A;  4DSR A;  3M9K A;  1Z6N A;  1IYI A;  2IN3 A;  5ID2 B;  3APQ A;  3D4M A;  1VRS D;  1GSU A;  4MF6 A;  3VLN A;  5KOX A;  2GQK A;  1F9M A;  1VF3 A;  12GS A;  1F3B A;  3KH9 A;  1OKT A;  2WJU A;  2V41 A;  1F6M C;  3O3T A;  2K8S A;  1XZO A;  2GSQ A;  2PGT A;  4NWY A;  1J08 A;  4YQM A;  4G0K A;  2L6C A;  2KLX A;  1BG5 A;  5DDL A;  3U6V A;  2C0F A;  1K0C A;  1XWA A;  1J0F A;  1PD2 1;  2FA8 A;  1KEB A;  1NHO A;  4K9Z A;  2HRF A;  2CQ9 A;  4POL A;  2H70 A;  1T1V A;  3FR3 A;  1ILO A;  1TTZ A;  1FG4 A;  4TXO A;  2VD0 A;  1QGV A;  1AW9 A;  4GRF A;  4PX1 A;  3FEU A;  3W6G A;  4OWY A;  2BJX A;  2GSR A;  5IMC A;  5CRE A;  3FHK A;  1TK0 B;  5ENU A;  3ZVJ D;  2V32 A;  4ZXG A;  5HR2 A;  3TCO A;  3CQF A;  1I5G A;  1JZD A;  3M0F A;  2WCI A;  5J9B A;  4K6X A;  3HZ4 A;  3TRX A;  2C80 A;  1AQV A;  3PGT A;  2VCZ A;  2WB9 A;  5G1K A;  2QC7 A;  4GWR A;  3C73 A;  1S3D A;  3PH9 A;  1FW1 A;  3P8W A;  2YWM A;  2ON5 A;  1GL8 A;  5AN1 A;  2VCX A;  2Z9S A;  6GSY A;  3L9V A;  5B8A A;  4BL7 A;  5LCZ A;  3G7Y A;  4PNG A;  3JCM L;  3U5R E;  1UC7 A;  2VM2 A;  4KE3 A;  3W8J A;  4F82 A;  5D73 A;  2AHE A;  2D2Z A;  3L0H A;  2XPD A;  3C1S A;  4DSS A;  3VI7 A;  3GX8 A;  4POK A;  1TRV A;  5CYY A;  5DAK A;  1H75 A;  5IMF A;  1YEP A;  3TKS E;  4ISD A;  2MBT A;  4FIW A;  3DEX A;  5ECP B;  1FVK A;  3R3E A;  3HJP A;  3VPQ A;  4WXT A;  2IFQ B;  4I2T A;  4FYC A;  5CAX A;  5ECO B;  4KGI A;  4JR6 A;  2JSZ A;  3TJJ A;  3MWH A;  1T3B A;  3EVI A;  4XIH A;  1GH2 A;  2HT9 A;  1F3A A;  2FWG A;  4KND A;  2AV4 A;  2IMK A;  3IV4 A;  4J2F A;  1Z6M A;  2GT5 A;  5D8I A;  3N5O A;  3HXS A;  4IJ3 A;  1Z7R A;  1SJZ A;  4ZIL A;  3F4R A;  3I69 A;  2A2S A;  5F8B A;  3GKX A;  1X9W B;  3ISO A;  5C00 A;  1XW5 A;  1OKD A;  5FT3 A;  3QR6 A;  1K3L A;  2E7P A;  5DJL A;  1M2D A;  3EU3 A;  2QA2 A;  2HYX A;  4V1A g;  2BTO T;  3A5W A;  1ZCP A;  3I43 A;  5G2Z A;  2GTU A;  1HNB A;  2TRX A;  5ELG A;  5IMA A;  3SWL A;  3NOF A;  2LRC A;  1DE1 A;  5INY A;  1G6Y A;  2HXK A;  18GS A;  1T8E B;  2K6V A;  2IPA A;  1ERV A;  1QK8 A;  2WFC A;  4JU5 A;  3QMX A;  1YF0 A;  2DJK A;  2IJY A;  4PXO A;  3FZ9 A;  3NZN A;  3KEB A;  1K0M A;  2YZH A;  2I9H A;  4BVX B;  3GTU A;  4CY8 A;  3FYG A;  3GUS A;  1K0D A;  2C1Y A;  5EPF A;  2X64 A;  3F6D A;  20GS A;  2DSA A;  1FAA A;  2G2Q A;  4MCU A;  1JLW A;  2DJ2 A;  2C3Q A;  2C4J A;  4ZB9 A;  1VF1 A;  3GV1 A;  3KXO A;  22GS A;  3APS A;  4G0I A;  1G6W A;  1ZGN A;  4YKG A;  5HR0 A;  4QL9 A;  3I6A A;  3V1W A;  2X4A A;  3HVX A;  1FO5 A;  1B4P A;  2HSY A;  1DE2 A;  1WPI A;  1EP8 A;  3KP8 A;  2VL3 A;  3GA4 A;  5ECN B;  1GSF A;  3KM6 A;  4ZL9 A;  3A2X A;  4ZIJ A;  5B7C A;  3HCZ A;  1EGR A;  2KP1 A;  2TRC P;  5G30 A;  1TW9 A;  2B7J A;  1EGO A;  2VO4 A;  5GAN D;  1G0T A;  2OBK A;  4EUY A;  4KF9 A;  4GQC A;  3J7Y k;  3M8N A;  3KZQ A;  5AGY A;  2YN1 A;  3E9J B;  3C8E A;  2DBC A;  2YZU A;  4ML6 A;  3GUR A;  2IIY A;  4K1F A;  2QSI A;  1GTA A;  1ZMA A;  4WET A;  3HYP A;  2F8A A;  3P90 A;  4LA1 A;  3QAW A;  1THX A;  2PN8 A;  3QFB C;  5CP1 A;  2LJK A;  1YDK A;  3F3R A;  4K2X A;  5F05 A;  5JWQ B;  1Y25 A;  3AY8 A;  2X99 A;  3FZA A;  5C04 A;  5DQS A;  4F03 A;  3KTB A;  3IAM 2;  4HZ4 A;  2I1U A;  3ZTL A;  2FA4 A;  3SBC A;  1M9B A;  2FGX A;  2VLU A;  3ERF A;  4LLR A;  1XOB A;  2ZUP A;  1WP0 A;  4ZB8 A;  1M99 A;  1XWB A;  2B5X A;  1GSD A;  2A2R A;  3QAV A;  3DYR A;  2XBI A;  4D73 A;  4RQX A;  3EWL A;  1V40 A;  2GDR A;  1N8J A;  2UZ8 A;  2VLT A;  1M7T A;  2YV9 A;  1SL0 B;  2R3X A;  1O8W A;  1X5C A;  3I9V 2;  2N5B A;  2MMO A;  4YKF A;  1SD8 A;  4IBP A;  1E6B A;  1Z9H A;  1TXX A;  4AJ6 A;  3UAP A;  2WRT A;  2KUC A;  1U6T A;  2LNT A;  4PUF C;  2HFD A;  3C7M A;  4JR4 A;  4YQV A;  1U3I A;  3VPT A;  1WIK A;  4HSC X;  3GRX A;  4MNN A;  3ERG A;  2C8U A;  3GNJ A;  1MDK A;  4G2E A;  5CO3 A;  2WDU A;  4RI7 A;  4CHS A;  3G9B A;  2DKI A;  1WWJ A;  2GQM A;  2X49 A;  4GXZ A;  4PUA A;  3QDN A;  2FY6 A;  2OBI A;  4MK3 A;  2M72 A;  4TN8 A;  2MMN A;  3GH9 A;  5IPG A;  2ON7 A;  1BAY A;  3ZIJ A;  2H72 A;  1GP1 A;  5H5R A;  2ZNM A;  3OR5 A;  2HRK A;  2HSM A;  4GLT A;  1N2A A;  2KOK A;  11GS A;  3TKS A;  1R5A A;  2JAD A;  1AIU A;  5IMD A;  4K0G A;  2ES7 A;  3TGZ A;  3F3Q A;  3UMA A;  5ID2 A;  1A2M A;  4PQ1 A;  5G5F A;  2MYG A;  3DKS A;  2A4V A;  3KGK A;  7GSS A;  4ICY A;  1U87 A;  1ZYE A;  2NPB A;  3KIJ A;  5A5K A;  3W8S A;  2LV3 A;  1Q4J A;  4OD7 A;  4XRD A;  1FHE A;  3RPP A;  5A4V A;  2NDO A;  3HHV A;  3LXZ A;  4EVM A;  3F4T A;  2O89 A;  2OE1 A;  4ZBD A;  4MA9 A;  3TKP A;  2VUP A;  1GWC A;  5FWG A;  4MZC A;  2C0D A;  1F37 A;  3DVX A;  3KCM A;  1X9S B;  1A24 A;  2MMA A;  3LYK A;  2H6Z A;  4ZB6 A;  3KJY A;  1TRS A;  3FZ5 A;  4JRR A;  2FWH A;  4V2M A;  3DRN A;  3UBL A;  1OE8 A;  5J5N A;  2RII A;  2VCV A;  2R37 A;  2B3S A;  3H4K A;  4Z2U A;  4KX4 A;  4OMV A;  3PR8 A;  3P2A A;  4XTS A;  1GTI A;  3QCP A;  3DML A;  5ECK B;  3E3E A;  2PMT A;  4XS4 B;  4RI6 A;  4IGJ A;  2GZP A;  2H73 A;  2B7K A;  4Q5N A;  2DML A;  3ZL5 A;  2HZE B;  5F06 A;  1FVJ A;  1A23 A;  2LST A;  2K8V A;  2CX3 A;  2FD3 A;  2CAQ A;  5CRH A;  1ZOF A;  3GKM A;  4AJ8 A;  1ZYP A;  5DJM A;  5H5Q A;  3ZML A;  5HQP A;  3GST A;  3F0I A;  1YKC A;  2VL2 C;  1SJ6 A;  1QFN A;  4TR1 B;  1PFO A;  1SK2 A;  2VLV A;  2PER A;  1Z7P A;  4IEL A;  1THO A;  4O92 A;  2IFQ A;  4NV2 A;  3DVW A;  3ZMK A;  3IOS A;  4OCE A;  5AIS A;  1GTB A;  1WJK A;  5G5E A;  2WZ9 A;  1XFL A;  1JFU A;  1VF2 A;  3RBT A;  5B6N A;  2H6X A;  5DAL A;  4K5S A;  4XS1 A;  3EUR A;  2B5E A;  4ZBB A;  2NVL A;  3BD2 A;  1GUM A;  4YAV A;  1KTE A;  3WD6 A;  1H4O A;  3RPN A;  3P7X A;  4I6X A;  4L5O A;  4CW9 A;  5DCG A;  1GRX A;  2RLI A;  3TJG A;  5D96 A;  2HSH A;  1BX9 A;  2I81 A;  2AAW A;  3Q6O A;  4JE1 A;  2IWT A;  2O87 A;  5ABR A;  5HR3 A;  1TU8 A;  2JZS A;  3A2V A;  3TKR A;  2WS2 A;  1AQX A;  2YWI A;  3LQ7 A;  5D9T A;  2VIM A;  2B6M A;  2C3N A;  3ZYW A;  4NMU A;  4GF0 A;  4WF5 A;  4JBB A;  3TOU A;  4WR4 A;  6GSX A;  1ON4 A;  4OFT A;  2DMM A;  2NTO A;  3GHA A;  4AGS A;  3Q18 A;  2H1A A;  4K8M A;  1PX6 A;  5KN3 A;  3CSJ A;  1PMT A;  3RAZ A;  3TUE A;  4K7I A;  4K2D A;  3HDC A;  3IHQ A;  1UN2 A;  1A8L A;  4BL7 B;  2OAD A;  3UVT A;  4KDU A;  5DQY A;  1S3A A;  5H5S A;  4WBR D;  1B9X C;  2R4V A;  1MDJ A;  2GS3 A;  4K7N A;  2IME A;  1PKW A;  2IMD A;  4E8E A;  1E2Y A;  2YP6 A;  2FLS A;  1TK8 B;  3CYN A;  3L78 A;  4YAP A;  2CV4 A;  4Z2R A;  2C3T A;  3IRA A;  5A4U A;  5FHI A;  5IO0 A;  2X8H A;  1TRW A;  2F8F A;  3LEF A;  5EL8 A;  5J41 A;  1RK4 A;  2XC2 A;  2AJQ B;  1O85 A;  4ECJ A;  2BMX A;  2YV7 A;  3HVN A;  2L5O A;  4EIQ A;  2O85 A;  1PL2 A;  2GGT A;  3TRQ A;  2XHF A;  5JWR B;  1AXD A;  3ERW A;  3TDG A;  1X0R A;  1ERW A;  1MDI A;  4O7H A;  3HJM A;  1DUG A;  2DJ0 A;  3VK9 A; 
#chains in the Genus database with same CATH homology
 1OAZ A;  2FWE A;  2ALB A;  4OCF A;  3GL5 A;  1AQW A;  4TR0 A;  4FQU A;  1K0B A;  3O6T A;  3QOU A;  4MF5 A;  1YQ1 A;  2YPM A;  3BOA A;  2DKH A;  1EWX A;  5D9X A;  1R4W A;  2LQO A;  2J9H A;  5IPH A;  2LJA A;  2JZR A;  1ZYN A;  3L4N A;  4I97 A;  1K3O A;  2YNX A;  2H66 A;  1B48 A;  4K0N A;  4HQZ A;  1XW6 A;  1NSW A;  1T4Y A;  3QFA C;  2I4A A;  1RW1 A;  1I9D A;  2OA7 A;  1SYR A;  4OO5 A;  3BCK A;  1C72 A;  1XVQ A;  3GN3 A;  1M0U A;  3LW9 A;  3C71 A;  6GSV A;  4MAB A;  3HD5 A;  1JZW A;  1FOH A;  5DBQ A;  2P0G A;  4J57 E;  1Z3E A;  3EMX A;  3LG6 A;  5E4W A;  1PKZ A;  5IM9 A;  1JZR A;  3D5J A;  3D4T A;  3KH7 A;  3VUR A;  4EC0 A;  4I5Q A;  1ACV A;  2K9F A;  4MLY A;  4KUN A;  1UVZ A;  2VL9 A;  1BED A;  1WRY A;  4MZB A;  2DIY A;  1T00 A;  1SKW B;  4FO5 A;  1X9M B;  1O7U A;  2GVP A;  2KHP A;  3GX0 A;  4IW9 A;  4KB3 A;  2RM5 A;  3CTG A;  1K3Y A;  2V1M A;  3IPZ A;  1TP9 A;  4BPY A;  3IBH A;  1XWK A;  5IIZ A;  4HS1 A;  1GSS A;  3VWU A;  5KN2 A;  2IL3 A;  1TI3 A;  3HVS A;  1X5E A;  2NBS A;  4HU7 A;  2OAC A;  3CSH A;  4MMM A;  4DVC A;  1NW2 A;  2PPT A;  1F2E A;  2XPE A;  1KBN A;  4EXJ A;  3WT1 A;  2LJR A;  4JED A;  2REM A;  2JL4 A;  1OC9 B;  4IP1 A;  2C0E A;  4EDZ A;  1SD9 A;  2PBJ A;  1SK1 A;  4OFM A;  3CRT A;  3MAK A;  5HR1 A;  1EOG A;  5ECI B;  1X5D A;  1G7E A;  2R6K A;  2MBS A;  2LNS A;  2VM1 A;  1ZYQ B;  2H76 A;  3IE3 A;  3CTF A;  3D21 A;  4KH7 A;  2CX4 A;  4AF2 A;  4NAX A;  2LS5 A;  3EE2 A;  3DIE A;  5GST A;  4GST A;  2R0G A;  3A5I A;  1GSQ A;  4IN0 A;  1SJI A;  1JZO A;  4NHZ A;  3ZZX A;  5KOW A;  3H8Q A;  4ECI A;  1GNE A;  5IOX A;  3RDW A;  1MEK A;  4IJI A;  4CDO A;  5A4W A;  2H19 A;  2G0F A;  4BVY A;  4HI7 A;  3MIX A;  2DIZ A;  3S9F A;  1GNW A;  3FR9 A;  3UOM A;  4YH2 A;  2CA8 A;  3WGX A;  2O7K A;  2CT6 A;  3A2W A;  3ZRD A;  2FHE A;  5D93 A;  2M80 A;  5HFG A;  2V6O A;  5KN0 A;  2JSY A;  3GL3 A;  4MZW A;  1A0R P;  1QQ2 A;  5J9C A;  1O6J A;  4NPB A;  3CSI A;  1GLQ A;  2V6K A;  3DGQ A;  1ZZY A;  4HQS A;  2J23 A;  1T4Z A;  4WR5 A;  1XVW A;  3F8U A;  5GZZ B;  4G9H A;  2F51 A;  3M3M A;  1TDI A;  2OE3 A;  3KMO A;  5JWO B;  3UAR A;  1ERT A;  3IK9 A;  4KAE A;  4ULX A;  3FMW A;  3A3T A;  4G10 A;  4O32 A;  4GCI A;  3CXG A;  3N9J A;  4F2I A;  3C1R A;  3H79 A;  5COH A;  2IMI A;  1SKR B;  4J56 E;  2H0H A;  5LD0 A;  2EIQ A;  3HKR A;  1M9A A;  1ML6 A;  4ZL8 A;  2E0Q A;  5EY6 A;  4AJ7 A;  5IMV A;  4Z7X A;  2OKA A;  4RUV A;  2OE0 A;  4HDE A;  1R7H A;  3TKQ A;  4NV5 A;  1YKA A;  2HZE A;  1J9B A;  2L59 A;  3LJR A;  2H0G A;  2GZZ A;  2H01 A;  4ECC A;  2M46 A;  2B1K A;  10GS A;  5ECH B;  2LRT A;  5JCW A;  2X8C A;  4CY6 A;  3ZRE A;  2N5A A;  4EF0 A;  2LUS A;  4MP4 A;  3ED3 A;  4F0B A;  1XW9 A;  5F07 A;  4POB A;  4XRA A;  2P5Q A;  5EVO A;  5G31 A;  1OVN A;  2LKU A;  4G0L A;  1A2J A;  4QQ7 A;  2E2G A;  5IQY A;  4TVE A;  4TR1 A;  2EIO A;  2VOC A;  3IR4 A;  3HY2 A;  1TJD A;  4L8E A;  4HJM A;  1GLP A;  5E59 A;  2DLX A;  4BWQ A;  3F6F A;  4EDY A;  2CAI A;  4EL1 A;  2FWF A;  1K0O A;  4L0U A;  5CRG A;  1XOA A;  2DJJ A;  4MDC A;  4HOJ A;  2H71 A;  1CQH A;  2L57 A;  1BJX A;  3TJF A;  3HA9 A;  3TB2 A;  4USS A;  6GSS A;  1XCC A;  2MZC A;  3H93 A;  1Z5Y E;  1UA5 A;  1K0A A;  3DXB A;  3KP9 A;  1WOU A;  5J4U A;  2P5R A;  1PL1 A;  1V58 A;  4HUA A;  1V98 A;  2LEG A;  1EEM A;  1PGT A;  3GH6 A;  3LGC A;  3ME8 A;  1ZL9 A;  2VCQ A;  3J7Y b;  4RQR A;  3IXR A;  1KNG A;  2AB6 A;  4K5R A;  1EP7 A;  2V2G A;  3ZIV A;  1HYU A;  4Z2T A;  1EV9 A;  4OO4 A;  2YWN A;  5BRT A;  1NM3 A;  1TOF A;  2FUG 2;  4GQF A;  2LQQ A;  4MJE A;  1MTC A;  5HFK A;  3UVH A;  3GIX A;  3RHB A;  4FYU A;  2GST A;  2H75 A;  13GS A;  1V9W A;  1W89 A;  4TR4 A;  4ZBA A;  4V1A p;  2E2M A;  2P31 A;  3GYK A;  2HNL A;  2QGV A;  1M2A A;  3IA1 A;  1HNA A;  3HJO A;  1LJR A;  2JU5 A;  3LFL A;  6GSU A;  4TXV A;  3QD9 A;  2YWO A;  2PVO C;  5ECL B;  1HQO A;  3IDV A;  3ZFL A;  1V57 A;  3IAS 2;  4QL7 A;  3IC4 A;  5CNW A;  1A0F A;  2H1G A;  5KEJ A;  2HZF A;  2YOI A;  1G7O A;  1O73 A;  4Q5Q A;  1SYX A;  4E8H A;  2GLR A;  3BBY A;  3TRP A;  2H0I A;  2DC5 A;  4ECB A;  1O8X A;  1Y6E A;  1XWC A;  2F3M A;  3GKN A;  3Q74 A;  1XWG A;  4X1U A;  4FYB A;  1U3A A;  5J3R A;  1QXH A;  2CZ3 A;  4IVF A;  2X8G A;  4TXO B;  1PN0 A;  2CZ2 A;  4ZL7 A;  3ZIT A;  5D9W A;  5AIX A;  3DD3 A;  1WMJ A;  4N30 A;  2PWJ A;  4O5U A;  3Q19 A;  1AUC A;  4HU9 A;  3TKS C;  1OC3 A;  1TKD B;  3UIW A;  3D0Z A;  4YQU A;  5ECQ B;  1LBK A;  4MH3 A;  3M9J A;  3APO A;  1U88 A;  3L9S A;  4O5Q A;  3K8N A;  6GST A;  1O81 A;  2HI7 A;  1B4Q A;  4BVX A;  3LWA A;  2H74 A;  4IQA A;  2L6D A;  3CRU A;  4EIP A;  1TI1 A;  2IMF A;  2CVK A;  3QPM A;  3EMP A;  1A2L A;  4DEJ A;  2GQL A;  4WEY A;  2A2P A;  3KTL A;  5DAL B;  2GZY A;  4LL1 B;  2O8V B;  3HVV A;  5HFI A;  3FRC A;  5CRD A;  3GKK A;  3US3 A;  1W4V A;  16GS A;  4XHM A;  1HD2 A;  3ZVJ A;  2JZT A;  3NIV A;  3LYP A;  1XIY A;  4DSS B;  3G7J A;  3FY7 A;  4KCE A;  4WKW A;  1Q98 A;  5DAK B;  1ST9 A;  3R2Q A;  2MMZ A;  4KA0 A;  4WBJ A;  5ECM B;  4HZ2 A;  1SK0 A;  4TOP A;  2VD1 A;  4IHU A;  4EKZ A;  14GS A;  4NHW A;  3TJK A;  5D9V A;  3VFI A;  2PVQ A;  1SKS B;  2H8L A;  4TKY A;  4TW5 A;  4K7O A;  2RUF A;  3MDK A;  3L9U A;  2B1L A;  4MJB A;  2H1D A;  2HRN A;  3BCI A;  4Q5R A;  5DVB A;  1A8Y A;  9GSS A;  2QA1 A;  1SL2 B;  3PIN A;  4N0Z A;  1MD4 A;  1B9Y C;  2A4H A;  4IQ1 A;  4V2N A;  6GSW A;  1YY7 A;  4DSQ A;  2HRA A;  1DSB A;  3EPT A;  1AC1 A;  4L5L A;  1SU9 A;  4H86 A;  4LL4 B;  3MYD A;  4GTU A;  5IMZ A;  1YZX A;  3QAG A;  4MPG A;  1YF1 A;  4POM A;  3IC8 A;  3F4S A;  1OC9 A;  1PA3 A;  3IHG A;  4L0W A;  1NHY A;  1DBY A;  4LMV A;  4MJA A;  4PGT A;  3E0U A;  1VGL A;  4JZQ A;  17GS A;  3F9U A;  3MSZ A;  4HJ2 A;  4MJC A;  3EIN A;  4MPF A;  2JAC A;  1MD3 A;  2H6Y A;  3D22 A;  3UBK A;  3GMF A;  5B8B A;  2FNO A;  2DJ1 A;  1OYJ A;  1PX7 A;  1OE7 A;  2VAF A;  2K18 A;  3FR6 A;  3G7I A;  4ML1 A;  5CRW A;  5GAP D;  3GTU B;  2VCW A;  2GT6 A;  3ZFB A;  5GSS A;  2HE3 A;  5DCH A;  3VWX A;  2YAN A;  5F0G A;  3MNG A;  4IP6 A;  3IK7 A;  1GTU A;  4TR3 A;  2LTK A;  4NXI A;  3FW2 A;  5JCG A;  1B8X A;  2L4C A;  1FB6 A;  5JCU A;  1QMV A;  1EEJ A;  1TK5 B;  2AUV A;  1M2B A;  4Q5F A;  1PQN A;  2GSS A;  4LMW A;  3UEM A;  5IO2 A;  2CVD A;  4MH2 A;  1PN9 A;  2FCH A;  1EZK A;  1YEX A;  2AYT A;  1FOV A;  4EE0 A;  19GS A;  5IOW A;  1LU4 A;  2LRN A;  4N10 A;  4EO3 A;  1GSY A;  2EIR A;  4ACS A;  3GFK A;  1ERU A;  2HLS A;  4N0V A;  1R5P A;  2R5G A;  2VL2 A;  1TRU A;  3LXT A;  1IYH A;  4N11 A;  2QKE A;  2KP2 A;  3D6I A;  3CMI A;  1GSE A;  4MF7 A;  4BWS A;  1EV4 A;  1CQG A;  3LOR A;  8GSS A;  3FK8 A;  2VCT A;  3H1N A;  5LNK e;  1URM A;  1EOH A;  4P3Y B;  3TOT A;  2RM6 A;  2PU9 C;  4A5P A;  1AAZ A;  4PTS A;  4I2U A;  4KDX A;  4G19 A;  1TU7 A;  4O5R A;  2RUE A;  3F63 A;  1R26 A;  3EU4 A;  2L5L A;  5ECS A;  3FZ4 A;  2I3Y A;  5B6M A;  1ABA A;  2L4Q A;  1GUK A;  5AIV A;  2DJ3 A;  4PUR A;  1HNC A;  4ILF A;  4ID0 A;  4WF4 A;  2R0C A;  1V2A A;  1S3C A;  4FH8 A;  2B5Y A;  5ECR B;  1K0N A;  1PRX A;  2EC4 A;  2F9S A;  1PSQ A;  2R2J A;  4F9Z A;  3ZLP A;  3WT2 A;  3UJ1 A;  4D73 B;  4F0C A;  2R0P A;  4X4J A;  2YJH A;  2OJL A;  3HZ8 A;  2H1B A;  2YCD A;  1YJ6 A;  3FKF A;  3EC3 A;  3KD0 A;  4GSS A;  3M1G A;  3WYW A;  4BA7 A;  5KN1 A;  1JLV A;  5BMU A;  5L71 A;  2C0G A;  1BQ7 A;  3BJ5 A;  1XPV A;  3LSZ A;  4XS4 A;  2XBQ A;  5G1L A;  2YJ7 A;  4KW6 A;  4KSM A;  1JHB A;  1T7P B;  1SEN A;  1QUW A;  4X0X A;  2WUL A;  1SL1 B;  1XBS A;  1WE0 A;  2TIR A;  2PUK C;  1XXU A;  4PNF A;  4IS0 A;  4BVY B;  4I8B A;  4XCS A;  4PQH A;  1RQM A;  4HEA 2;  4TRX A;  4KCA A;  1GUH A;  2ZCT A;  4OFN A;  4X43 A;  3DWV A;  4V2L A;  3O76 A;  3EYT A;  3VWW A;  1OC8 A;  2CVB A;  5ELA A;  3PPU A;  3KMN A;  2N5F A;  4KDY A;  1VF4 A;  4GSN A;  3WGE A;  3VI5 A;  1GUL A;  3RHC A;  1BYE A;  4XS6 A;  4KSO A;  3TJB A;  4IKH A;  1FB0 A;  2H30 A;  3VWV A;  4PQI A;  3WGD A;  3UL3 A;  3GSS A;  3CBU A;  1USB A;  2WGR A;  3ME7 A;  4DSR A;  3M9K A;  1Z6N A;  1IYI A;  2IN3 A;  5ID2 B;  3APQ A;  3D4M A;  1VRS D;  1GSU A;  4MF6 A;  3VLN A;  5KOX A;  2GQK A;  1F9M A;  1VF3 A;  12GS A;  1F3B A;  3KH9 A;  1OKT A;  2WJU A;  2V41 A;  1F6M C;  3O3T A;  2K8S A;  1XZO A;  2GSQ A;  2PGT A;  4NWY A;  1J08 A;  4YQM A;  4G0K A;  2L6C A;  2KLX A;  1BG5 A;  5DDL A;  3U6V A;  2C0F A;  1K0C A;  1XWA A;  1J0F A;  1PD2 1;  2FA8 A;  1KEB A;  1NHO A;  4K9Z A;  2HRF A;  2CQ9 A;  4POL A;  2H70 A;  1T1V A;  3FR3 A;  1ILO A;  1TTZ A;  1FG4 A;  4TXO A;  2VD0 A;  1QGV A;  1AW9 A;  4GRF A;  4PX1 A;  3FEU A;  3W6G A;  4OWY A;  2BJX A;  2GSR A;  5IMC A;  5CRE A;  3FHK A;  1TK0 B;  5ENU A;  3ZVJ D;  2V32 A;  4ZXG A;  5HR2 A;  3TCO A;  1I5G A;  1JZD A;  3M0F A;  2WCI A;  5J9B A;  4K6X A;  3HZ4 A;  3TRX A;  2C80 A;  1AQV A;  3PGT A;  2VCZ A;  2WB9 A;  5G1K A;  2QC7 A;  4GWR A;  3C73 A;  1S3D A;  3PH9 A;  1FW1 A;  3P8W A;  2YWM A;  2ON5 A;  1GL8 A;  5AN1 A;  2VCX A;  2Z9S A;  6GSY A;  3L9V A;  5B8A A;  4BL7 A;  5LCZ A;  3G7Y A;  4PNG A;  3JCM L;  3U5R E;  1UC7 A;  2VM2 A;  4KE3 A;  3W8J A;  4F82 A;  5D73 A;  2AHE A;  2D2Z A;  3L0H A;  2XPD A;  3C1S A;  4DSS A;  3VI7 A;  3GX8 A;  4POK A;  1TRV A;  5CYY A;  5DAK A;  1H75 A;  5IMF A;  1YEP A;  3TKS E;  4ISD A;  2MBT A;  4FIW A;  3DEX A;  5ECP B;  1FVK A;  3R3E A;  3HJP A;  3VPQ A;  4WXT A;  2IFQ B;  4I2T A;  4FYC A;  5CAX A;  5ECO B;  4KGI A;  4JR6 A;  2JSZ A;  3TJJ A;  3MWH A;  1T3B A;  3EVI A;  4XIH A;  1GH2 A;  2HT9 A;  1F3A A;  2FWG A;  4KND A;  2AV4 A;  2IMK A;  3IV4 A;  4J2F A;  1Z6M A;  2GT5 A;  5D8I A;  3N5O A;  3HXS A;  4IJ3 A;  1Z7R A;  1SJZ A;  4ZIL A;  3F4R A;  3I69 A;  2A2S A;  5F8B A;  3GKX A;  1X9W B;  3ISO A;  5C00 A;  1XW5 A;  1OKD A;  5FT3 A;  3QR6 A;  1K3L A;  2E7P A;  5DJL A;  1M2D A;  3EU3 A;  2QA2 A;  2HYX A;  4V1A g;  2BTO T;  3A5W A;  1ZCP A;  3I43 A;  5G2Z A;  2GTU A;  1HNB A;  2TRX A;  5ELG A;  5IMA A;  3SWL A;  3NOF A;  2LRC A;  1DE1 A;  5INY A;  1G6Y A;  2HXK A;  18GS A;  1T8E B;  2K6V A;  2IPA A;  1ERV A;  1QK8 A;  2WFC A;  4JU5 A;  3QMX A;  1YF0 A;  2DJK A;  2IJY A;  4PXO A;  3FZ9 A;  3NZN A;  3KEB A;  1K0M A;  2YZH A;  2I9H A;  4BVX B;  3GTU A;  4CY8 A;  3FYG A;  3GUS A;  1K0D A;  2C1Y A;  5EPF A;  2X64 A;  3F6D A;  20GS A;  2DSA A;  1FAA A;  2G2Q A;  4MCU A;  1JLW A;  2DJ2 A;  2C3Q A;  2C4J A;  4ZB9 A;  1VF1 A;  3GV1 A;  3KXO A;  22GS A;  3APS A;  4G0I A;  1G6W A;  1ZGN A;  4YKG A;  5HR0 A;  4QL9 A;  3I6A A;  3V1W A;  2X4A A;  3HVX A;  1FO5 A;  1B4P A;  2HSY A;  1DE2 A;  1WPI A;  1EP8 A;  3KP8 A;  2VL3 A;  3GA4 A;  5ECN B;  1GSF A;  3KM6 A;  4ZL9 A;  3A2X A;  4ZIJ A;  5B7C A;  3HCZ A;  1EGR A;  2KP1 A;  2TRC P;  5G30 A;  1TW9 A;  2B7J A;  1EGO A;  2VO4 A;  5GAN D;  1G0T A;  2OBK A;  4EUY A;  4KF9 A;  4GQC A;  3J7Y k;  3M8N A;  3KZQ A;  5AGY A;  2YN1 A;  3E9J B;  3C8E A;  2DBC A;  2YZU A;  4ML6 A;  3GUR A;  2IIY A;  4K1F A;  2QSI A;  1GTA A;  1ZMA A;  4WET A;  3HYP A;  2F8A A;  3P90 A;  4LA1 A;  3QAW A;  1THX A;  2PN8 A;  3QFB C;  5CP1 A;  2LJK A;  1YDK A;  3F3R A;  4K2X A;  5F05 A;  5JWQ B;  1Y25 A;  3AY8 A;  2X99 A;  3FZA A;  5C04 A;  5DQS A;  4F03 A;  3KTB A;  3IAM 2;  4HZ4 A;  2I1U A;  3ZTL A;  2FA4 A;  3SBC A;  1M9B A;  2FGX A;  2VLU A;  3ERF A;  4LLR A;  1XOB A;  2ZUP A;  1WP0 A;  4ZB8 A;  1M99 A;  1XWB A;  2B5X A;  1GSD A;  2A2R A;  3QAV A;  3DYR A;  2XBI A;  4D73 A;  4RQX A;  3EWL A;  1V40 A;  2GDR A;  1N8J A;  2UZ8 A;  2VLT A;  1M7T A;  2YV9 A;  1SL0 B;  2R3X A;  1O8W A;  1X5C A;  3I9V 2;  2N5B A;  2MMO A;  4YKF A;  1SD8 A;  4IBP A;  1E6B A;  1Z9H A;  1TXX A;  4AJ6 A;  3UAP A;  2WRT A;  2KUC A;  1U6T A;  2LNT A;  4PUF C;  2HFD A;  3C7M A;  4JR4 A;  4YQV A;  1U3I A;  3VPT A;  1WIK A;  3GRX A;  4MNN A;  3ERG A;  2C8U A;  3GNJ A;  1MDK A;  4G2E A;  5CO3 A;  2WDU A;  4RI7 A;  4CHS A;  3G9B A;  2DKI A;  1WWJ A;  2GQM A;  2X49 A;  4GXZ A;  4PUA A;  3QDN A;  2FY6 A;  2OBI A;  4MK3 A;  2M72 A;  4TN8 A;  2MMN A;  3GH9 A;  5IPG A;  2ON7 A;  1BAY A;  3ZIJ A;  2H72 A;  1GP1 A;  5H5R A;  2ZNM A;  3OR5 A;  2HRK A;  2HSM A;  4GLT A;  1N2A A;  2KOK A;  11GS A;  3TKS A;  1R5A A;  2JAD A;  1AIU A;  5IMD A;  4K0G A;  2ES7 A;  3TGZ A;  3F3Q A;  3UMA A;  5ID2 A;  1A2M A;  4PQ1 A;  5G5F A;  2MYG A;  3DKS A;  2A4V A;  3KGK A;  7GSS A;  4ICY A;  1U87 A;  1ZYE A;  2NPB A;  3KIJ A;  5A5K A;  3W8S A;  2LV3 A;  1Q4J A;  4OD7 A;  4XRD A;  1FHE A;  3RPP A;  5A4V A;  2NDO A;  3HHV A;  3LXZ A;  4EVM A;  3F4T A;  2O89 A;  2OE1 A;  4ZBD A;  4MA9 A;  3TKP A;  2VUP A;  1GWC A;  5FWG A;  4MZC A;  2C0D A;  1F37 A;  3DVX A;  3KCM A;  1X9S B;  1A24 A;  2MMA A;  3LYK A;  2H6Z A;  4ZB6 A;  3KJY A;  1TRS A;  3FZ5 A;  4JRR A;  2FWH A;  4V2M A;  3DRN A;  3UBL A;  1OE8 A;  5J5N A;  2RII A;  2VCV A;  2R37 A;  2B3S A;  3H4K A;  4Z2U A;  4KX4 A;  4OMV A;  3PR8 A;  3P2A A;  4XTS A;  1GTI A;  3QCP A;  3DML A;  5ECK B;  3E3E A;  2PMT A;  4XS4 B;  4RI6 A;  4IGJ A;  2GZP A;  2H73 A;  2B7K A;  4Q5N A;  2DML A;  3ZL5 A;  2HZE B;  5F06 A;  1FVJ A;  1A23 A;  2LST A;  2K8V A;  2CX3 A;  2FD3 A;  2CAQ A;  5CRH A;  1ZOF A;  3GKM A;  4AJ8 A;  1ZYP A;  5DJM A;  5H5Q A;  3ZML A;  5HQP A;  3GST A;  3F0I A;  1YKC A;  2VL2 C;  1SJ6 A;  1QFN A;  4TR1 B;  1SK2 A;  2VLV A;  2PER A;  1Z7P A;  4IEL A;  1THO A;  4O92 A;  2IFQ A;  4NV2 A;  3DVW A;  3ZMK A;  3IOS A;  4OCE A;  5AIS A;  1GTB A;  1WJK A;  5G5E A;  2WZ9 A;  1XFL A;  1JFU A;  1VF2 A;  3RBT A;  5B6N A;  2H6X A;  5DAL A;  4K5S A;  4XS1 A;  3EUR A;  2B5E A;  4ZBB A;  2NVL A;  3BD2 A;  1GUM A;  4YAV A;  1KTE A;  3WD6 A;  1H4O A;  3RPN A;  3P7X A;  4I6X A;  4L5O A;  4CW9 A;  5DCG A;  1GRX A;  2RLI A;  3TJG A;  5D96 A;  2HSH A;  1BX9 A;  2I81 A;  2AAW A;  3Q6O A;  4JE1 A;  2IWT A;  2O87 A;  5ABR A;  5HR3 A;  1TU8 A;  2JZS A;  3A2V A;  3TKR A;  2WS2 A;  1AQX A;  2YWI A;  3LQ7 A;  5D9T A;  2VIM A;  2B6M A;  2C3N A;  3ZYW A;  4NMU A;  4GF0 A;  4WF5 A;  4JBB A;  3TOU A;  4WR4 A;  6GSX A;  1ON4 A;  4OFT A;  2DMM A;  2NTO A;  3GHA A;  4AGS A;  3Q18 A;  2H1A A;  4K8M A;  1PX6 A;  5KN3 A;  3CSJ A;  1PMT A;  3RAZ A;  3TUE A;  4K7I A;  4K2D A;  3HDC A;  3IHQ A;  1UN2 A;  1A8L A;  4BL7 B;  2OAD A;  3UVT A;  4KDU A;  5DQY A;  1S3A A;  5H5S A;  4WBR D;  1B9X C;  2R4V A;  1MDJ A;  2GS3 A;  4K7N A;  2IME A;  1PKW A;  2IMD A;  4E8E A;  1E2Y A;  2YP6 A;  2FLS A;  1TK8 B;  3CYN A;  3L78 A;  4YAP A;  2CV4 A;  4Z2R A;  2C3T A;  3IRA A;  5A4U A;  5FHI A;  5IO0 A;  2X8H A;  1TRW A;  2F8F A;  3LEF A;  5EL8 A;  5J41 A;  1RK4 A;  2XC2 A;  2AJQ B;  1O85 A;  4ECJ A;  2BMX A;  2YV7 A;  2L5O A;  4EIQ A;  2O85 A;  1PL2 A;  2GGT A;  3TRQ A;  2XHF A;  5JWR B;  1AXD A;  3ERW A;  3TDG A;  1X0R A;  1ERW A;  1MDI A;  4O7H A;  3HJM A;  1DUG A;  2DJ0 A;  3VK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...