2VLVA

Crystal structure of barley thioredoxin h isoform 2 in partially radiation-reduced state
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
111
structure length
111
Chain Sequence
b'AEVISVHSLEQWTMQIEEANTAKKLVVIDFTASWCGPCRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN H ISOFORM 2.
publication title Crystal Structures of Barley Thioredoxin H Isoforms Hvtrxh1 and Hvtrxh2 Reveal Features Involved in Protein Recognition and Possibly in Discriminating the Isoform Specificity.
pubmed doi rcsb
source organism Hordeum vulgare var. distichum
molecule tags Oxidoreductase
total genus 33
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vlvA01
3ZFBA 4PURA 2NPBA 4V1Ap 2PVQA 3DYRA 2OBKA 3F4TA 3L0HA 3RHBA 1RW1A 1I5GA 3KTLA 10GSA 1SL2B 1EZKA 4JRRA 1FO5A 5KEJA 1O6JA 2I4AA 1VRSD 1M0UA 2N5BA 4GSSA 3QCPA 4ZXGA 1OE8A 1XPVA 3R2QA 1F3AA 1B8XA 2LRCA 1TK0B 3L9SA 1Z6MA 5AIVA 5KN0A 3TKSA 2YWOA 2V32A 4FYBA 2L57A 1LU4A 3E9JB 4PUAA 4L5LA 1GSQA 1PGTA 2WULA 5AGYA 1HNAA 3KIJA 1JFUA 3VWUA 2CA8A 2GLRA 1XW6A 5J4UA 4JEDA 4V2MA 4ECJA 5GAPD 4MZBA 1J0FA 6GSWA 2VL3A 1SK0A 3VI7A 5G30A 2RUEA 3O76A 2GZYA 4OFMA 5ENUA 4MJEA 1QK8A 2IN3A 1UN2A 4GWRA 3C1SA 1ST9A 4XCSA 1R5AA 1BQ7A 4POMA 2VM2A 3GHAA 2E0QA 2DMMA 3BJ5A 1GRXA 1OC3A 3GURA 3A2WA 4EDZA 1JZOA 1M2DA 2FHEA 1XVWA 4IGJA 1SYRA 2CVBA 4J57E 4LMWA 3QR6A 2A4VA 1EGRA 4PQIA 2QGVA 2WGRA 1U3IA 2LV3A 2LQOA 2O85A 4J56E 1AC1A 2V41A 2H73A 1Z7RA 2B6MA 2H76A 1WRYA 1SU9A 2EIRA 4KSMA 3I69A 5HR0A 2OACA 8GSSA 3KTBA 1URMA 2J23A 3F8UA 4MJAA 1XIYA 3ZITA 2JL4A 2GSSA 3UBLA 1YKCA 4MZWA 5DALA 2NDOA 5D9TA 2WZ9A 1WMJA 4MF5A 4N10A 2C0DA 1M2AA 2OE1A 3QD9A 1EV9A 4ZBBA 4MPGA 1K0MA 1XOBA 2TRXA 2YP6A 4MJCA 3QAWA 4HQSA 2WJUA 4LMVA 2F9SA 3P7XA 1XXUA 1PL1A 2BTOT 2XPEA 1TRWA 4G19A 5IQYA 2CQ9A 4NMUA 3APOA 2O89A 3IV4A 5HFIA 4F9ZA 2VUPA 4PNGA 1B9YC 4WKWA 3GTUB 4K9ZA 3D5JA 1XWGA 3LFLA 3N5OA 2H01A 2ZUPA 1TK5B 1PA3A 5J9BA 3DGQA 4FYUA 4IQAA 4K2DA 2ZCTA 1HYUA 2P0GA 2B5EA 1OC9B 1VF4A 1N2AA 3PGTA 2LTKA 1ERWA 4TR1B 5B6MA 3ME8A 2P5RA 3F6DA 2DLXA 3KMOA 3APQA 4OWYA 3KXOA 2A2SA 1XFLA 4F0BA 1G6YA 3F3RA 1K3YA 4EDYA 4ZL8A 5B8AA 5ECHB 4OO4A 3IAM2 5CREA 4POLA 1Y25A 1ACVA 5EVOA 4XTSA 3IE3A 3M9JA 2WS2A 4NV2A 2XBQA 1U88A 4IP6A 4WBJA 5F8BA 1KEBA 4AJ7A 4IW9A 4DVCA 3TOTA 2GVPA 1DE2A 4POKA 4LL1B 5DVBA 2GSRA 3ZL5A 3ZVJD 4L0WA 4IP1A 3RBTA 5IMDA 1SKWB 1KTEA 2CZ3A 1G7OA 4KUNA 4LA1A 4OD7A 4D73A 3ZRDA 1S3AA 5IMVA 2FA4A 2DJ2A 2AJQB 2VCXA 5CO3A 2JADA 4OFNA 2WFCA 4IQ1A 3E3EA 4WETA 1SD8A 1M99A 3L4NA 3HDCA 3F3QA 5DCGA 3MNGA 1OC8A 3D4TA 2H70A 4IVFA 2H66A 2ON5A 3D6IA 4V1Ag 3VWVA 1EP8A 12GSA 3LYKA 4AJ6A 1BYEA 1TI3A 1JLWA 5ECMB 1B4PA 4PNFA 5ECQB 2PWJA 3APSA 4GF0A 3LORA 2KOKA 4ZL7A 4GLTA 2C0GA 2M80A 5ECKB 1VGLA 1U6TA 3ISOA 1X5DA 4KB3A 3RAZA 3H8QA 2YNXA 4EVMA 1GSUA 3A2VA 3MWHA 2GQMA 3F9UA 4V2NA 4EO3A 2K8VA 3TJFA 3GKKA 3WGDA 1GLQA 4XHMA 5GSTA 4DSSB 2H75A 4V2LA 4N11A 2ZNMA 2RLIA 1ZOFA 2H6XA 5J3RA 3HJMA 4X43A 1OKTA 3O6TA 1GTUA 2MMAA 1MDKA 1ZCPA 2LRTA 2X8GA 1OKDA 3ZMKA 2VD1A 2F3MA 2LKUA 3QMXA 3ERGA 3IR4A 4Q5RA 1F3BA 2HXKA 3GKNA 4ID0A 2E2MA 2C4JA 5AN1A 3V1WA 5ID2B 1A2LA 3VK9A 1DE1A 4X1UA 1K0NA 5G31A 2D2ZA 2MBTA 5IO0A 2V1MA 1GSFA 4ZIJA 3Q19A 2YV9A 1WPIA 3HYPA 3KZQA 1MTCA 2LS5A 3G7YA 2BMXA 1GUKA 2CAIA 4QQ7A 3PINA 2KLXA 2GGTA 3EURA 3IOSA 3KCMA 4KNDA 4WR4A 4DSQA 2JZTA 4MK3A 3F0IA 3P90A 5IOWA 4LLRA 1J9BA 5JWQB 5ECLB 3ZZXA 2RIIA 1G6WA 1O8XA 4RI7A 2WDUA 1O73A 3QDNA 4O32A 1RQMA 3HKRA 2LNTA 3LSZA 5AISA 2FWGA 5IIZA 2V6OA 5HR2A 4XIHA 5E59A 3GTUA 3EMXA 4CW9A 1AXDA 3L9VA 4ML1A 3DKSA 3ZREA 3UVTA 4KAEA 3GMFA 3I6AA 1AQXA 3LQ7A 2VCZA 1AIUA 3DIEA 3HXSA 5E4WA 5IPGA 3KMNA 3WD6A 2EIOA 2VO4A 4TR1A 5IM9A 1F6MC 5GAND 2IJYA 4TOPA 1K0CA 2GZPA 1AAZA 2JSYA 2N5AA 1TU7A 3D22A 2H19A 1SYXA 4KDYA 1FW1A 3J7Yk 3D0ZA 3EWLA 3DMLA 2OJLA 2JU5A 3K8NA 4POBA 1NW2A 5DAKB 1LJRA 3M0FA 1K0DA 2I9HA 3A5WA 3D21A 4DSRA 2R6KA 1VF2A 1WOUA 3TKSC 22GSA 1T4ZA 1YQ1A 2R37A 2WCIA 2H1GA 2PBJA 3F4SA 2IMDA 2REMA 4MF7A 1HNCA 2L59A 1A0RP 3KM6A 2M72A 2DJJA 2RM5A 2C3QA 1BAYA 2H1BA 1R7HA 3BBYA 4OO5A 2MMOA 1OVNA 2FGXA 4ISDA 1FHEA 4BVXA 3WGXA 4MMMA 2H6ZA 2GSTA 3GKXA 3DVXA 2H0HA 1T7PB 2K9FA 2AHEA 2C0FA 1XW9A 3HCZA 3TRQA 1WWJA 1NSWA 3WT2A 1PMTA 2HFDA 2C3TA 2AUVA 1XCCA 4K7NA 2AV4A 2C1YA 1GSSA 1ZYEA 2I1UA 4F2IA 5G1LA 3FZ5A 3IBHA 1PX6A 3GSTA 2DBCA 1Z9HA 3TUEA 4F0CA 9GSSA 2WB9A 4WXTA 3S9FA 2TIRA 3UAPA 2FLSA 3VPTA 3FKFA 3VFIA 3SWLA 4TKYA 1R26A 3ZIVA 2GTUA 3DXBA 4I2UA 2R5GA 3EC3A 3ZFLA 2H71A 2LSTA 3DRNA 2GSQA 4TXOB 2MZCA 2PN8A 1ILOA 3DD3A 4HUAA 1EWXA 2TRCP 2L4QA 1XVQA 1Z6NA 2AAWA 2H0IA 1VF1A 5GSSA 2FNOA 2Z9SA 1U87A 1V2AA 2XHFA 1EGOA 2VD0A 3FW2A 2G2QA 1JZWA 1USBA 3TGZA 5EL8A 17GSA 4FIWA 4XS4B 3EINA 1MD3A 1XWCA 1ZMAA 6GSUA 1A8YA 2VOCA 1F2EA 5G5FA 2CV4A 2YN1A 2DIZA 4KDUA 1Z5YE 2MMNA 1THXA 3UVHA 2HZFA 1TDIA 3RPNA 1O7UA 2H8LA 2RUFA 3IA1A 5LNKe 4MZCA 2OADA 2QSIA 3FR3A 4WR5A 2LJAA 3C1RA 4EE0A 2FD3A 4QL7A 2LQQA 2QC7A 3VPQA 3GYKA 4K7OA 4ACSA 4KGIA 3KGKA 1T8EB 1YEXA 1QGVA 4HZ2A 3C71A 3GKMA 4BA7A 1BG5A 2LUSA 1X9SB 4GSTA 1N8JA 2F51A 3FR6A 2HYXA 4HJMA 5LD0A 1TJDA 2L5OA 16GSA 4KDXA 1A23A 5J41A 3SBCA 3EVIA 2VLVA 2CAQA 4RQXA 1X5CA 2AB6A 4KW6A 1TP9A 1Z7PA 1TKDB 1FB6A 1K3OA 4NXIA 1SKRB 2LEGA 3KD0A 5CRHA 1MEKA 4O5RA 2H1DA 2PERA 3GL3A 1GSYA 1SD9A 4TR4A 3TJJA 2K6VA 3HY2A 3GUSA 2VM1A 1GSEA 3U6VA 3H4KA 3MSZA 2EIQA 2VL2A 3FRCA 5H5QA 2YCDA 1XZOA 1YDKA 3ZMLA 2VL9A 3C73A 1E2YA 2CT6A 2FY6A 2CVDA 5ECSA 4MDCA 3LG6A 1QMVA 1TK8B 5D96A 3JCML 5A4VA 3M1GA 4GQFA 2PPTA 2QKEA 1PRXA 4OCFA 1ERVA 1V9WA 3CSJA 4YAPA 1EV4A 2YJHA 3HVXA 4HI7A 5F05A 4ZB6A 2HSHA 3I9V2 2F8AA 4EUYA 2FWEA 1XWBA 5C00A 3E0UA 1SL1B 5IPHA 5DDLA 1OE7A 6GSXA 4YQUA 2HE3A 3M9KA 3BCIA 3TKQA 5G1KA 1DSBA 4TW5A 5CYYA 1GH2A 4O92A 1XBSA 5FWGA 3GNJA 4E8EA 1A24A 2IFQB 1SKSB 4PUFC 2CZ2A 3TRXA 3EYTA 2H30A 4HEA2 2X99A 5ECRB 3ERFA 3CBUA 1DBYA 3FY7A 5C04A 1E6BA 3TKSE 5B7CA 4MP4A 5HR1A 5CRDA 3TJBA 3A3TA 4TR3A 1TW9A 6GSTA 1GTBA 4G9HA 3IHQA 4GQCA 4CDOA 1ZGNA 3ZTLA 1XWKA 4JBBA 3DEXA 3GN3A 1TI1A 11GSA 2C0EA 2L6CA 4XRAA 1ABAA 5A4WA 3QOUA 4RQRA 1YKAA 3CTGA 1TRUA 2PUKC 1GUMA 4N0ZA 4I6XA 2B5XA 3ME7A 4K6XA 1OAZA 3D4MA 2R4VA 1BJXA 1YF1A 3AY8A 4ZBDA 3VWWA 1SL0B 4TXOA 2PVOC 5L71A 3UL3A 2JZRA 1KNGA 2L4CA 2IL3A 5ELGA 1TOFA 1IYHA 4J2FA 2MMZA 3CRUA 5FT3A 2M46A 2C3NA 2YZUA 4N30A 2YWIA 1GTIA 1SK1A 2B7JA 1WJKA 3I43A 5IMCA 6GSVA 2VCVA 2YV7A 1S3DA 1Q4JA 19GSA 2IPAA 3KH7A 1WIKA 13GSA 2DJ3A 3FR9A 4K1FA 3M3MA 5GZZB 1WP0A 2DJ0A 1AUCA 3CXGA 5AIXA 2H1AA 1C72A 5G2ZA 2VIMA 4L5OA 4KE3A 4PQ1A 4KA0A 4XS4A 4HS1A 5DCHA 2IMFA 1RK4A 4NAXA 1YJ6A 3GV1A 3HVSA 2K18A 1PN9A 1Z3EA 2FWHA 2JZSA 4JU5A 1VF3A 1T3BA 1ZZYA 3TJGA 4IJ3A 2CX3A 4XRDA 2HNLA 1O85A 1PKZA 3HD5A 1V40A 4NHWA 1QXHA 3LWAA 4PXOA 2PU9C 2H74A 2OE3A 1FG4A 3ERWA 1H4OA 3BD2A 1O81A 2DJKA 3FHKA 1OC9A 2GT5A 1M9BA 5F06A 1EOHA 2I3YA 3UEMA 5HFKA 1S3CA 4BWSA 3GIXA 2YZHA 4HU7A 2YWNA 3GFKA 3HHVA 5INYA 1GULA 1ZL9A 3DVWA 2HT9A 3GA4A 3EE2A 1SJZA 1PQNA 5DQYA 1FVJA 2LJRA 5ECIB 2HZEB 4GSNA 3EU4A 1QUWA 2FUG2 4YQMA 1TRVA 5CNWA 3GH9A 1B48A 2BJXA 3PH9A 1V57A 3P8WA 1TRSA 3H79A 3HJPA 1B4QA 4JZQA 2K8SA 5ABRA 4ILFA 1FOVA 1Y6EA 1AQWA 3QAVA 3UIWA 3TRPA 1HNBA 1G7EA 1FB0A 1B9XC 2DSAA 5DJMA 18GSA 1ON4A 1WE0A 3HJOA 4RI6A 4HDEA 2HRFA 1ML6A 5HQPA 3VURA 3UARA 4E8HA 3ZVJA 1GP1A 4NPBA 1GTAA 2XPDA 2X8HA 3TOUA 2VCWA 2FWFA 3FEUA 1AW9A 3MDKA 4RUVA 5B6NA 2RM6A 2GDRA 2VLUA 1YY7A 3IC4A 3BCKA 4MH3A 3UMAA 3LEFA 4ML6A 1ERTA 1J08A 3U5RE 4MABA 3WYWA 1BX9A 2KHPA 4K8MA 2B1KA 1TXXA 4L8EA 1GNEA 5H5SA 1R4WA 3KP8A 4JR6A 2VLTA 4I8BA 4PGTA 4QL9A 2AYTA 3CRTA 4EL1A 5HR3A 2B1LA 3LXZA 2MBSA 1HD2A 1A2JA 4TRXA 3ZIJA 2IWTA 1O8WA 2YOIA 2LRNA 4PQHA 4WEYA 2V6KA 4WF5A 2VCTA 2IFQA 3G7JA 3GX8A 1YZXA 2V2GA 2X64A 1EEJA 5ECOB 1PKWA 3WT1A 3GX0A 3FYGA 3L9UA 4DSSA 4BWQA 2OKAA 4Q5QA 3IAS2 2FA8A 1THOA 1X5EA 3TCOA 1XWAA 4ULXA 1A8LA 3VLNA 1T00A 4HZ4A 1FAAA 3F4RA 3QAGA 1H75A 6GSYA 3DWVA 4WF4A 4IELA 5B8BA 1BEDA 1PL2A 3RHCA 1PX7A 2ES7A 5ID2A 4IJIA 2XC2A 1U3AA 4MJBA 2R2JA 4ECBA 3CMIA 7GSSA 2CX4A 2DIYA 4EC0A 5D73A 1A2MA 4MLYA 2C80A 3TJKA 4DEJA 2IIYA 1F37A 4K0GA 1IYIA 4EXJA 4EF0A 3CTFA 4XS1A 1PD21 5JWRB 1K0BA 3UJ1A 2O7KA 3H1NA 4GRFA 3KEBA 3EU3A 2F8FA 1GWCA 2P31A 4NV5A 1Q98A 5D9WA 3ED3A 1GUHA 1ERUA 2J9HA 3LXTA 1NM3A 5IMZA 3FK8A 3W8JA 4MPFA 2GQLA 5J5NA 2VL2C 1MDIA 5CRWA 2YWMA 2OBIA 3GSSA 4JR4A 4ECCA 2PMTA 1EOGA 1X9WB 2YPMA 1M2BA 5D8IA 3M8NA 5LCZA 1YF0A 1JLVA 1LBKA 4GXZA 1CQHA 1SJIA 3GH6A 3FZ9A 5DJLA 2ON7A 3IRAA 4IS0A 5IO2A 2I81A 3LGCA 1SENA 4K7IA 5CP1A 1JHBA 3IPZA 3GRXA 3HA9A 1T1VA 4HJ2A 1EP7A 3Q18A 3KJYA 3GL5A 4KH7A 2A2RA 1M7TA 5CAXA 3NIVA 3US3A 3QFBC 4TXVA 1M9AA 4TN8A 4BVYA 1ZYQB 3J7Yb 1X0RA 2B7KA 2O87A 2H0GA 2P5QA 1SJ6A 1JZDA 1GSDA 4KCEA 2HZEA 4OCEA 5EPFA 2H72A 5H5RA 3BOAA 3TB2A 5DAKA 2B5YA 2IMIA 1KBNA 1DUGA 3NOFA 3EMPA 1X9MB 1G0TA 4I97A 5KN1A 1MDJA 2IMKA 3TKRA 2MYGA 2KUCA 3Q6OA 3W8SA 2HI7A 3C8EA 3PR8A 1NHYA 4ZBAA 2L5LA 4ECIA 3VI5A 3RDWA 4LL4B 4JE1A 5ECNB 3KP9A 1SK2A 3IDVA 2LNSA 4O7HA 2H6YA 2GS3A 4OFTA 1PSQA 3IK9A 1MD4A 2LJKA 5JCWA 1W4VA 2YJ7A 2NBSA 3UOMA 5ECPB 14GSA 4YH2A 1TTZA 4GTUA 4BL7A 1XW5A 1GNWA 5JWOB 4Z7XA 2YANA 5D9XA 4ZL9A 4FYCA 4ZB8A 1GLPA 2L6DA 2DJ1A 3P2AA 4TVEA 2KP1A 4I5QA 2WRTA 3FZ4A 2EC4A 4F82A 4P3YB 4ZILA 5J9CA 5DQSA 5D9VA 2FCHA 2GQKA 4AF2A 3F63A 3IK7A 1JZRA 2VCQA 4Q5FA 5JCUA 4CHSA 2OA7A 1T4YA 5JCGA 2NTOA 3QFAC 1CQGA 2PGTA 20GSA 1HQOA 1V58A 1TU8A 3HZ4A 4IBPA 5DALB 2JACA 4IKHA 3H93A 4WBRD 3VWXA 3NZNA 4MF6A 2HRNA 3C7MA 4FH8A 5A4UA 3F6FA 2E7PA 4N0VA 2DMLA 3LYPA 4YAVA 2G0FA 3HVVA 5HFGA 2B3SA 1I9DA 3CSIA 4G2EA 4YQVA 5KN3A 3LJRA 2IMEA 4H86A 4AGSA 4FO5A 4AJ8A 2JSZA 3FZAA 3CYNA 1W89A 2DC5A 1AQVA 5IMFA 4PX1A 6GSSA 1R5PA 1F9MA 1UA5A 4KX4A 4ZB9A 1XOAA 3Q74A 4NWYA 2NVLA 3KH9A 3W6GA 4Q5NA 4F03A 4MCUA 4HU9A 1V98A 4HOJA 2CVKA 3A2XA 3G7IA 3TKPA 5G5EA 2C8UA 1NHOA 1YEPA 2O8VB 1UC7A 4TR0A 4HQZA 1K0AA 2KP2A 1QFNA 3G9BA 4BPYA 2R3XA 1OYJA 4G10A 1GL8A 5DBQA 3RPPA 4EKZA 3MAKA 3CSHA 4KCAA 5CRGA 4IN0A 4MH2A 1UVZA 5A5KA 4K0NA 4KSOA 2X8CA 4XS6A 5D93A 3WGEA 2OE0A 1A0FA 1EEMA 2GT6A 4I2TA 2HSYA 3ZLPA 5IOXA 1K0OA 1FVKA 2N5FA 2VAFA 5F07A 4GCIA 3O3TA 3UBKA 3N9JA 2GZZA 3QPMA 3IXRA 4MA9A 5FHIA 3HZ8A 5IMAA 3ZYWA 5ELAA 4X0XA 5EY6A 3L78A 5COHA 2XBIA 2E2GA 4NHZA 1QQ2A 4D73B 4L0UA 4OMVA 5F0GA 3TDGA 4IHUA 1K3LA 2HLSA 3OR5A 2ALBA 5KN2A
chains in the Genus database with same CATH superfamily
3ZFBA 4PURA 2NPBA 4V1Ap 2PVQA 3DYRA 2OBKA 3F4TA 3L0HA 3RHBA 1RW1A 4Z2UA 1I5GA 3KTLA 10GSA 1SL2B 1EZKA 4JRRA 1FO5A 5KEJA 1O6JA 2I4AA 1VRSD 1M0UA 2N5BA 4GSSA 3QCPA 4ZXGA 1OE8A 1XPVA 3R2QA 1F3AA 1B8XA 2LRCA 1TK0B 3L9SA 1Z6MA 5AIVA 5KN0A 3TKSA 2YWOA 2V32A 4FYBA 2L57A 1LU4A 3E9JB 4PUAA 4L5LA 1GSQA 1PGTA 2WULA 5AGYA 1HNAA 3KIJA 1JFUA 3VWUA 2CA8A 2GLRA 1XW6A 5J4UA 4JEDA 4V2MA 4ECJA 5GAPD 4MZBA 1J0FA 6GSWA 2VL3A 1SK0A 3VI7A 5G30A 2RUEA 3O76A 2GZYA 4OFMA 4YKGA 5ENUA 4MJEA 1QK8A 2IN3A 1UN2A 4GWRA 3C1SA 1ST9A 4XCSA 1R5AA 1BQ7A 4POMA 2VM2A 3GHAA 2E0QA 2DMMA 3BJ5A 1GRXA 1OC3A 3GURA 3A2WA 4EDZA 1JZOA 1M2DA 2A4HA 2FHEA 1XVWA 4IGJA 4EIQA 1SYRA 2CVBA 4J57E 4LMWA 3QR6A 2A4VA 1EGRA 4PQIA 2QGVA 2WGRA 1U3IA 2LV3A 2LQOA 2O85A 4J56E 1AC1A 2V41A 2H73A 1Z7RA 2B6MA 2H76A 1WRYA 1SU9A 2EIRA 4KSMA 3I69A 5HR0A 2OACA 8GSSA 3KTBA 1URMA 2J23A 3F8UA 4MJAA 1XIYA 3ZITA 2JL4A 2GSSA 3UBLA 1YKCA 4MZWA 5DALA 2NDOA 5D9TA 3FMWA 2WZ9A 4PTSA 1WMJA 4MF5A 4N10A 2C0DA 1M2AA 2OE1A 3QD9A 1EV9A 4ZBBA 4MPGA 1K0MA 1XOBA 2TRXA 2YP6A 4MJCA 3QAWA 4HQSA 2WJUA 4LMVA 2F9SA 3P7XA 1XXUA 1PL1A 2BTOT 2XPEA 1FOHA 1TRWA 5BRTA 4G19A 4A5PA 5IQYA 2CQ9A 4NMUA 3APOA 2O89A 3IV4A 5HFIA 4F9ZA 2VUPA 4PNGA 1B9YC 4WKWA 3GTUB 4K9ZA 3D5JA 1XWGA 3LFLA 3N5OA 2H01A 4USSA 2ZUPA 1TK5B 1PA3A 5J9BA 3DGQA 4FYUA 4IQAA 4K2DA 2ZCTA 1HYUA 2P0GA 2B5EA 1OC9B 1VF4A 1N2AA 3PGTA 2LTKA 1ERWA 4TR1B 5B6MA 3ME8A 2P5RA 3F6DA 2DLXA 3KMOA 3APQA 4OWYA 3KXOA 2A2SA 1XFLA 4F0BA 1G6YA 3F3RA 1K3YA 4EDYA 4ZL8A 5B8AA 5ECHB 4OO4A 4MNNA 3IAM2 3IC8A 5CREA 4POLA 1Y25A 1ACVA 5EVOA 4XTSA 3IE3A 3M9JA 2WS2A 4NV2A 2XBQA 1U88A 4IP6A 4WBJA 5F8BA 1KEBA 4AJ7A 4IW9A 4DVCA 3TOTA 2GVPA 1DE2A 4POKA 2A2PA 4LL1B 5DVBA 2GSRA 3ZL5A 3ZVJD 4L0WA 2X4AA 4IP1A 3RBTA 5IMDA 1SKWB 1KTEA 2CZ3A 1G7OA 4KUNA 4LA1A 4OD7A 4D73A 4G0IA 3ZRDA 1S3AA 5IMVA 2FA4A 2DJ2A 2AJQB 2VCXA 5CO3A 2JADA 4OFNA 2WFCA 4IQ1A 3E3EA 4WETA 1SD8A 1M99A 3L4NA 3HDCA 3F3QA 5DCGA 3MNGA 1OC8A 3D4TA 2H70A 4IVFA 2H66A 2ON5A 3D6IA 4V1Ag 3VWVA 1EP8A 4K2XA 12GSA 3LYKA 4AJ6A 1BYEA 1TI3A 1JLWA 5ECMB 1B4PA 4PNFA 5ECQB 2PWJA 3APSA 4GF0A 3LORA 2KOKA 4ZL7A 4GLTA 2C0GA 2M80A 5ECKB 1VGLA 1U6TA 3ISOA 1X5DA 4KB3A 3RAZA 3H8QA 2YNXA 4EVMA 1GSUA 3A2VA 3MWHA 2GQMA 3F9UA 4V2NA 4EO3A 2K8VA 3TJFA 3GKKA 3WGDA 1GLQA 4XHMA 1PN0A 5GSTA 4DSSB 2H75A 4V2LA 4N11A 2ZNMA 2RLIA 1ZOFA 2H6XA 5J3RA 3HJMA 4X43A 1OKTA 3O6TA 1GTUA 2MMAA 2R0CA 1MDKA 1ZCPA 2LRTA 2X8GA 2QA2A 1OKDA 3ZMKA 2VD1A 2F3MA 2LKUA 3QMXA 3ERGA 3IR4A 4Q5RA 1F3BA 2HXKA 3GKNA 4ID0A 2E2MA 2C4JA 5AN1A 3V1WA 5ID2B 4EIPA 2HSMA 1A2LA 3VK9A 1DE1A 4X1UA 1K0NA 5G31A 2D2ZA 2MBTA 5IO0A 2V1MA 1GSFA 4ZIJA 3Q19A 2YV9A 1WPIA 3HYPA 3KZQA 1MTCA 2LS5A 3G7YA 2BMXA 1GUKA 2CAIA 4QQ7A 3PINA 2KLXA 2GGTA 3EURA 3IOSA 3KCMA 4KNDA 4WR4A 4DSQA 2JZTA 4MK3A 3F0IA 3P90A 5IOWA 4LLRA 1J9BA 5JWQB 5ECLB 3ZZXA 2RIIA 1G6WA 1O8XA 4RI7A 2WDUA 1O73A 3QDNA 4O32A 1RQMA 3HKRA 2LNTA 3LSZA 5AISA 2FWGA 5IIZA 2V6OA 5HR2A 4XIHA 5E59A 3GTUA 3EMXA 4CW9A 1AXDA 3L9VA 4ML1A 3DKSA 3ZREA 3UVTA 4KAEA 3GMFA 3I6AA 1AQXA 3LQ7A 4FQUA 2VCZA 1AIUA 3DIEA 3HXSA 5E4WA 5IPGA 3KMNA 3WD6A 2EIOA 2VO4A 4TR1A 5IM9A 1F6MC 5GAND 2IJYA 4TOPA 1K0CA 2GZPA 1AAZA 2JSYA 2N5AA 1TU7A 3D22A 2H19A 1SYXA 4KDYA 1FW1A 3J7Yk 3D0ZA 3EWLA 3DMLA 2OJLA 2JU5A 3K8NA 4POBA 1NW2A 5DAKB 1LJRA 3M0FA 1K0DA 2I9HA 3A5WA 3D21A 4DSRA 2R6KA 1VF2A 1WOUA 3TKSC 22GSA 1T4ZA 1YQ1A 2R37A 2WCIA 4ICYA 2H1GA 2PBJA 3F4SA 2IMDA 2REMA 4MF7A 1HNCA 2L59A 1A0RP 3KM6A 2M72A 2DJJA 2RM5A 2C3QA 1BAYA 2H1BA 1R7HA 3BBYA 4OO5A 2MMOA 1OVNA 2FGXA 4ISDA 4O5QA 1FHEA 4BVXA 3WGXA 4MMMA 2H6ZA 2GSTA 3GKXA 2DKHA 3DVXA 2H0HA 1T7PB 2K9FA 2AHEA 2C0FA 1XW9A 3HCZA 3TRQA 1WWJA 1NSWA 3WT2A 1PMTA 4CY8A 2HFDA 4YKFA 2C3TA 2AUVA 1XCCA 4K7NA 2AV4A 2C1YA 1GSSA 1ZYEA 2I1UA 4F2IA 5G1LA 3FZ5A 3IBHA 1PX6A 3GSTA 2DBCA 1Z9HA 3TUEA 4F0CA 9GSSA 2WB9A 4WXTA 3S9FA 2TIRA 3UAPA 2FLSA 3VPTA 3A5IA 3FKFA 3VFIA 3SWLA 4TKYA 1R26A 3ZIVA 2GTUA 3DXBA 4I2UA 2R5GA 3EC3A 3ZFLA 2H71A 2LSTA 3DRNA 2GSQA 4TXOB 2MZCA 2PN8A 1ILOA 3DD3A 4HUAA 1EWXA 2TRCP 2L4QA 3CQFA 1XVQA 1Z6NA 2AAWA 2H0IA 1VF1A 5GSSA 2FNOA 2Z9SA 1U87A 1V2AA 2XHFA 1EGOA 2VD0A 3FW2A 2G2QA 1JZWA 1USBA 3TGZA 5EL8A 17GSA 4FIWA 4XS4B 3EINA 1MD3A 1XWCA 1ZMAA 6GSUA 1A8YA 2VOCA 1F2EA 5G5FA 2CV4A 2YN1A 2DIZA 4KDUA 1Z5YE 2MMNA 1THXA 3UVHA 2HZFA 1TDIA 3RPNA 1O7UA 2H8LA 2RUFA 3IA1A 5LNKe 4MZCA 2OADA 2QSIA 3FR3A 4WR5A 2LJAA 3C1RA 4EE0A 2FD3A 4QL7A 2LQQA 2QC7A 3VPQA 3GYKA 4K7OA 4ACSA 4KGIA 3KGKA 1T8EB 1YEXA 1QGVA 4HZ2A 3C71A 3GKMA 4BA7A 1BG5A 2LUSA 1X9SB 4GSTA 1N8JA 2F51A 4CY6A 3FR6A 2HYXA 4HJMA 5LD0A 1TJDA 2L5OA 16GSA 4KDXA 1A23A 5J41A 3SBCA 3EVIA 2VLVA 4X4JA 2CAQA 2HRAA 4RQXA 1X5CA 2AB6A 4KW6A 1TP9A 1Z7PA 1TKDB 1FB6A 1K3OA 4NXIA 1SKRB 2LEGA 3KD0A 5CRHA 3R3EA 1MEKA 4O5RA 1M3JA 2H1DA 2PERA 3GL3A 1GSYA 1SD9A 4TR4A 3TJJA 2K6VA 3HY2A 3GUSA 2VM1A 1GSEA 3U6VA 3H4KA 3MSZA 2EIQA 2VL2A 3FRCA 5H5QA 2YCDA 1XZOA 1YDKA 3ZMLA 2VL9A 3C73A 1E2YA 2CT6A 2FY6A 2CVDA 5ECSA 4MDCA 3LG6A 1XG8A 1QMVA 1TK8B 5D96A 3JCML 5A4VA 5KOWA 3M1GA 4GQFA 2PPTA 2QKEA 1PRXA 4OCFA 1ERVA 1V9WA 3CSJA 4YAPA 1EV4A 2YJHA 3HVXA 4HI7A 5F05A 4ZB6A 2HSHA 3I9V2 2F8AA 4EUYA 2FWEA 1XWBA 5C00A 3E0UA 1SL1B 5IPHA 5DDLA 2HRKA 1OE7A 6GSXA 4YQUA 2R0GA 2HE3A 3M9KA 3BCIA 3LW9A 3TKQA 5G1KA 1DSBA 4TW5A 5CYYA 1GH2A 4O92A 1XBSA 5FWGA 3GNJA 4E8EA 1A24A 2IFQB 1SKSB 4PUFC 2CZ2A 3TRXA 3EYTA 2H30A 4HEA2 2X99A 5ECRB 3ERFA 3CBUA 1DBYA 3FY7A 5C04A 1E6BA 3TKSE 5B7CA 4MP4A 5HR1A 5CRDA 3TJBA 3A3TA 4TR3A 1TW9A 6GSTA 1GTBA 4G9HA 3IHQA 4GQCA 4CDOA 1ZGNA 3ZTLA 1XWKA 4JBBA 3DEXA 3GN3A 1TI1A 11GSA 2C0EA 2L6CA 4XRAA 1ABAA 2DKIA 5A4WA 3QOUA 4RQRA 1YKAA 3CTGA 1TRUA 3PPUA 2PUKC 1GUMA 4N0ZA 4I6XA 2B5XA 3ME7A 4K6XA 1OAZA 3D4MA 2R4VA 1BJXA 1YF1A 3AY8A 4ZBDA 3VWWA 1SL0B 4TXOA 2PVOC 5L71A 3UL3A 2JZRA 1KNGA 2L4CA 2IL3A 5ELGA 1TOFA 1IYHA 4J2FA 2MMZA 3CRUA 5FT3A 2M46A 2C3NA 2YZUA 4N30A 2YWIA 1GTIA 1SK1A 2B7JA 1WJKA 3I43A 5IMCA 6GSVA 2VCVA 2YV7A 1S3DA 1Q4JA 19GSA 2IPAA 3KH7A 1WIKA 4HSCX 13GSA 2DJ3A 3FR9A 4K1FA 3M3MA 5GZZB 1WP0A 2DJ0A 1AUCA 3CXGA 5AIXA 2H1AA 1C72A 5G2ZA 2VIMA 4L5OA 4KE3A 4PQ1A 4KA0A 4XS4A 4HS1A 5DCHA 2IMFA 1RK4A 4NAXA 1YJ6A 3GV1A 3HVSA 2K18A 1PN9A 1Z3EA 2FWHA 2JZSA 4JU5A 1VF3A 1T3BA 1ZZYA 3TJGA 4IJ3A 2CX3A 4XRDA 2HNLA 1O85A 1PKZA 3HD5A 1V40A 4NHWA 1QXHA 3LWAA 4PXOA 2PU9C 2H74A 2OE3A 1FG4A 3ERWA 1H4OA 3BD2A 1O81A 2DJKA 3FHKA 1OC9A 2GT5A 1M9BA 5F06A 1EOHA 2I3YA 3UEMA 5HFKA 1S3CA 4BWSA 3GIXA 2YZHA 4HU7A 2YWNA 3GFKA 3HHVA 5INYA 1GULA 1ZL9A 3DVWA 2HT9A 4BVYB 3GA4A 3EE2A 1SJZA 1PQNA 5DQYA 1FVJA 2LJRA 5ECIB 2HZEB 4GSNA 3EU4A 1QUWA 2FUG2 4YQMA 1TRVA 5CNWA 3GH9A 1B48A 2BJXA 3PH9A 1V57A 3P8WA 1TRSA 3H79A 3HJPA 1B4QA 4JZQA 2K8SA 5ABRA 4ILFA 1FOVA 1Y6EA 1AQWA 3QAVA 3UIWA 3TRPA 1HNBA 1G7EA 1FB0A 1B9XC 2DSAA 5DJMA 18GSA 1ON4A 1WE0A 3HJOA 4RI6A 4HDEA 2HRFA 1ML6A 5HQPA 3VURA 3UARA 4E8HA 3ZVJA 1GP1A 4NPBA 1GTAA 2XPDA 2X8HA 3TOUA 2VCWA 2FWFA 3FEUA 1AW9A 2X49A 3MDKA 4RUVA 5B6NA 2RM6A 2GDRA 2VLUA 1YY7A 3IC4A 4BL7B 2UZ8A 3BCKA 4MH3A 3UMAA 3LEFA 4ML6A 1ERTA 1J08A 3U5RE 4MABA 3WYWA 1BX9A 2KHPA 4K8MA 2B1KA 3HVNA 1TXXA 4L8EA 1GNEA 5H5SA 1R4WA 3KP8A 4JR6A 3IHGA 2VLTA 4I8BA 4PGTA 4QL9A 2AYTA 3CRTA 4EL1A 5HR3A 2B1LA 3LXZA 2MBSA 1HD2A 1A2JA 4TRXA 3ZIJA 2IWTA 1O8WA 2YOIA 4BIKA 2LRNA 4PQHA 4WEYA 2V6KA 4WF5A 2VCTA 2IFQA 3G7JA 3GX8A 4Z2RA 1YZXA 2V2GA 2X64A 1EEJA 5ECOB 1PKWA 3WT1A 3GX0A 3FYGA 3L9UA 4KF9A 1PFOA 4DSSA 4BWQA 2OKAA 4Q5QA 3IAS2 2FA8A 1THOA 1X5EA 3TCOA 1XWAA 4ULXA 1A8LA 3VLNA 2QA1A 1T00A 4HZ4A 1FAAA 3F4RA 3QAGA 1H75A 6GSYA 3DWVA 4WF4A 2R0PA 4IELA 5B8BA 1BEDA 1PL2A 3RHCA 1PX7A 2ES7A 5ID2A 4IJIA 2XC2A 1U3AA 4MJBA 2R2JA 4ECBA 3CMIA 4O5UA 7GSSA 4K5RA 2CX4A 2DIYA 4EC0A 5D73A 1A2MA 4MLYA 2C80A 3TJKA 4DEJA 2IIYA 1F37A 4K0GA 1IYIA 4EXJA 4EF0A 3CTFA 4XS1A 1PD21 5JWRB 1K0BA 3UJ1A 2O7KA 3H1NA 4GRFA 3KEBA 3EU3A 2F8FA 1GWCA 2P31A 4NV5A 4K5SA 1Q98A 5D9WA 3ED3A 1GUHA 1ERUA 2J9HA 3LXTA 1NM3A 5IMZA 3FK8A 3W8JA 4MPFA 2GQLA 5J5NA 2VL2C 1MDIA 5CRWA 2YWMA 2OBIA 3GSSA 1ZYNA 4JR4A 5KOXA 4ECCA 2PMTA 1EOGA 1X9WB 2YPMA 1M2BA 5D8IA 3M8NA 5LCZA 1YF0A 1JLVA 1LBKA 4GXZA 1CQHA 1SJIA 3GH6A 3FZ9A 5DJLA 2ON7A 3IRAA 4IS0A 5IO2A 2I81A 3LGCA 1SENA 4K7IA 5CP1A 1JHBA 3IPZA 3GRXA 3HA9A 1T1VA 4HJ2A 1EP7A 3Q18A 3KJYA 3GL5A 4KH7A 2A2RA 1M7TA 5CAXA 3NIVA 3US3A 3QFBC 4TXVA 1M9AA 4TN8A 4BVYA 1ZYQB 3J7Yb 1X0RA 2B7KA 2O87A 2H0GA 2P5QA 1SJ6A 1JZDA 1GSDA 4KCEA 2HZEA 4OCEA 5EPFA 2H72A 5H5RA 3BOAA 3TB2A 5DAKA 2B5YA 2IMIA 1KBNA 1DUGA 3NOFA 1S3RA 3EMPA 1X9MB 1G0TA 4I97A 5KN1A 1MDJA 2IMKA 3TKRA 2MYGA 2KUCA 3Q6OA 3W8SA 2HI7A 3C8EA 3PR8A 1NHYA 4ZBAA 2L5LA 4BVXB 4ECIA 3VI5A 3RDWA 4LL4B 4JE1A 5ECNB 3KP9A 1SK2A 3IDVA 2LNSA 4O7HA 2H6YA 2GS3A 4OFTA 1PSQA 3IK9A 1MD4A 2LJKA 5JCWA 1W4VA 2YJ7A 4Z2TA 2NBSA 3UOMA 5ECPB 14GSA 4YH2A 1TTZA 4GTUA 4BL7A 1XW5A 1GNWA 5JWOB 4Z7XA 2YANA 5D9XA 4ZL9A 4FYCA 4G0KA 4ZB8A 1GLPA 2L6DA 2DJ1A 3P2AA 4TVEA 2KP1A 4I5QA 2WRTA 3FZ4A 2EC4A 4F82A 4P3YB 4ZILA 5J9CA 5DQSA 5D9VA 2FCHA 2GQKA 4AF2A 3F63A 3IK7A 1JZRA 2VCQA 4Q5FA 5JCUA 4CHSA 2OA7A 1T4YA 5JCGA 2NTOA 3QFAC 1CQGA 2PGTA 20GSA 1HQOA 1V58A 1TU8A 3HZ4A 4IBPA 5DALB 2JACA 4IKHA 3H93A 4WBRD 3VWXA 3NZNA 4MF6A 2HRNA 3C7MA 4FH8A 5A4UA 1M3IA 3F6FA 2E7PA 4N0VA 2DMLA 3LYPA 4YAVA 2G0FA 3HVVA 5HFGA 2B3SA 1I9DA 3CSIA 4G2EA 4YQVA 5KN3A 3LJRA 2IMEA 3MIXA 4H86A 4AGSA 4FO5A 4AJ8A 2JSZA 3FZAA 3CYNA 1W89A 2DC5A 1AQVA 5IMFA 4PX1A 6GSSA 1R5PA 1F9MA 1UA5A 4KX4A 4ZB9A 1ZYPA 1XOAA 3Q74A 4NWYA 2NVLA 3KH9A 3W6GA 4Q5NA 4F03A 4MCUA 4HU9A 1V98A 4HOJA 2CVKA 3A2XA 3G7IA 3TKPA 5G5EA 2C8UA 1NHOA 1YEPA 2O8VB 1UC7A 4TR0A 4HQZA 1K0AA 2KP2A 1QFNA 3G9BA 4BPYA 2R3XA 1OYJA 4G10A 1GL8A 5DBQA 3RPPA 4EKZA 3MAKA 3CSHA 4KCAA 5CRGA 4IN0A 4MH2A 3EPTA 1UVZA 5A5KA 4K0NA 4KSOA 5BMUA 2X8CA 4XS6A 5D93A 4G0LA 3WGEA 2OE0A 1A0FA 1EEMA 2GT6A 4I2TA 2HSYA 3ZLPA 5IOXA 1K0OA 1FVKA 2N5FA 2VAFA 5F07A 4GCIA 3O3TA 3UBKA 3N9JA 2GZZA 3QPMA 3IXRA 4MA9A 5FHIA 3HZ8A 3MYDA 5IMAA 3ZYWA 5ELAA 4X0XA 5EY6A 3L78A 5COHA 2XBIA 2E2GA 4NHZA 1QQ2A 4D73B 4L0UA 4OMVA 5F0GA 3TDGA 4IHUA 1K3LA 2HLSA 3OR5A 2ALBA 5KN2A
chains in the Genus database with same CATH topology
3ZFBA 4PURA 2NPBA 4V1Ap 2PVQA 3DYRA 2OBKA 3F4TA 3L0HA 3RHBA 1RW1A 4Z2UA 1I5GA 3KTLA 10GSA 1SL2B 1EZKA 4JRRA 1FO5A 5KEJA 1O6JA 2I4AA 1VRSD 1M0UA 2N5BA 4GSSA 3QCPA 4ZXGA 1OE8A 1XPVA 3R2QA 1F3AA 1B8XA 2LRCA 1TK0B 3L9SA 1Z6MA 5AIVA 5KN0A 3TKSA 2YWOA 2V32A 4FYBA 2L57A 1LU4A 3E9JB 4PUAA 4L5LA 1GSQA 1PGTA 2WULA 5AGYA 1HNAA 3KIJA 1JFUA 3VWUA 2CA8A 2GLRA 1XW6A 5J4UA 4JEDA 4V2MA 4ECJA 5GAPD 4MZBA 1J0FA 6GSWA 2VL3A 1SK0A 3VI7A 5G30A 2RUEA 3O76A 2GZYA 4OFMA 4YKGA 5ENUA 4MJEA 1QK8A 2IN3A 1UN2A 4GWRA 3C1SA 1ST9A 4XCSA 1R5AA 1BQ7A 4POMA 2VM2A 3GHAA 2E0QA 2DMMA 3BJ5A 1GRXA 1OC3A 3GURA 3A2WA 4EDZA 1JZOA 1M2DA 2A4HA 2FHEA 1XVWA 4IGJA 4EIQA 1SYRA 2CVBA 4J57E 4LMWA 3QR6A 2A4VA 1EGRA 4PQIA 2QGVA 2WGRA 1U3IA 2LV3A 2LQOA 2O85A 4J56E 1AC1A 2V41A 2H73A 1Z7RA 2B6MA 2H76A 1WRYA 1SU9A 2EIRA 4KSMA 3I69A 5HR0A 2OACA 8GSSA 3KTBA 1URMA 2J23A 3F8UA 4MJAA 1XIYA 3ZITA 2JL4A 2GSSA 3UBLA 1YKCA 4MZWA 5DALA 2NDOA 5D9TA 3FMWA 2WZ9A 4PTSA 1WMJA 4MF5A 4N10A 2C0DA 1M2AA 2OE1A 3QD9A 1EV9A 4ZBBA 4MPGA 1K0MA 1XOBA 2TRXA 2YP6A 4MJCA 3QAWA 4HQSA 2WJUA 4LMVA 2F9SA 3P7XA 1XXUA 1PL1A 2BTOT 2XPEA 1FOHA 1TRWA 5BRTA 4G19A 4A5PA 5IQYA 2CQ9A 4NMUA 3APOA 2O89A 3IV4A 5HFIA 4F9ZA 2VUPA 4PNGA 1B9YC 4WKWA 3GTUB 4K9ZA 3D5JA 1XWGA 3LFLA 3N5OA 2H01A 4USSA 2ZUPA 1TK5B 1PA3A 5J9BA 3DGQA 4FYUA 4IQAA 4K2DA 2ZCTA 1HYUA 2P0GA 2B5EA 1OC9B 1VF4A 1N2AA 3PGTA 2LTKA 1ERWA 4TR1B 5B6MA 3ME8A 2P5RA 3F6DA 2DLXA 3KMOA 3APQA 4OWYA 3KXOA 2A2SA 1XFLA 4F0BA 1G6YA 3F3RA 1K3YA 4EDYA 4ZL8A 5B8AA 5ECHB 4OO4A 4MNNA 3IAM2 3IC8A 5CREA 4POLA 1Y25A 1ACVA 5EVOA 4XTSA 3IE3A 3M9JA 2WS2A 4NV2A 2XBQA 1U88A 4IP6A 4WBJA 5F8BA 1KEBA 4AJ7A 4IW9A 4DVCA 3TOTA 2GVPA 1DE2A 4POKA 2A2PA 4LL1B 5DVBA 2GSRA 3ZL5A 3ZVJD 4L0WA 2X4AA 4IP1A 3RBTA 5IMDA 1SKWB 1KTEA 2CZ3A 1G7OA 4KUNA 4LA1A 4OD7A 4D73A 4G0IA 3ZRDA 1S3AA 5IMVA 2FA4A 2DJ2A 2AJQB 2VCXA 5CO3A 2JADA 4OFNA 2WFCA 4IQ1A 3E3EA 4WETA 1SD8A 1M99A 3L4NA 3HDCA 3F3QA 5DCGA 3MNGA 1OC8A 3D4TA 2H70A 4IVFA 2H66A 2ON5A 3D6IA 4V1Ag 3VWVA 1EP8A 4K2XA 12GSA 3LYKA 4AJ6A 1BYEA 1TI3A 1JLWA 5ECMB 1B4PA 4PNFA 5ECQB 2PWJA 3APSA 4GF0A 3LORA 2KOKA 4ZL7A 4GLTA 2C0GA 2M80A 5ECKB 1VGLA 1U6TA 3ISOA 1X5DA 4KB3A 3RAZA 3H8QA 2YNXA 4EVMA 1GSUA 3A2VA 3MWHA 2GQMA 3F9UA 4V2NA 4EO3A 2K8VA 3TJFA 3GKKA 3WGDA 1GLQA 4XHMA 1PN0A 5GSTA 4DSSB 2H75A 4V2LA 4N11A 2ZNMA 2RLIA 1ZOFA 2H6XA 5J3RA 3HJMA 4X43A 1OKTA 3O6TA 1GTUA 2MMAA 2R0CA 1MDKA 1ZCPA 2LRTA 2X8GA 2QA2A 1OKDA 3ZMKA 2VD1A 2F3MA 2LKUA 3QMXA 3ERGA 3IR4A 4Q5RA 1F3BA 2HXKA 3GKNA 4ID0A 2E2MA 2C4JA 5AN1A 3V1WA 5ID2B 4EIPA 2HSMA 1A2LA 3VK9A 1DE1A 4X1UA 1K0NA 5G31A 2D2ZA 2MBTA 5IO0A 2V1MA 1GSFA 4ZIJA 3Q19A 2YV9A 1WPIA 3HYPA 3KZQA 1MTCA 2LS5A 3G7YA 2BMXA 1GUKA 2CAIA 4QQ7A 3PINA 2KLXA 2GGTA 3EURA 3IOSA 3KCMA 4KNDA 4WR4A 4DSQA 2JZTA 4MK3A 3F0IA 3P90A 5IOWA 4LLRA 1J9BA 5JWQB 5ECLB 3ZZXA 2RIIA 1G6WA 1O8XA 4RI7A 2WDUA 1O73A 3QDNA 4O32A 1RQMA 3HKRA 2LNTA 3LSZA 5AISA 2FWGA 5IIZA 2V6OA 5HR2A 4XIHA 5E59A 3GTUA 3EMXA 4CW9A 1AXDA 3L9VA 4ML1A 3DKSA 3ZREA 3UVTA 4KAEA 3GMFA 3I6AA 1AQXA 3LQ7A 4FQUA 2VCZA 1AIUA 3DIEA 3HXSA 5E4WA 5IPGA 3KMNA 3WD6A 2EIOA 2VO4A 4TR1A 5IM9A 1F6MC 5GAND 2IJYA 4TOPA 1K0CA 2GZPA 1AAZA 2JSYA 2N5AA 1TU7A 3D22A 2H19A 1SYXA 4KDYA 1FW1A 3J7Yk 3D0ZA 3EWLA 3DMLA 2OJLA 2JU5A 3K8NA 4POBA 1NW2A 5DAKB 1LJRA 3M0FA 1K0DA 2I9HA 3A5WA 3D21A 4DSRA 2R6KA 1VF2A 1WOUA 3TKSC 22GSA 1T4ZA 1YQ1A 2R37A 2WCIA 4ICYA 2H1GA 2PBJA 3F4SA 2IMDA 2REMA 4MF7A 1HNCA 2L59A 1A0RP 3KM6A 2M72A 2DJJA 2RM5A 2C3QA 1BAYA 2H1BA 1R7HA 3BBYA 4OO5A 2MMOA 1OVNA 2FGXA 4ISDA 4O5QA 1FHEA 4BVXA 3WGXA 4MMMA 2H6ZA 2GSTA 3GKXA 2DKHA 3DVXA 2H0HA 1T7PB 2K9FA 2AHEA 2C0FA 1XW9A 3HCZA 3TRQA 1WWJA 1NSWA 3WT2A 1PMTA 4CY8A 2HFDA 4YKFA 2C3TA 2AUVA 1XCCA 4K7NA 2AV4A 2C1YA 1GSSA 1ZYEA 2I1UA 4F2IA 5G1LA 3FZ5A 3IBHA 1PX6A 3GSTA 2DBCA 1Z9HA 3TUEA 4F0CA 9GSSA 2WB9A 4WXTA 3S9FA 2TIRA 3UAPA 2FLSA 3VPTA 3A5IA 3FKFA 3VFIA 3SWLA 4TKYA 1R26A 3ZIVA 2GTUA 3DXBA 4I2UA 2R5GA 3EC3A 3ZFLA 2H71A 2LSTA 3DRNA 2GSQA 4TXOB 2MZCA 2PN8A 1ILOA 3DD3A 4HUAA 1EWXA 2TRCP 2L4QA 1XVQA 1Z6NA 2AAWA 2H0IA 1VF1A 5GSSA 2FNOA 2Z9SA 1U87A 1V2AA 2XHFA 1EGOA 2VD0A 3FW2A 2G2QA 1JZWA 1USBA 3TGZA 5EL8A 17GSA 4FIWA 4XS4B 3EINA 1MD3A 1XWCA 1ZMAA 6GSUA 1A8YA 2VOCA 1F2EA 5G5FA 2CV4A 2YN1A 2DIZA 4KDUA 1Z5YE 2MMNA 1THXA 3UVHA 2HZFA 1TDIA 3RPNA 1O7UA 2H8LA 2RUFA 3IA1A 5LNKe 4MZCA 2OADA 2QSIA 3FR3A 4WR5A 2LJAA 3C1RA 4EE0A 2FD3A 4QL7A 2LQQA 2QC7A 3VPQA 3GYKA 4K7OA 4ACSA 4KGIA 3KGKA 1T8EB 1YEXA 1QGVA 4HZ2A 3C71A 3GKMA 4BA7A 1BG5A 2LUSA 1X9SB 4GSTA 1N8JA 2F51A 4CY6A 3FR6A 2HYXA 4HJMA 5LD0A 1TJDA 2L5OA 16GSA 4KDXA 1A23A 5J41A 3SBCA 3EVIA 2VLVA 4X4JA 2CAQA 2HRAA 4RQXA 1X5CA 2AB6A 4KW6A 1TP9A 1Z7PA 1TKDB 1FB6A 1K3OA 4NXIA 1SKRB 2LEGA 3KD0A 5CRHA 3R3EA 1MEKA 4O5RA 2H1DA 2PERA 3GL3A 1GSYA 1SD9A 4TR4A 3TJJA 2K6VA 3HY2A 3GUSA 2VM1A 1GSEA 3U6VA 3H4KA 3MSZA 2EIQA 2VL2A 3FRCA 5H5QA 2YCDA 1XZOA 1YDKA 3ZMLA 2VL9A 3C73A 1E2YA 2CT6A 2FY6A 2CVDA 5ECSA 4MDCA 3LG6A 1QMVA 1TK8B 5D96A 3JCML 5A4VA 5KOWA 3M1GA 4GQFA 2PPTA 2QKEA 1PRXA 4OCFA 1ERVA 1V9WA 3CSJA 4YAPA 1EV4A 2YJHA 3HVXA 4HI7A 5F05A 4ZB6A 2HSHA 3I9V2 2F8AA 4EUYA 2FWEA 1XWBA 5C00A 3E0UA 1SL1B 5IPHA 5DDLA 2HRKA 1OE7A 6GSXA 4YQUA 2R0GA 2HE3A 3M9KA 3BCIA 3LW9A 3TKQA 5G1KA 1DSBA 4TW5A 5CYYA 1GH2A 4O92A 1XBSA 5FWGA 3GNJA 4E8EA 1A24A 2IFQB 1SKSB 4PUFC 2CZ2A 3TRXA 3EYTA 2H30A 4HEA2 2X99A 5ECRB 3ERFA 3CBUA 1DBYA 3FY7A 5C04A 1E6BA 3TKSE 5B7CA 4MP4A 5HR1A 5CRDA 3TJBA 3A3TA 4TR3A 1TW9A 6GSTA 1GTBA 4G9HA 3IHQA 4GQCA 4CDOA 1ZGNA 3ZTLA 1XWKA 4JBBA 3DEXA 3GN3A 1TI1A 11GSA 2C0EA 2L6CA 4XRAA 1ABAA 2DKIA 5A4WA 3QOUA 4RQRA 1YKAA 3CTGA 1TRUA 3PPUA 2PUKC 1GUMA 4N0ZA 4I6XA 2B5XA 3ME7A 4K6XA 1OAZA 3D4MA 2R4VA 1BJXA 1YF1A 3AY8A 4ZBDA 3VWWA 1SL0B 4TXOA 2PVOC 5L71A 3UL3A 2JZRA 1KNGA 2L4CA 2IL3A 5ELGA 1TOFA 1IYHA 4J2FA 2MMZA 3CRUA 5FT3A 2M46A 2C3NA 2YZUA 4N30A 2YWIA 1GTIA 1SK1A 2B7JA 1WJKA 3I43A 5IMCA 6GSVA 2VCVA 2YV7A 1S3DA 1Q4JA 19GSA 2IPAA 3KH7A 1WIKA 13GSA 2DJ3A 3FR9A 4K1FA 3M3MA 5GZZB 1WP0A 2DJ0A 1AUCA 3CXGA 5AIXA 2H1AA 1C72A 5G2ZA 2VIMA 4L5OA 4KE3A 4PQ1A 4KA0A 4XS4A 4HS1A 5DCHA 2IMFA 1RK4A 4NAXA 1YJ6A 3GV1A 3HVSA 2K18A 1PN9A 1Z3EA 2FWHA 2JZSA 4JU5A 1VF3A 1T3BA 1ZZYA 3TJGA 4IJ3A 2CX3A 4XRDA 2HNLA 1O85A 1PKZA 3HD5A 1V40A 4NHWA 1QXHA 3LWAA 4PXOA 2PU9C 2H74A 2OE3A 1FG4A 3ERWA 1H4OA 3BD2A 1O81A 2DJKA 3FHKA 1OC9A 2GT5A 1M9BA 5F06A 1EOHA 2I3YA 3UEMA 5HFKA 1S3CA 4BWSA 3GIXA 2YZHA 4HU7A 2YWNA 3GFKA 3HHVA 5INYA 1GULA 1ZL9A 3DVWA 2HT9A 4BVYB 3GA4A 3EE2A 1SJZA 1PQNA 5DQYA 1FVJA 2LJRA 5ECIB 2HZEB 4GSNA 3EU4A 1QUWA 2FUG2 4YQMA 1TRVA 5CNWA 3GH9A 1B48A 2BJXA 3PH9A 1V57A 3P8WA 1TRSA 3H79A 3HJPA 1B4QA 4JZQA 2K8SA 5ABRA 4ILFA 1FOVA 1Y6EA 1AQWA 3QAVA 3UIWA 3TRPA 1HNBA 1G7EA 1FB0A 1B9XC 2DSAA 5DJMA 18GSA 1ON4A 1WE0A 3HJOA 4RI6A 4HDEA 2HRFA 1ML6A 5HQPA 3VURA 3UARA 4E8HA 3ZVJA 1GP1A 4NPBA 1GTAA 2XPDA 2X8HA 3TOUA 2VCWA 2FWFA 3FEUA 1AW9A 2X49A 3MDKA 4RUVA 5B6NA 2RM6A 2GDRA 2VLUA 1YY7A 3IC4A 4BL7B 2UZ8A 3BCKA 4MH3A 3UMAA 3LEFA 4ML6A 1ERTA 1J08A 3U5RE 4MABA 3WYWA 1BX9A 2KHPA 4K8MA 2B1KA 1TXXA 4L8EA 1GNEA 5H5SA 1R4WA 3KP8A 4JR6A 3IHGA 2VLTA 4I8BA 4PGTA 4QL9A 2AYTA 3CRTA 4EL1A 5HR3A 2B1LA 3LXZA 2MBSA 1HD2A 1A2JA 4TRXA 3ZIJA 2IWTA 1O8WA 2YOIA 2LRNA 4PQHA 4WEYA 2V6KA 4WF5A 2VCTA 2IFQA 3G7JA 3GX8A 4Z2RA 1YZXA 2V2GA 2X64A 1EEJA 5ECOB 1PKWA 3WT1A 3GX0A 3FYGA 3L9UA 4KF9A 4DSSA 4BWQA 2OKAA 4Q5QA 3IAS2 2FA8A 1THOA 1X5EA 3TCOA 1XWAA 4ULXA 1A8LA 3VLNA 2QA1A 1T00A 4HZ4A 1FAAA 3F4RA 3QAGA 1H75A 6GSYA 3DWVA 4WF4A 2R0PA 4IELA 5B8BA 1BEDA 1PL2A 3RHCA 1PX7A 2ES7A 5ID2A 4IJIA 2XC2A 1U3AA 4MJBA 2R2JA 4ECBA 3CMIA 4O5UA 7GSSA 4K5RA 2CX4A 2DIYA 4EC0A 5D73A 1A2MA 4MLYA 2C80A 3TJKA 4DEJA 2IIYA 1F37A 4K0GA 1IYIA 4EXJA 4EF0A 3CTFA 4XS1A 1PD21 5JWRB 1K0BA 3UJ1A 2O7KA 3H1NA 4GRFA 3KEBA 3EU3A 2F8FA 1GWCA 2P31A 4NV5A 4K5SA 1Q98A 5D9WA 3ED3A 1GUHA 1ERUA 2J9HA 3LXTA 1NM3A 5IMZA 3FK8A 3W8JA 4MPFA 2GQLA 5J5NA 2VL2C 1MDIA 5CRWA 2YWMA 2OBIA 3GSSA 1ZYNA 4JR4A 5KOXA 4ECCA 2PMTA 1EOGA 1X9WB 2YPMA 1M2BA 5D8IA 3M8NA 5LCZA 1YF0A 1JLVA 1LBKA 4GXZA 1CQHA 1SJIA 3GH6A 3FZ9A 5DJLA 2ON7A 3IRAA 4IS0A 5IO2A 2I81A 3LGCA 1SENA 4K7IA 5CP1A 1JHBA 3IPZA 3GRXA 3HA9A 1T1VA 4HJ2A 1EP7A 3Q18A 3KJYA 3GL5A 4KH7A 2A2RA 1M7TA 5CAXA 3NIVA 3US3A 3QFBC 4TXVA 1M9AA 4TN8A 4BVYA 1ZYQB 3J7Yb 1X0RA 2B7KA 2O87A 2H0GA 2P5QA 1SJ6A 1JZDA 1GSDA 4KCEA 2HZEA 4OCEA 5EPFA 2H72A 5H5RA 3BOAA 3TB2A 5DAKA 2B5YA 2IMIA 1KBNA 1DUGA 3NOFA 3EMPA 1X9MB 1G0TA 4I97A 5KN1A 1MDJA 2IMKA 3TKRA 2MYGA 2KUCA 3Q6OA 3W8SA 2HI7A 3C8EA 3PR8A 1NHYA 4ZBAA 2L5LA 4BVXB 4ECIA 3VI5A 3RDWA 4LL4B 4JE1A 5ECNB 3KP9A 1SK2A 3IDVA 2LNSA 4O7HA 2H6YA 2GS3A 4OFTA 1PSQA 3IK9A 1MD4A 2LJKA 5JCWA 1W4VA 2YJ7A 4Z2TA 2NBSA 3UOMA 5ECPB 14GSA 4YH2A 1TTZA 4GTUA 4BL7A 1XW5A 1GNWA 5JWOB 4Z7XA 2YANA 5D9XA 4ZL9A 4FYCA 4G0KA 4ZB8A 1GLPA 2L6DA 2DJ1A 3P2AA 4TVEA 2KP1A 4I5QA 2WRTA 3FZ4A 2EC4A 4F82A 4P3YB 4ZILA 5J9CA 5DQSA 5D9VA 2FCHA 2GQKA 4AF2A 3F63A 3IK7A 1JZRA 2VCQA 4Q5FA 5JCUA 4CHSA 2OA7A 1T4YA 5JCGA 2NTOA 3QFAC 1CQGA 2PGTA 20GSA 1HQOA 1V58A 1TU8A 3HZ4A 4IBPA 5DALB 2JACA 4IKHA 3H93A 4WBRD 3VWXA 3NZNA 4MF6A 2HRNA 3C7MA 4FH8A 5A4UA 3F6FA 2E7PA 4N0VA 2DMLA 3LYPA 4YAVA 2G0FA 3HVVA 5HFGA 2B3SA 1I9DA 3CSIA 4G2EA 4YQVA 5KN3A 3LJRA 2IMEA 3MIXA 4H86A 4AGSA 4FO5A 4AJ8A 2JSZA 3FZAA 3CYNA 1W89A 2DC5A 1AQVA 5IMFA 4PX1A 6GSSA 1R5PA 1F9MA 1UA5A 4KX4A 4ZB9A 1ZYPA 1XOAA 3Q74A 4NWYA 2NVLA 3KH9A 3W6GA 4Q5NA 4F03A 4MCUA 4HU9A 1V98A 4HOJA 2CVKA 3A2XA 3G7IA 3TKPA 5G5EA 2C8UA 1NHOA 1YEPA 2O8VB 1UC7A 4TR0A 4HQZA 1K0AA 2KP2A 1QFNA 3G9BA 4BPYA 2R3XA 1OYJA 4G10A 1GL8A 5DBQA 3RPPA 4EKZA 3MAKA 3CSHA 4KCAA 5CRGA 4IN0A 4MH2A 3EPTA 1UVZA 5A5KA 4K0NA 4KSOA 5BMUA 2X8CA 4XS6A 5D93A 4G0LA 3WGEA 2OE0A 1A0FA 1EEMA 2GT6A 4I2TA 2HSYA 3ZLPA 5IOXA 1K0OA 1FVKA 2N5FA 2VAFA 5F07A 4GCIA 3O3TA 3UBKA 3N9JA 2GZZA 3QPMA 3IXRA 4MA9A 5FHIA 3HZ8A 3MYDA 5IMAA 3ZYWA 5ELAA 4X0XA 5EY6A 3L78A 5COHA 2XBIA 2E2GA 4NHZA 1QQ2A 4D73B 4L0UA 4OMVA 5F0GA 3TDGA 4IHUA 1K3LA 2HLSA 3OR5A 2ALBA 5KN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZFB A;  4PUR A;  2NPB A;  4V1A p;  2PVQ A;  3DYR A;  2OBK A;  3F4T A;  3L0H A;  3RHB A;  1RW1 A;  1I5G A;  3KTL A;  10GS A;  1SL2 B;  1EZK A;  4JRR A;  1FO5 A;  5KEJ A;  1O6J A;  2I4A A;  1VRS D;  1M0U A;  2N5B A;  4GSS A;  3QCP A;  4ZXG A;  1OE8 A;  1XPV A;  3R2Q A;  1F3A A;  1B8X A;  2LRC A;  1TK0 B;  3L9S A;  1Z6M A;  5AIV A;  5KN0 A;  3TKS A;  2YWO A;  2V32 A;  4FYB A;  2L57 A;  1LU4 A;  3E9J B;  4PUA A;  4L5L A;  1GSQ A;  1PGT A;  2WUL A;  5AGY A;  1HNA A;  3KIJ A;  1JFU A;  3VWU A;  2CA8 A;  2GLR A;  1XW6 A;  5J4U A;  4JED A;  4V2M A;  4ECJ A;  5GAP D;  4MZB A;  1J0F A;  6GSW A;  2VL3 A;  1SK0 A;  3VI7 A;  5G30 A;  2RUE A;  3O76 A;  2GZY A;  4OFM A;  5ENU A;  4MJE A;  1QK8 A;  2IN3 A;  1UN2 A;  4GWR A;  3C1S A;  1ST9 A;  4XCS A;  1R5A A;  1BQ7 A;  4POM A;  2VM2 A;  3GHA A;  2E0Q A;  2DMM A;  3BJ5 A;  1GRX A;  1OC3 A;  3GUR A;  3A2W A;  4EDZ A;  1JZO A;  1M2D A;  2FHE A;  1XVW A;  4IGJ A;  1SYR A;  2CVB A;  4J57 E;  4LMW A;  3QR6 A;  2A4V A;  1EGR A;  4PQI A;  2QGV A;  2WGR A;  1U3I A;  2LV3 A;  2LQO A;  2O85 A;  4J56 E;  1AC1 A;  2V41 A;  2H73 A;  1Z7R A;  2B6M A;  2H76 A;  1WRY A;  1SU9 A;  2EIR A;  4KSM A;  3I69 A;  5HR0 A;  2OAC A;  8GSS A;  3KTB A;  1URM A;  2J23 A;  3F8U A;  4MJA A;  1XIY A;  3ZIT A;  2JL4 A;  2GSS A;  3UBL A;  1YKC A;  4MZW A;  5DAL A;  2NDO A;  5D9T A;  2WZ9 A;  1WMJ A;  4MF5 A;  4N10 A;  2C0D A;  1M2A A;  2OE1 A;  3QD9 A;  1EV9 A;  4ZBB A;  4MPG A;  1K0M A;  1XOB A;  2TRX A;  2YP6 A;  4MJC A;  3QAW A;  4HQS A;  2WJU A;  4LMV A;  2F9S A;  3P7X A;  1XXU A;  1PL1 A;  2BTO T;  2XPE A;  1TRW A;  4G19 A;  5IQY A;  2CQ9 A;  4NMU A;  3APO A;  2O89 A;  3IV4 A;  5HFI A;  4F9Z A;  2VUP A;  4PNG A;  1B9Y C;  4WKW A;  3GTU B;  4K9Z A;  3D5J A;  1XWG A;  3LFL A;  3N5O A;  2H01 A;  2ZUP A;  1TK5 B;  1PA3 A;  5J9B A;  3DGQ A;  4FYU A;  4IQA A;  4K2D A;  2ZCT A;  1HYU A;  2P0G A;  2B5E A;  1OC9 B;  1VF4 A;  1N2A A;  3PGT A;  2LTK A;  1ERW A;  4TR1 B;  5B6M A;  3ME8 A;  2P5R A;  3F6D A;  2DLX A;  3KMO A;  3APQ A;  4OWY A;  3KXO A;  2A2S A;  1XFL A;  4F0B A;  1G6Y A;  3F3R A;  1K3Y A;  4EDY A;  4ZL8 A;  5B8A A;  5ECH B;  4OO4 A;  3IAM 2;  5CRE A;  4POL A;  1Y25 A;  1ACV A;  5EVO A;  4XTS A;  3IE3 A;  3M9J A;  2WS2 A;  4NV2 A;  2XBQ A;  1U88 A;  4IP6 A;  4WBJ A;  5F8B A;  1KEB A;  4AJ7 A;  4IW9 A;  4DVC A;  3TOT A;  2GVP A;  1DE2 A;  4POK A;  4LL1 B;  5DVB A;  2GSR A;  3ZL5 A;  3ZVJ D;  4L0W A;  4IP1 A;  3RBT A;  5IMD A;  1SKW B;  1KTE A;  2CZ3 A;  1G7O A;  4KUN A;  4LA1 A;  4OD7 A;  4D73 A;  3ZRD A;  1S3A A;  5IMV A;  2FA4 A;  2DJ2 A;  2AJQ B;  2VCX A;  5CO3 A;  2JAD A;  4OFN A;  2WFC A;  4IQ1 A;  3E3E A;  4WET A;  1SD8 A;  1M99 A;  3L4N A;  3HDC A;  3F3Q A;  5DCG A;  3MNG A;  1OC8 A;  3D4T A;  2H70 A;  4IVF A;  2H66 A;  2ON5 A;  3D6I A;  4V1A g;  3VWV A;  1EP8 A;  12GS A;  3LYK A;  4AJ6 A;  1BYE A;  1TI3 A;  1JLW A;  5ECM B;  1B4P A;  4PNF A;  5ECQ B;  2PWJ A;  3APS A;  4GF0 A;  3LOR A;  2KOK A;  4ZL7 A;  4GLT A;  2C0G A;  2M80 A;  5ECK B;  1VGL A;  1U6T A;  3ISO A;  1X5D A;  4KB3 A;  3RAZ A;  3H8Q A;  2YNX A;  4EVM A;  1GSU A;  3A2V A;  3MWH A;  2GQM A;  3F9U A;  4V2N A;  4EO3 A;  2K8V A;  3TJF A;  3GKK A;  3WGD A;  1GLQ A;  4XHM A;  5GST A;  4DSS B;  2H75 A;  4V2L A;  4N11 A;  2ZNM A;  2RLI A;  1ZOF A;  2H6X A;  5J3R A;  3HJM A;  4X43 A;  1OKT A;  3O6T A;  1GTU A;  2MMA A;  1MDK A;  1ZCP A;  2LRT A;  2X8G A;  1OKD A;  3ZMK A;  2VD1 A;  2F3M A;  2LKU A;  3QMX A;  3ERG A;  3IR4 A;  4Q5R A;  1F3B A;  2HXK A;  3GKN A;  4ID0 A;  2E2M A;  2C4J A;  5AN1 A;  3V1W A;  5ID2 B;  1A2L A;  3VK9 A;  1DE1 A;  4X1U A;  1K0N A;  5G31 A;  2D2Z A;  2MBT A;  5IO0 A;  2V1M A;  1GSF A;  4ZIJ A;  3Q19 A;  2YV9 A;  1WPI A;  3HYP A;  3KZQ A;  1MTC A;  2LS5 A;  3G7Y A;  2BMX A;  1GUK A;  2CAI A;  4QQ7 A;  3PIN A;  2KLX A;  2GGT A;  3EUR A;  3IOS A;  3KCM A;  4KND A;  4WR4 A;  4DSQ A;  2JZT A;  4MK3 A;  3F0I A;  3P90 A;  5IOW A;  4LLR A;  1J9B A;  5JWQ B;  5ECL B;  3ZZX A;  2RII A;  1G6W A;  1O8X A;  4RI7 A;  2WDU A;  1O73 A;  3QDN A;  4O32 A;  1RQM A;  3HKR A;  2LNT A;  3LSZ A;  5AIS A;  2FWG A;  5IIZ A;  2V6O A;  5HR2 A;  4XIH A;  5E59 A;  3GTU A;  3EMX A;  4CW9 A;  1AXD A;  3L9V A;  4ML1 A;  3DKS A;  3ZRE A;  3UVT A;  4KAE A;  3GMF A;  3I6A A;  1AQX A;  3LQ7 A;  2VCZ A;  1AIU A;  3DIE A;  3HXS A;  5E4W A;  5IPG A;  3KMN A;  3WD6 A;  2EIO A;  2VO4 A;  4TR1 A;  5IM9 A;  1F6M C;  5GAN D;  2IJY A;  4TOP A;  1K0C A;  2GZP A;  1AAZ A;  2JSY A;  2N5A A;  1TU7 A;  3D22 A;  2H19 A;  1SYX A;  4KDY A;  1FW1 A;  3J7Y k;  3D0Z A;  3EWL A;  3DML A;  2OJL A;  2JU5 A;  3K8N A;  4POB A;  1NW2 A;  5DAK B;  1LJR A;  3M0F A;  1K0D A;  2I9H A;  3A5W A;  3D21 A;  4DSR A;  2R6K A;  1VF2 A;  1WOU A;  3TKS C;  22GS A;  1T4Z A;  1YQ1 A;  2R37 A;  2WCI A;  2H1G A;  2PBJ A;  3F4S A;  2IMD A;  2REM A;  4MF7 A;  1HNC A;  2L59 A;  1A0R P;  3KM6 A;  2M72 A;  2DJJ A;  2RM5 A;  2C3Q A;  1BAY A;  2H1B A;  1R7H A;  3BBY A;  4OO5 A;  2MMO A;  1OVN A;  2FGX A;  4ISD A;  1FHE A;  4BVX A;  3WGX A;  4MMM A;  2H6Z A;  2GST A;  3GKX A;  3DVX A;  2H0H A;  1T7P B;  2K9F A;  2AHE A;  2C0F A;  1XW9 A;  3HCZ A;  3TRQ A;  1WWJ A;  1NSW A;  3WT2 A;  1PMT A;  2HFD A;  2C3T A;  2AUV A;  1XCC A;  4K7N A;  2AV4 A;  2C1Y A;  1GSS A;  1ZYE A;  2I1U A;  4F2I A;  5G1L A;  3FZ5 A;  3IBH A;  1PX6 A;  3GST A;  2DBC A;  1Z9H A;  3TUE A;  4F0C A;  9GSS A;  2WB9 A;  4WXT A;  3S9F A;  2TIR A;  3UAP A;  2FLS A;  3VPT A;  3FKF A;  3VFI A;  3SWL A;  4TKY A;  1R26 A;  3ZIV A;  2GTU A;  3DXB A;  4I2U A;  2R5G A;  3EC3 A;  3ZFL A;  2H71 A;  2LST A;  3DRN A;  2GSQ A;  4TXO B;  2MZC A;  2PN8 A;  1ILO A;  3DD3 A;  4HUA A;  1EWX A;  2TRC P;  2L4Q A;  1XVQ A;  1Z6N A;  2AAW A;  2H0I A;  1VF1 A;  5GSS A;  2FNO A;  2Z9S A;  1U87 A;  1V2A A;  2XHF A;  1EGO A;  2VD0 A;  3FW2 A;  2G2Q A;  1JZW A;  1USB A;  3TGZ A;  5EL8 A;  17GS A;  4FIW A;  4XS4 B;  3EIN A;  1MD3 A;  1XWC A;  1ZMA A;  6GSU A;  1A8Y A;  2VOC A;  1F2E A;  5G5F A;  2CV4 A;  2YN1 A;  2DIZ A;  4KDU A;  1Z5Y E;  2MMN A;  1THX A;  3UVH A;  2HZF A;  1TDI A;  3RPN A;  1O7U A;  2H8L A;  2RUF A;  3IA1 A;  5LNK e;  4MZC A;  2OAD A;  2QSI A;  3FR3 A;  4WR5 A;  2LJA A;  3C1R A;  4EE0 A;  2FD3 A;  4QL7 A;  2LQQ A;  2QC7 A;  3VPQ A;  3GYK A;  4K7O A;  4ACS A;  4KGI A;  3KGK A;  1T8E B;  1YEX A;  1QGV A;  4HZ2 A;  3C71 A;  3GKM A;  4BA7 A;  1BG5 A;  2LUS A;  1X9S B;  4GST A;  1N8J A;  2F51 A;  3FR6 A;  2HYX A;  4HJM A;  5LD0 A;  1TJD A;  2L5O A;  16GS A;  4KDX A;  1A23 A;  5J41 A;  3SBC A;  3EVI A;  2VLV A;  2CAQ A;  4RQX A;  1X5C A;  2AB6 A;  4KW6 A;  1TP9 A;  1Z7P A;  1TKD B;  1FB6 A;  1K3O A;  4NXI A;  1SKR B;  2LEG A;  3KD0 A;  5CRH A;  1MEK A;  4O5R A;  2H1D A;  2PER A;  3GL3 A;  1GSY A;  1SD9 A;  4TR4 A;  3TJJ A;  2K6V A;  3HY2 A;  3GUS A;  2VM1 A;  1GSE A;  3U6V A;  3H4K A;  3MSZ A;  2EIQ A;  2VL2 A;  3FRC A;  5H5Q A;  2YCD A;  1XZO A;  1YDK A;  3ZML A;  2VL9 A;  3C73 A;  1E2Y A;  2CT6 A;  2FY6 A;  2CVD A;  5ECS A;  4MDC A;  3LG6 A;  1QMV A;  1TK8 B;  5D96 A;  3JCM L;  5A4V A;  3M1G A;  4GQF A;  2PPT A;  2QKE A;  1PRX A;  4OCF A;  1ERV A;  1V9W A;  3CSJ A;  4YAP A;  1EV4 A;  2YJH A;  3HVX A;  4HI7 A;  5F05 A;  4ZB6 A;  2HSH A;  3I9V 2;  2F8A A;  4EUY A;  2FWE A;  1XWB A;  5C00 A;  3E0U A;  1SL1 B;  5IPH A;  5DDL A;  1OE7 A;  6GSX A;  4YQU A;  2HE3 A;  3M9K A;  3BCI A;  3TKQ A;  5G1K A;  1DSB A;  4TW5 A;  5CYY A;  1GH2 A;  4O92 A;  1XBS A;  5FWG A;  3GNJ A;  4E8E A;  1A24 A;  2IFQ B;  1SKS B;  4PUF C;  2CZ2 A;  3TRX A;  3EYT A;  2H30 A;  4HEA 2;  2X99 A;  5ECR B;  3ERF A;  3CBU A;  1DBY A;  3FY7 A;  5C04 A;  1E6B A;  3TKS E;  5B7C A;  4MP4 A;  5HR1 A;  5CRD A;  3TJB A;  3A3T A;  4TR3 A;  1TW9 A;  6GST A;  1GTB A;  4G9H A;  3IHQ A;  4GQC A;  4CDO A;  1ZGN A;  3ZTL A;  1XWK A;  4JBB A;  3DEX A;  3GN3 A;  1TI1 A;  11GS A;  2C0E A;  2L6C A;  4XRA A;  1ABA A;  5A4W A;  3QOU A;  4RQR A;  1YKA A;  3CTG A;  1TRU A;  2PUK C;  1GUM A;  4N0Z A;  4I6X A;  2B5X A;  3ME7 A;  4K6X A;  1OAZ A;  3D4M A;  2R4V A;  1BJX A;  1YF1 A;  3AY8 A;  4ZBD A;  3VWW A;  1SL0 B;  4TXO A;  2PVO C;  5L71 A;  3UL3 A;  2JZR A;  1KNG A;  2L4C A;  2IL3 A;  5ELG A;  1TOF A;  1IYH A;  4J2F A;  2MMZ A;  3CRU A;  5FT3 A;  2M46 A;  2C3N A;  2YZU A;  4N30 A;  2YWI A;  1GTI A;  1SK1 A;  2B7J A;  1WJK A;  3I43 A;  5IMC A;  6GSV A;  2VCV A;  2YV7 A;  1S3D A;  1Q4J A;  19GS A;  2IPA A;  3KH7 A;  1WIK A;  13GS A;  2DJ3 A;  3FR9 A;  4K1F A;  3M3M A;  5GZZ B;  1WP0 A;  2DJ0 A;  1AUC A;  3CXG A;  5AIX A;  2H1A A;  1C72 A;  5G2Z A;  2VIM A;  4L5O A;  4KE3 A;  4PQ1 A;  4KA0 A;  4XS4 A;  4HS1 A;  5DCH A;  2IMF A;  1RK4 A;  4NAX A;  1YJ6 A;  3GV1 A;  3HVS A;  2K18 A;  1PN9 A;  1Z3E A;  2FWH A;  2JZS A;  4JU5 A;  1VF3 A;  1T3B A;  1ZZY A;  3TJG A;  4IJ3 A;  2CX3 A;  4XRD A;  2HNL A;  1O85 A;  1PKZ A;  3HD5 A;  1V40 A;  4NHW A;  1QXH A;  3LWA A;  4PXO A;  2PU9 C;  2H74 A;  2OE3 A;  1FG4 A;  3ERW A;  1H4O A;  3BD2 A;  1O81 A;  2DJK A;  3FHK A;  1OC9 A;  2GT5 A;  1M9B A;  5F06 A;  1EOH A;  2I3Y A;  3UEM A;  5HFK A;  1S3C A;  4BWS A;  3GIX A;  2YZH A;  4HU7 A;  2YWN A;  3GFK A;  3HHV A;  5INY A;  1GUL A;  1ZL9 A;  3DVW A;  2HT9 A;  3GA4 A;  3EE2 A;  1SJZ A;  1PQN A;  5DQY A;  1FVJ A;  2LJR A;  5ECI B;  2HZE B;  4GSN A;  3EU4 A;  1QUW A;  2FUG 2;  4YQM A;  1TRV A;  5CNW A;  3GH9 A;  1B48 A;  2BJX A;  3PH9 A;  1V57 A;  3P8W A;  1TRS A;  3H79 A;  3HJP A;  1B4Q A;  4JZQ A;  2K8S A;  5ABR A;  4ILF A;  1FOV A;  1Y6E A;  1AQW A;  3QAV A;  3UIW A;  3TRP A;  1HNB A;  1G7E A;  1FB0 A;  1B9X C;  2DSA A;  5DJM A;  18GS A;  1ON4 A;  1WE0 A;  3HJO A;  4RI6 A;  4HDE A;  2HRF A;  1ML6 A;  5HQP A;  3VUR A;  3UAR A;  4E8H A;  3ZVJ A;  1GP1 A;  4NPB A;  1GTA A;  2XPD A;  2X8H A;  3TOU A;  2VCW A;  2FWF A;  3FEU A;  1AW9 A;  3MDK A;  4RUV A;  5B6N A;  2RM6 A;  2GDR A;  2VLU A;  1YY7 A;  3IC4 A;  3BCK A;  4MH3 A;  3UMA A;  3LEF A;  4ML6 A;  1ERT A;  1J08 A;  3U5R E;  4MAB A;  3WYW A;  1BX9 A;  2KHP A;  4K8M A;  2B1K A;  1TXX A;  4L8E A;  1GNE A;  5H5S A;  1R4W A;  3KP8 A;  4JR6 A;  2VLT A;  4I8B A;  4PGT A;  4QL9 A;  2AYT A;  3CRT A;  4EL1 A;  5HR3 A;  2B1L A;  3LXZ A;  2MBS A;  1HD2 A;  1A2J A;  4TRX A;  3ZIJ A;  2IWT A;  1O8W A;  2YOI A;  2LRN A;  4PQH A;  4WEY A;  2V6K A;  4WF5 A;  2VCT A;  2IFQ A;  3G7J A;  3GX8 A;  1YZX A;  2V2G A;  2X64 A;  1EEJ A;  5ECO B;  1PKW A;  3WT1 A;  3GX0 A;  3FYG A;  3L9U A;  4DSS A;  4BWQ A;  2OKA A;  4Q5Q A;  3IAS 2;  2FA8 A;  1THO A;  1X5E A;  3TCO A;  1XWA A;  4ULX A;  1A8L A;  3VLN A;  1T00 A;  4HZ4 A;  1FAA A;  3F4R A;  3QAG A;  1H75 A;  6GSY A;  3DWV A;  4WF4 A;  4IEL A;  5B8B A;  1BED A;  1PL2 A;  3RHC A;  1PX7 A;  2ES7 A;  5ID2 A;  4IJI A;  2XC2 A;  1U3A A;  4MJB A;  2R2J A;  4ECB A;  3CMI A;  7GSS A;  2CX4 A;  2DIY A;  4EC0 A;  5D73 A;  1A2M A;  4MLY A;  2C80 A;  3TJK A;  4DEJ A;  2IIY A;  1F37 A;  4K0G A;  1IYI A;  4EXJ A;  4EF0 A;  3CTF A;  4XS1 A;  1PD2 1;  5JWR B;  1K0B A;  3UJ1 A;  2O7K A;  3H1N A;  4GRF A;  3KEB A;  3EU3 A;  2F8F A;  1GWC A;  2P31 A;  4NV5 A;  1Q98 A;  5D9W A;  3ED3 A;  1GUH A;  1ERU A;  2J9H A;  3LXT A;  1NM3 A;  5IMZ A;  3FK8 A;  3W8J A;  4MPF A;  2GQL A;  5J5N A;  2VL2 C;  1MDI A;  5CRW A;  2YWM A;  2OBI A;  3GSS A;  4JR4 A;  4ECC A;  2PMT A;  1EOG A;  1X9W B;  2YPM A;  1M2B A;  5D8I A;  3M8N A;  5LCZ A;  1YF0 A;  1JLV A;  1LBK A;  4GXZ A;  1CQH A;  1SJI A;  3GH6 A;  3FZ9 A;  5DJL A;  2ON7 A;  3IRA A;  4IS0 A;  5IO2 A;  2I81 A;  3LGC A;  1SEN A;  4K7I A;  5CP1 A;  1JHB A;  3IPZ A;  3GRX A;  3HA9 A;  1T1V A;  4HJ2 A;  1EP7 A;  3Q18 A;  3KJY A;  3GL5 A;  4KH7 A;  2A2R A;  1M7T A;  5CAX A;  3NIV A;  3US3 A;  3QFB C;  4TXV A;  1M9A A;  4TN8 A;  4BVY A;  1ZYQ B;  3J7Y b;  1X0R A;  2B7K A;  2O87 A;  2H0G A;  2P5Q A;  1SJ6 A;  1JZD A;  1GSD A;  4KCE A;  2HZE A;  4OCE A;  5EPF A;  2H72 A;  5H5R A;  3BOA A;  3TB2 A;  5DAK A;  2B5Y A;  2IMI A;  1KBN A;  1DUG A;  3NOF A;  3EMP A;  1X9M B;  1G0T A;  4I97 A;  5KN1 A;  1MDJ A;  2IMK A;  3TKR A;  2MYG A;  2KUC A;  3Q6O A;  3W8S A;  2HI7 A;  3C8E A;  3PR8 A;  1NHY A;  4ZBA A;  2L5L A;  4ECI A;  3VI5 A;  3RDW A;  4LL4 B;  4JE1 A;  5ECN B;  3KP9 A;  1SK2 A;  3IDV A;  2LNS A;  4O7H A;  2H6Y A;  2GS3 A;  4OFT A;  1PSQ A;  3IK9 A;  1MD4 A;  2LJK A;  5JCW A;  1W4V A;  2YJ7 A;  2NBS A;  3UOM A;  5ECP B;  14GS A;  4YH2 A;  1TTZ A;  4GTU A;  4BL7 A;  1XW5 A;  1GNW A;  5JWO B;  4Z7X A;  2YAN A;  5D9X A;  4ZL9 A;  4FYC A;  4ZB8 A;  1GLP A;  2L6D A;  2DJ1 A;  3P2A A;  4TVE A;  2KP1 A;  4I5Q A;  2WRT A;  3FZ4 A;  2EC4 A;  4F82 A;  4P3Y B;  4ZIL A;  5J9C A;  5DQS A;  5D9V A;  2FCH A;  2GQK A;  4AF2 A;  3F63 A;  3IK7 A;  1JZR A;  2VCQ A;  4Q5F A;  5JCU A;  4CHS A;  2OA7 A;  1T4Y A;  5JCG A;  2NTO A;  3QFA C;  1CQG A;  2PGT A;  20GS A;  1HQO A;  1V58 A;  1TU8 A;  3HZ4 A;  4IBP A;  5DAL B;  2JAC A;  4IKH A;  3H93 A;  4WBR D;  3VWX A;  3NZN A;  4MF6 A;  2HRN A;  3C7M A;  4FH8 A;  5A4U A;  3F6F A;  2E7P A;  4N0V A;  2DML A;  3LYP A;  4YAV A;  2G0F A;  3HVV A;  5HFG A;  2B3S A;  1I9D A;  3CSI A;  4G2E A;  4YQV A;  5KN3 A;  3LJR A;  2IME A;  4H86 A;  4AGS A;  4FO5 A;  4AJ8 A;  2JSZ A;  3FZA A;  3CYN A;  1W89 A;  2DC5 A;  1AQV A;  5IMF A;  4PX1 A;  6GSS A;  1R5P A;  1F9M A;  1UA5 A;  4KX4 A;  4ZB9 A;  1XOA A;  3Q74 A;  4NWY A;  2NVL A;  3KH9 A;  3W6G A;  4Q5N A;  4F03 A;  4MCU A;  4HU9 A;  1V98 A;  4HOJ A;  2CVK A;  3A2X A;  3G7I A;  3TKP A;  5G5E A;  2C8U A;  1NHO A;  1YEP A;  2O8V B;  1UC7 A;  4TR0 A;  4HQZ A;  1K0A A;  2KP2 A;  1QFN A;  3G9B A;  4BPY A;  2R3X A;  1OYJ A;  4G10 A;  1GL8 A;  5DBQ A;  3RPP A;  4EKZ A;  3MAK A;  3CSH A;  4KCA A;  5CRG A;  4IN0 A;  4MH2 A;  1UVZ A;  5A5K A;  4K0N A;  4KSO A;  2X8C A;  4XS6 A;  5D93 A;  3WGE A;  2OE0 A;  1A0F A;  1EEM A;  2GT6 A;  4I2T A;  2HSY A;  3ZLP A;  5IOX A;  1K0O A;  1FVK A;  2N5F A;  2VAF A;  5F07 A;  4GCI A;  3O3T A;  3UBK A;  3N9J A;  2GZZ A;  3QPM A;  3IXR A;  4MA9 A;  5FHI A;  3HZ8 A;  5IMA A;  3ZYW A;  5ELA A;  4X0X A;  5EY6 A;  3L78 A;  5COH A;  2XBI A;  2E2G A;  4NHZ A;  1QQ2 A;  4D73 B;  4L0U A;  4OMV A;  5F0G A;  3TDG A;  4IHU A;  1K3L A;  2HLS A;  3OR5 A;  2ALB A;  5KN2 A; 
#chains in the Genus database with same CATH topology
 3ZFB A;  4PUR A;  2NPB A;  4V1A p;  2PVQ A;  3DYR A;  2OBK A;  3F4T A;  3L0H A;  3RHB A;  1RW1 A;  4Z2U A;  1I5G A;  3KTL A;  10GS A;  1SL2 B;  1EZK A;  4JRR A;  1FO5 A;  5KEJ A;  1O6J A;  2I4A A;  1VRS D;  1M0U A;  2N5B A;  4GSS A;  3QCP A;  4ZXG A;  1OE8 A;  1XPV A;  3R2Q A;  1F3A A;  1B8X A;  2LRC A;  1TK0 B;  3L9S A;  1Z6M A;  5AIV A;  5KN0 A;  3TKS A;  2YWO A;  2V32 A;  4FYB A;  2L57 A;  1LU4 A;  3E9J B;  4PUA A;  4L5L A;  1GSQ A;  1PGT A;  2WUL A;  5AGY A;  1HNA A;  3KIJ A;  1JFU A;  3VWU A;  2CA8 A;  2GLR A;  1XW6 A;  5J4U A;  4JED A;  4V2M A;  4ECJ A;  5GAP D;  4MZB A;  1J0F A;  6GSW A;  2VL3 A;  1SK0 A;  3VI7 A;  5G30 A;  2RUE A;  3O76 A;  2GZY A;  4OFM A;  4YKG A;  5ENU A;  4MJE A;  1QK8 A;  2IN3 A;  1UN2 A;  4GWR A;  3C1S A;  1ST9 A;  4XCS A;  1R5A A;  1BQ7 A;  4POM A;  2VM2 A;  3GHA A;  2E0Q A;  2DMM A;  3BJ5 A;  1GRX A;  1OC3 A;  3GUR A;  3A2W A;  4EDZ A;  1JZO A;  1M2D A;  2A4H A;  2FHE A;  1XVW A;  4IGJ A;  4EIQ A;  1SYR A;  2CVB A;  4J57 E;  4LMW A;  3QR6 A;  2A4V A;  1EGR A;  4PQI A;  2QGV A;  2WGR A;  1U3I A;  2LV3 A;  2LQO A;  2O85 A;  4J56 E;  1AC1 A;  2V41 A;  2H73 A;  1Z7R A;  2B6M A;  2H76 A;  1WRY A;  1SU9 A;  2EIR A;  4KSM A;  3I69 A;  5HR0 A;  2OAC A;  8GSS A;  3KTB A;  1URM A;  2J23 A;  3F8U A;  4MJA A;  1XIY A;  3ZIT A;  2JL4 A;  2GSS A;  3UBL A;  1YKC A;  4MZW A;  5DAL A;  2NDO A;  5D9T A;  3FMW A;  2WZ9 A;  4PTS A;  1WMJ A;  4MF5 A;  4N10 A;  2C0D A;  1M2A A;  2OE1 A;  3QD9 A;  1EV9 A;  4ZBB A;  4MPG A;  1K0M A;  1XOB A;  2TRX A;  2YP6 A;  4MJC A;  3QAW A;  4HQS A;  2WJU A;  4LMV A;  2F9S A;  3P7X A;  1XXU A;  1PL1 A;  2BTO T;  2XPE A;  1FOH A;  1TRW A;  5BRT A;  4G19 A;  4A5P A;  5IQY A;  2CQ9 A;  4NMU A;  3APO A;  2O89 A;  3IV4 A;  5HFI A;  4F9Z A;  2VUP A;  4PNG A;  1B9Y C;  4WKW A;  3GTU B;  4K9Z A;  3D5J A;  1XWG A;  3LFL A;  3N5O A;  2H01 A;  4USS A;  2ZUP A;  1TK5 B;  1PA3 A;  5J9B A;  3DGQ A;  4FYU A;  4IQA A;  4K2D A;  2ZCT A;  1HYU A;  2P0G A;  2B5E A;  1OC9 B;  1VF4 A;  1N2A A;  3PGT A;  2LTK A;  1ERW A;  4TR1 B;  5B6M A;  3ME8 A;  2P5R A;  3F6D A;  2DLX A;  3KMO A;  3APQ A;  4OWY A;  3KXO A;  2A2S A;  1XFL A;  4F0B A;  1G6Y A;  3F3R A;  1K3Y A;  4EDY A;  4ZL8 A;  5B8A A;  5ECH B;  4OO4 A;  4MNN A;  3IAM 2;  3IC8 A;  5CRE A;  4POL A;  1Y25 A;  1ACV A;  5EVO A;  4XTS A;  3IE3 A;  3M9J A;  2WS2 A;  4NV2 A;  2XBQ A;  1U88 A;  4IP6 A;  4WBJ A;  5F8B A;  1KEB A;  4AJ7 A;  4IW9 A;  4DVC A;  3TOT A;  2GVP A;  1DE2 A;  4POK A;  2A2P A;  4LL1 B;  5DVB A;  2GSR A;  3ZL5 A;  3ZVJ D;  4L0W A;  2X4A A;  4IP1 A;  3RBT A;  5IMD A;  1SKW B;  1KTE A;  2CZ3 A;  1G7O A;  4KUN A;  4LA1 A;  4OD7 A;  4D73 A;  4G0I A;  3ZRD A;  1S3A A;  5IMV A;  2FA4 A;  2DJ2 A;  2AJQ B;  2VCX A;  5CO3 A;  2JAD A;  4OFN A;  2WFC A;  4IQ1 A;  3E3E A;  4WET A;  1SD8 A;  1M99 A;  3L4N A;  3HDC A;  3F3Q A;  5DCG A;  3MNG A;  1OC8 A;  3D4T A;  2H70 A;  4IVF A;  2H66 A;  2ON5 A;  3D6I A;  4V1A g;  3VWV A;  1EP8 A;  4K2X A;  12GS A;  3LYK A;  4AJ6 A;  1BYE A;  1TI3 A;  1JLW A;  5ECM B;  1B4P A;  4PNF A;  5ECQ B;  2PWJ A;  3APS A;  4GF0 A;  3LOR A;  2KOK A;  4ZL7 A;  4GLT A;  2C0G A;  2M80 A;  5ECK B;  1VGL A;  1U6T A;  3ISO A;  1X5D A;  4KB3 A;  3RAZ A;  3H8Q A;  2YNX A;  4EVM A;  1GSU A;  3A2V A;  3MWH A;  2GQM A;  3F9U A;  4V2N A;  4EO3 A;  2K8V A;  3TJF A;  3GKK A;  3WGD A;  1GLQ A;  4XHM A;  1PN0 A;  5GST A;  4DSS B;  2H75 A;  4V2L A;  4N11 A;  2ZNM A;  2RLI A;  1ZOF A;  2H6X A;  5J3R A;  3HJM A;  4X43 A;  1OKT A;  3O6T A;  1GTU A;  2MMA A;  2R0C A;  1MDK A;  1ZCP A;  2LRT A;  2X8G A;  2QA2 A;  1OKD A;  3ZMK A;  2VD1 A;  2F3M A;  2LKU A;  3QMX A;  3ERG A;  3IR4 A;  4Q5R A;  1F3B A;  2HXK A;  3GKN A;  4ID0 A;  2E2M A;  2C4J A;  5AN1 A;  3V1W A;  5ID2 B;  4EIP A;  2HSM A;  1A2L A;  3VK9 A;  1DE1 A;  4X1U A;  1K0N A;  5G31 A;  2D2Z A;  2MBT A;  5IO0 A;  2V1M A;  1GSF A;  4ZIJ A;  3Q19 A;  2YV9 A;  1WPI A;  3HYP A;  3KZQ A;  1MTC A;  2LS5 A;  3G7Y A;  2BMX A;  1GUK A;  2CAI A;  4QQ7 A;  3PIN A;  2KLX A;  2GGT A;  3EUR A;  3IOS A;  3KCM A;  4KND A;  4WR4 A;  4DSQ A;  2JZT A;  4MK3 A;  3F0I A;  3P90 A;  5IOW A;  4LLR A;  1J9B A;  5JWQ B;  5ECL B;  3ZZX A;  2RII A;  1G6W A;  1O8X A;  4RI7 A;  2WDU A;  1O73 A;  3QDN A;  4O32 A;  1RQM A;  3HKR A;  2LNT A;  3LSZ A;  5AIS A;  2FWG A;  5IIZ A;  2V6O A;  5HR2 A;  4XIH A;  5E59 A;  3GTU A;  3EMX A;  4CW9 A;  1AXD A;  3L9V A;  4ML1 A;  3DKS A;  3ZRE A;  3UVT A;  4KAE A;  3GMF A;  3I6A A;  1AQX A;  3LQ7 A;  4FQU A;  2VCZ A;  1AIU A;  3DIE A;  3HXS A;  5E4W A;  5IPG A;  3KMN A;  3WD6 A;  2EIO A;  2VO4 A;  4TR1 A;  5IM9 A;  1F6M C;  5GAN D;  2IJY A;  4TOP A;  1K0C A;  2GZP A;  1AAZ A;  2JSY A;  2N5A A;  1TU7 A;  3D22 A;  2H19 A;  1SYX A;  4KDY A;  1FW1 A;  3J7Y k;  3D0Z A;  3EWL A;  3DML A;  2OJL A;  2JU5 A;  3K8N A;  4POB A;  1NW2 A;  5DAK B;  1LJR A;  3M0F A;  1K0D A;  2I9H A;  3A5W A;  3D21 A;  4DSR A;  2R6K A;  1VF2 A;  1WOU A;  3TKS C;  22GS A;  1T4Z A;  1YQ1 A;  2R37 A;  2WCI A;  4ICY A;  2H1G A;  2PBJ A;  3F4S A;  2IMD A;  2REM A;  4MF7 A;  1HNC A;  2L59 A;  1A0R P;  3KM6 A;  2M72 A;  2DJJ A;  2RM5 A;  2C3Q A;  1BAY A;  2H1B A;  1R7H A;  3BBY A;  4OO5 A;  2MMO A;  1OVN A;  2FGX A;  4ISD A;  4O5Q A;  1FHE A;  4BVX A;  3WGX A;  4MMM A;  2H6Z A;  2GST A;  3GKX A;  2DKH A;  3DVX A;  2H0H A;  1T7P B;  2K9F A;  2AHE A;  2C0F A;  1XW9 A;  3HCZ A;  3TRQ A;  1WWJ A;  1NSW A;  3WT2 A;  1PMT A;  4CY8 A;  2HFD A;  4YKF A;  2C3T A;  2AUV A;  1XCC A;  4K7N A;  2AV4 A;  2C1Y A;  1GSS A;  1ZYE A;  2I1U A;  4F2I A;  5G1L A;  3FZ5 A;  3IBH A;  1PX6 A;  3GST A;  2DBC A;  1Z9H A;  3TUE A;  4F0C A;  9GSS A;  2WB9 A;  4WXT A;  3S9F A;  2TIR A;  3UAP A;  2FLS A;  3VPT A;  3A5I A;  3FKF A;  3VFI A;  3SWL A;  4TKY A;  1R26 A;  3ZIV A;  2GTU A;  3DXB A;  4I2U A;  2R5G A;  3EC3 A;  3ZFL A;  2H71 A;  2LST A;  3DRN A;  2GSQ A;  4TXO B;  2MZC A;  2PN8 A;  1ILO A;  3DD3 A;  4HUA A;  1EWX A;  2TRC P;  2L4Q A;  3CQF A;  1XVQ A;  1Z6N A;  2AAW A;  2H0I A;  1VF1 A;  5GSS A;  2FNO A;  2Z9S A;  1U87 A;  1V2A A;  2XHF A;  1EGO A;  2VD0 A;  3FW2 A;  2G2Q A;  1JZW A;  1USB A;  3TGZ A;  5EL8 A;  17GS A;  4FIW A;  4XS4 B;  3EIN A;  1MD3 A;  1XWC A;  1ZMA A;  6GSU A;  1A8Y A;  2VOC A;  1F2E A;  5G5F A;  2CV4 A;  2YN1 A;  2DIZ A;  4KDU A;  1Z5Y E;  2MMN A;  1THX A;  3UVH A;  2HZF A;  1TDI A;  3RPN A;  1O7U A;  2H8L A;  2RUF A;  3IA1 A;  5LNK e;  4MZC A;  2OAD A;  2QSI A;  3FR3 A;  4WR5 A;  2LJA A;  3C1R A;  4EE0 A;  2FD3 A;  4QL7 A;  2LQQ A;  2QC7 A;  3VPQ A;  3GYK A;  4K7O A;  4ACS A;  4KGI A;  3KGK A;  1T8E B;  1YEX A;  1QGV A;  4HZ2 A;  3C71 A;  3GKM A;  4BA7 A;  1BG5 A;  2LUS A;  1X9S B;  4GST A;  1N8J A;  2F51 A;  4CY6 A;  3FR6 A;  2HYX A;  4HJM A;  5LD0 A;  1TJD A;  2L5O A;  16GS A;  4KDX A;  1A23 A;  5J41 A;  3SBC A;  3EVI A;  2VLV A;  4X4J A;  2CAQ A;  2HRA A;  4RQX A;  1X5C A;  2AB6 A;  4KW6 A;  1TP9 A;  1Z7P A;  1TKD B;  1FB6 A;  1K3O A;  4NXI A;  1SKR B;  2LEG A;  3KD0 A;  5CRH A;  3R3E A;  1MEK A;  4O5R A;  1M3J A;  2H1D A;  2PER A;  3GL3 A;  1GSY A;  1SD9 A;  4TR4 A;  3TJJ A;  2K6V A;  3HY2 A;  3GUS A;  2VM1 A;  1GSE A;  3U6V A;  3H4K A;  3MSZ A;  2EIQ A;  2VL2 A;  3FRC A;  5H5Q A;  2YCD A;  1XZO A;  1YDK A;  3ZML A;  2VL9 A;  3C73 A;  1E2Y A;  2CT6 A;  2FY6 A;  2CVD A;  5ECS A;  4MDC A;  3LG6 A;  1XG8 A;  1QMV A;  1TK8 B;  5D96 A;  3JCM L;  5A4V A;  5KOW A;  3M1G A;  4GQF A;  2PPT A;  2QKE A;  1PRX A;  4OCF A;  1ERV A;  1V9W A;  3CSJ A;  4YAP A;  1EV4 A;  2YJH A;  3HVX A;  4HI7 A;  5F05 A;  4ZB6 A;  2HSH A;  3I9V 2;  2F8A A;  4EUY A;  2FWE A;  1XWB A;  5C00 A;  3E0U A;  1SL1 B;  5IPH A;  5DDL A;  2HRK A;  1OE7 A;  6GSX A;  4YQU A;  2R0G A;  2HE3 A;  3M9K A;  3BCI A;  3LW9 A;  3TKQ A;  5G1K A;  1DSB A;  4TW5 A;  5CYY A;  1GH2 A;  4O92 A;  1XBS A;  5FWG A;  3GNJ A;  4E8E A;  1A24 A;  2IFQ B;  1SKS B;  4PUF C;  2CZ2 A;  3TRX A;  3EYT A;  2H30 A;  4HEA 2;  2X99 A;  5ECR B;  3ERF A;  3CBU A;  1DBY A;  3FY7 A;  5C04 A;  1E6B A;  3TKS E;  5B7C A;  4MP4 A;  5HR1 A;  5CRD A;  3TJB A;  3A3T A;  4TR3 A;  1TW9 A;  6GST A;  1GTB A;  4G9H A;  3IHQ A;  4GQC A;  4CDO A;  1ZGN A;  3ZTL A;  1XWK A;  4JBB A;  3DEX A;  3GN3 A;  1TI1 A;  11GS A;  2C0E A;  2L6C A;  4XRA A;  1ABA A;  2DKI A;  5A4W A;  3QOU A;  4RQR A;  1YKA A;  3CTG A;  1TRU A;  3PPU A;  2PUK C;  1GUM A;  4N0Z A;  4I6X A;  2B5X A;  3ME7 A;  4K6X A;  1OAZ A;  3D4M A;  2R4V A;  1BJX A;  1YF1 A;  3AY8 A;  4ZBD A;  3VWW A;  1SL0 B;  4TXO A;  2PVO C;  5L71 A;  3UL3 A;  2JZR A;  1KNG A;  2L4C A;  2IL3 A;  5ELG A;  1TOF A;  1IYH A;  4J2F A;  2MMZ A;  3CRU A;  5FT3 A;  2M46 A;  2C3N A;  2YZU A;  4N30 A;  2YWI A;  1GTI A;  1SK1 A;  2B7J A;  1WJK A;  3I43 A;  5IMC A;  6GSV A;  2VCV A;  2YV7 A;  1S3D A;  1Q4J A;  19GS A;  2IPA A;  3KH7 A;  1WIK A;  4HSC X;  13GS A;  2DJ3 A;  3FR9 A;  4K1F A;  3M3M A;  5GZZ B;  1WP0 A;  2DJ0 A;  1AUC A;  3CXG A;  5AIX A;  2H1A A;  1C72 A;  5G2Z A;  2VIM A;  4L5O A;  4KE3 A;  4PQ1 A;  4KA0 A;  4XS4 A;  4HS1 A;  5DCH A;  2IMF A;  1RK4 A;  4NAX A;  1YJ6 A;  3GV1 A;  3HVS A;  2K18 A;  1PN9 A;  1Z3E A;  2FWH A;  2JZS A;  4JU5 A;  1VF3 A;  1T3B A;  1ZZY A;  3TJG A;  4IJ3 A;  2CX3 A;  4XRD A;  2HNL A;  1O85 A;  1PKZ A;  3HD5 A;  1V40 A;  4NHW A;  1QXH A;  3LWA A;  4PXO A;  2PU9 C;  2H74 A;  2OE3 A;  1FG4 A;  3ERW A;  1H4O A;  3BD2 A;  1O81 A;  2DJK A;  3FHK A;  1OC9 A;  2GT5 A;  1M9B A;  5F06 A;  1EOH A;  2I3Y A;  3UEM A;  5HFK A;  1S3C A;  4BWS A;  3GIX A;  2YZH A;  4HU7 A;  2YWN A;  3GFK A;  3HHV A;  5INY A;  1GUL A;  1ZL9 A;  3DVW A;  2HT9 A;  4BVY B;  3GA4 A;  3EE2 A;  1SJZ A;  1PQN A;  5DQY A;  1FVJ A;  2LJR A;  5ECI B;  2HZE B;  4GSN A;  3EU4 A;  1QUW A;  2FUG 2;  4YQM A;  1TRV A;  5CNW A;  3GH9 A;  1B48 A;  2BJX A;  3PH9 A;  1V57 A;  3P8W A;  1TRS A;  3H79 A;  3HJP A;  1B4Q A;  4JZQ A;  2K8S A;  5ABR A;  4ILF A;  1FOV A;  1Y6E A;  1AQW A;  3QAV A;  3UIW A;  3TRP A;  1HNB A;  1G7E A;  1FB0 A;  1B9X C;  2DSA A;  5DJM A;  18GS A;  1ON4 A;  1WE0 A;  3HJO A;  4RI6 A;  4HDE A;  2HRF A;  1ML6 A;  5HQP A;  3VUR A;  3UAR A;  4E8H A;  3ZVJ A;  1GP1 A;  4NPB A;  1GTA A;  2XPD A;  2X8H A;  3TOU A;  2VCW A;  2FWF A;  3FEU A;  1AW9 A;  2X49 A;  3MDK A;  4RUV A;  5B6N A;  2RM6 A;  2GDR A;  2VLU A;  1YY7 A;  3IC4 A;  4BL7 B;  2UZ8 A;  3BCK A;  4MH3 A;  3UMA A;  3LEF A;  4ML6 A;  1ERT A;  1J08 A;  3U5R E;  4MAB A;  3WYW A;  1BX9 A;  2KHP A;  4K8M A;  2B1K A;  3HVN A;  1TXX A;  4L8E A;  1GNE A;  5H5S A;  1R4W A;  3KP8 A;  4JR6 A;  3IHG A;  2VLT A;  4I8B A;  4PGT A;  4QL9 A;  2AYT A;  3CRT A;  4EL1 A;  5HR3 A;  2B1L A;  3LXZ A;  2MBS A;  1HD2 A;  1A2J A;  4TRX A;  3ZIJ A;  2IWT A;  1O8W A;  2YOI A;  4BIK A;  2LRN A;  4PQH A;  4WEY A;  2V6K A;  4WF5 A;  2VCT A;  2IFQ A;  3G7J A;  3GX8 A;  4Z2R A;  1YZX A;  2V2G A;  2X64 A;  1EEJ A;  5ECO B;  1PKW A;  3WT1 A;  3GX0 A;  3FYG A;  3L9U A;  4KF9 A;  1PFO A;  4DSS A;  4BWQ A;  2OKA A;  4Q5Q A;  3IAS 2;  2FA8 A;  1THO A;  1X5E A;  3TCO A;  1XWA A;  4ULX A;  1A8L A;  3VLN A;  2QA1 A;  1T00 A;  4HZ4 A;  1FAA A;  3F4R A;  3QAG A;  1H75 A;  6GSY A;  3DWV A;  4WF4 A;  2R0P A;  4IEL A;  5B8B A;  1BED A;  1PL2 A;  3RHC A;  1PX7 A;  2ES7 A;  5ID2 A;  4IJI A;  2XC2 A;  1U3A A;  4MJB A;  2R2J A;  4ECB A;  3CMI A;  4O5U A;  7GSS A;  4K5R A;  2CX4 A;  2DIY A;  4EC0 A;  5D73 A;  1A2M A;  4MLY A;  2C80 A;  3TJK A;  4DEJ A;  2IIY A;  1F37 A;  4K0G A;  1IYI A;  4EXJ A;  4EF0 A;  3CTF A;  4XS1 A;  1PD2 1;  5JWR B;  1K0B A;  3UJ1 A;  2O7K A;  3H1N A;  4GRF A;  3KEB A;  3EU3 A;  2F8F A;  1GWC A;  2P31 A;  4NV5 A;  4K5S A;  1Q98 A;  5D9W A;  3ED3 A;  1GUH A;  1ERU A;  2J9H A;  3LXT A;  1NM3 A;  5IMZ A;  3FK8 A;  3W8J A;  4MPF A;  2GQL A;  5J5N A;  2VL2 C;  1MDI A;  5CRW A;  2YWM A;  2OBI A;  3GSS A;  1ZYN A;  4JR4 A;  5KOX A;  4ECC A;  2PMT A;  1EOG A;  1X9W B;  2YPM A;  1M2B A;  5D8I A;  3M8N A;  5LCZ A;  1YF0 A;  1JLV A;  1LBK A;  4GXZ A;  1CQH A;  1SJI A;  3GH6 A;  3FZ9 A;  5DJL A;  2ON7 A;  3IRA A;  4IS0 A;  5IO2 A;  2I81 A;  3LGC A;  1SEN A;  4K7I A;  5CP1 A;  1JHB A;  3IPZ A;  3GRX A;  3HA9 A;  1T1V A;  4HJ2 A;  1EP7 A;  3Q18 A;  3KJY A;  3GL5 A;  4KH7 A;  2A2R A;  1M7T A;  5CAX A;  3NIV A;  3US3 A;  3QFB C;  4TXV A;  1M9A A;  4TN8 A;  4BVY A;  1ZYQ B;  3J7Y b;  1X0R A;  2B7K A;  2O87 A;  2H0G A;  2P5Q A;  1SJ6 A;  1JZD A;  1GSD A;  4KCE A;  2HZE A;  4OCE A;  5EPF A;  2H72 A;  5H5R A;  3BOA A;  3TB2 A;  5DAK A;  2B5Y A;  2IMI A;  1KBN A;  1DUG A;  3NOF A;  1S3R A;  3EMP A;  1X9M B;  1G0T A;  4I97 A;  5KN1 A;  1MDJ A;  2IMK A;  3TKR A;  2MYG A;  2KUC A;  3Q6O A;  3W8S A;  2HI7 A;  3C8E A;  3PR8 A;  1NHY A;  4ZBA A;  2L5L A;  4BVX B;  4ECI A;  3VI5 A;  3RDW A;  4LL4 B;  4JE1 A;  5ECN B;  3KP9 A;  1SK2 A;  3IDV A;  2LNS A;  4O7H A;  2H6Y A;  2GS3 A;  4OFT A;  1PSQ A;  3IK9 A;  1MD4 A;  2LJK A;  5JCW A;  1W4V A;  2YJ7 A;  4Z2T A;  2NBS A;  3UOM A;  5ECP B;  14GS A;  4YH2 A;  1TTZ A;  4GTU A;  4BL7 A;  1XW5 A;  1GNW A;  5JWO B;  4Z7X A;  2YAN A;  5D9X A;  4ZL9 A;  4FYC A;  4G0K A;  4ZB8 A;  1GLP A;  2L6D A;  2DJ1 A;  3P2A A;  4TVE A;  2KP1 A;  4I5Q A;  2WRT A;  3FZ4 A;  2EC4 A;  4F82 A;  4P3Y B;  4ZIL A;  5J9C A;  5DQS A;  5D9V A;  2FCH A;  2GQK A;  4AF2 A;  3F63 A;  3IK7 A;  1JZR A;  2VCQ A;  4Q5F A;  5JCU A;  4CHS A;  2OA7 A;  1T4Y A;  5JCG A;  2NTO A;  3QFA C;  1CQG A;  2PGT A;  20GS A;  1HQO A;  1V58 A;  1TU8 A;  3HZ4 A;  4IBP A;  5DAL B;  2JAC A;  4IKH A;  3H93 A;  4WBR D;  3VWX A;  3NZN A;  4MF6 A;  2HRN A;  3C7M A;  4FH8 A;  5A4U A;  1M3I A;  3F6F A;  2E7P A;  4N0V A;  2DML A;  3LYP A;  4YAV A;  2G0F A;  3HVV A;  5HFG A;  2B3S A;  1I9D A;  3CSI A;  4G2E A;  4YQV A;  5KN3 A;  3LJR A;  2IME A;  3MIX A;  4H86 A;  4AGS A;  4FO5 A;  4AJ8 A;  2JSZ A;  3FZA A;  3CYN A;  1W89 A;  2DC5 A;  1AQV A;  5IMF A;  4PX1 A;  6GSS A;  1R5P A;  1F9M A;  1UA5 A;  4KX4 A;  4ZB9 A;  1ZYP A;  1XOA A;  3Q74 A;  4NWY A;  2NVL A;  3KH9 A;  3W6G A;  4Q5N A;  4F03 A;  4MCU A;  4HU9 A;  1V98 A;  4HOJ A;  2CVK A;  3A2X A;  3G7I A;  3TKP A;  5G5E A;  2C8U A;  1NHO A;  1YEP A;  2O8V B;  1UC7 A;  4TR0 A;  4HQZ A;  1K0A A;  2KP2 A;  1QFN A;  3G9B A;  4BPY A;  2R3X A;  1OYJ A;  4G10 A;  1GL8 A;  5DBQ A;  3RPP A;  4EKZ A;  3MAK A;  3CSH A;  4KCA A;  5CRG A;  4IN0 A;  4MH2 A;  3EPT A;  1UVZ A;  5A5K A;  4K0N A;  4KSO A;  5BMU A;  2X8C A;  4XS6 A;  5D93 A;  4G0L A;  3WGE A;  2OE0 A;  1A0F A;  1EEM A;  2GT6 A;  4I2T A;  2HSY A;  3ZLP A;  5IOX A;  1K0O A;  1FVK A;  2N5F A;  2VAF A;  5F07 A;  4GCI A;  3O3T A;  3UBK A;  3N9J A;  2GZZ A;  3QPM A;  3IXR A;  4MA9 A;  5FHI A;  3HZ8 A;  3MYD A;  5IMA A;  3ZYW A;  5ELA A;  4X0X A;  5EY6 A;  3L78 A;  5COH A;  2XBI A;  2E2G A;  4NHZ A;  1QQ2 A;  4D73 B;  4L0U A;  4OMV A;  5F0G A;  3TDG A;  4IHU A;  1K3L A;  2HLS A;  3OR5 A;  2ALB A;  5KN2 A; 
#chains in the Genus database with same CATH homology
 3ZFB A;  4PUR A;  2NPB A;  4V1A p;  2PVQ A;  3DYR A;  2OBK A;  3F4T A;  3L0H A;  3RHB A;  1RW1 A;  4Z2U A;  1I5G A;  3KTL A;  10GS A;  1SL2 B;  1EZK A;  4JRR A;  1FO5 A;  5KEJ A;  1O6J A;  2I4A A;  1VRS D;  1M0U A;  2N5B A;  4GSS A;  3QCP A;  4ZXG A;  1OE8 A;  1XPV A;  3R2Q A;  1F3A A;  1B8X A;  2LRC A;  1TK0 B;  3L9S A;  1Z6M A;  5AIV A;  5KN0 A;  3TKS A;  2YWO A;  2V32 A;  4FYB A;  2L57 A;  1LU4 A;  3E9J B;  4PUA A;  4L5L A;  1GSQ A;  1PGT A;  2WUL A;  5AGY A;  1HNA A;  3KIJ A;  1JFU A;  3VWU A;  2CA8 A;  2GLR A;  1XW6 A;  5J4U A;  4JED A;  4V2M A;  4ECJ A;  5GAP D;  4MZB A;  1J0F A;  6GSW A;  2VL3 A;  1SK0 A;  3VI7 A;  5G30 A;  2RUE A;  3O76 A;  2GZY A;  4OFM A;  4YKG A;  5ENU A;  4MJE A;  1QK8 A;  2IN3 A;  1UN2 A;  4GWR A;  3C1S A;  1ST9 A;  4XCS A;  1R5A A;  1BQ7 A;  4POM A;  2VM2 A;  3GHA A;  2E0Q A;  2DMM A;  3BJ5 A;  1GRX A;  1OC3 A;  3GUR A;  3A2W A;  4EDZ A;  1JZO A;  1M2D A;  2A4H A;  2FHE A;  1XVW A;  4IGJ A;  4EIQ A;  1SYR A;  2CVB A;  4J57 E;  4LMW A;  3QR6 A;  2A4V A;  1EGR A;  4PQI A;  2QGV A;  2WGR A;  1U3I A;  2LV3 A;  2LQO A;  2O85 A;  4J56 E;  1AC1 A;  2V41 A;  2H73 A;  1Z7R A;  2B6M A;  2H76 A;  1WRY A;  1SU9 A;  2EIR A;  4KSM A;  3I69 A;  5HR0 A;  2OAC A;  8GSS A;  3KTB A;  1URM A;  2J23 A;  3F8U A;  4MJA A;  1XIY A;  3ZIT A;  2JL4 A;  2GSS A;  3UBL A;  1YKC A;  4MZW A;  5DAL A;  2NDO A;  5D9T A;  3FMW A;  2WZ9 A;  4PTS A;  1WMJ A;  4MF5 A;  4N10 A;  2C0D A;  1M2A A;  2OE1 A;  3QD9 A;  1EV9 A;  4ZBB A;  4MPG A;  1K0M A;  1XOB A;  2TRX A;  2YP6 A;  4MJC A;  3QAW A;  4HQS A;  2WJU A;  4LMV A;  2F9S A;  3P7X A;  1XXU A;  1PL1 A;  2BTO T;  2XPE A;  1FOH A;  1TRW A;  5BRT A;  4G19 A;  4A5P A;  5IQY A;  2CQ9 A;  4NMU A;  3APO A;  2O89 A;  3IV4 A;  5HFI A;  4F9Z A;  2VUP A;  4PNG A;  1B9Y C;  4WKW A;  3GTU B;  4K9Z A;  3D5J A;  1XWG A;  3LFL A;  3N5O A;  2H01 A;  4USS A;  2ZUP A;  1TK5 B;  1PA3 A;  5J9B A;  3DGQ A;  4FYU A;  4IQA A;  4K2D A;  2ZCT A;  1HYU A;  2P0G A;  2B5E A;  1OC9 B;  1VF4 A;  1N2A A;  3PGT A;  2LTK A;  1ERW A;  4TR1 B;  5B6M A;  3ME8 A;  2P5R A;  3F6D A;  2DLX A;  3KMO A;  3APQ A;  4OWY A;  3KXO A;  2A2S A;  1XFL A;  4F0B A;  1G6Y A;  3F3R A;  1K3Y A;  4EDY A;  4ZL8 A;  5B8A A;  5ECH B;  4OO4 A;  4MNN A;  3IAM 2;  3IC8 A;  5CRE A;  4POL A;  1Y25 A;  1ACV A;  5EVO A;  4XTS A;  3IE3 A;  3M9J A;  2WS2 A;  4NV2 A;  2XBQ A;  1U88 A;  4IP6 A;  4WBJ A;  5F8B A;  1KEB A;  4AJ7 A;  4IW9 A;  4DVC A;  3TOT A;  2GVP A;  1DE2 A;  4POK A;  2A2P A;  4LL1 B;  5DVB A;  2GSR A;  3ZL5 A;  3ZVJ D;  4L0W A;  2X4A A;  4IP1 A;  3RBT A;  5IMD A;  1SKW B;  1KTE A;  2CZ3 A;  1G7O A;  4KUN A;  4LA1 A;  4OD7 A;  4D73 A;  4G0I A;  3ZRD A;  1S3A A;  5IMV A;  2FA4 A;  2DJ2 A;  2AJQ B;  2VCX A;  5CO3 A;  2JAD A;  4OFN A;  2WFC A;  4IQ1 A;  3E3E A;  4WET A;  1SD8 A;  1M99 A;  3L4N A;  3HDC A;  3F3Q A;  5DCG A;  3MNG A;  1OC8 A;  3D4T A;  2H70 A;  4IVF A;  2H66 A;  2ON5 A;  3D6I A;  4V1A g;  3VWV A;  1EP8 A;  4K2X A;  12GS A;  3LYK A;  4AJ6 A;  1BYE A;  1TI3 A;  1JLW A;  5ECM B;  1B4P A;  4PNF A;  5ECQ B;  2PWJ A;  3APS A;  4GF0 A;  3LOR A;  2KOK A;  4ZL7 A;  4GLT A;  2C0G A;  2M80 A;  5ECK B;  1VGL A;  1U6T A;  3ISO A;  1X5D A;  4KB3 A;  3RAZ A;  3H8Q A;  2YNX A;  4EVM A;  1GSU A;  3A2V A;  3MWH A;  2GQM A;  3F9U A;  4V2N A;  4EO3 A;  2K8V A;  3TJF A;  3GKK A;  3WGD A;  1GLQ A;  4XHM A;  1PN0 A;  5GST A;  4DSS B;  2H75 A;  4V2L A;  4N11 A;  2ZNM A;  2RLI A;  1ZOF A;  2H6X A;  5J3R A;  3HJM A;  4X43 A;  1OKT A;  3O6T A;  1GTU A;  2MMA A;  2R0C A;  1MDK A;  1ZCP A;  2LRT A;  2X8G A;  2QA2 A;  1OKD A;  3ZMK A;  2VD1 A;  2F3M A;  2LKU A;  3QMX A;  3ERG A;  3IR4 A;  4Q5R A;  1F3B A;  2HXK A;  3GKN A;  4ID0 A;  2E2M A;  2C4J A;  5AN1 A;  3V1W A;  5ID2 B;  4EIP A;  2HSM A;  1A2L A;  3VK9 A;  1DE1 A;  4X1U A;  1K0N A;  5G31 A;  2D2Z A;  2MBT A;  5IO0 A;  2V1M A;  1GSF A;  4ZIJ A;  3Q19 A;  2YV9 A;  1WPI A;  3HYP A;  3KZQ A;  1MTC A;  2LS5 A;  3G7Y A;  2BMX A;  1GUK A;  2CAI A;  4QQ7 A;  3PIN A;  2KLX A;  2GGT A;  3EUR A;  3IOS A;  3KCM A;  4KND A;  4WR4 A;  4DSQ A;  2JZT A;  4MK3 A;  3F0I A;  3P90 A;  5IOW A;  4LLR A;  1J9B A;  5JWQ B;  5ECL B;  3ZZX A;  2RII A;  1G6W A;  1O8X A;  4RI7 A;  2WDU A;  1O73 A;  3QDN A;  4O32 A;  1RQM A;  3HKR A;  2LNT A;  3LSZ A;  5AIS A;  2FWG A;  5IIZ A;  2V6O A;  5HR2 A;  4XIH A;  5E59 A;  3GTU A;  3EMX A;  4CW9 A;  1AXD A;  3L9V A;  4ML1 A;  3DKS A;  3ZRE A;  3UVT A;  4KAE A;  3GMF A;  3I6A A;  1AQX A;  3LQ7 A;  4FQU A;  2VCZ A;  1AIU A;  3DIE A;  3HXS A;  5E4W A;  5IPG A;  3KMN A;  3WD6 A;  2EIO A;  2VO4 A;  4TR1 A;  5IM9 A;  1F6M C;  5GAN D;  2IJY A;  4TOP A;  1K0C A;  2GZP A;  1AAZ A;  2JSY A;  2N5A A;  1TU7 A;  3D22 A;  2H19 A;  1SYX A;  4KDY A;  1FW1 A;  3J7Y k;  3D0Z A;  3EWL A;  3DML A;  2OJL A;  2JU5 A;  3K8N A;  4POB A;  1NW2 A;  5DAK B;  1LJR A;  3M0F A;  1K0D A;  2I9H A;  3A5W A;  3D21 A;  4DSR A;  2R6K A;  1VF2 A;  1WOU A;  3TKS C;  22GS A;  1T4Z A;  1YQ1 A;  2R37 A;  2WCI A;  4ICY A;  2H1G A;  2PBJ A;  3F4S A;  2IMD A;  2REM A;  4MF7 A;  1HNC A;  2L59 A;  1A0R P;  3KM6 A;  2M72 A;  2DJJ A;  2RM5 A;  2C3Q A;  1BAY A;  2H1B A;  1R7H A;  3BBY A;  4OO5 A;  2MMO A;  1OVN A;  2FGX A;  4ISD A;  4O5Q A;  1FHE A;  4BVX A;  3WGX A;  4MMM A;  2H6Z A;  2GST A;  3GKX A;  2DKH A;  3DVX A;  2H0H A;  1T7P B;  2K9F A;  2AHE A;  2C0F A;  1XW9 A;  3HCZ A;  3TRQ A;  1WWJ A;  1NSW A;  3WT2 A;  1PMT A;  4CY8 A;  2HFD A;  4YKF A;  2C3T A;  2AUV A;  1XCC A;  4K7N A;  2AV4 A;  2C1Y A;  1GSS A;  1ZYE A;  2I1U A;  4F2I A;  5G1L A;  3FZ5 A;  3IBH A;  1PX6 A;  3GST A;  2DBC A;  1Z9H A;  3TUE A;  4F0C A;  9GSS A;  2WB9 A;  4WXT A;  3S9F A;  2TIR A;  3UAP A;  2FLS A;  3VPT A;  3A5I A;  3FKF A;  3VFI A;  3SWL A;  4TKY A;  1R26 A;  3ZIV A;  2GTU A;  3DXB A;  4I2U A;  2R5G A;  3EC3 A;  3ZFL A;  2H71 A;  2LST A;  3DRN A;  2GSQ A;  4TXO B;  2MZC A;  2PN8 A;  1ILO A;  3DD3 A;  4HUA A;  1EWX A;  2TRC P;  2L4Q A;  1XVQ A;  1Z6N A;  2AAW A;  2H0I A;  1VF1 A;  5GSS A;  2FNO A;  2Z9S A;  1U87 A;  1V2A A;  2XHF A;  1EGO A;  2VD0 A;  3FW2 A;  2G2Q A;  1JZW A;  1USB A;  3TGZ A;  5EL8 A;  17GS A;  4FIW A;  4XS4 B;  3EIN A;  1MD3 A;  1XWC A;  1ZMA A;  6GSU A;  1A8Y A;  2VOC A;  1F2E A;  5G5F A;  2CV4 A;  2YN1 A;  2DIZ A;  4KDU A;  1Z5Y E;  2MMN A;  1THX A;  3UVH A;  2HZF A;  1TDI A;  3RPN A;  1O7U A;  2H8L A;  2RUF A;  3IA1 A;  5LNK e;  4MZC A;  2OAD A;  2QSI A;  3FR3 A;  4WR5 A;  2LJA A;  3C1R A;  4EE0 A;  2FD3 A;  4QL7 A;  2LQQ A;  2QC7 A;  3VPQ A;  3GYK A;  4K7O A;  4ACS A;  4KGI A;  3KGK A;  1T8E B;  1YEX A;  1QGV A;  4HZ2 A;  3C71 A;  3GKM A;  4BA7 A;  1BG5 A;  2LUS A;  1X9S B;  4GST A;  1N8J A;  2F51 A;  4CY6 A;  3FR6 A;  2HYX A;  4HJM A;  5LD0 A;  1TJD A;  2L5O A;  16GS A;  4KDX A;  1A23 A;  5J41 A;  3SBC A;  3EVI A;  2VLV A;  4X4J A;  2CAQ A;  2HRA A;  4RQX A;  1X5C A;  2AB6 A;  4KW6 A;  1TP9 A;  1Z7P A;  1TKD B;  1FB6 A;  1K3O A;  4NXI A;  1SKR B;  2LEG A;  3KD0 A;  5CRH A;  3R3E A;  1MEK A;  4O5R A;  2H1D A;  2PER A;  3GL3 A;  1GSY A;  1SD9 A;  4TR4 A;  3TJJ A;  2K6V A;  3HY2 A;  3GUS A;  2VM1 A;  1GSE A;  3U6V A;  3H4K A;  3MSZ A;  2EIQ A;  2VL2 A;  3FRC A;  5H5Q A;  2YCD A;  1XZO A;  1YDK A;  3ZML A;  2VL9 A;  3C73 A;  1E2Y A;  2CT6 A;  2FY6 A;  2CVD A;  5ECS A;  4MDC A;  3LG6 A;  1QMV A;  1TK8 B;  5D96 A;  3JCM L;  5A4V A;  5KOW A;  3M1G A;  4GQF A;  2PPT A;  2QKE A;  1PRX A;  4OCF A;  1ERV A;  1V9W A;  3CSJ A;  4YAP A;  1EV4 A;  2YJH A;  3HVX A;  4HI7 A;  5F05 A;  4ZB6 A;  2HSH A;  3I9V 2;  2F8A A;  4EUY A;  2FWE A;  1XWB A;  5C00 A;  3E0U A;  1SL1 B;  5IPH A;  5DDL A;  2HRK A;  1OE7 A;  6GSX A;  4YQU A;  2R0G A;  2HE3 A;  3M9K A;  3BCI A;  3LW9 A;  3TKQ A;  5G1K A;  1DSB A;  4TW5 A;  5CYY A;  1GH2 A;  4O92 A;  1XBS A;  5FWG A;  3GNJ A;  4E8E A;  1A24 A;  2IFQ B;  1SKS B;  4PUF C;  2CZ2 A;  3TRX A;  3EYT A;  2H30 A;  4HEA 2;  2X99 A;  5ECR B;  3ERF A;  3CBU A;  1DBY A;  3FY7 A;  5C04 A;  1E6B A;  3TKS E;  5B7C A;  4MP4 A;  5HR1 A;  5CRD A;  3TJB A;  3A3T A;  4TR3 A;  1TW9 A;  6GST A;  1GTB A;  4G9H A;  3IHQ A;  4GQC A;  4CDO A;  1ZGN A;  3ZTL A;  1XWK A;  4JBB A;  3DEX A;  3GN3 A;  1TI1 A;  11GS A;  2C0E A;  2L6C A;  4XRA A;  1ABA A;  2DKI A;  5A4W A;  3QOU A;  4RQR A;  1YKA A;  3CTG A;  1TRU A;  3PPU A;  2PUK C;  1GUM A;  4N0Z A;  4I6X A;  2B5X A;  3ME7 A;  4K6X A;  1OAZ A;  3D4M A;  2R4V A;  1BJX A;  1YF1 A;  3AY8 A;  4ZBD A;  3VWW A;  1SL0 B;  4TXO A;  2PVO C;  5L71 A;  3UL3 A;  2JZR A;  1KNG A;  2L4C A;  2IL3 A;  5ELG A;  1TOF A;  1IYH A;  4J2F A;  2MMZ A;  3CRU A;  5FT3 A;  2M46 A;  2C3N A;  2YZU A;  4N30 A;  2YWI A;  1GTI A;  1SK1 A;  2B7J A;  1WJK A;  3I43 A;  5IMC A;  6GSV A;  2VCV A;  2YV7 A;  1S3D A;  1Q4J A;  19GS A;  2IPA A;  3KH7 A;  1WIK A;  13GS A;  2DJ3 A;  3FR9 A;  4K1F A;  3M3M A;  5GZZ B;  1WP0 A;  2DJ0 A;  1AUC A;  3CXG A;  5AIX A;  2H1A A;  1C72 A;  5G2Z A;  2VIM A;  4L5O A;  4KE3 A;  4PQ1 A;  4KA0 A;  4XS4 A;  4HS1 A;  5DCH A;  2IMF A;  1RK4 A;  4NAX A;  1YJ6 A;  3GV1 A;  3HVS A;  2K18 A;  1PN9 A;  1Z3E A;  2FWH A;  2JZS A;  4JU5 A;  1VF3 A;  1T3B A;  1ZZY A;  3TJG A;  4IJ3 A;  2CX3 A;  4XRD A;  2HNL A;  1O85 A;  1PKZ A;  3HD5 A;  1V40 A;  4NHW A;  1QXH A;  3LWA A;  4PXO A;  2PU9 C;  2H74 A;  2OE3 A;  1FG4 A;  3ERW A;  1H4O A;  3BD2 A;  1O81 A;  2DJK A;  3FHK A;  1OC9 A;  2GT5 A;  1M9B A;  5F06 A;  1EOH A;  2I3Y A;  3UEM A;  5HFK A;  1S3C A;  4BWS A;  3GIX A;  2YZH A;  4HU7 A;  2YWN A;  3GFK A;  3HHV A;  5INY A;  1GUL A;  1ZL9 A;  3DVW A;  2HT9 A;  4BVY B;  3GA4 A;  3EE2 A;  1SJZ A;  1PQN A;  5DQY A;  1FVJ A;  2LJR A;  5ECI B;  2HZE B;  4GSN A;  3EU4 A;  1QUW A;  2FUG 2;  4YQM A;  1TRV A;  5CNW A;  3GH9 A;  1B48 A;  2BJX A;  3PH9 A;  1V57 A;  3P8W A;  1TRS A;  3H79 A;  3HJP A;  1B4Q A;  4JZQ A;  2K8S A;  5ABR A;  4ILF A;  1FOV A;  1Y6E A;  1AQW A;  3QAV A;  3UIW A;  3TRP A;  1HNB A;  1G7E A;  1FB0 A;  1B9X C;  2DSA A;  5DJM A;  18GS A;  1ON4 A;  1WE0 A;  3HJO A;  4RI6 A;  4HDE A;  2HRF A;  1ML6 A;  5HQP A;  3VUR A;  3UAR A;  4E8H A;  3ZVJ A;  1GP1 A;  4NPB A;  1GTA A;  2XPD A;  2X8H A;  3TOU A;  2VCW A;  2FWF A;  3FEU A;  1AW9 A;  2X49 A;  3MDK A;  4RUV A;  5B6N A;  2RM6 A;  2GDR A;  2VLU A;  1YY7 A;  3IC4 A;  4BL7 B;  2UZ8 A;  3BCK A;  4MH3 A;  3UMA A;  3LEF A;  4ML6 A;  1ERT A;  1J08 A;  3U5R E;  4MAB A;  3WYW A;  1BX9 A;  2KHP A;  4K8M A;  2B1K A;  1TXX A;  4L8E A;  1GNE A;  5H5S A;  1R4W A;  3KP8 A;  4JR6 A;  3IHG A;  2VLT A;  4I8B A;  4PGT A;  4QL9 A;  2AYT A;  3CRT A;  4EL1 A;  5HR3 A;  2B1L A;  3LXZ A;  2MBS A;  1HD2 A;  1A2J A;  4TRX A;  3ZIJ A;  2IWT A;  1O8W A;  2YOI A;  2LRN A;  4PQH A;  4WEY A;  2V6K A;  4WF5 A;  2VCT A;  2IFQ A;  3G7J A;  3GX8 A;  4Z2R A;  1YZX A;  2V2G A;  2X64 A;  1EEJ A;  5ECO B;  1PKW A;  3WT1 A;  3GX0 A;  3FYG A;  3L9U A;  4KF9 A;  4DSS A;  4BWQ A;  2OKA A;  4Q5Q A;  3IAS 2;  2FA8 A;  1THO A;  1X5E A;  3TCO A;  1XWA A;  4ULX A;  1A8L A;  3VLN A;  2QA1 A;  1T00 A;  4HZ4 A;  1FAA A;  3F4R A;  3QAG A;  1H75 A;  6GSY A;  3DWV A;  4WF4 A;  2R0P A;  4IEL A;  5B8B A;  1BED A;  1PL2 A;  3RHC A;  1PX7 A;  2ES7 A;  5ID2 A;  4IJI A;  2XC2 A;  1U3A A;  4MJB A;  2R2J A;  4ECB A;  3CMI A;  4O5U A;  7GSS A;  4K5R A;  2CX4 A;  2DIY A;  4EC0 A;  5D73 A;  1A2M A;  4MLY A;  2C80 A;  3TJK A;  4DEJ A;  2IIY A;  1F37 A;  4K0G A;  1IYI A;  4EXJ A;  4EF0 A;  3CTF A;  4XS1 A;  1PD2 1;  5JWR B;  1K0B A;  3UJ1 A;  2O7K A;  3H1N A;  4GRF A;  3KEB A;  3EU3 A;  2F8F A;  1GWC A;  2P31 A;  4NV5 A;  4K5S A;  1Q98 A;  5D9W A;  3ED3 A;  1GUH A;  1ERU A;  2J9H A;  3LXT A;  1NM3 A;  5IMZ A;  3FK8 A;  3W8J A;  4MPF A;  2GQL A;  5J5N A;  2VL2 C;  1MDI A;  5CRW A;  2YWM A;  2OBI A;  3GSS A;  1ZYN A;  4JR4 A;  5KOX A;  4ECC A;  2PMT A;  1EOG A;  1X9W B;  2YPM A;  1M2B A;  5D8I A;  3M8N A;  5LCZ A;  1YF0 A;  1JLV A;  1LBK A;  4GXZ A;  1CQH A;  1SJI A;  3GH6 A;  3FZ9 A;  5DJL A;  2ON7 A;  3IRA A;  4IS0 A;  5IO2 A;  2I81 A;  3LGC A;  1SEN A;  4K7I A;  5CP1 A;  1JHB A;  3IPZ A;  3GRX A;  3HA9 A;  1T1V A;  4HJ2 A;  1EP7 A;  3Q18 A;  3KJY A;  3GL5 A;  4KH7 A;  2A2R A;  1M7T A;  5CAX A;  3NIV A;  3US3 A;  3QFB C;  4TXV A;  1M9A A;  4TN8 A;  4BVY A;  1ZYQ B;  3J7Y b;  1X0R A;  2B7K A;  2O87 A;  2H0G A;  2P5Q A;  1SJ6 A;  1JZD A;  1GSD A;  4KCE A;  2HZE A;  4OCE A;  5EPF A;  2H72 A;  5H5R A;  3BOA A;  3TB2 A;  5DAK A;  2B5Y A;  2IMI A;  1KBN A;  1DUG A;  3NOF A;  3EMP A;  1X9M B;  1G0T A;  4I97 A;  5KN1 A;  1MDJ A;  2IMK A;  3TKR A;  2MYG A;  2KUC A;  3Q6O A;  3W8S A;  2HI7 A;  3C8E A;  3PR8 A;  1NHY A;  4ZBA A;  2L5L A;  4BVX B;  4ECI A;  3VI5 A;  3RDW A;  4LL4 B;  4JE1 A;  5ECN B;  3KP9 A;  1SK2 A;  3IDV A;  2LNS A;  4O7H A;  2H6Y A;  2GS3 A;  4OFT A;  1PSQ A;  3IK9 A;  1MD4 A;  2LJK A;  5JCW A;  1W4V A;  2YJ7 A;  4Z2T A;  2NBS A;  3UOM A;  5ECP B;  14GS A;  4YH2 A;  1TTZ A;  4GTU A;  4BL7 A;  1XW5 A;  1GNW A;  5JWO B;  4Z7X A;  2YAN A;  5D9X A;  4ZL9 A;  4FYC A;  4G0K A;  4ZB8 A;  1GLP A;  2L6D A;  2DJ1 A;  3P2A A;  4TVE A;  2KP1 A;  4I5Q A;  2WRT A;  3FZ4 A;  2EC4 A;  4F82 A;  4P3Y B;  4ZIL A;  5J9C A;  5DQS A;  5D9V A;  2FCH A;  2GQK A;  4AF2 A;  3F63 A;  3IK7 A;  1JZR A;  2VCQ A;  4Q5F A;  5JCU A;  4CHS A;  2OA7 A;  1T4Y A;  5JCG A;  2NTO A;  3QFA C;  1CQG A;  2PGT A;  20GS A;  1HQO A;  1V58 A;  1TU8 A;  3HZ4 A;  4IBP A;  5DAL B;  2JAC A;  4IKH A;  3H93 A;  4WBR D;  3VWX A;  3NZN A;  4MF6 A;  2HRN A;  3C7M A;  4FH8 A;  5A4U A;  3F6F A;  2E7P A;  4N0V A;  2DML A;  3LYP A;  4YAV A;  2G0F A;  3HVV A;  5HFG A;  2B3S A;  1I9D A;  3CSI A;  4G2E A;  4YQV A;  5KN3 A;  3LJR A;  2IME A;  3MIX A;  4H86 A;  4AGS A;  4FO5 A;  4AJ8 A;  2JSZ A;  3FZA A;  3CYN A;  1W89 A;  2DC5 A;  1AQV A;  5IMF A;  4PX1 A;  6GSS A;  1R5P A;  1F9M A;  1UA5 A;  4KX4 A;  4ZB9 A;  1ZYP A;  1XOA A;  3Q74 A;  4NWY A;  2NVL A;  3KH9 A;  3W6G A;  4Q5N A;  4F03 A;  4MCU A;  4HU9 A;  1V98 A;  4HOJ A;  2CVK A;  3A2X A;  3G7I A;  3TKP A;  5G5E A;  2C8U A;  1NHO A;  1YEP A;  2O8V B;  1UC7 A;  4TR0 A;  4HQZ A;  1K0A A;  2KP2 A;  1QFN A;  3G9B A;  4BPY A;  2R3X A;  1OYJ A;  4G10 A;  1GL8 A;  5DBQ A;  3RPP A;  4EKZ A;  3MAK A;  3CSH A;  4KCA A;  5CRG A;  4IN0 A;  4MH2 A;  3EPT A;  1UVZ A;  5A5K A;  4K0N A;  4KSO A;  5BMU A;  2X8C A;  4XS6 A;  5D93 A;  4G0L A;  3WGE A;  2OE0 A;  1A0F A;  1EEM A;  2GT6 A;  4I2T A;  2HSY A;  3ZLP A;  5IOX A;  1K0O A;  1FVK A;  2N5F A;  2VAF A;  5F07 A;  4GCI A;  3O3T A;  3UBK A;  3N9J A;  2GZZ A;  3QPM A;  3IXR A;  4MA9 A;  5FHI A;  3HZ8 A;  3MYD A;  5IMA A;  3ZYW A;  5ELA A;  4X0X A;  5EY6 A;  3L78 A;  5COH A;  2XBI A;  2E2G A;  4NHZ A;  1QQ2 A;  4D73 B;  4L0U A;  4OMV A;  5F0G A;  3TDG A;  4IHU A;  1K3L A;  2HLS A;  3OR5 A;  2ALB A;  5KN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...