2VM4A

Structure of alcaligenes xylosoxidans nitrite reductase in space group r3 - 2 of 2
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
334
structure length
334
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Crystallography with Online Optical and X-Ray Absorption Spectroscopies Demonstrates an Ordered Mechanism in Copper Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 90
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vm4A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vm4A02
1GR7A 1WAEA 1AS7A 1J9SA 1WS7A 1SDDA 1FA4A 6PCYA 1AIZA 3TU6A 4CSZA 5I5MA 4E9WA 3PXLA 2XV0A 4DP0X 3FT0A 1JOIA 2A3TA 2CJ3A 3V9CA 2E86A 2IWKA 2FT8A 3QJRB 3PAUA 5F7AA 2EILB 4DP7X 3FU7A 1UATA 3FYEB 3U25A 3FSWA 1HAUA 2DV6A 1AG0A 3ZDWA 3NSYA 1I53A 4W1TA 1N68A 2MRYA 3G5WA 1A4BA 2UX6A 3FSVA 2IWFA 3OM3B 1TEFA 3OD3A 4DP8X 2YAHA 1JXFA 3NJNA 1GY2A 3SBPA 1SJMA 1M56B 3UAEA 1PF3A 3L45A 3TBCA 2YXVA 2FQEA 3WI9A 3TA4D 1XMEB 3WIAA 2BWIA 3NJMA 1SHWA 3EHBB 4JKNA 1JZHA 1GS7A 1WA1X 2AVFA 3RYMA 1NWOA 2JKWA 3DIVA 5I6MA 1AS8A 1VLXA 1CYXA 3H4HA 4NAJA 3S3DB 4A2DA 4YSSA 1JXDA 1ILSA 2WO3B 3ERXA 3FPXA 2IWEA 3DKHA 5B1JC 4UAHA 1ADWA 2NRDA 1X9UA 3QJVB 1CURA 2PPEA 9PCYA 1J9RA 2QPEB 3AG2B 2QDVA 2XXGA 3SBRA 3NJGA 2IDTA 2H47C 3FYIB 4HCGA 1IBYA 1RZQA 1NIEA 1SF3A 2FJSA 3FPYA 3NJHA 1E65A 1PLBA 2BZ7A 2GBAA 2IH9A 4KO5A 4DP9X 4YSDA 2FNWA 3S8FB 1E67A 2Y1AA 3WG7B 1A8ZA 2Y69B 4G7QB 2RACA 3QJUB 3AZUA 2UXTA 4DP6X 2BP0B 4F7KA 4QKTA 1W8EA 2FWLB 5IY5B 1AANA 3ZBMA 4KO6A 1WA2X 5B1KA 4NERA 5TK4A 3NJKA 1NIDA 5AKRA 1FWXA 4E9VA 4BXSV 3FU9A 4KNSA 1PY0A 4G7RB 2XV3A 5I26A 4YSCA 2ZXWB 3CDZB 2BW4A 4A2FA 2XWZA 2B3IA 1J5CA 1L9PA 1ET7A 3CVBA 7PAZA 3N55A 2PCFA 4QLWA 4ENZA 3QJSB 4M3HA 4UF7C 5I6PA 1SFDA 1KV7A 2BWDA 1KYAA 5I6OA 1WS8A 1KDJA 3EH3B 2HZHA 3PAVA 2JXMA 1IKOP 1OCOB 2R7EA 1SF5A 3T6WA 2WSDA 2P80A 3ABKB 3N2JA 4P5RA 2IDFA 1SHXA 5F7BA 3FQ1A 4BDVA 8PAZA 2BHFA 3MX0B 1SDDB 4GP5B 3FSAA 2HRHA 1NPJA 3H56A 5FC9A 1GW0A 2LLNA 3PAZA 3WNJA 1PMYA 1KBWA 4MFHA 1XB3A 3CVCA 4DP5X 1PLAA 1ET8A 5B1AB 3T6VA 3SQRA 3NSCA 2B08A 3T9WA 4AI7A 4DP1X 1AR1B 3X1NA 1GS6X 2IDSA 1KDIA 1NTDA 2XV2A 1GS8A 5I28A 5B7EA 4N4YB 5B1BB 3EH4B 4YSPA 2VM4A 3IN2A 1BQ5A 1WA0X 1JVOA 1XB8A 1ET5A 1MDAA 5I5IA 2PLTA 1BAWA 1ZDSA 4KO7A 5A7EA 1ID2A 2AZUA 2FQGA 1EHKB 2GIMA 4HCIA 4DPCX 4G7SB 4Q8BA 2J56A 3IBOA 1CUOA 3V9EA 1OE2A 4JHUA 4E9XA 1M9WA 1OE1A 3OQRA 2PPCA 2GC7C 4KNUA 4ZK8A 2UX7A 1W6LA 1BQRA 3OMNB 1PZAA 4AZUA 1ASPA 1GYCA 2AZAA 2QDWA 1AZCA 2J55A 2PPAA 4A2HA 4BXVA 2FQFA 2MTAA 4WKXA 1ZPUA 2HX9A 1A65A 1PZBA 2HRGA 1PNCA 6PAZA 4G72B 2J5WA 1KGYE 2YAOA 1BQKA 5ANHA 2PPFA 4F2FA 3D12B 1X9RA 3NJIA 4TXVB 1ETJA 5B1JA 2XYBA 2VSMB 1IC0A 2YQBA 4Q89A 1BXAA 2YAEA 3IEAA 1W6WA 2H5UA 3JTBA 1NZRA 4X4KA 4A66A 3BQVA 3QPKA 5I5JA 1OV8A 4E9QA 2XX1A 3KW8A 4K9JA 3X1GA 1JZJA 4E9SA 2BP8B 1PAZA 5AZUA 1AACA 1AS6A 4YL4A 4AKPA 2PP7A 1AZNA 4KOBA 4HIPA 4KO9A 2UXGA 4DPAX 4E9RA 3NJJA 3X1EA 2YARA 1E5YA 3NSFA 1J5DA 1A3ZA 3AG3B 4GXFA 2X88A 4YSOA 2DWSA 3NP3A 2CAKA 5LDUA 4FAAB 1JERA 3TBBA 3HEIB 3QJQB 5B7MA 1A4CA 3GXUB 4AX3A 3GDCA 5I6NA 4M4RB 3T6ZA 4CSPA 5PAZA 2ZWNA 4BWWA 3FS9A 2XUWA 2VN3A 1PLCA 2QT6A 2XX0A 4GY4A 1JZGA 3CZUB 2BP0A 1NICA 1CYWA 2VM3A 4A68A 2FT7A 5D4HA 3AG4B 1NINA 1V55B 2CUAA 2EIKB 2VMJA 1F56A 2VW7A 3S8GB 2FT6A 1YLBB 3UAAA 3CDZA 1TU2A 1TEGA 1JZEA 2YXWA 2ZONA 3X1FA 4YSEA 3HB3B 1AG6A 1AAJA 3NP4A 1NWPA 3WKQA 4EF3A 2YAQA 1T5KA 1OE3A 1ASOA 2EINB 4HCFA 1BXUA 1QHQA 4AKQA 2W8CA 3EH5B 3S3CB 4GP4B 1BEXA 4A2GA 3FQYA 2PP9A 2GHZA 2IDUA 5D4IA 1KCBA 3FSZA 3FU7B 3ASOB 3PLYA 3QQXA 1OCRB 1GSKA 2GC4C 1QNIA 3NJLA 1J9TA 1IUZA 4JHVA 2HXAA 5B7FA 1L9RA 2H3XC 4E9YA 2UXVA 3C75A 3T6XA 2GSMB 3ZX1A 3ABGA 3IE9A 3SBQA 1AOZA 3BVDB 1ZDQA 1L9QA 5E9NA 5B3SB 4BWUA 1OCCB 3OMIB 3KW7A 4KNTA 1BXVA 1DZ0A 2BZCA 2XLLA 4L0PB 4AKOA 3UACA 3UGEA 4YSUA 1PZCA 1V54B 1R1CA 2X87A 3PCYA 4BWTA 2TSBA 1MG2C 2AANA 4RH4A 3S3BB 2HX7A 2HX8A 2I7OA 1AZUA 1HFUA 2CALA 3X2QB 4NB7A 4WTQA 2EIMB 1ZIAA 4DP2X 2GB2A 3TASA 3UABA 7PCYA 3T71A 1M57B 2JFCA 2DYSB 5EHFA 1E5ZA 1NIBA 2FQDA 1RKRA 2PCYA 2OV0A 2J57A 1PCSA 4DP4X 2TSAA 4YVNA 3NSDA 4A67A 4N8UA 3NT0A 2DWTA 2FTAA 1HAWA 1A4AA 4HHGA 1XB6A 5I6KA 2WO2B 3WNIA 1BYPA 1SFHA 4FA7B 3DTUB 4G70B 4A2EA 2HLEB 2PP8A 1MZZA 3FU8A 1JVLA 1IBZA 1SNRA 2OCCB 2ZOOA 1PNDA 1DYZA 2QPDB 1L9OA 2XU9A 3ABMB 4F2EA 2I7SA 4UANA 1JZFA 2UXFA 2N0MA 2Q9OA 4YSTA 3CVDA 1MG3C 3PPSA 3X1BA 2DY2A 1ZIBA 3AY2A 4DPBX 1E30A 3JT2A 4G71B 1ASQA 1NPNA 1JXGA 1AZRA 2VW6A 3ABLB 1NDTA 2IDQA 2XVBA 2IH8A 4PCYA 1ILUA 1TKWA 1L9SA 1V10A 5I6LA 1EZLA 1NIAA 2Q5BA 3IN0A 1OOWA 2BP8A 1GY1A 1J9QA 4HHWA 5PCYA 1KBVA 1AQ8A 1NIFA 4HZ1A 1AZBA 4YVUA 2GI0A 4HAKA 4YSAA 1KCWA 2XXFA 3NYKA 3CG8A 4KOCA 3WKPA 1URIA 2IAAC 2YAMA 3ZIYA 2PPDA 3H4FA 4YSQA 5AFAA 4GP8B 1QLEB 2I85A 2VW4A 4HALA 4BK5C 3NJFA 2P80D 2EIJB 4E9TA 1RZPA 4P5SA 3GYRA 1MZYA 1N70A 3ASNB 4W9ZA 2CBPA 2DYRB 2R7EB 2W88A 1FFTB 2BW5A 5TK2A 2YAFA 2VSKB 3FQ2A 3QJTB 1JZIA 1L9TA 4BDVB 1BYOA 3UADA 1CC3A 2CCWA 4YSRA 3AG1B 2OJ1A 3MBWB 4GYBA 5D4JA 2BO0A 3AW5A 3OMAB 4PAZA 1B3IA 2AFNA 1OF0A 2YAPA 1OCZB 1ZV2A 3EF4A 1RCYA
chains in the Genus database with same CATH superfamily
4L5FL 4PBWD 3QFGA 4AOFA 2V8MA 2YLKA 1YPZF 1SXNA 1YG9A 2CO7A 4OLWL 1KLFA 5DEGB 3REVA 4U4IA 5F7WC 5K33A 3DECA 1JPSL 1Q8MA 3S4SA 1YQ2A 1QFOA 2JSFA 2LABA 3RZWA 4JDZB 3SCMD 3HZYB 3PDOA 1VERA 5EEYA 3IM1A 3K46A 5D1QB 4MMZB 1OPOA 3VD2A 4ZFGH 3RWGB 1U2CA 2R9HC 2JQAA 4UV7H 4XMVA 1KGXA 2Q6WA 1I8LC 5L9DL 4EXKA 1DHKA 1EDYA 3FYEB 3M1CA 1GZHA 5DD3H 4F5CE 4C57C 5KJRL 5FFOA 4PVBA 1NOFA 3VFPA 5I71B 1OP3K 1ZANL 3K71B 2BOCA 3UC2A 1KJ2H 4EN3B 5D1QC 2WLKA 3MNVA 4MMZC 3UCRA 3D52A 3TJEH 3D2TA 2MSPA 3AREA 1DFBL 3HC0B 2MTPA 2MNUA 2YGVA 5AALA 4P05A 1PTZA 4FA6A 3FQXB 5DURD 3VQ2C 4LSUL 3CIQA 4QTFA 3O0RH 5I71C 1WFTA 3ABZA 1UXMA 2XIIA 4FOMA 4EN3C 2ICWI 3FFCE 1FBIL 3IFOB 4BV1A 4V11A 2XRAL 4LAQH 4G6ML 4LNRA 3TEXA 4PS8A 4HWEL 4AWJC 5JIKA 4QRPB 5KYWB 3UJIH 3SDXB 1TTGA 1HL4A 1OF2B 1OAXH 5C92A 2HMID 4M6OH 3SGDH 4J2QA 4C56D 1RZKH 1A1NB 2Z7WA 2IWEA 5D1ZA 2PF6A 4U6YA 2B8OT 1RK1A 5F7UA 4Y9EA 1MWAA 2BNQE 1YEDA 1KIQB 2YUVA 2YPVA 1HC1A 5ILTH 2DQIH 1C5CH 2NZ9D 5SWSA 2GEQA 3FBQA 2YEQA 2Z1PA 1FVDA 4IMKA 3SYQA 1FHGA 4N0YL 3SQOH 1NLDL 3BD5A 3UO8B 1SF3A 4B7LA 1UA6L 2GW5A 4JANA 4JFSA 5ISZD 3OKDB 2H1XA 2MCPH 1MH5B 4EKJA 1A1MB 2DQHL 3P0VL 4N2DA 2GJZA 1D6EB 5GPRA 4JY5H 1Q0EA 3RWJB 1GJWA 1TNNA 4TSBH 4GT7A 2APVA 3IDIA 4UZUA 3IETA 1HQRA 4H0GA 2VGLM 1FFOA 4HIXH 4Y4KD 2LHAA 4P4KB 4P07A 2APFA 2OA9A 5HDQL 4KZCA 5K9JL 2VC2H 5GGSB 1I7ZA 2VDOH 4IRSD 1CO1A 5HHME 4N5ED 3QZLA 3W81A 5FKPA 3OF6D 4IRZH 2AKRB 3OLDA 1E50A 4MVBC 1UGNA 4ZPVA 4ZW6A 3FU9A 2IOIA 4HUUA 3W38A 5I19L 2QKIA 4A2FA 1T7VA 2J8HA 1GTNA 4ENZA 2ZICA 1I3VA 3GIVB 5HYSB 1SVZA 2BWDA 3B2UD 1MW3A 2D03L 1WZMA 3DYOA 1KGWA 4JFHE 2VXQA 5C08E 2HLAA 3NCFB 1HHGB 2WC7A 1TQWA 3C5ZA 3EFOA 2BJMH 1N0LA 2CDGA 3NK4A 4DEPB 1Z5LA 3GF8A 4K3EH 1EXGA 2DQMA 4JKLA 3VXNA 4B27A 5F7BA 2W0KA 3B9AA 5JIMA 3CDFA 5FECB 1F3RB 3BZDA 4V2CB 3IDJA 4MQXC 1NGYA 3H56A 3IPFA 2LLNA 1A66A 2VH5H 4MJJA 2HFEB 4OQTH 1RZJH 1EAPB 1SOKA 2Y7OA 4LHUA 4TN9A 3ZYOA 1F1AA 3WFDH 1HOCA 4JZNA 1ZT7A 2VISB 2VDQB 4HJ0D 1CTMA 2R29A 3NFPA 3FQUA 5CEYB 3S96A 5IEHB 2XN9A 1N4XL 2MQCA 2LFGA 5HHXH 5HPOA 4M3KB 4N4YB 2EDJA 1HIML 2VM4A 1HT6A 1SZNA 1MDAA 2CRIA 2PLTA 1HL9A 3H3PH 4YEEA 1JGVL 5E99L 3TT1L 1BA9A 4HLZH 4NQQA 3VD4A 4LOUC 5C09B 1N8ZB 2JIXD 1JNJA 3PXHA 1MQKL 1MFBL 1O6SB 4GXUN 4WNQB 5IVOA 3WSQH 2ZYRA 2DQUH 5LBSH 3MCLL 4Z0XB 1RJLA 1B4LA 1XCQB 3GK8L 4OD2B 5CLTA 5CGTA 3ME0B 1HSBB 4Y9FA 3UBXA 2C1OB 3MV9D 5I1AA 3F05A 2K7QA 3MLSL 1BQRA 4L4VD 4ODUA 5FYLL 4LP5A 2Y1YA 2A9NH 4X0NA 3BUDA 4P23A 5J3HC 3SJVD 4AYEC 3QHFL 4EI6A 1BZQK 1D3CA 2B0SH 5CINH 2J1KA 4MJIB 2V5RA 3FO1A 5E1IA 4P9HC 3V4PH 4IKLA 4JRYA 3HNTH 1EANA 3BMWA 5IFHH 5IJVA 1XSKA 3ARGD 4YXLH 1BBJB 3BZEB 1Y1DA 4N2EA 4NFCA 3DK0A 4TXVB 3APDA 4N3UA 3KD4A 3BUYA 5I1JL 2YQBA 1W6WA 1YZZA 4YDKH 3QO1B 4XP9L 5B4MC 4XMTA 2KZWA 2WWKT 4XBPB 3I75B 3BRFA 1QFUH 2WUCL 3LAFA 3ETTA 3GO1L 3GSUB 2XX1A 2W5PA 4X80L 1GHFH 1XVSA 1T4WA 2YA2A 4HFUL 4UQ3A 2E7LC 3SE3C 4DN3H 1E7UA 3OMZA 5J13B 3VXTB 4K3JL 3QXDA 3IDYB 1KBBA 1T89C 4HEPG 4G7YL 5ANMB 1AS6A 1W9XA 3KPNB 1UZ8B 4QAWA 3TBSB 3UAJD 3W11C 3BVWA 4XB7A 4QXVA 4APXB 2FD6H 5I23A 2P8LB 3QXAA 5DZAA 4C4UA 2OR9H 5DMIH 4KZDH 3P1VA 3MLRH 4NQCE 3P3SA 2WLHA 3ETSA 1PPIA 1QSEB 4KTDL 4U49A 5J13C 3GBNH 2OTWA 3IDYC 1UB5B 3B2PA 1SOSA 2WYTA 3GXPA 3OR7B 4LHJB 4K0OA 3QDJD 5DMYA 3K2IA 3MNWA 1BG9A 4TVPL 1JWMB 3FDWA 4R4FL 4ZT1A 4F57H 3QCUH 5F1OB 3GKWH 2XX0A 2A0LC 4OCRL 4DFHA 4XGZB 1LO2H 3CZUB 1G7QA 1OWWA 1E9PA 4PRHE 4WK0B 3RWCB 2BVQA 4PJXB 1KJ2A 1FNSL 3A6OA 4FP8L 1P6FA 3O3BA 3CH1B 5ITFA 2Z0UA 4MAYB 1SY6L 5KSBE 1BIIB 4H8UA 1RAMA 2XG4A 1ZWIB 5HHNB 2CKBL 2JJTC 1CZ8L 3IRCA 5F93C 5C0CA 4I0KA 4Z77A 1YEIH 3PL6B 3H55A 2NY6D 4KK6C 4NS0A 5A16B 1XH3B 1DO5A 4LOVA 4HH9A 3CHQA 2PETA 3D0LA 3IK2A 4MAYC 1XXFC 3HW7A 1TLMA 2DDQH 3F7QA 4HCFA 2ZUTA 1JZ5A 3VXOA 2CLVA 5D1XA 1BEXA 2Y4SA 5AOLA 5GZNA 1OM3L 3PL6C 3E1ZA 3L54A 1MXDA 1E5BA 4LAJH 4Z7VA 1DUYA 4PV9B 5DK2A 1L9RA 2QGBA 1QPKA 3WXVH 1MRFH 3GINA 4GW1B 4JDTH 2F8XC 3C75A 4WI0B 3FAXA 5E6RB 4GI8A 4PU2A 3IE9A 3B37A 1FO0H 3BVDB 2GI7A 3QWOA 3U2JA 3EOYG 1KYFA 2HWZH 4P2OA 1DZ0A 2XLLA 4PN6A 2QLYA 2XFGB 5LO7A 3EYOB 5IOKA 2R4SH 4DT2A 1MCWW 3QR0A 5CBEB 3EOAA 3ESUF 4QWWC 4ZFZB 1CXHA 4U1SB 4Q6KA 4JRXA 5G5DB 2E56A 3BSGA 1H8SA 1QG3A 1UWXK 4NNPH 3TN0D 5I9QC 1S7TA 4OI9A 4TQPA 4XAKD 2J88H 5GS0C 2NT1A 2BIQA 1Z6JT 2AVGA 3R4RA 3MFFA 4TULL 5AZEL 2XNAB 4QTHB 4QY8B 3VFRA 2IBZX 1NCOA 5HI4C 3WD5H 1E5ZA 2BX5A 2EEDA 5HD8D 3O3AA 2J57A 4IRZA 3I6LD 4HK3N 1MW0A 4J3OG 2VM9A 3RZCA 4PRPE 4FG0A 1W72H 2GTZA 2UZIH 4RMVA 1JPTL 2RAMA 4JFWA 3TO2B 3GKZA 4HCRH 4FABH 3ROLB 2V5SA 5F44A 2ZCHL 3AAZB 3ET9F 1DSFH 2ADIB 1SFHA 3HI5L 4GXVL 4K07A 4PMEA 3H9HA 4B9CA 5FYJU 3CVIL 4MKMA 4NRXB 3W0WD 1DYZA 4P2QD 5CFHA 1CG9A 4OT1L 4PWIA 2QQNL 4XNUL 2UWEA 1ROWA 1ZHLA 1F4WH 3IPBA 5FM4A 5KBDA 1SLVA 1H6TA 3K72B 4QYAA 1G6RL 2BY0A 2Q8AH 1W15A 3R1GH 1U8MB 5AW3B 1MFEH 2W94A 1T21A 1H3VA 4OQTA 2RBLA 3PWLB 3ZT5A 2H2SD 1ZGLB 1GC1C 3I6KA 1CL7I 2Q5BA 4PJ7F 5DJ0B 3V0VB 5BQ7B 3HPLA 4FQ1L 4NHCL 3DROB 5AVZB 1G7PB 2BHUA 4PRDB 3DXAD 4LB8A 4J3XA 5C70A 1U3NA 2X9ZA 5IFJA 5KSUB 2A83A 2MMXA 3NZ8A 1IILE 5CFAA 4Y19A 4FG4A 3OPZL 4RMUA 4OLVL 1QFHA 3BP7A 3MRFB 2OSXA 2PCFB 4GP8B 5F88B 5T3XH 5CZKA 2I85A 4NWUL 4BK5C 1U8IA 4ZUWB 1BOGB 2NSMA 1IKNC 4PLJD 3TNMB 1O7SA 1Q0YH 3M86A 5C7ZA 5D8JH 2WVVA 4NKOA 2J1XA 3EO1A 5IIEB 1ZTXE 3SODB 4HKXA 5LBSA 3U82B 1N6UA 4LSTL 4OZHA 3VU2A 4HIJA 1K2DA 4AUYA 2FX7L 3OKMB 1X5MA 1JFHA 1AXIB 1RIHH 3KYMA 2RR3A 2V5YA 4EIGB 3JVGC 3D87B 2Y2TA 3X13B 1HNGA 1VGEL 1AHWB 3ZXAC 3HN3A 1RK0B 5EPMB 2ZD0A 2BVOA 4PY8I 2YA0A 1B3IA 4TUKH 2AFNA 2V8LA 5F9JB 3V4PA 2OAAA 5FLUA 3VDAA 2OJZL 1KB9J 4FS0A 3QEUA 1N0XH 2XIBA 1S78C 1AMXA 4Z7UB 4HK3J 5E1GA 4K9EL 3QUXA 1YPZA 2VNCA 3D4GA 1AHWC 3Q43A 2FL5A 3WTTA 2F74B 1A6UH 4PRNA 3QXTA 1KGUA 3MLWL 5I0XA 3CSYA 3LNDA 5KOVC 3S7GA 3FT0A 3CX5K 4I87A 1IBBA 4NNXB 2IWGA 4JZJA 3DIFB 3FU7A 1R24B 4EZKA 5FA4A 1FH2A 2QSCL 2V6HA 1M7DB 3U25A 2WBWB 4K8RC 2EDXA 3TIEB 2F5BH 3VM5A 5KG9B 3GIZH 4HLEA 1NGWB 5L2KB 4JAMA 2YD4A 4X9GA 5DT1L 3Q5OA 4JY4A 3KWWA 3NA9H 4O51A 4MJ5A 1S3KH 4LPTA 4FDWA 1CDBA 3MRNA 1J1OL 4JFXB 5GRVL 1BMGA 4K23H 4UINL 3IMWA 2OMVB 1NEZB 1DE4A 3GBML 3VVVA 1XGRB 4LLAA 3TX4A 1MJUH 1CICB 1CE1L 1RUPH 3T65B 1JZHA 1WA1X 3UAFA 2JQMA 1A22B 1KGCD 4UUJB 5I6MA 1OALA 4E42B 4HV8B 2OSLB 3FTVA 3LSOB 4KJYA 3P77A 4PR5A 2W80C 3DJ9A 5FYLD 2MHAB 4OJCA 3UTSB 1CICC 4X5LA 3MV7E 4NP4H 4FTVD 3ZTNH 1AZVA 1RZIA 3QAZB 3K1KC 4AGOA 3H9SA 1E6OH 2ZOTA 2IANE 4EZJA 9PCYA 5E4OA 4FI8A 1I75A 2J71A 4B96A 3S5LA 1TQVA 4XE0A 5BO1H 4FE9A 4Z7WE 2CCVA 2PW1B 3IGLA 5ENWA 4NO2B 1GRWA 3QDAA 5GGRY 1QVOB 3LKSA 4R0LB 1I8KA 5F8QC 2TRHA 1AYRA 1UQSB 5IVZB 1WH0A 4J6IA 3QAZC 4WNJA 3K8KA 5SV3A 2QADD 4M7LL 3NACH 2COVD 4PIRF 3ULUC 2ZWSA 3WG7B 1T5XA 1UJ3A 1LDPL 5HGBB 3KPQB 4R0LC 5D72H 4A6YB 1JVKA 5JXEA 4IIZA 1KB3A 3VSVA 4GUOA 1FO0A 4GKSA 4X6EA 1R46A 1KXTB 4KX8A 3RPIA 5HTSA 3GLDA 3C5SA 5DUPH 5TTRA 4AGLA 3WDJA 5IQOA 4KNSA 2DQJL 3WYRA 4Y1AD 2XV3A 1TJGH 3A21A 4HOXA 1ANUA 2XWZA 1D5IL 3DK2A 3IFPA 5INCB 1O5DT 5MENA 1H8OA 1NC4D 2F58H 4MRCA 4RWYH 1UCBL 1C5BL 2OMNA 4FXTA 3KGTA 4TVPD 1JJUA 2D9QB 2HJLB 4DKTA 4JFQB 5FV1L 5DC0A 1IEAB 1J8HD 2G2RA 2ZUVA 3JT0A 4PGBB 3BYTA 3N2JA 3UZQB 4LCWE 1QLFA 1QO3A 4BSJA 5EO9B 4Q9RL 3QA3B 2N59A 3OV6A 3UDWC 4TLKA 1W72A 5IWLC 3FO9A 5D2LF 1N64L 3V95A 4HCRA 2CM6A 5TF1L 3SQRA 3UYOD 4P49A 1AGCA 3HZ3A 3U1QA 2CUHA 3BVXA 1Z9SA 4M6NH 3KYAA 4ZOAA 4PWKA 1NTDA 4Y16A 3MGAA 3O6MH 3C5JA 5T3ZL 1TZIB 2PXYA 3LQMA 2V9UA 4ALAC 2ZIDA 3GXTA 2OM5A 4QRBA 3K6IA 4X6FB 1G87A 3BSHA 4H13C 1EFXB 1MAJA 1A3RH 3TFBA 4XX1E 3BH9B 1NBQA 5F7NC 4FA8A 1BEYH 1OGAD 4V1DD 2QV4A 1AC6A 4MJ6A 4XCNB 1KLGB 4QXWA 4PVLA 1E43A 5CZXC 2AXJA 1MREL 2DQGH 2C3XA 1W91A 4Q2ZB 4U31A 3KAAA 3BAKA 4P57A 5E6YA 4R3SB 3IMVA 4Z3TA 2Z8VC 3HPJB 3Q2CA 5JXAH 2EDLA 4MAZA 2D2OA 1M1XA 4P5MA 4CGUB 3FUHA 5CEXB 6PAZA 2P5WB 4UDUB 3DSFL 1JGDA 2FEEL 3PXJA 4K5MA 1KIPB 3GM0A 3QT2A 1KGYE 3WIFB 1KIRA 3FMGH 3QAQA 3D5OF 3GSVB 3HVDA 4MJHA 2Z6FA 2VDLB 3Q8BA 1DQQA 3IJSB 1WZ1H 2XTSA 3DSNB 4JN2A 4HIEB 4Y88A 1I9EA 5KVDE 4Q89A 5EN2B 2IV8A 2VN6A 1OW0C 3DC0A 4NCC2 1A02N 1W0YT 2LE9A 5D7LE 4DOHB 4Z8FH 3PV6B 5MERB 4QHMB 5BUGA 4AYGA 1WP6A 4GINA 4RDQG 2GJ6E 3QNXB 1MCSA 4IW4C 2FR4A 2ATAA 1HEJC 3X1GA 3MSPA 5IJCC 4MDJB 5C0BA 2IXQA 4U6TA 2OXHB 3SD2A 1TETH 5IT2L 4Y2DA 4NQXA 2ICWB 5AZUA 1P1ZA 4AEEA 3IMBA 4KO9A 4KKLC 4BRVA 3C9NA 2R1WB 1JWUA 5DK0B 4HPYL 3HNSL 5L7XL 4FFZH 5HDLA 1PX8A 3CU7A 1M3JA 3H85A 4AEHH 2LTQB 4HZAA 3DO7B 1U2HA 1HWWA 4BBWA 3C09B 3PWPB 4PJFB 2HPTA 2LQRA 5H35B 1JP5A 3WJMB 4JPVL 2GK0B 4JL1A 3SPHA 5CR8A 3WHE1 4JL2A 2NUPA 3SKJH 2OYKA 3S8WA 4DTGL 5EBWB 5B39A 4YUEH 4WJKB 1MNUH 1UOKA 4KKQA 2WZPD 3RE0A 4X7SL 3HG1A 3POCA 3C09C 3IKKA 1E2ZA 4K3DL 4LSQL 1E2VA 4XO9A 3EH1A 1FZJB 1CLZL 2CUAA 2I9TA 4E41B 1PU0A 3TTSA 1IC5L 5J1SC 43CAB 4C83A 1GGUA 1KCUL 1ZOXA 1CT8A 1G7JA 1Q1JL 4RRPM 1LTXA 1KTLA 2QVFB 3QXVA 5EV7A 3TO4D 3RU8L 2X4RA 3H54A 4UT6H 4PBXA 3N9GH 3MTXA 2H6PA 1MJ8L 5FCUH 1B4TA 3CFJB 4O9HH 5KSVB 2EINB 5C07E 4GG6E 1T2QH 4OGXH 2O5ZH 5IV2B 2O4EA 4WI2A 4WFED 3LKQB 2I60L 1UD2A 1WLHA 1ZPLA 4S2SB 3KWTA 5DGQA 3ZTDC 1UHVA 5BMFH 1A6ZB 3UJJH 4WWKA 1NCWH 4K7PL 3PV7A 2FO8A 2QR0B 4AQEA 1M6OA 4XVUD 4E9YA 4E36A 2GSMB 4JDZA 5DS8A 2AJUL 3ZX1A 3HZYA 5AZ2H 4JB9H 4CRPA 4IKIA 1OEZW 3FU3A 3QI9A 1JDCA 4HMDA 1F0LA 3KH4A 5GGVL 4U6VL 1SJEB 3D85A 5T3ZE 3E80A 3PHQB 1ACZA 3V0AC 3VDBA 3WFHB 4Q9CA 3HG0A 2AANA 4RH4A 1QLEH 3O4LE 4TUJA 1P69B 5DYFA 5TE6L 3T0AA 3SGJC 1DUZB 3CFUA 5JZ7D 1FFRA 3APNA 2CHDA 1IEBB 4R5XA 4WO0A 5IBUG 4WJG3 4WWOA 5A6IA 1Q4NX 5MP6H 3THML 5J6HB 5EZOL 3D18B 1U93B 1RFDL 3P4OA 2MNWA 4N2MA 1E9QB 2FWOB 3LIZL 4P5TA 1AXTH 2DKSA 3DX4A 5HHQA 2NNXA 2NQDA 2W9EH 5I16B 3MV8A 3UMTA 2AQQA 5KYWA 3LKOB 2FO4B 1DBAH 2WZ5A 5F7EL 4X8XA 2AGJL 4DJMA 4FA7B 5JNYA 3DTUB 1U91B 5DTFA 2WIIB 4BFGA 2JB6A 2VDMH 5FYJL 4A2EA 1JFQL 2CDEA 2EICA 4QJ3B 3WXWL 1XF4B 3UC0L 5AAPA 4W6XB 3VW3L 3P2BA 3F12A 2OTUB 2GUOB 3MRIA 4H25B 3PFQA 4UOQA 4OIAA 1NPNA 4B9PA 5D7JB 3E8VA 2J2ZB 4JY6A 2X89D 4GNKB 3OKDA 4LEOA 4AJYV 2XI9A 3UBFA 4CL7A 3SYAA 4X4ME 2ITFA 3UTOA 1XEDA 4WQOA 2XV6B 1DJZA 3S4SG 3PAYA 1E5UI 3ARYA 3ZKMC 3V6OC 4MNQD 3L9YA 1BVLB 1KCSL 1XR9A 4PJ7A 3QNYB 4O2FA 4JG0H 1PD1A 1P7HL 2PPDA 4J3OD 5D7JC 4N1EA 3HJ0A 4Y9CA 3V79C 4LASH 4W70A 2B15A 5CSZB 1KBGL 1RSYA 4HALA 5FDWB 2MKWA 3CQQA 4OM0L 4QT5A 5J1TC 2ESVE 4LSSL 4P5SA 1GZPB 5IROD 4XRCA 2CBPA 2O72A 4OCXL 5CJ8A 3IFNL 2XKNA 3ZE1E 3TFKC 2DI9A 1XCTB 4TQEH 2EIBA 1KCRL 1OZUA 3DBSA 1RURH 1MCNA 3CSFA 4JFUA 4WO4B 1IC1A 1OTTC 3GIVA 3SDAB 3KLDA 5HYSA 3UYRL 5IB3B 3R7RA 2JCCB 3PQYE 2AP2A 4LKXA 3RPBA 4GYBA 1LE9B 1RZGB 3C6SB 3D6GA 4GJTB 3JV4A 4ZMTA 3DX9B 4L8DB 3IXTA 3ZIMA 4M48H 1TVBA 1WAEA 3HC4H 4WO4C 5KVFH 5F7LB 5E7BA 4J8RB 1MIEL 3SDAC 3EDFA 1UUNA 3O9WA 1BAFL 4X9BA 3GHBL 5I5MA 2HFEA 1EAPA 2X3BA 2VERN 3V0FA 2XV0A 4APQB 2JTDA 4JJ5A 4KZEL 1U8JB 5DJ2A 2QQLH 2CJ3A 3ARBD 3KG5A 4F8QA 2DH2A 4Z5RB 1IAMA 5F7AA 2MNJB 5T1KD 5E03A 4NC0B 4OFDA 4HT1L 5TE4H 1IBGL 3HKFA 1T5WA 1HAUA 4UNVA 4E5XG 1KYOJ 5I1IL 4JM0A 2Y06L 3AY4A 4APQC 2Z4QB 4X7TA 2Z3FA 1XGUB 1N68A 1P53A 2YRBA 5E5MA 4EZLA 1R3LA 5F7DB 1I1CA 1O6SA 3GT6A 4WNQA 4S1DD 5D6DC 2D0HA 5IM7B 3SDYH 5IQ9B 4JS7A 1T0PB 4DZ8B 4MLIA 1HYSD 2IQ9L 4FFZA 4OD2A 5DD1L 3IMTA 3LRKA 2C1OA 1SJMA 5HHVL 1A7OH 43C9B 4HUNB 3TA4D 3G3LA 2VT0A 5C6PB 3LMJH 1MCPH 1SHWA 3QDHA 5DURB 4JEGB 3RWFA 2PNDA 2X70B 5AQ0A 5TF0A 3V4UL 3L1OH 3C6EA 1ZHBB 4F1ZA 2CXKA 5FHBL 1KTDA 2UVFA 1X3DA 3NN8A 3GB7B 3ML9A 3NIFB 3E8UL 4XMZA 3Q5YA 3S3DB 2ZNWA 3P4LA 2PWDA 3ULVF 4CU6A 4WTZA 1E4HA 3F65A 1I8MB 1DJXA 3LH2H 1JS4A 1YEHL 3QDGB 5ADOH 2ZXQA 1CGSL 4B9YA 3H6JA 4RMTA 5EWIH 3TA3A 3F84A 4KXCA 4PRIA 3ZZSA 2V7NB 4NKMB 2QJDA 1U3HD 3MO1B 3RG1C 1X5XA 1UXWA 2VTFA 4IHBA 4JQXC 4XBPA 3I75A 4BFOA 2FATH 3A6BL 4Z7NE 4UT6A 3DMMA 4YHNA 1F8TL 4NT6A 5FYJE 3ZKND 5AW7B 1F4XL 3ZE0E 2WXGA 3EAKA 5CXPA 4IEFB 4DO5A 2HMIC 2XN2A 4GSRA 2PCXA 3HRZA 4H8WC 2BIHA 2EYSB 1WBXA 4JHAL 3SKOB 4MNHB 2HLFD 5IGXH 5HHOD 2OMUB 1U41A 4JJHA 2VRQA 4JCMA 4APXA 4AE1A 3ARZA 5ESQB 3HZKB 5C3IA 3MA7B 2NZ9C 1UH3A 3CC5A 5AB2A 4PJFF 3T2QA 2K7PA 5B1KA 2R2EA 8CGTA 2KLSA 2OCJA 2ZKHL 5E0FA 4LIQL 3OR6B 1ZAGA 3AXLA 1QABA 1Q94A 2MJWA 2XWCA 5DO8A 5FYKH 2ZXWB 4IRSB 1DBKL 4Z7IA 3M07A 4R26L 1KG0A 3NDYE 4KJQD 3CVBA 3P2TA 1NGPL 2DOCA 4LO9A 4Q9QH 4PG9B 5E5LA 5BW7A 5C6TL 2CPUA 4N0UA 3VQMA 3BKCH 3CH1A 1UZ6E 1VDGA 2WMPB 1XFPA 1FNAA 1CGTA 3RVXD 3CGTA 1MCOL 4IRSC 4QHLA 1SF5A 3PL6A 4N5EC 4ILDA 3B9KD 5A16A 2Y7MA 1XH3A 3HZVA 4JPIA 4KUCF 1DSWA 4RAUA 5KYNA 3WNJA 2BSTB 3X14B 4MFHA 1WE5A 3G7TA 3ZDZE 2NY3D 3K6DA 1UD4A 3PGDB 4WY7H 4HJJL 3L13A 5D2LA 1WCBB 4OV5B 1FG2B 3B2UC 1IZJA 4JDVA 4UM9D 4OD1H 1YAZA 3FTYA 3GMNA 3VGEA 5I30H 1NM9A 3GDBA 3ALPA 4U0RB 5I8KH 1FDLL 4JO4L 3CLWA 3BUTA 3EH4B 1XMWA 4ONOA 4YPGB 1SUJA 5ALCH 1JNLH 4XN8A 1PZDA 1JUFB 3IKCB 4H1LB 4WI0A 1JYVA 1MVUB 3DGCR 1VFBA 1PW3A 1DLHB 1Z5HA 3ELQA 2GIMA 4NAMA 2CK0L 3EYOA 4R5VA 5L8LB 4U0RC 1I9JH 3UGXA 2O5XH 2UZXB 1FYTE 1BQHA 5FGRA 3V10A 1B0IA 3QXUA 2PPCA 2ZUWA 5FF6A 2YOCA 1HXYB 2OMTA 4KNUA 3VCLB 4CVUA 2JIXB 3KR3L 1BDYA 5GRWA 4BHUI 3IWVA 4KRPD 4QYOB 2Y36H 1UWEL 3QULB 4UQAA 3Q2VA 1W16A 1OAZL 1KPVB 4P2AA 5BVPL 2VDRH 3LN4B 2F53E 3ZLQC 4L4VB 4KPHH 2HX9A 2GPZA 4XNQB 3GBDA 5D4QA 4ZUTA 5T33H 4PWFA 3SJVB 2VL5B 3S37L 1FNFA 5HDBF 4P2RD 1CDIA 1T3FB 1AO7D 2P24B 4HIIA 4UT7H 5KVGL 4ALAH 2VMFA 3UO1H 5IFAH 5JIIA 2A9AA 3WFBL 3WUWG 3LEYL 2A9CA 2H5UA 4XMPL 3FFCB 1T1WB 3AAZA 3ARGB 1G7IA 2ADIA 4BJLA 1H9DA 4NQVA 3IT8D 1F4YL 1Z3GL 2KHAA 3LHAA 3PU7A 4MQTB 4E9QA 3LN5A 3N5AA 3WNMA 3FT4A 3BXNB 2HRPL 4NRXA 4BUHA 2VXUH 3KJ4B 3EGSA 2EDDA 2CK2A 5E08L 5ALBL 2IGFL 4O2CB 4XOAA 4GRWE 3T8XB 4YX2H 3ARGC 1I7UA 3CFTA 3EFDL 4DPAX 3K72A 3L4UA 2X4SA 1OGTA 3I50H 4NC1E 1U8MA 2DI7A 5AKTA 2OYMA 2DRUA 5SX4H 3HOGA 3QJFA 3PWLA 3KJ4C 1K4CB 1JERA 4JREB 3Q5TA 1IKNA 3G5ZB 2BFGA 1CD8A 3FT9A 5J89A 2BERA 3X3GH 4LVOB 3ZK0A 1LP9F 3HS0A 4PRDA 4AX3A 1XF2A 4ESKA 3FS9A 4BK8A 4ODWB 2VN3A 1PLCA 2D8KA 3LZFH 3TBYA 1BVOA 4PJEB 3LNIA 5IQ7H 4JHWH 2ENSA 1EO8H 2J8UB 3JVGA 3UTTD 4F8NA 3UTQB 4LVOC 3ULVH 3AG4B 3QCTH 1NFAA 1XF3B 1C12B 1C16A 3AB0B 4RGNE 3VYOA 4TRPL 2XA8H 5IIEA 1LVEA 2FUQA 2VMJA 3L7EB 5B38A 1YMHB 2CRYA 2OCFD 4M8QB 4MMXA 5H4YA 3OKMA 1RUQH 3OAWA 2YXWA 1SYSA 1THCA 3KYNA 3OKLA 1AG6A 2JCCF 3EKCA 1BPVA 3B83A 2UUDH 1CGWA 2V4LA 1NWPA 4IIQB 3U6RB 2YAQA 4WFFD 3ARRA 5GGQH 1RK0A 2H1PL 3CLFH 3QQDA 4JN1H 1MVYA 2JKLA 1BSIA 4PGDA 5CR1A 1AKJB 1RL1A 3ZQ9A 1SLXA 2IF7A 5DEFA 2NX5E 4AW7A 3SKNA 1KCBA 4ODTH 3GS7A 5AD0B 2WSKA 4NZUL 3MBXH 2Y7QA 5C0AA 4ZFOA 3OKYA 4YLBA 4IIQC 1IAIL 3NG5A 2KQNA 1IKFL 2VZ3A 2Y3AA 3HE7A 3OJ2C 4KJWD 4OJAA 2A6IA 3VD7A 2CPCA 5G4MA 4ZW7A 2ADFL 2AK1H 2F19L 4IM8A 4DN4L 1TR7A 3DETD 4RNRB 4F7MB 2H32B 4DWHA 5FPIA 4NNXA 5I1DB 5FOBA 2NTFA 1M7DA 3C6LB 2P47B 2F1EA 4GG8A 2EE3A 4IGBA 3WFZA 4NM8H 5L2KA 3PP4H 4HOZA 5DHYA 2PYED 5G2NA 3O41A 4NDMA 1EVUA 2QPUA 3MRCA 5GS2D 4XCCL 1YNLL 4KI5E 4DP2X 3V0JA 4ZUSA 4JRLA 5AEAA 4FNQA 2AITA 5E8OA 1T1XB 3L6FA 5LWYH 3TN0B 2WWMC 1S7WA 1XGRA 1IGJB 2FEEI 3POHA 3W9EB 1OAQH 1PCSA 1HQ4A 3MC0A 5E9DD 2HVJA 4N8CH 2TSAA 1JK8A 1TG8A 3GLAA 4FKKA 3V0GA 4MD5B 1IV8A 2A4CA 4FQLL 4D0DA 3BAXA 3NIFF 3IB4A 3FRPB 3AQDA 4P4RA 1ORQB 3KLQA 3RTQB 3LSOA 3WNIA 2PABA 4FKEA 4GBXA 4HXBH 3W9DB 5ICYB 3TN0C 3QG7H 3QZBA 4BGLA 2R4RL 1JTTA 3UTSA 1MZZA 4NZRH 4R8WH 4NYLB 4X99A 3U4EA 4XHJD 1J1XL 2BSDA 4OUUA 3S6CA 5C2BL 1MHEB 4DUWA 3NFNB 4NCC1 3RTQC 1MI5D 1QP1A 1ZA6A 3QSKB 5IK3B 1QI4A 3JT2A 3L7FB 2EDYA 4RETB 2VUKA 1GYUA 4P2QB 1MCDA 5FDYA 4OJYA 3TTYA 1LNUB 2D31A 3HG4A 1CR9H 2VWEC 2F54E 5DA0B 4AVIA 2OYLA 3PE9A 1TQBB 2NR6C 4HZ1A 2EDBA 5EEZA 4XXWC 3CFBB 3VTAA 3OSKA 1AD9B 1ODUA 2IAAC 2QFRA 2WV3A 1TZGL 1A6TB 2ZF9A 4XNXL 4AL8H 2O61A 4OGYL 1JGEA 4GAGL 5AFAA 3QIWB 4G8GE 1KZYA 2HTKC 3DXAB 3L08A 3NJFA 3N1FC 4WUUD 1KXQE 4M8UA 1KPRB 2VQTA 1TQBC 2G75B 3ZGHA 1N70A 1E4XL 2JXMB 3INUH 3MUGB 4ODSL 5CMAA 4W9ZA 5A2BA 1LQSR 2ZAHA 2NY5L 1G7HB 3JTSB 5T1MA 4NQCB 1T6BX 2H2SC 2R7EB 4NPYB 5E5RB 5I5RA 2Q0ZX 1GGBL 5J11B 2G9HA 3ENEA 2AQ2A 3VH8G 1IE4A 3VSTA 5ICZB 3QIWC 4YHLH 4QCIA 5E94A 3MUUA 4G7VL 1CC3A 3GRWL 4ZXBB 1JK9B 3LNGA 4L1TA 3V4VH 2J7LA 5IWLA 1IGYB 2PCPB 3UXFA 4JFQA 3HFMH 4PRHB 4NBZB 1F4AA 3TT3L 4AC2A 4DCQB 3U0WL 1GR7A 4G9FE 4MSWA 1AS7A 2BOBB 3GMMB 2GT9B 4HXAL 4D0CA 4G59C 4ZXBC 2X7LA 3V2AR 5D7KD 3EZ8A 5IHLB 4MMYB 2Z93A 3LZOA 5GXBB 2CR3A 3OKOA 3GJEB 4F91B 1BREA 2C7UA 2WQRA 4YBQD 1QSFE 3F85A 3GTTA 3Q8AA 1U9KA 3BD3A 4M6AA 1XBDA 4BQ6A 1AG0A 2L0DA 4NN6B 1YNKL 5HYFA 4M7KL 3GS4A 4GKZA 5I73B 4WKZA 1BM7A 4X6FA 2Y9RT 1DBJL 3Q6FB 3NK3A 1L4IA 5CSBA 5KTEH 1I3UA 3REWB 4WSJA 2YMTA 4F7CB 4YDJA 1HI6B 4ZYKA 1KLGA 4Z9KB 3JUZA 2G3MA 2H2PD 3QQNA 1M3IA 3B9DA 4NN6C 5FHAH 1PF3A 4NFBA 2DKUA 4XMKH 5I73C 2VJ0A 4NO0A 3DURA 2BWIA 2WXNA 3UPRB 2VQUA 5AVUB 2Y7LA 3GMOA 1Y18A 4WHTA 1AXSB 1ECYA 4JFDD 1NMCC 5IEKA 1HWGB 2WCPA 5J06A 5AG8A 3H4HA 1RQ5A 3WIFA 4O5LH 1AQDA 2BVYA 5HJ3B 2P44B 3BKYL 4NWTH 3E6FA 4KUZL 1LO5A 3OB0H 1XAUA 2KPNA 3ETBF 4LOFA 3GZKA 2YK1H 3FB8A 3TH3T 3S88L 3FT2B 4DGWC 2P5EE 5EN2A 1MRCH 4Q56A 4PJCF 1S7XB 2EO7A 2ED7A 2OMXB 4YAQB 3QQ3B 4XVSH 1NM4A 3O4LA 1GVIA 3B43A 4FZ8H 4YN3A 2HFFB 3DTXA 1S4IA 4FTVB 3MRMB 1ZHKA 1MJ7H 3B9VA 1J5OL 4O4YH 2NT0A 3IJHB 1H0DB 3R8BB 2JJSA 5JOPD 3DVFA 4MDJA 5BZZA 2QVKA 5I6XB 3RY6A 1WFOA 1NCBL 4N2NA 1I85A 2Y6SD 2R2BA 4LCVA 2FBRA 2VMEA 5DJDA 1TO5A 4YFLF 3CPUA 4ZSOB 3QH3B 2ZOLA 3LYRA 2IO5A 3WUZA 2AV1A 4K55A 5DK0A 3JV6A 1ZEAL 2WLYA 5D7SL 3IGFA 4F7KA 4QKTA 1W8EA 3D39E 5DDHA 4MCNA 3WJJA 3HG2A 3C60B 4KO6A 5D70H 4P59H 5I6XC 1EEYB 3DO7A 1BQSA 2M1KA 4WCYH 1EAOA 1KCVL 4PJFA 3RB7A 4UILL 4ZMVA 1AQHA 5C0GB 5F6HI 3HHMA 2GK0A 2VZUA 3HS8A 4U1HB 4PJEF 2W9DH 5L8KB 3EO9H 1KTBA 2BC4B 4EIUA 4E0RB 5FV2A 1J5CA 4I0PA 1L9PA 3LZNA 2J8UF 1XD0A 3C60C 1WG3A 4EQ3A 1G9MH 1HHHA 4XP5L 1CS6A 3MLVH 4Y1AB 4WLCA 3WS3A 1QUNB 1KXHA 3SYPA 3VFNB 3EH3B 3S35L 4PB0H 1O0VA 5K59E 3G04A 1BD2A 1A7QL 2WLNA 1CFSB 3CMGA 5E24E 4HU8A 1HILA 4BDVA 4O58H 4ISVA 4OU3A 3M1BB 4QPEA 2D4FA 2BFVH 3RA7H 1QQDA 4OBRA 2VLJA 4DUXA 3CFJA 2BY1A 2EDQA 3ZT6A 1AVAA 3MBWA 4S1RH 3MVSA 4OGAD 5BRZA 3UTPE 1NFIA 2JKSA 5B1AB 1E27B 5JW3L 4MXWL 2KLRA 4A7GF 1LD9B 3RWDA 1IAKB 3LKQA 32C2B 2DQFA 2AJYL 1DR9A 2XV2A 2IBGA 4XCYB 3AU1B 4MHHG 1RLWA 4WI4A 1NCCH 4PUBH 1HOEA 2H6UA 5IB5B 3N85L 5IUCA 5E7FA 3PWUB 2GIXA 2CO3A 1CFVH 3HE6D 4LRIC 2F18A 2F08A 1EHKB 3L2NA 2BSSA 2C7FA 4YHZL 2J12B 4OZGF 3UZVA 3FBKA 3U36B 3IDGB 2AJVH 5AAMA 1DCEA 3PIQB 4S1QH 3MJ9L 3NSJA 1A2YB 3B56A 3JUYA 4XP4H 2QFPA 5D5MB 2ARJA 4IJ3B 3DO4A 3SEPA 4YO0A 2X4TA 2YMXL 4Z76B 4BSVB 1RSFA 1QR4A 3INOA 4BXVA 1O9WA 4IS6B 4AE0A 2AK4E 3LNEA 3QC5X 4Y4HD 5GS1A 2WKLA 5IBTL 1CFTB 5FFGA 3SPJA 1PZBA 4FCHA 5DJCA 3T0ED 3VMOA 3MGTA 5HHPB 3II3A 4X4YB 4IJ3C 4G8AC 2FWOA 3L16A 2FO1A 4DKDC 2AJXL 2HB0A 2L04A 3RAJH 3U0TB 4MA7L 5F3BB 2GBUA 1GMIA 1BZ8A 4L3EE 3TPUB 5IW1A 5KVEH 4ZNEA 2VLRA 1GGCL 3Q48A 1JTOA 3NCBB 2AI0H 4FLRA 5KVFE 2A5UA 3HAEB 5I5JA 1I3GL 1OV8A 2K78A 2WP3T 1U91A 1W0WA 1ZJBA 2EUXA 4GKNA 2FLMA 1SN2A 3V4VA 3HUJF 3TYGL 4I18A 3Q2NA 1XF4A 4H88L 3SO3B 4EUPH 1FUNA 3HMXL 4PB9L 4XC3H 4M5ZH 3E0GA 1PAZA 5LNGA 4H25A 3DLQR 1AZNA 3WELA 3NEOA 3QQ9D 5GSRB 4B95C 4F2MB 4E9RA 1FVEB 1OB0A 3MV7B 4WW2A 2YARA 2DQEL 2J2ZA 4X5WA 2X0UA 25C8H 1F4HA 2IANB 3QORB 3EXJA 3SO3C 1VKXA 2N1KA 4TSCL 5F7MC 4DHLA 3ATAA 1GMEA 1CF8H 2CJUL 2KERA 1OT2A 1EZSA 4CN6A 1F42A 3MRBA 2BHZA 1LP9A 5PAZA 1BZEA 4TTDD 1HCFX 4N28A 1I9IL 2WBJD 1IM9A 1TMCB 3ZL4H 3DOSB 2L7QA 1HINL 2OKMA 3QORC 4MA1B 2A9ML 1EDHA 3MLYL 2A7BA 1NICA 1JPGB 1RHFA 5AYQA 1DVFB 3DVNA 4S0HA 2YD9A 4YXHL 1DL7H 1LO3L 4DKFH 1JZ2A 2B9AA 4PLKC 1V55B 5DD5L 3GZQA 1X5JA 3NABH 3V7AG 1BMWA 1C08B 1LO0L 3MXVH 4QXTB 4FJYA 3CUPB 2DTSA 3UAAA 3M88A 2R15A 1FAKT 4MA1C 2Z92B 4HQQL 3W2DH 1BF8A 1TVHB 2G60H 3FOLB 2EDKA 1XR8A 3AM8C 3UZEC 2Q1EA 5TE7L 5IB3A 1HL5A 5E2VL 3FOMB 2D7PA 3UIZA 3C6SA 4TPRH 1VJSA 1E42A 4U7KA 3KLAA 3H1ZA 2CO1A 4OJEH 4Y9BA 4GQRA 4R7NA 3N06B 5CU5A 3QDMD 3TO4B 3QFJE 4QXGH 4V1DE 2VDNL 3D51A 3FSZA 4KVNH 5JPNB 4JQIL 2BY3A 4H5SB 5AVQB 1N9PA 3UROR 2IFFL 2AMUA 4JDEB 5DLML 5BZWB 5CM1A 4FJZA 3QP3A 4PG2C 5CIPH 4IRJB 1P84K 1C9SA 4LCWB 3FH7A 4DKAA 1LO4L 1UA7A 3F6IA 4Q6YA 3TO4C 4MQSB 3WHXB 5E4IA 2GSGB 4Z5RA 3DX2A 4RFOH 3QYMA 1RJCA 2QHRL 3OMIB 1NANI 2A6DB 2B2XL 4FF9A 2K6ZA 5JPNC 5IMMB 4ZUVB 1INDH 2O5YH 1EHLH 3SCMA 1SOXA 2W1NA 1R5VA 2VERA 3AU0A 1O75A 3PCYA 4LEBA 1U4FA 3CFEB 1PCXA 5JORA 5AL8A 4IRJC 3BO8B 4GQ9L 4ETQB 3CFKB 4AEIH 2ZSWB 3QGVA 4Y4FB 2ZXDA 3WS6A 4NXKA 4XVUC 2X3CA 3DX7B 5DZOA 3T0XA 1M9SA 3OZKA 4JG1H 5EOQH 3KL0A 5KSAD 2DEWX 2CJTA 43C9A 4WWID 4K9EC 4DIXA 4Y4FC 4POYA 2O1AA 5IHUL 5EC1B 3DI3B 4A67A 1UFUA 5FWRA 3NT0A 1WISA 1A9BA 3QG6A 3Q9QA 3KM1A 4G6JL 4J3VA 1EXUA 1URLA 4HHGA 3BZ4B 4XP6L 1XB6A 5C0RH 2VZ1A 3P3YA 3WTUA 1FF5A 3LOWA 1NLBL 2I5YH 3M8OH 3TV3L 3UPAA 3F7YB 3NQIA 4G70B 4OZFB 4WEMB 5LQBL 4KX7A 5HYSG 3FU8A 4OY9A 3BDYH 1OPGL 4JX0A 4RMRA 3I9IA 5LBVA 3F5WB 3DPDA 4N90E 1ADQL 2XU9A 1FNEA 1MPAH 1TZHB 4KAQL 4C56A 1QNZH 2VR8A 1YUHA 4ANWA 5IQMA 3CVDA 4XB3A 2WGXA 5TDNB 2APBA 2VXTL 2FJGA 1E8XA 2VE6A 1D7FA 1G5AA 1MCRA 4I5BA 3AMKA 2ZZUT 5D7LB 3ZMRA 2BY2A 4IEFA 4L5FH 4HHAB 2F53A 4NOFA 4PGEB 2VJ8A 4N2FA 5DWUH 3G08A 2NUTA 2BNRD 2YN3A 4YVUA 1AZBA 5ISZA 2GJ6B 4MNHA 3HVNA 5GIRB 5JHDE 1JPSH 2Z0BA 4KOCA 5F1KC 3IF1A 3ZTEA 5CCGE 3H4FA 5ESQA 3VXME 4XTRD 3MRJA 1UC6A 4I2XA 4U1JB 3DHUA 1UOLA 3QUYD 4CADB 4LVNB 2FLBT 4OIIH 3EJUA 1UXLA 1G4RA 4CMMB 3FB7B 1BF2A 4WI7A 1NBYB 4BH7A 2ZOKA 1PKQA 4U1KA 4Y4KA 3UG4A 4O00A 4YHML 4JFYB 3L4WA 1Y0LB 5D2NE 4ZZKA 5ERWA 3QQ4B 2Q2LA 4ZMZA 3BEVA 4UNTA 4IRSA 1ZANH 2OMWB 4ZO9A 1MHPH 4M61B 2QSVA 3MLTA 5J4MA 2DBLL 4LLVB 4LVNC 1JZIA 3LEXA 1MY7A 1DFBH 2PO6D 5I15H 4PGCB 3L9RB 1TJHL 4Q14A 3BPCB 3WBDA 1LWHA 3BLKA 3D2UD 4FNRA 2WMPA 4LU5L 4PS4L 2F1BA 1U21A 2BNUB 1UENA 5DMGD 1LEGB 2KC0A 1V5JA 2DB8A 2KPWA 4DZBB 4I1NB 1UB6B 1FBIH 7FABH 2AHIA 4OJDH 5IROC 2MQGA 1WTLA 2V2TB 2XRAH 4G6MH 3B7TA 4JQVC 1MCQA 1F86A 1ZV9A 4AG4L 1PD6A 3MNZA 1S9YB 2P7TA 2NW2B 3KLHC 2BSTA 4QMEA 4AUUA 1T03H 3HC3L 4UZSA 3WHE0 4E9WA 2X4UB 2OK0L 2NXZD 1S7VB 1OWRM 2ZSVB 4ZAKB 2CO4A 5F71A 2X1OA 1IU1A 1T0MB 3G6DL 3EJPA 3QZWA 1KB5B 4HUCA 1UATA 3K6OA 3QJHB 4NQDD 4XH2B 4LSRH 3TCTA 1RP9A 5C07B 1MUJA 3FSWA 4GG6B 3OAUL 5CEZE 4YPGA 4F7PB 1EJOH 3EDEA 1JUFA 3IKCA 2BSRB 1TTFA 3KPOB 3MLZH 4HX1B 2FZ3B 4EUPA 3DPBA 3NSYA 4FQQB 1L6XA 3WE6B 4ZAKC 2R1YA 3LKRB 1UA6H 3NUKA 3EO0A 1ZS2A 5H4ZA 2B59B 4R7VA 3NJNA 3P0VH 5J12B 2L7UA 3P73B 5CD3B 1AQKL 5D5MF 3WMQA 2Y5EA 4KXDA 1BFOB 1M56B 3UAEA 4OLZH 2YPKB 3CK0H 1MHHB 3WEXB 4QYOA 1QMUA 1VPOL 2UUDK 5L4FA 3VD5A 1KPVA 2YN5A 3MTRA 2IH3A 1NUNB 5HDQH 3MV9A 4KDVA 1FL3A 3LN4A 2MOVA 5J12C 4N22A 2Q7AA 3SGKC 5E8PA 4NO3B 2YEZB 1X6NA 4L9DA 4R7DB 5SV4A 2XJLA 3ZDYB 5HDOA 4ZPTB 3BP5B 5I1LA 4QXUH 2WO3B 4S1DC 4DAGL 4DO6A 1WDAA 4JKPL 1F11B 2JKRM 4MB1A 1GGIH 2P24A 1HYSC 4HWZB 2WXKA 2ZWKA 1ADWA 1GYVA 5EOCL 5I1GH 4M56A 1PY9A 3L5WB 2A6JB 2O6CA 3NCYS 4PRAB 3UP6A 3FQRB 4JMXA 5DJ8B 4C54A 4D9RD 1T1WA 3ARGA 4PJCA 4BK4A 3EXLA 4EAEA 2D03H 1G7MA 4HCGA 1PZ5A 5IR1B 3DJRA 1IGMH 4P46A 1KTCA 3BEWB 4GMTL 3KXFD 4IHOA 1QOKA 4X6CE 3ZR5A 1MCBA 1VFAB 1E6JL 2ENYA 3EIFA 3ARQA 3ROOA 3O6FD 2EACA 3KDPB 4F8LA 1IB5A 3BPNB 3P9MB 3S8FB 5E2UL 2Y1AA 4N25A 3FRUA 4PP2A 4QAMB 3WCYA 3VXSE 5EEVA 4IDJH 1DJGA 4BZ1H 3O2DH 4MYPA 3QIUB 5CIPA 3ECBB 3OAZH 5IREA 1MFDH 5J1AA 1KTRL 3UAJA 3AXIA 1WA2X 1N4XH 5HHOB 4J7RA 4PYHA 1QRNE 3BPNC 5EO0B 1JRHH 3ZKNC 1HIMH 1E4XI 1VZGA 2ZYHA 2GFBA 2XG5A 5E00B 3VTTA 1HHKB 1BJ1H 2JI1A 3TT1H 5E99H 3VRLF 3GJFH 1MF2L 3QDJA 3ZDXE 1W80A 4FXKB 2Z31A 3QIUC 4JUTA 3ZZ1A 4HAGA 3SKMA 4M3HA 5IJBC 4EE2A 1MQKH 2VDQL 1ODAA 1SFDA 2HTLD 3NQKA 3OXSB 3NIGF 1BVNT 4W9HC 5CS7A 3V6FB 4BZ2L 3MCLH 3GSQA 3BW9A 3GK8H 4FQJH 3FCGA 1OCOB 4YDIL 1OHQA 1ECZA 3MLSH 2J3SA 5DQ9B 2R0ZL 1FFNA 5FYLH 2WSDA 4YE4H 1J0HA 2ESVB 4FXKC 2GJRA 1CD1B 1R3HB 1JN6B 3RLSA 1MHCB 3QHFH 5LGJA 4BFIB 5HYJD 2RGSA 3TOPA 1Q0XH 2P48B 1KBWA 1AJ7H 4MD0A 4X6BB 2CH8A 3T3MF 2XICA 3CXFA 1BVNP 1MCIA 4GO8A 1TQCB 3X1NA 1CWVA 3TURA 2RJMA 3VVWA 4A7GA 3PQYB 4CC4A 1WBZB 1U8QA 1UXSB 1UM4L 3GZOA 4RGMB 3WKYA 3MJ7B 1TIUA 3J27A 1Z5YD 3U30B 3QZNA 3ISWA 2WYHA 1RH8A 4P3DB 4JFFE 3ES6A 4WU7A 4J4PC 1CN4A 3HG3A 4K94C 5EU5B 1TQCC 3GO1H 3LS4L 2R0WH 4LSPL 4X80H 4M5SA 4HFUH 1PBYA 3V52H 3S36L 1RXLA 3GI9H 4RGMC 3V5DB 1IT9L 5BZXA 1UD8A 4OZGA 4G7YH 5EUOB 2I24N 3ZYZA 2PR4H 4YHOL 1Y6MR 1W6LA 3FF8A 4CVZA 4U6XA 5C71A 1I4FA 4ZO8A 2IAMD 2MWCA 3SDCD 1HZLA 1D9KB 1X7QA 4KVCL 2IC2A 1ZPUA 2VQ1B 2XBTA 3V6BR 5EOCJ 3VA2C 5K1JA 3A4FA 5EU6E 3TN0A 1NKRA 1F3JB 2WB7A 4TVPH 4KH9A 3QEQE 1OAYH 4R4FH 2PPFA 3F7RA 5ID0A 4WU5B 2WYZA 1TT6A 2D3JA 4MQ7B 2Y7SA 3D12B 4FQXD 1D9KC 4OCRH 2CO6A 4KJPD 4NQED 4KTGA 2K3TA 3LZQA 1P5VA 4P2RB 3FRPA 1FNSH 1ZSHA 4FP8H 1M53A 3S5YA 4Z78A 5EIIB 2PWEA 1SY6H 4JVWA 5F2FA 2X4PA 2CQVA 2CKBH 4W68A 3S3SA 3H7BB 2BM3A 2NQ3A 3FTUA 1Z7JA 3TF7C 3K4ZA 3SZ6A 1MAKA 3TZVD 4LQFL 4TUOA 4L8SB 3EGXA 2P8PA 3HUJA 2C8NA 2WN2A 2G5UA 4KKPA 3QS3A 4KHXL 2ZCKL 3PFUA 5C97A 4PJ5D 2J6EH 2X6VA 1ERNA 2XTJD 3FAWA 4K15A 2G4EA 4KQ4L 3CSPA 4GT0A 4XXWA 3U9UB 5BOZG 3IE4A 4JG9A 2UXGA 1R6VA 1D7DA 3W0WA 1HL8A 4I48B 4P2QA 5AKSA 3L3DB 4KGJA 4N3TA 3D3VD 2GAZB 4N2IA 1OM3H 1R19A 4D9QD 1LNUA 2ATKA 4LPWA 1Z9PA 4L8SC 4CU8A 3DDFA 3L4CA 3MLUL 1MN4A 5I74C 4FNLL 4IBVA 4BCYA 4CVXB 3WLBB 3GXUB 5EORL 1O7DC 5SWZB 4DEWA 3G9VA 5DZJA 1AD9A 4BWWA 2ZWNA 4B97A 3ZE0B 5T5NF 4AYFA 1INQA 1JV5B 3CSGA 2W0PA 3EJJX 1OP9A 1QBAA 2FX8L 3DXAA 5I66A 5DLLA 1JF6A 5GGSY 4D8OA 2JJWA 1A6VH 3MUGA 3HB3D 3NSXA 4MCZA 1AGEB 3ESNA 5DR5H 1PGRB 3GMRB 2FT6A 1M7IB 1YLBB 2UV3A 1OSPH 1QLRA 2GHWB 3DTDA 3NCJH 2WXMA 1OM9A 4UMGA 2LR4A 2Y3NA 5EDXA 1NEZG 3O0LA 3NP4A 1T20B 1UYWL 4OFKA 1DCLA 1I8IA 3WMSA 1IGYA 1ASOA 4TULH 4OCWL 2PCPA 3I02B 3GPEA 5F0PB 4ECNA 1UVQB 3GBEA 5GZOD 1UOWA 3D39A 1E4KC 1CDJA 5EZJA 5C0FA 4WRLA 3PLYA 1IX2A 2I32A 2XBDA 5IP4A 2QVIA 5D1QD 5EC2B 3U1SH 4JHVA 2HXAA 1OXYA 3QPXL 1PEWA 2AC0A 4GIAA 1FN4B 2ZCHH 4LCUB 3ABGA 3HI5H 5A7BA 4P04A 1HXMB 5DZVA 3GJEA 2DMCA 3KBFA 1AMYA 4L1LA 3S9DB 2AEPH 5FUZH 5DD0L 1JHTB 1DN0A 1FH5H 2Z35B 4AKOA 5E1HB 4EN3D 4YSUA 2C3HA 1JHKH 1ONQB 4LP4A 4XPGL 5F7YC 1V54B 1WBYA 1OAUH 3NRPA 2ZCZA 3VX0A 3O6KH 2HX7A 3O6LL 5IVXB 3T4AC 4GUQA 2Y5QA 5BS0D 1G6RH 1KEMH 1CDGA 1LYQA 1N26A 2C4FU 3L3GB 5DQJA 5FW8A 5SX5H 2EO1A 2KT6A 1BQLL 3TIDB 4BZ1A 2AXGB 2DYSB 3DOIA 3MCKA 2QGCA 2Z91A 3O2DA 5C0EA 4L8CB 4NHCH 1GC1L 3PGCB 5F9WB 1QWNA 1NIBA 1TCRB 4H20L 2PCYA 4JLRA 5JA8B 3QC6X 1SQ2N 4Z0BH 3BESR 3OPZH 3HI1B 3OGCB 1FYTB 3ML8A 4YVNA 3FN0L 4R7XA 4I9WE 4OLVH 2HRLA 4KNQA 3MRKB 4NWUH 3EZJB 3ZHKA 3UL4A 3DGGA 3ZDYF 3G9AB 3GJFA 2P4AB 1KJ3L 2C9RA 5E9DB 3VA6A 1N7MH 4Y5XB 3VTMA 2XZQH 2G3NA 3QNZA 4LLUA 5FOJA 3V7MA 1OCWL 2HLEB 4LSTH 1TJIH 2CGRL 2B1AL 1YN6B 5DHVH 4AT6B 2FIKB 2I7SA 3MRPB 5JO5A 2BXYA 2UXFA 2ZNXA 5TFSH 5JQ6L 4NRYA 3C8DA 4Y5XC 2BWQA 1E8ZA 5TGBB 2VABB 1QW8A 3MRMA 4FTVA 5T1LB 2R27A 4ELMF 5K9KB 3CD4A 1MCJA 1RLBA 2OJZH 2EH7L 2IH8A 3N40F 2YRPA 1I7RA 1L0YA 3ULSB 5J57B 4P4KD 3FONA 5EUKB 2BP8A 4HHWA 4K9EH 5DJZB 5EZIL 1LEKA 3NYKA 3CG8A 4ZSOA 2QMKA 1KT2A 4PJ6A 4YFDB 3UBHA 5C6WH 4GIPD 5FO8B 3MZGB 1A3LH 3R19A 4LSVL 5TJWK 3MLWH 1Z9MA 2WXLA 3LRGA 3GSXB 4L4TD 4N2BA 1L5GA 1LK2A 3ARFB 2DWEB 5K69A 4GRWB 4FLHA 4JW3A 4RZCA 3K74B 4IOSD 5DJXB 1T1YB 1ORSA 3CX2A 3AS1A 1M7XA 3VWKD 3PGFL 3P4NB 4XXDA 3VRIB 5AWNL 5C0GA 3QARA 1FGNL 2FECL 2BIOA 5KZCD 4QOKE 5LGYA 1MRDL 3AT0A 1U8NA 2BC4A 1DZBA 3VXUE 3BQUB 3Q7JA 3ARFC 1S9XB 3WEMA 3P9LA 1BVKB 4R90L 5F1NB 1TITA 5F9AC 3WTSA 4KQ0A 1J1OH 4Y1AA 2VDKH 2WOYA 5C2UB 1COBA 1RK7A 4NC1C 1KXVC 1ZA3B 4NKQB 3HBGA 3JZYA 4KKNA 3TEZA 2LV4A 2UY7A 2HKHL 4CN1A 3S34L 1HZHH 1J18A 2DWYA 4OSUH 3T3PE 3GQFA 5ACZB 3MACL 1NC4A 1SGKA 1INEL 5HGHB 3BSZL 3ILPA 5F89B 3BQUC 1RCYA 1Q9WB 1ZE3H 2VDPL 3VE0B 3CZEA 5EU4B 4HJGA 1CE1H 3L4VA 1VGKA 2OBGA 5CBAB 4KH2A 3D69B 4RLDA 4U3XA 3B8SA 1XBRA 4IOIA 1U8LA 1J8HA 4GOSA 4WTXA 1RJYB 3RP1A 4F7TA 1MCEA 5F9DC 2BSBA 3DRTA 5GISH 4KHTL 5CCJA 32C2A 3FQWB 3C8KB 1SRDA 1AGFA 4XCYA 1SY6A 5E4EB 1BLNB 1G9NL 3AU1A 4FG6D 2CKBA 1EZUA 2EUWA 1EVTC 3VACA 5C09D 1CQYA 1FORL 5IB5A 5J3HD 3N91A 2IPUK 2ZX8A 3I6GA 4YMPA 3KPPA 4RRPG 4EVNB 3N42F 4J3OH 2J6EA 3RWHB 1LDSA 2AAVA 3OG6B 2Q87A 2ZE0A 2HUEA 3PWNA 5E4EC 1EWHA 3FCBA 5EUOF 1XZWA 4W4OA 5ICUA 4HIHB 1A2YA 4A63A 6FABH 3NJVA 5E2TL 4MJID 3QFJA 5D5MA 4CC1A 3TBTB 4F8TA 3MUHL 4L9LB 3LS5L 3RL2A 1OGAA 4V1DA 4Z76A 4BSVA 4MA3A 1LDPH 4XVTL 4RQQB 2N7SA 5FUOH 3EYVB 2Z7YA 1NWOA 1CFTA 3T1FB 5DMJB 2NNAA 1O7VA 4W9DC 1BXXA 5ACLA 4XPFL 2VLME 5HHPA 1P5UB 4L9LC 1XH1A 2YPLE 4ODHH 5AVVB 4EI5D 1QFWH 1IM3B 5DSCB 1HH9A 3U0TA 3W11D 4UAHA 1MIML 2H2PC 4K73A 2Q7YA 1G0DA 2RFXB 2PPEA 2X6UA 3IXAB 3A3YB 3WNLA 2EDHA 3BFWA 1EUUA 1ED3B 1PYWB 2YBGA 3Q44A 1UCBH 3SBRA 4A6YL 5SWZE 2F7RA 1YMME 1P5UC 2UZPA 5TH2A 5GGRA 4W9EC 2VXQL 4XN5A 5GSVB 3N50A 4PJ9B 3KBPA 1T0OA 3SPVA 3A4EA 2BZ7A 4NQSB 4Z3EA 2W92A 2D0FA 2GBAA 1MSPA 2DJ4A 1JGIA 3V0IA 4Q9RH 4KO5A 2A0LD 2W65A 3CBRA 1GJUA 1TQSA 3VI3E 2AXHA 4F8PA 5JDSB 4QRUB 4LEXH 4F2MA 1QSED 1TTRA 4W9FC 1PD0A 4AIZA 4KV5F 5D71L 1XO8A 4G7QB 5BZDA 2X1PA 1N64H 3DJTA 1SVBA 3OHXB 4ABUA 1XCXA 4LVEA 4PJ9C 4RGOH 5BUPA 1NQBA 3OLIA 3GMPA 4LARH 3OKKA 3WGVB 1DANU 2Y5TB 4U6HA 3UTZB 4D7PA 4XPAL 4KITB 5E6IB 1NIDA 2X9WA 3MGOA 5C9KA 4B0MM 3BP6B 2Y6SC 1QR1B 2DM2A 1FC2D 5KWYC 1HJCA 3OHXC 4MAYD 3QUZB 3SOBL 2EXYD 4KTEL 4YDNA 2FX9H 1QTSA 5FEBA 2EIZB 1UD6A 3CX5J 5DRWB 1VHPA 4AH2B 1G6RA 1REIA 5E6IC 3EDDA 1CK0H 4WSKA 5JMOC 1IKOP 1C08A 1NL0H 4XMUA 5GRUH 2WZPA 4OFQA 3RL1A 3ZRSA 3B3IB 4HFWB 5EF3A 1NDGB 3TEYA 1CU4L 5KANI 4HUWA 2P80A 3QUZC 3K8MA 1U92B 2V5TA 3FQ1A 1EQWA 1SDDB 1TFPA 4GP5B 3FSAA 4ABWA 2VSCA 4QR7A 1JV2B 1MWOA 2ENPA 3DI2B 3IGAB 4F80A 3G5YB 1LMIA 3MUJA 4ORGA 4H26B 1XWVA 4HEPA 3DSFH 3TO4A 2AXFB 2VAAB 4L18A 4QWWD 4U05A 3MREB 3QHZH 1W8OA 4K7FB 4WGVB 3RFZA 3IJYB 4IBSA 3NAAL 1FZOB 1BQ5A 2JH2A 2VR9A 1ZXQA 4AENA 1NCDH 4I4WB 5DHVA 5C9JB 3HBPA 3PPEA 4LKCB 5GRZA 4M3JA 4DEUA 3LEVL 3WHXA 2X4NB 1OTSD 4JHUA 2EXTA 3LXAA 3U7AA 3F8UB 1OAKL 1RIVL 5IT2H 3Q06A 4FI6A 5KYUB 2GEEA 3CFEA 3HE6B 3O8XB 5IVXF 5SWSE 1H5BB 4GAJL 4AIXA 2BSED 5TDOA 3Q1SL 1UKSA 3CXDL 1BZ7B 3RGVD 1QSFB 4QUOA 1QEWA 5LAXA 4UWQB 3VYNA 3HNSH 2AZAA 4ZQKA 1AZCA 3S3JA 3DX7A 3RWEB 5JOEA 1HJBC 5I1EH 1OGPA 3NIDF 4KRLB 3BT2L 3HE6C 3O8XC 4UYPA 3RIAF 4G72B 2J5WA 1H5BC 5HDWA 4ZFGL 3PJSB 4F8OA 1J8RA 5CSGA 1JPST 2FSEB 2YAOA 5LGHH 2ZWLT 1QX1A 3HA0A 3VXPB 5FB8A 1MLCB 5DD3L 1X9RA 1H3GA 4G80B 5B1JA 2CIKA 3WFEH 3BWAB 2XWXA 1WC7B 3FCTB 4X7SH 3BZ4A 3DDGA 5EFIB 4AYSA 1KJ2L 2W60B 2UY6A 4X4KA 3KMDA 4K3DH 3QIBD 3TJEL 4QRRD 1YVLA 1B6UA 4LSQH 2F9BT 3MRDB 2IVFC 1NFDF 2LFEA 3GHPA 2E9JA 4YGVB 2JKNA 2YD5A 4Y4HC 1ZSDB 3WN5A 5DRXB 3T0EC 4ICWA 4NI6A 1Q1JH 3QS2A 5CJOH 2D73A 3O0RL 5H37G 4IKKA 1DQDH 4G43B 1L3WA 1MJ8H 1UUSA 3DUSA 3KPSD 2PTVA 1EHAA 3MRLB 4LAQL 1EJFA 2HH0L 2P5EB 1AE6L 2X88A 1FLRL 1IAIM 1YC7A 2E3VA 5DD6A 4YBHA 3NZUA 2I60H 4KXZI 2A6KA 2DJMA 4J6RL 4PGEA 4ZX4A 4ELKA 2WXPA 3ZTJG 2CWRA 2WNXA 4N0FA 4D9LL 5CJ5A 3QZOA 3T6ZA 1YDPB 1XF5B 3FQNB 1ZLUK 4UTAL 4GRMB 4B9KC 2AJUH 2B7DT 5I76B 5JUEH 2H8PB 4XPHH 2HJFB 3IJEB 4GY4A 4MNQA 1BW8A 1M1SA 1C5CL 2DQIL 4MX7B 2COQA 4O2EA 3TWCH 3QQ9C 4PPTA 5EO1A 4GUPB 1U3ZA 4G1EB 1M71A 2XN9E 3SQOL 1UD3A 5I1KH 4Z7OB 3UCQA 1S78D 5JIQA 2E27H 1QZNA 4G3YL 4DQOH 3PWVA 2MCPL 2ICCA 1JNHA 5F72S 5IOPB 1TU2A 4NN7B 4JE0A 2HVKB 4MS8D 4JY5L 3D0VA 4OCYL 2DM7A 4NNYB 4TSBL 3GI8H 4L48A 5JPMB 1CGYA 1N8OE 3BPCA 1TZOA 4OIBA 1KJVB 3LH8A 4OZIA 3IDMA 2BNUA 4L29B 1LEGA 3THMH 4G8EB 5EZOH 1K9TA 4K8RD 4DZBA 2VDOL 1BFVH 5JOFA 5HVGB 4NN7C 2Z1KA 3DX8A 3L2LA 4FQHB 3LIZH 1WUZA 4IRZL 5DQDL 4FFWC 2X9YA 5I1HL 4AYBA 2NW2A 5JPMC 3QZPA 2OZ4L 5BRPA 2A9DA 4JRYE 1U2YA 2AGJH 3OAZK 4AIEA 2IOOA 4D8PA 5B3SB 3JWOL 2N7AA 2AQSA 4I13B 2F15A 5FA3A 3BWUF 3KPRB 2OYPA 3QUGA 3WXWH 4YR6B 3UC0H 5GRYA 3ARBA 1AIFA 3VW3H 1NGXA 4DK3A 4GSXA 2ENQA 2BJML 3GJFK 4K3EL 2VN5A 3QEGH 4FQQA 5BRQA 3LKNA 5T1KA 3VFVB 2A99A 2OULB 3IAQA 2ISDA 4NB7A 3LKRA 4QRSA 4U7SA 2QLVB 5HYIA 1PG7L 4LDOB 1WJ3A 5C0DB 4PJAF 3RX9A 4FRWA 2YKKA 3S98A 3V5KB 3GNMH 4OQTL 2CE6A 3WFDL 4EKXA 3U46A 4J3UA 1MCLA 1FPTH 1X7SA 3WEXA 2OV0A 3CN1A 3RKPA 3KGRA 4JFPB 1N18A 4GKLA 2FTAA 4TNFA 1XGYH 1KCKA 1M2VB 3AS2A 3GRGA 3PP3H 4HKBB 4I3SH 2WO2B 3H3PL 3C12A 2H9GB 2YEZA 3OLGA 2WVTA 3MOBH 5H94B 4ODVL 1R3JB 3BP5A 1N59A 5E8DL 2C9QA 2YD1A 1WZAA 4H4NA 3IFNH 2YSSB 1M4KA 4WZ9A 2AK4B 3WSQL 1Q90A 2DQUL 4HWZA 4IDLA 2JJVA 5FO7B 3ULUD 4CW1B 1BX2A 5KSAC 3PWJA 4OCLC 1DN2A 1HYRC 4PRAA 3ABMB 3NOIA 3PG2A 1KV3A 4L37A 5D7IB 3PPSA 1EO5A 1EHNA 4XXCC 2VW6A 3U6XS 4K5PA 2B0SL 4ZQTA 4ELMA 5BXFB 2XWRA 2IH1B 5C0CE 1U3HA 3EOBB 4QHUA 3V4PL 3B2VL 3HNTL 1GSMA 4HUXB 5IFHL 5IF0A 4E2OA 1X9LA 3PNWA 4YXLL 3N1GC 3IU3A 1PVHA 4NKIL 3FN9A 1B2WL 5D1XE 3ECBA 2VW4A 4G8FA 4H1LG 5HHOA 5CKAA 1NCIA 4PJIF 1XXDC 1NGZB 4NIKB 4HT1H 5DJ6B 2DLIA 1QFUL 3N41B 4QHNB 4N6RA 2EC9U 1FNGA 4JFZH 2DYRB 1GHFL 1USQA 2ODHA 3ZJAA 2LW3A 2Y06H 4A2MA 3DIDA 1MJJB 3FUJA 3OWEA 1RHHB 4FYTA 2EE9A 5IB1A 3NZHL 2OL3H 2HAZA 2CCWA 1N2RA 4WFHD 4XTRC 2FD6L 2IQ9H 4CNIB 2DD8H 5DD1H 3Q9PA 4N2CA 2J5LB 3L5XL 4KZDL 4PAZA 4NKDB 5HHVH 3MLRL 1OTUC 5DQ9A 2QVTA 5I75B 1KYDA 3GBNL 3PHSA 4JRXE 1MEXH 5J56B 1J9SA 1JN6A 2M8XA 4YE0A 6PCYA 1W0VA 1JG9A 3QCUL 3NCMA 2J5LC 5DHDA 3B9KA 4DP0X 2FHBA 1LO2L 1ZS8B 3W5NA 2A3TA 3FSOA 1IARB 2IWKA 1MQ8A 3V6ZB 4BIKA 3ECVA 1WBZA 1YEHH 4UQDA 2WZ6A 4LFHG 1O5PA 4N68A 1CGSH 1A47A 3MJ7A 1EFXD 2NXZB 1SDAB 2VAJA 1TDQA 4HKZA 3DYPA 1UM6L 4UM9A 1OARL 2UZYB 3A6CL 4F33A 1F8TH 1FVCB 4ZFFA 1E4WL 1T7XA 4D0BA 2YAHA 5KS9E 4FX5A 4MTMA 1LM8V 2NXZC 3X12A 1S7QA 2OLDA 3AC0A 5ABDE 3AFLA 1C8PA 4JHAH 1V05A 1NAMH 3FTZA 1G1CA 2UWEE 1XMEB 4PCSA 1KGJA 1XHHA 3WIAA 3ILQC 5MEPA 2P5WD 1P7BA 2ZOUA 1K4DB 4Y1SA 3VO0A 1MRFL 4ODXA 3GSWA 2XWEA 1KIUA 3BMVA 1J7VR 1IQWL 1OB1A 1VLXA 1BG1A 2ZKHH 4A2DA 4XBGA 5I0WA 2R56L 4AQ1A 4LIQH 4LBEB 2VOTA 1OSZB 3ERXA 3B8YA 1JTPA 1DBKH 4MQ7A 2WXFA 4Y19E 4R26H 1PX3A 4KKLD 3I6SA 1NGPH 1RIUH 1AR2A 2NNCA 1ZLDA 3BKMH 4JG5A 3BJ91 1YC8A 3VI4F 3BE1L 2BZDA 1AO7A 4NNPL 2H47C 4NZFA 4Y9GA 5I17B 1NIEA 2NNRA 3I3EA 3O45B 1U58A 3H7BA 2FHCA 4J27A 5CUSH 4LCCA 1KC5H 2J88L 3QO0A 4OZHE 5JQHC 4HEMA 4G83A 5ETUB 3L3OB 3P11L 1KJMA 3WD5L 3FC8A 3LIZA 1A6AB 3TF4A 3HG5A 4N2GA 1GW6A 1FLTX 2JNZA 3VFWB 3L3DA 1W72L 2IGLA 3PWPD 1XSIA 1FC1A 2ED8A 2UZIL 5LAPA 4HJJH 4FFVD 1K72A 5E2JA 5E8EA 4FABL 5FIEA 1QA9B 4UQ2A 3BUQA 4G42B 4JO8A 1CL7L 3L3OC 4ZTOH 4JO4H 4AMXA 1PDKB 1YPZE 3FHAA 1NEUA 4MGXA 5HPMA 2Q7NA 2QGDA 3X17A 1JV5A 4I8DA 3CDZB 3O6FC 3CQPA 5FUCE 3EDKA 3MXWH 3U30C 5JMRA 4E41D 5IHZB 5H2BA 1SXZA 2A74B 4X0KA 4Z7OF 4ZD3H 5JHDB 3OSVA 3ECWA 2CK0H 1AQMA 2CRMA 3NA4A 1H8LA 2HZHA 3A47A 3OHMB 4MDRA 1MFEL 5DZPA 4AVKA 1BYNA 3D7PA 3KR3H 2YJLA 3LRSA 4M5YH 4OCSH 3D4ZA 4KUCD 1RZ8B 3P4MB 3UTTA 3VD1A 5ID1B 1MFVA 1X4ZA 4G6AD 1ZKAA 2A74C 5D2NB 3E6HA 4JFEE 4X8CA 1ZVSA 1XCWA 3M1OA 5E95B 5I8OH 5K9QI 4Y5VA 2GIYA 1OQOA 3S37H 1W2KT 5IB4A 5T3XL 2VLKD 5J9PB 2HTLC 3D25A 5HYJB 4PEEA 2Q3ZA 3FRPG 2FRGP 2IEPA 1Q0YL 4M1DL 4PCKA 4YDVB 5ECJE 4ES9A 5FGCE 5A43C 4TS6A 5D8JL 3T77B 5B8CA 1CJYA 5D1ZI 5B1BB 3BUIA 1U8HB 3LEYH 5HGAB 3QEHA 1ZJAA 4X8JB 4XMPH 3SQBA 4ZMLA 5LUMA 4LCUA 2YOAA 5FK9B 5IKCA 4DK6A 3T4AA 1V3JA 4YHYB 5A7EA 1RIHL 3AJ7A 1F4YH 4CDHA 2FQGA 4DPCX 1KBKA 3OKNB 3K0YA 2E47A 3FFOA 3LZLA 4TQIA 4B50A 1YNTF 3TCLA 3W39B 5ABAA 1OE2A 1P4BH 4PJBA 4BFEA 5IMLA 4IMLB 5E08H 4WHCA 1OLZA 2AEOA 1EERB 1B0RB 4Y2OA 3H9SE 3AITA 3CFQA 4X42A 1ROCA 5FFLA 3RUGF 3G6AB 4FL4B 1N0XL 3L3HA 3I84A 3EFDH 2E5EA 4YHYC 3BZFA 3BN9C 3EYUL 3BT0A 2GTWB 4P5KB 1X5AA 4JPKL 2VKXA 4UOJA 1ETB1 4IQHA 1Z9OA 1XGQB 2AV7B 4HS6A 1E2WA 3HMWL 3QB7C 4HBQA 3TIDA 2X44D 2V3EA 2PYEA 4OFPA 2WOBA 1D6VH 3PHOA 4ZI8A 1IJNA 2D7MA 4FL4C 3JV5A 4PM1A 4KDTC 4WV1A 3C2AH 1WWWX 5ANHA 5K9OB 5FM5O 2TRYA 4HD9A 4AVHA 1EEZB 1EZVY 4GMSL 2F5BL 4EJ1C 4L05A 3GIZL 3KYOB 5A2IH 3ISYA