2VM4A

Structure of alcaligenes xylosoxidans nitrite reductase in space group r3 - 2 of 2
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
334
structure length
334
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallography with Online Optical and X-Ray Absorption Spectroscopies Demonstrates an Ordered Mechanism in Copper Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 90
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vm4A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vm4A02
2PCFA 3CDZB 2MRYA 2N0MA 3NSFA 2MTAA 4GP5B 3T6XA 1MG3C 1HAWA 1JOIA 5I6MA 2IDFA 1J9RA 2VM3A 3PXLA 3QJSB 3NYKA 3X2QB 3CVCA 2XXFA 3NP3A 4KNTA 2AFNA 3PLYA 2VW7A 2CCWA 4AX3A 1AQ8A 3T6WA 4RH4A 3S8GB 2IH8A 2PPAA 1BQ5A 4HIPA 5E9NA 3FSVA 1PNDA 2PPCA 4KO6A 1ZPUA 6PAZA 1RCYA 1AR1B 1WS7A 5PAZA 2PPEA 3CZUB 5PCYA 4G7SB 3FSAA 2H3XC 3JT2A 4UANA 3QJTB 4P5RA 3TU6A 4DP7X 1WA2X 1MZZA 1KDJA 4GP4B 1L9PA 1V54B 1ET7A 3PPSA 1AANA 1SFDA 3CG8A 3FQ1A 2IWEA 4E9VA 1AZCA 4W9ZA 4QLWA 4BXVA 1A4CA 2QDWA 2BP8A 2YAPA 5I28A 4WTQA 2QPEB 4AKQA 1MDAA 1IUZA 3NJFA 4JKNA 4HHWA 4E9WA 1RZPA 1JZHA 3OQRA 4EF3A 4HALA 2DV6A 1V55B 1ILUA 1ZDSA 8PAZA 4YSQA 4BWWA 1NIAA 4HZ1A 2CUAA 1OCZB 2OCCB 2XUWA 1QNIA 4E9QA 3FS9A 3ZX1A 2FWLB 2FT7A 1ID2A 5D4IA 2BP0A 4A2GA 4YVUA 2IDUA 1YLBB 1V10A 1AOZA 2BZ7A 1OCOB 1SDDA 3AZUA 3NJLA 3QJQB 3WI9A 3X1FA 5AFAA 4F7KA 5B7FA 4DP6X 1BQRA 1NDTA 1IBZA 1PLCA 5B1KA 2VW6A 1WA0X 1AZNA 1M9WA 2FNWA 1A4BA 3FPYA 3EH4B 2YAEA 2RACA 3T6VA 2P80D 2EIMB 3IEAA 1JXDA 2AZAA 4F2FA 3NJIA 4X4KA 4GYBA 3S3CB 4A68A 1AZBA 1AZUA 1ET8A 2ZONA 1JZJA 2CJ3A 2ZOOA 1E30A 3UABA 2PCYA 4UF7C 2EINB 1HFUA 4YSAA 2EIKB 2QT6A 1JZFA 3ABGA 4G7RB 2GHZA 2YAOA 2X87A 3UGEA 3WIAA 4M4RB 2YAMA 3PAZA 3KW7A 3IE9A 4A2DA 5B7MA 3OD3A 1GY2A 1SJMA 4AKPA 2B08A 3DTUB 3ERXA 2UXVA 1E67A 1TU2A 1J5CA 1URIA 2ZXWB 3WNJA 3UAAA 2AZUA 1NIFA 2GC4C 2UX6A 3NSDA 2H5UA 5IY5B 2XX1A 3FU7B 1AZRA 4M3HA 3H4HA 5FC9A 2HRHA 1KCBA 4YSSA 4N8UA 2PP7A 2PPDA 4FA7B 1KDIA 4PAZA 1NIDA 4YVNA 4ZK8A 1KYAA 3S3DB 3FT0A 7PAZA 1BXUA 2IAAC 1JZGA 3AG1B 4G72B 4KOCA 3SQRA 1CYXA 1SF5A 4GY4A 1TEGA 3U25A 5ANHA 5I6KA 4AZUA 1OV8A 1ASOA 2WO3B 3QQXA 1A3ZA 5B7EA 3D12B 2PPFA 3WKQA 3NP4A 1JXGA 1ET5A 1B3IA 5B3SB 1KBVA 1QLEB 2YAHA 5F7AA 1PMYA 4BDVA 1ADWA 3GDCA 1J9TA 5I6OA 2B3IA 2A3TA 1CUOA 3WG7B 1ZV2A 4NB7A 4YSTA 3PAUA 1GS6X 2YAQA 1ASPA 1NZRA 3RYMA 4PCYA 1AG0A 2GSMB 3FPXA 4E9XA 4BWTA 2FTAA 3WNIA 2PP9A 3TA4D 2HX8A 4A2FA 1L9OA 2P80A 3AG3B 2HLEB 5B1AB 3FQYA 3C75A 1AS8A 4E9YA 1CC3A 1QHQA 3CVDA 4JHUA 3TBCA 4P5SA 3WKPA 1TEFA 2OV0A 3PAVA 1ZDQA 2HX9A 2R7EB 2W8CA 1AAJA 2XYBA 2XX0A 3T6ZA 3X1GA 3H56A 3FYIB 3NJKA 2XV0A 1BYOA 1AS7A 3NJJA 3V9CA 2UXFA 1TKWA 1NTDA 4E9RA 4HCGA 3MX0B 3QJUB 1NIEA 1FWXA 1EHKB 4FAAB 2GIMA 3AW5A 3AG2B 2QPDB 2VN3A 3X1NA 2YQBA 3NSCA 1GY1A 3DKHA 3S8FB 3IBOA 2BO0A 4YSRA 4HCFA 3ABLB 1AIZA 1JZEA 2VW4A 1W8EA 4GP8B 1JXFA 7PCYA 4N4YB 2IDSA 1BQKA 1NICA 4WKXA 1PY0A 3TBBA 4G7QB 2IWFA 3N55A 2J55A 3AG4B 1GR7A 3HB3B 2HX7A 2PLTA 1ASQA 5B1JC 1BYPA 2YAFA 1SHXA 5TK4A 3CVBA 1JVOA 1GSKA 1A65A 4AI7A 2CAKA 5I6PA 1RZQA 2JKWA 3N2JA 1E5ZA 4DPAX 3FU9A 2AVFA 4DP0X 3ABMB 1NINA 3ASOB 1R1CA 1N70A 2AANA 2FQEA 2PP8A 4Q89A 1DYZA 5D4HA 4K9JA 3V9EA 1E65A 3QPKA 2J57A 3PCYA 3X1EA 3TASA 3UACA 3UAEA 3CDZA 4DP2X 2DWSA 3L45A 1BXAA 2J5WA 3NSYA 3JTBA 4YL4A 2LLNA 4AKOA 1M56B 4CSPA 4KO7A 4DP8X 1ILSA 1NPJA 3IN0A 2BHFA 2BP8B 2BW4A 2R7EA 1OE2A 3ZDWA 3G5WA 2YXVA 4BXSV 4Q8BA 1SHWA 1MG2C 3OMNB 1M57B 4YSEA 2Y1AA 2UXGA 1XMEB 4YSOA 2Q5BA 2GC7C 2BWDA 3FQ2A 1FFTB 2GI0A 3ZBMA 1KCWA 3BVDB 3GYRA 5I26A 2I7SA 1HAUA 2FQGA 1KBWA 4YSCA 4W1TA 1XB8A 2VM4A 2XV3A 4KNSA 2NRDA 3FSZA 5A7EA 5EHFA 4KNUA 1WA1X 4E9SA 1A4AA 5B1JA 1NWPA 2XU9A 2DYSB 4YSDA 4ENZA 2HZHA 2XXGA 1PLBA 1WAEA 4BWUA 3NJHA 3ZIYA 4F2EA 1GS8A 1DZ0A 2BZCA 2IWKA 1E5YA 5I5IA 2BP0B 2DY2A 1L9RA 1PCSA 3H4FA 1MZYA 4TXVB 4HAKA 3QJVB 1PZAA 1SNRA 2XVBA 1GS7A 1BEXA 1OE1A 5I5MA 3FYEB 3T71A 4A2HA 1NPNA 3SBQA 4BK5C 4KO9A 1IKOP 2QDVA 1SFHA 1L9TA 1J9QA 1W6LA 1VLXA 3QJRB 3OM3B 2YXWA 4UAHA 2CALA 2FQFA 2IDQA 2XLLA 4DP5X 3FU8A 5AZUA 4CSZA 2IH9A 1WS8A 4A66A 2DYRB 1JZIA 1OOWA 1PAZA 1FA4A 1N68A 2UXTA 1RKRA 4YSPA 3EF4A 4GXFA 1ZIBA 2HRGA 1EZLA 1BXVA 4A67A 4JHVA 3FSWA 5I5JA 2VMJA 2Y69B 2VSKB 2TSBA 3EH5B 1BAWA 2IDTA 1AG6A 2EILB 4DP9X 4DPCX 3NJGA 3OMAB 3FU7A 1NIBA 5TK2A 1JVLA 1IC0A 3T9WA 1PF3A 3SBRA 2W88A 3ABKB 1I53A 4KOBA 3NJNA 3X1BA 3EH3B 3BQVA 4G70B 1AS6A 2GBAA 2X88A 2OJ1A 1KGYE 4HCIA 5F7BA 5B1BB 1L9SA 1OCRB 3OMIB 1GW0A 3NT0A 4HHGA 1UATA 3UADA 1OF0A 2FQDA 5LDUA 1J5DA 4G71B 2GB2A 3DIVA 2E86A 2JXMA 3IN2A 1OE3A 6PCYA 5I6NA 2HXAA 1NWOA 3MBWB 1A8ZA 3GXUB 4DP4X 1XB6A 2WO2B 3EHBB 1PZCA 1J9SA 2BWIA 1W6WA 4BDVB 1X9RA 2EIJB 1SF3A 2YARA 1PLAA 2CBPA 2JFCA 1JERA 2VSMB 3HEIB 4QKTA 2ZWNA 9PCYA 4DP1X 4KO5A 4NERA 2BW5A 1PNCA 2H47C 3KW8A 1L9QA 2J56A 2UX7A 2WSDA 4DPBX 2XV2A 1KV7A 2I85A 1AACA 2FJSA 2FT6A 1CURA 1CYWA 1ETJA 2TSAA 4YSUA 5I6LA 4MFHA 5D4JA 1XB3A 3ASNB 1GYCA 4E9TA 2I7OA 3S3BB 1ZIAA 5AKRA 1SDDB 3NJMA 1T5KA 2DWTA 1OCCB 3SBPA 4A2EA 2Q9OA 1X9UA 4NAJA 1F56A 2XWZA 4L0PB 3AY2A 1IBYA 2FT8A 1PZBA
chains in the Genus database with same CATH superfamily
1P2CA 8FABB 2K8QA 2EEDA 1JPEA 4ZAKA 3V4PH 4J1UB 1R5VB 2E7MA 1ZLDA 3D69B 1EEYA 1O7VA 5J8OA 1AQKL 3KWUA 3BUIA 5KSUB 3U30C 2N01B 3I6SA 3X12A 4ZO6A 3L3DA 2XA3A 3BDYH 2V0AA 4NHUA 4AEHL 3L7FB 5KSVB 4BFNA 3TT1L 3C6SB 2VKXA 1P53A 4FI8A 1WUNT 3MRGB 4O9HL 3V4PB 4R26L 4BE6A 1RUKH 4HIJA 4Y5VB 3DJTA 4HWBA 5LNDA 4NP4L 4XNBA 4ETQA 5F72S 5HPMA 4MJJA 4B5EA 1RCYA 2FUQA 6PAZA 4P5KB 5LWYL 4LCIH 2KMWA 5FA4A 4GFTB 1F1GA 2BSTA 2NXYB 3F7PC 1JV5A 4MJ5B 4RGMB 4UNIA 4Z7NF 3IJYB 5GS1B 4OZIF 3IWVA 2WQSA 3IRCA 4PJBA 1IGCH 2VZ1A 3QDGE 2NXZB 4YHNA 4Y89A 3S96B 3K46A 4IKJA 2LGNA 3WTTA 4W9ZA 4R26H 4R4FL 2WXMA 2ZKYA 2BP8A 5DJAB 5E24E 3BD5A 3ZL1A 1F0LA 1MNUH 1UWFA 1Q0YL 2O26U 2XTJB 3BKCH 1UWEL 2SEBB 3GUTB 2YUVA 3TBSA 5F1OB 3L5IA 1NBCA 1XZWA 1HWWA 1X5XA 2UUDK 1VB9A 1S7VA 2PNDA 5EOTB 5C0CD 3LKPB 3C60D 3GD1C 4D9LL 1MWAA 3Q6FB 3STLB 1SUJA 3CBKB 1JIBA 3MR9B 4KAQH 2Z0BA 2CR0A 5E8OA 2R2HA 1KYFA 3H3PL 4MA7H 2FZ3B 5D1QD 3FT4A 1NEZB 1OK0A 4P46C 3GI8L 4NKMB 2PN5A 1ZY9A 4RSYA 2R8SH 1V10A 4JREB 5KBNC 4YR6B 4OLZH 1K8IB 4Z3HA 4U0RB 2XWRA 2YUZA 5T8IA 3TN0C 2F1BA 3CLWA 2VLKB 5JHLA 4ZRGA 3U2SA 1GKOA 1NAMH 3CTTA 4XRCB 2JF1A 4OVUA 5A2LH 3D39D 5B1KA 5CBEA 3U36B 1TZHA 1NLBL 4Q0XL 4PQXA 1XHHA 1KYDA 4YHML 2J1XA 4HKZB 1OALA 4MCMA 4OCSL 1JZDC 4LRIA 1A2YA 5A16B 5BRZA 4U6XB 4XI5D 3VQMA 4U2YA 3VGGA 3L9EA 4X4KA 3VXRE 1HXYA 3H3BC 2UZYB 4DEPC 3TYFB 3RY5A 2EIKB 1FFPA 2YAOA 1FGVL 1CTNA 3IDYB 3AT8A 1G0YR 3JWDC 5G4MA 1QPXA 3QPXL 2ADFH 4M48H 3ZRCC 2WM0A 3LZNA 3VXOA 5BXFA 1A3QA 3HG1B 1TU2A 4WAFA 3V95A 4AL8C 3TBVA 2ZXWB 5C09E 5LCVL 1A6VH 3SE3C 2WBJB 4IW4C 1INEL 3BAXA 4PJAB 1JK9B 4C83B 4AGNA 4KJYB 4ZPVA 4LSSL 2A99A 1QRKA 4N8UA 4Y19B 3CMOH 1I1RA 3LKOB 3ZDXE 1MHPH 4PWGA 2FYVA 3DO7A 4Q4IA 4M1CD 3PQYE 2NLJA 3N41F 3FT0A 2YBRA 1QI5A 2K6WA 4LSDA 5E2UL 3AG1B 4D8PA 4NKQB 4WRLA 3A4AA 3FRPG 1OV8A 2F5AH 4AZUA 3NRQA 2A77L 4Z7VF 4DW2H 3B9KC 4B0MM 4XBGA 4IOIA 3RWEA 1QLEB 2YAHA 3DXAB 3MZGB 3HC4L 4YNYA 1F42A 3QZNA 3WFZA 4BQ6A 5K9JL 4U05A 2X6MA 3DDGA 2RD0A 4QXGL 5FHAL 1TCMA 1JHKL 3KPLB 4WENB 4Z7QE 5KEZA 3T0EC 4YZWA 2GSMB 1PAMA 1RD6A 2HX8A 5C0CA 4N2CA 3REWA 3U46A 5HGHB 1KLFA 3QDMA 4KTYA 4P3CL 4F7PB 5IEHB 2EDTA 5C0IA 1CDUA 1G9MC 1RZFH 1YSOA 3L3HB 2NY4D 2VC2H 4L1BA 5TTRA 3J07A 2KBGA 4LGRB 1N4XH 4NRYB 3SDXE 3RPBA 5DHEA 2JELH 2QQQA 4IRJA 4DO5A 5A7BA 1OAKL 2AK4E 5DS2A 3FT2B 3EYUH 2FRGP 3P77B 1D5MB 2Y6SC 3WENA 2YPLA 2OSYA 4UV7L 1NIEA 3M45A 5I76A 4U1GC 4HS3A 1CFNA 4YXLL 3B34A 3F2LA 1SLVA 3GBEA 3BT2L 4K71B 4M7KL 3OKDA 3T2NH 1Q9WA 3KNBB 1XX9C 4ZUSB 3NPSC 1AFVL 1VACB 3UC0L 1R47A 4WK2B 2G4GA 5MEOB 5HVHC 4PJHA 5IOPB 2W65A 2P24B 3EADA 4YR6A 2EQDA 2BNQD 2YOCA 3FZUC 2PLTA 1SJEA 3QG6A 5B1JC 1N26A 1FJ1B 1QHPA 1EFQA 3RX5A 1MFMA 4TNWF 3S34L 3M17B 1VEPA 3GSWA 2JKWA 4MS6A 2X4QB 4ZAKC 3ZOAA 2AVFA 4NZTH 5F88A 1FYTB 4KPHH 5I18H 4XPFH 5C9KA 4J6IA 1X4YA 1CL7H 3QZPA 1I7ZA 3MRIA 1RY7B 4OB5L 1VSCA 3T8MA 5CZVL 4L8CA 1Q9LB 4KK8C 2VISA 2V2XB 1PCXA 3QEQB 3BH4A 4TRPL 1SLWA 1X5GA 1XCQB 4GXVH 3RVVC 1LO4L 1P7KB 3L7EA 3B9EA 4UT9A 1HEZB 2I5YL 4EXKA 2BP8B 3HNSL 4HUWA 5DJAA 5KJ7E 1OE2A 4F91B 2Y7QB 5E7FA 1M7IB 1TXKA 3KS0J 1KEML 5E8PA 2AAAA 3WFBL 2YC1B 1K8DB 3FO1A 1M57B 2D2OA 3MCKA 2Y1AA 2DRUA 1XMEB 5DC9B 3GLDA 4M8QB 4WWKA 5FYLL 2A9MH 2ICES 4OKVB 4AV5A 2Z31A 2NYKA 5ID1A 3TEUA 5ISZA 3ZLQC 3DI3B 2AK1L 3BEWB 1YO4A 5DD0H 1F4WH 1JWMB 5E9DA 5AG8A 3Q2VA 5CJXC 4APXA 2JJTC 3CZFA 1YEKH 2MNJB 2NZIA 1JWSB 1LK3H 4JY6B 4RFOH 4ZDHB 4LQFH 5EBMA 4U1GB 2ZOWA 3MOAH 4M43H 3V4PA 4FQIH 1I1AC 4QHKI 4HK0B 5LGHL 2XVGA 2XXGA 4HJIA 4P2RA 4S1SH 4GSQA 4JZJA 1XL6A 5CGTA 2FSEA 3A4DA 4TXVB 1CN4A 2YD9A 1MW0A 5IMMA 4B9GA 5JZ7D 1H0DA 2VC2L 5J6HA 4UM8A 5LAXB 1V7NH 1GS7A 1JPFA 1LHZA 1WFNA 3KWXA 1E5CA 2NY2B 4PWFA 2CO7B 2BNUA 3BQUB 3HAEH 5FKPA 4X98A 1CLZH 4MAUL 1L9TA 2ESVE 4P2CG 1GIGH 4LCCC 1F02I 2WN2A 5CHNB 3ARFA 3MRLA 5TF1H 2F1AA 2WLYA 2VH5H 3WEXA 3IDNB 4CAGA 3S9DB 1TDQA 1WD8A 2LR4A 1A9VA 5CILH 2P8PB 1EDQA 3FRPB 3OG6B 3OPUA 4XB7A 3H7BA 3BWSA 5I66B 3CZNA 4TULH 3VWJA 4GXFA 1KZQA 4YHIA 4ODXB 2BOBB 4WI6A 1EZLA 4N2NA 4KXZH 4YHKL 1XWVA 1UCBL 4DK6A 5I5JA 4MNGE 2W9EL 4BSWB 1R5VA 1CLOH 1Q9WB 2NY0B 4YHPA 2R0KL 3DDFA 2JH2A 3C5ZB 2XN9E 4WI8A 4G43B 4PV1C 8FABA 2VLME 1BIIB 4FTVE 4LFHG 4PP2A 3EFDH 3MUGB 4L4TA 4BE5A 3OKMB 4TLTA 5IMLB 4PJEE 2BFGA 1GGBL 4C4KT 4F9LA 2BC4B 1DN2A 1QYGH 3QHZL 4N2AA 3SDDB 1ES0B 3ZDYB 3G5YB 4KKBC 4W9IC 5E2TL 3VVVA 3V79C 2BIHA 1TQSA 5I0XA 3V0AC 3L3DB 3SIKA 1Z9LA 1QEXA 5GS0H 4PJBE 5T5NF 1YY8A 3Q2LA 1JGUL 1K4DB 4KK6C 4PJ9C 4W9KC 5HDWA 1L9SA 3GIVB 4PG9B 1WITA 3RB7A 3NT0A 4X6CF 1IBGL 3ETTA 3EH2A 1J5IA 4LKXB 2E86A 4KJQC 1ZVHA 4J6RH 2P3YA 3QNFA 4QOKA 2WYZA 5F3BA 1YZZA 4AVIA 4M1DL 3SDAA 4YAQA 5T1LD 1HE7A 5K9KA 2FD6L 1B90A 1W6WA 2N7AA 5D1XE 4XWOC 1U8QB 1BD2B 2SEBA 4J23A 2E56A 3ULUE 1S7TB 2IAMA 1OARH 1I7RA 3RZCB 2NXYD 4N90E 4ODWB 4N6RB 2JFCA 4EIBA 2HB0A 3DX6A 3QORB 3ME0B 2FX7H 5IEHA 3US9A 3GHEH 5JYLA 2VAAA 4JPQA 4PPTA 4YXKH 2BM3A 3O9WC 1E6JH 2B0SH 5HYSA 1S9WB 3WYRA 2WXOA 3MBEC 3P11L 1T4KA 5FECA 1D3CA 2X1QA 4N5ED 3O4LE 2YMTA 3L1FA 3P02A 1A9EB 2WHVA 5F8QC 2YD6A 3SHSA 1D9KC 1U36A 4BH7B 1AXTL 1A6UH 3KPQB 4XZ4A 1OAYL 3RY6A 5I19L 1XIWD 3I3BA 3GI9L 4IHOB 4MA3B 4MB5A 5E8EB 3S37L 4PJAA 1M3JA 5BO1L 4KMLB 3MXVH 1QKZH 3L3IA 5BV7H 4M5YL 5AKRA 2WUBL 5ECJE 2YFOA 5FO9A 4L8DA 4D9QE 2X4PA 2MSPA 2QSTA 4FE9A 3SKJH 4JHWL 4KU1A 2BVPB 3EKCA 5D2LB 1H8LA 5EG6C 4R7NB 2WB7A 3VTAA 1IAOA 5JW3H 4ORGA 5F21B 3I9IA 4ALAL 4YHZL 4RZCA 4X4ME 2XHNA 2KPWA 4L9LC 5JUEL 4XMZA 1PKQB 4UQCA 2EVHA 1KTJA 4AJYV 1IGCL 2MIZA 1YY9C 4F2MB 3ARTA 3X2QB 4NZRH 1KJ2B 3CVCA 2W9DH 4CMMB 2FECI 4AMKL 4GBXB 1QBLL 3AFLA 3VGEA 3QWRD 4F1ZA 3HZVB 4PWKA 3JZYA 3RL2A 5TDPB 1MIML 3SB3A 2E4FA 1MCJA 4O02L 3SKOB 4Q9QL 2OCFD 2NW2A 1M7DB 3LEXA 5KSAA 5E9NA 2EXYC 4IM8A 5JHDA 1TYRA 1UB5A 3B8SA 1WGOA 3H9HA 4L8BA 2CBOA 5FV2A 4YHZH 4AIOA 3N50A 1AR1B 3V0WH 1JZ8A 3P54A 2JJTA 1P1ZB 1QLFB 2ZCLH 4HBCL 5PCYA 1BZEA 4PREA 2R0ZL 3GMNB 2A9AA 1U8HB 4AYGA 4MZ3A 4X4XB 3WJMB 3KL5A 3MKGA 4U1IB 1O5DT 1JI2A 2OX5A 1OWWA 5E8NA 5DHMC 1CDGA 2VAAB 5JQ6H 2Y07L 3U2SB 3ZIMA 4JPWL 5AVVB 4S10A 1J12A 4KDTC 4BBWA 2ADYA 1ZPLA 1AMYA 4F8TA 4QRPE 4YDVA 4YDMA 5FYJD 4LASH 1HWHB 3ARGA 4UT6H 4ONHB 1VKXB 5J56B 5DZOA 3BWUC 3B2VL 3WO3B 3X13B 3KPNB 4M6NH 2YD3A 2FH8A 3BAKA 4L9LB 4MD0B 3H6AA 4Q2ZB 3DX9B 3VW3L 5MEND 3MO1B 1E5BA 3KPMA 4KJWD 4BZ1A 4TVSa 2B1HL 5FGSA 5LCVA 5DD6A 5IQLA 1A7RL 5EO0A 3FS9A 1FYTA 5AOJA 5EEUA 3BAYA 3LDBB 1YC7A 3GSQB 4JRWA 1E5AA 4ERSH 2IDUA 3ML9A 3OGOE 2FD6H 3IFNL 5L2JA 2ITDB 5GGVY 2H32B 1KELL 1QFPA 3OTTA 1E90A 1YEHL 3LXBA 1KB9K 4Y4KB 5I30H 3PQYD 5H94B 2GT9A 4GMSL 1QTSA 5CHNA 3QCUH 4PM1A 4GOSA 2WTOA 3BFOA 5T1LA 2DMGA 1FNFA 4XBMA 4ZQKB 3KNBA 1QBLH 5E1GA 4JO8A 1NGXB 1N4XL 1NCBL 4HJGA 2OYMA 5AB1A 3MBEB 4RESB 2EIMB 4PUBL 4HS3B 4I3RH 5DJDB 4NYLA 2N0KA 3OQ3B 3LQMA 1L0PA 5KBLA 1PX4A 3C60C 3T0EE 1WBYA 2ZOOA 1UEMA 3BPCB 1OCWH 1P7HL 1OTSC 5IROC 5F7NC 4JZJB 4O4YH 2BSED 4JO5A 3WD5H 1FG2B 5A6LA 3DTUB 1QA9A 2PTTA 3QHTC 1ND0B 3IJEA 4LHJB 4BUHA 1URIA 3IFPA 5EV7A 1TNMA 5I6XB 2YJLA 3RGVD 2H32H 3GGWB 3CHSA 3VRLE 4XPHL 1R3HA 2CO7A 4UOW0 1T1YB 4YSSA 1A1OB 2ICWA 1LE9B 4WEBL 3MNVB 4KXBA 2VR5A 2R69L 4HHAA 4L4VA 4ZK8A 5ILTH 3O3EA 4AWJC 4OV5B 1LNUA 1I7UA 1QRND 4QRQA 4BCZA 1M2OA 2A6JA 1A4KB 3NESA 1X4ZA 3OX8B 4DKAA 4ZTOL 5IK3B 4CC4A 4DGVL 3ELQA 1KCSH 4LOFA 5GZNC 1MI5B 3OXSA 4LPVA 2QPSA 3OKOA 5EF1A 2ED6A 2X4TB 4P9HH 3VX1A 5ALBL 5K9KB 1MJ7H 5CBAB 2ENJA 1V7NL 3QNYA 1S7XB 5AAMA 5GS0C 1Q1PA 4JFZL 1DR9A 1FL3A 1HHHA 2Y5TA 1F86A 5FUCE 2HKHH 5GJTL 1DLHA 4OT1H 4P59L 1KGJA 4JBSA 1Q9OA 2YAQA 4A2MA 1C7SA 4X4XA 1YEDA 3T77A 1NUFA 1YN6A 1X7QA 2IPUK 4JLRA 1U6AL 3TA4D 3KLSA 4FCAA 1BF5A 2ZE0A 2QR0B 4S1DD 5EWIL 2HRLA 3CVDA 1N0LA 4KTGA 4PVMA 4RAUB 4QPEA 4XPBL 5D72H 3MRBB 2OV0A 3U9PL 1I75A 2DQDL 2BVOB 2XQBH 2FAUA 2R7EB 3X1GA 3BLPX 3GSXA 5FO2A 3V5HA 3LPGA 1BMGA 2XV0A 1HWGB 4OLUH 4UT9L 3LV3B 5HD8D 1KV3A 4LL9A 3QIBA 4LPYA 4OLZL 3VXRB 1QBMH 2MNUA 3NVQA 3RFZB 3MFFA 4OBRA 1QLEH 3R18A 5DJCB 5EO1A 3PNWB 4PLOB 4UB0L 4QTIL 3ULSB 3IGAB 5AL8A 1DUYA 4KZ0A 4LOEA 1XGYL 4NFCA 4QT5A 4QO1B 5K69A 4WJG3 1IJ9A 1CXIA 2J88L 2XPGA 2YEVB 3HR5B 4UTBA 2J25A 1EJFA 4ONGH 3O9WB 3SDCC 3QFJE 2ADGA 5F3FA 3MRKA 4BGLA 3ETBF 4K7PL 1JVOA 4PRBA 1Y0LB 4QHNA 1U3NA 2HFEA 1G7LA 1E4XL 2J8HA 1UGKA 1VGEL 2N7SA 3FMGL 4GSDL 4LBEA 1S8DB 4GUOA 1WUZA 2AQ2A 4ZMQA 1U92A 2ZUQB 1ZTXL 2ZKWA 3PABA 2BH0A 4JHZA 2ATAA 4BH7A 2PP8A 5IQ9B 4R0LC 3L4CA 4F15B 4NZTL 2R4RL 2H8PB 4QXVA 2ROYA 3QRBA 5CR8A 3SQBB 4XPTH 5SV4A 2BVQA 4CW1A 1DJGA 4DTGL 1X44A 2NNFA 2XVKA 1J0JA 1LO3L 3RFRA 4F7CA 4HKXA 5JPMC 4EQ3A 5IV2A 3VNYA 4H8QA 4JQVA 4X8CA 2BHFA 4AXWB 1GGYA 1SYSB 1WIOA 1CFSB 5I1JH 2UWEB 3H9SD 3KE0A 5AVWB 1A6TA 5IG7A 2YK1H 1RIVH 1U8QA 2ZCKH 2DZEA 5ID0B 3RA7H 2EUVA 3QHFL 3C8KA 1CLYH 3EFOB 4Z7WB 2BRRL 4P23B 4LRIC 4I1PA 3DNKA 1KCWA 12E8H 3CX2A 4HZLB 4AEEA 1JPTL 1EHLL 1HAUA 4NXKA 2FX9L 1JI1A 3ENEA 4WTZG 3TH3T 3L5HA 4PTTA 4Y16A 2IQ9H 4G9DB 5B8CC 3LNHA 2ZF8A 1PJWA 3VA6A 1XAUA 1SBSH 2NY3D 1UM4H 2OTUB 4KNUA 4OBSA 5ESAA 5F7HA 4ODXA 4YPJA 1A1NB 1JNNH 1M1XB 1TJHL 2NTFB 2V33A 3U9UB 1EAOA 3LEVL 1L9NA 2MKLC 2DYSB 4QHMB 3MLZH 5A2CA 1Y18A 4YSDA 2JJVA 3C6LB 1INQA 3ZYIA 2BSSB 1CO1A 1ZLWH 3GXMA 4JJOA 2IWKA 4M6OL 3I6KB 5I5IA 3LHPL 1XGYH 3P3UA 5B38G 1XSKA 1YJDC 4KQ3H 3HMWH 5C2BL 1DVQA 2VQTA 4FMKA 3AWFA 4BK8A 1RK7A 2XZCH 2PXYB 1VGEH 3FMGH 4RAVA 4J3OG 1GZQB 1LO4H 2HMIC 4WI3A 4MDIA 4ZFGH 3AITA 3WUWB 1OW0C 4W4OC 2IH3A 5G55A 3OBAA 3ZTDC 1XXDC 3G08A 3RHWF 3RUGE 5AZUA 2GK0B 4TUKH 1WT5C 4UDTB 3WDIA 4JB9L 4E41D 3AVEA 4PJ9A 1HC1A 4CDGC 5AEAA 3QG7H 1G7QA 2WQWA 4UWQB 5EC2A 3BSGA 3IDJA 3NCMA 3PUUA 2F0CA 2IF7A 3H85A 4I48A 2J8UE 5E5LA 5IIEB 5I8KH 3SE4C 4L1LA 2EDXA 2G0LA 1K4CA 4LAQL 5D2LF 4I0PC 4F5CE 3CFBB 4P06A 2IXQB 1DL7L 3BKML 4BFRA 1RPUA 5JO5B 5ICYB 2EILB 2PCFB 3E7JA 2DDQH 1D2OA 1UQSB 4GKLA 3BN9D 1VA9A 3BPNB 2XYCA 1SOSA 2C9VA 1OO2A 1MJUH 1AP2B 2OJEB 4NN6B 4QD2E 2OZ4A 2Q8BL 1S78C 3UXFA 3QIBD 2CO6A 2M1KA 1D5ZA 1YRKA 3UTSD 5T1DL 1HK6A 3X1BA 1GHFL 5GIRB 4MXVE 4X7SH 1IL1A 2M2DA 4PS8A 2A6JB 2APXA 3N5AA 2JWYA 4X99B 1OTUD 3ZL4L 1ULVA 2O6EA 2VDPH 4G7VH 4KK5D 4OZGB 1R46A 1CD1A 3DO3A 4EE2A 2AQ1A 1J1OL 1PLGH 1ZHBB 1ZTMA 2RJMA 1M1SA 3UX9B 3K6IA 3QW9A 5CP7B 3WAJA 4R0LA 4S1RH 5DUBA 1J0ZA 4ZPVB 1P1ZA 1EXHA 1QSED 3ARBA 4N0UB 6PCYA 5DUML 4WFED 3LIZL 4OGAD 4PJDB 4OLXH 3JVGA 1URZA 5CILL 3UBXA 3K6SB 1MFVA 1WVZA 4BDVB 2FEDD 3HMWL 1QASA 4GG6A 5GGSA 1U95A 3U79A 4H2AA 4YO0A 4B96A 1WV7T 2BINA 5AZ2L 4FP8L 3K2MC 2AITA 2J1ZA 4JFFA 4Z77A 3NGBB 1BAFL 3BPCA 4KO5A 1GYVA 2YPVL 1PIFA 1OM3L 1PKQA 1GMEA 1IGYA 3F7YA 5IJKC 4OKDA 1IEAB 2Q86A 4HF5H 1F41A 1Q94A 1OPOA 2CZNA 1YYML 4MTMA 1OGAD 1AYOA 4JG5A 1TO4A 2DF3A 2LQRA 5I2IA 5DURB 4AM0A 1EFXD 1CYWA 1SMAA 1MIEL 2F7RA 2XN1A 3KPLA 4XVJH 1L5GB 3VU2A 5EOQH 3V8OA 4K71C 1GYCA 4FQJL 1CE6B 3S3BB 4Z7OE 3BESR 2ZPKH 1TYJA 3NA9H 1ZS8B 4JFPB 1AGEA 4NRXA 5DTFB 3V52L 4Y4KA 4J3WA 4FHJA 4Z0BH 1S7SA 4ABWA 2DMKA 5IF0A 2AV1B 1MQ8A 2GBTA 1C5CH 4AQ1B 5JHDE 3QPQC 4V1DA 4Z5RA 3VSVA 4CMHB 3LTVA 3QJZA 4PRPB 2VQ4A 4PP1D 2FEDC 3M8OH 2F9BT 5LQBH 5D7KD 1CXHA 5D7SL 2VXQA 4J4PC 4FTVB 5EU6D 5LLIC 1CPUA 3SQBA 2QHRH 3ZHKA 3L54A 5IFHL 1ED3A 4P4KB 3DK0A 2XG4B 1S7XA 3JVGC 2DQHH 4MAZA 2L7JA 3GMRA 5SWZD 2VITA 2XACC 5T1KB 3MA9H 4RNRB 3MFGB 3BD3A 1DBJH 1MHCB 2GPZA 1BA9A 1MCOL 2NQCA 1F8TH 2O5XL 4AX3A 3D52A 3T6WA 5HDQL 3KH3A 4HD9A 3WAKA 3BZFB 4FZ8H 3PG2A 3QO1A 3QDJD 4KO6A 5F7EH 1TIUA 3MV8E 4NOFA 3QYMA 3PNRB 4NNYA 5DD3L 3ESUF 3RDJA 4MYPA 1LWJA 3K2UH 3IDXL 1UVQB 4JKMA 2F61A 4P5TA 3GKZA 3QAZB 3HN3A 5JIDA 3BVNA 4FG0A 4MQTB 5EH1A 5INDA 1EPFA 5BZWB 1ET7A 2IALB 2PCPB 1CDYA 3CG8A 4ETQB 1BPVA 3O41A 3Q5YA 1IQDA 2GAZB 2QEJA 3K5RA 2XBTA 4WI9A 1FPTH 4LPWA 1TZIA 1O6VA 4ZW8A 1KJ2H 3GJEB 1X5JA 4PGCA 4PRPD 2P8LA 4GUPB 4X7EC 2DV6A 2P48B 3KZ8A 4GLRI 4HDIA 3VMNA 2WXNA 4LMQI 4NKMA 2E9IA 5B3NA 2FLMA 5T3ZD 4M9OA 5TE7H 1GOGA 2QBWA 1RZKC 2DB8A 1IC7L 3RILA 3ULUC 1HKFA 3ULVE 5GRXG 3PWLA 2AXHA 3RJQB 1P4BH 1FSKC 3HFMH 3QRGL 3QUKA 2ZIDA 3OLGA 1LK3L 2Y9RT 3MRRA 3NG5A 4RFOL 2QVKA 4HEME 5CBEB 4JQIA 4H20H 1NEZG 3QXTA 4YVUA 2HKHL 3U4AA 2AXGA 4NQCD 3EZJB 5GGSB 1VADA 2V4LA 3HN8A 2XETA 4OZGF 4QR7A 5EUOA 1LO3H 3RGBA 4NLAA 3ZE1E 2D03H 3DSFL 3QS2A 4OTXH 4P4RB 2FIRT 3ECBB 4NUGH 2CCVA 4AJWA 1RERA 1K5NA 4U7SA 4GMTL 5EBLB 5EEYA 5IJKA 2NY5C 1QRNE 3EO9L 4GFXA 4GAYB 2VDQL 2YQ2A 1UUSA 1C9SA 2EDYA 3O2DL 3S4SA 3P2BA 2VQ1B 2KZWA 4EUPH 4ZO8A 1G9NL 2VN6A 4YIQB 1E30A 2G75B 4O02A 2YA2A 3WIAA 1M05A 1IBDA 1NSNL 2X87A 3SDYH 2YWZA 2CO6B 3OPZL 2F2HA 4HUMB 3O6MH 4MVBD 1OAXL 1NCHA 2HG0A 3PGDA 1QG3A 3FB6A 3EJYC 1S9YB 4PJGA 2XWXA 1UA6L 4DN3H 3BDXA 1XCTB 4MMZB 5IUSA 1KFGA 4LP8A 5E8DL 3VD9A 3WTUA 2PPDA 4AVJA 1XR8A 1RFDH 4GQQA 1KDIA 3FULA 1AGCB 1B0GB 4A55A 5C0JB 3MRQA 4K07A 1LEKA 3K8LA 1S9XB 5D9SB 1RPKA 1R5WB 1F4YH 3PRZA 1L3WA 4U6HB 3GS4A 1TEGA 1QBAA 4XP5H 2VZUA 4M6AA 5EZLB 3VXTA 5C6PB 2P7TB 3BQUD 1P4BL 3HFML 1CICD 5D7IB 1T0NA 2ZSVA 3KLKA 3QNZA 1R5IB 4RDQF 5AVSB 1UA6H 4DN3L 1TF4A 3TURA 2DPKA 2JK5B 3B56A 4L3EA 4BDVA 1I3GL 1PZ5A 2B3IA 2DQCH 4B41A 1NMBH 1REIA 3OB0H 4OCXH 4XOCA 2EUZA 5DQJB 4EDWH 1N2RA 4P5TB 1QPKA 1FNHA 3O3DB 2NQDA 2X3CA 2BS9A 4MMXC 3QFDA 2QLVB 5KYYA 4R83A 4P23A 4RCAA 1I8KA 1I3VA 3R06B 4PGDB 5DO2D 2DQJH 3VXMA 4OF0A 3JTTB 4U33A 1ZA3A 3VD4A 3QUZC 4C56E 2HG5A 1Y18B 4W9FC 4KFZC 4DQOL 4PW4A 4EPSA 1CGYA 2VRKA 4EJ1C 4JMXA 4WW2A 3G5XB 2WCGA 3RY4A 4HLZG 2JB6A 1ZWIA 2P5WE 1TMQA 2J6EL 4B53A 1DBAH 1S7RA 1DJSA 2DEWX 4B9YA 5E2VL 5AD0A 4F7PA 1GZHC 5LBSL 4NQCA 4WEBH 5MENB 2UYLA 3S36H 4FAAB 2PYEB 4P2OC 2Q3ZA 5LGKA 1JNNL 1OY3B 3KAAA 3WIHL 3I6GB 3VXPA 1WJ3A 1FDLH 2GW5A 4X7TA 2ZUVA 5CXPA 2K8MA 4LSVH 4AYID 3VRJB 1JWMA 2IANB 4ZXBD 3SDXF 5F1SA 2IO5A 3PHAA 3QUMA 3ZL4H 1OP5H 4PRPA 4L1TA 1UENA 1T2QH 3E9TA 4PJFB 1D5MA 2ODHA 4NZFA 1NICA 3OXRA 2X4UA 1Q0YH 2R1XA 4JM2D 2C3HA 2ERJC 2H3NB 2WWNA 4WV1C 4WEUD 3EDFA 1IBHA 2K6YA 2HX7A 5EC2B 2O61B 1WLHA 5EUOB 3FFDB 4XVSL 3CVBA 2VLJE 4Y4FC 2JKRM 2ZKXA 2ZXCA 3MNWB 1YQ2A 3GXFA 4KV5E 5DK2A 2VITB 3C12A 3NCFB 5T1KA 3WMSA 5D5MF 2X09A 5ABDE 5DO2C 1OGAE 3UG3A 3HE6A 3IETA 4KITB 5I1GH 2ZT9C 1C5CL 4MJHA 4O2EB 5ICYA 3C2AH 2G0KA 3CSFA 4WI0B 4B97A 1GYAA 4RIRA 3IMTA 1N10A 1DQDH 2Q76B 5A3ID 2ED8A 4NM4H 3TNNB 4DP2X 5CJOL 2X1PA 4MRBA 4YDIL 3HHSA 4YL4A 4AKOA 4B3VA 1R6VA 2V9RA 2BNRE 2Z93B 4KO7A 4POUB 3WFBH 2OMXA 4S1QL 2OLDA 1H5BB 1OD9A 4YBLB 3RTQC 2CDFB 1SBBA 1Z0NA 3UP6A 3FQTA 3MV7A 3NZUA 5TFSH 3SKNB 1KB3A 3SY6A 4ZOBA 1KB5H 3HB3D 4P5TC 1BIIA 1CZ8L 1TTRA 2X4RA 3VA2C 1TFHA 1P5VA 1F58H 4HKJB 4U1JB 1GOFA 4QNPE 4ZFGL 3UPRB 4BSWA 4ZUSA 2UVFA 3IK2A 4IK7A 4YSCA 4BGDA 1RXLA 2OZNA 2EDHA 2VM4A 4TSCH 1XFPA 1BYNA 3LVEA 1TVDA 4LLDB 4MJIA 4DO4A 1TQCB 5LB1A 5L8KB 3AS3A 1IFRA 2FX7L 3O6KH 4LLVA 5FO9B 5DHDA 1K6QH 3MA7B 2JIXA 4OFQA 5ELIA 3K6SA 1UM4L 5AENA 3UAJA 4NOBA 2GTWB 2D7TH 5LAPA 3MRCA 1C5BL 1RUML 5DC0A 5C6TH 1MRFH 2CLVB 2BSEA 2OJZH 3DO4A 1I3GH 3ZKMC 3P4NB 4MYWB 4AM0B 2VMDA 4QOKD 3O0RH 1J87A 4UDUA 5AAMC 4Q9RL 1KIPB 4FF9A 1V3KA 5KYWB 2ENPA 2JKTM 1IEAA 1SMOA 3LSOA 2ZKHL 2AJVH 3N91A 3QR0A 1BJMA 1XDTT 3DGGA 4GW5A 1UYWL 4MNQE 2FQFA 4YHLH 5GIRA 4LLYA 3CSTA 3HG1E 3QUHA 1JGUH 4MNGB 2ZZUT 3VD2A 2VQUA 5IF0B 4NKDA 4WW2B 4EVNA 2XZAH 4GAGH 4TVPL 2IAMB 5IQOA 2CHNA 1MCIA 2XN9B 3EGSA 1CDJA 4I89A 1AGEB 4FXGB 5ETUA 1KWKA 1ZIBA 5D1ZA 4WHCA 1TJIH 4YS4A 4YC2C 4DZ8B 3W0WA 1JHTA 3WEAA 3F12B 4FNSA 2Z8RA 1YQVL 3DJ9A 4F9PA 4PJCB 3VMOA 5C2UB 3GSVA 5FM4A 4MSWB 1ANUA 5HVFB 3OKYA 1EQWA 3K6FA 1S7VB 5I0YA 1KXHA 3FH8A 2XQYA 1X6NA 2ETWA 4XHQA 2YGOA 4OFVA 3FTYA 4NUJB 5F9OH 3PHOB 4QXUL 1FSKB 1MFEH 2ZXBA 1T0NB 4ZBJA 1GGCL 3TH2T 1QEWB 2ARWA 5AKVA 3AY4C 2QQLL 4Z7QB 3P4MB 1YCSA 2XJKA 1T3FA 1F3JB 5IHUL 5IJCC 1MQKL 1KGYE 2X0UA 4LCWE 3V6OE 3REVB 5T1DH 5E4OA 1OCRB 3UPCA 3IKCA 4EKJA 3HPJB 3MGOA 4QRUB 5DVKA 3O3DA 4GRLC 1AHWA 2X70B 3LZFH 1YMMB 4G71B 2Q8BH 1TOXA 4JFQA 1OSZA 1QI3A 3NIDF 1H9DA 5GGTL 4N0YH 1L0QA 4AW4A 5I6NA 4MLSA 1P7QD 5ID1B 4RQQB 1T04B 2XN0A 3QO0B 1X4XA 3TJHD 2Q8AH 5F89A 3HG1D 3W9DB 5KN5B 3VGAC 1SJVA 1OQOA 1ZWIB 1XF2B 1JERA 5IJVB 3B1TA 2L8AA 2GQHA 5EZJA 1X7SA 2BW5A 2GIXA 2QMKA 2C1OB 2NCEA 1WIPA 1XGRB 3OC5A 3MYJB 3CFDA 1BEYL 3L9YA 4PRID 1JK8A 2F54D 4DPBX 1BAGA 2DDQL 3BPNC 4LGPB 4DZBB 2R2EA 1NMAH 3FW6A 2VDPB 4HC1A 4BH8A 4XMVA 5DVLA 3GTVA 2XKNB 1DQJB 4TV3A 4DFHA 3U1PA 1IC4H 4MFHA 2CH8A 2UYLB 1ZHNA 1NGZB 4E9TA 5F6IC 4OZFB 3LZLA 2HAZA 3STZA 4J39A 4GRLD 3FO0L 4QJ4B 3FFDA 1ZVSB 3O0RL 4QY8B 2JI1A 1R4XA 4AYFA 3FSOA 1HZHH 2N56A 4D8PB 4E41E 1XSOA 2L7QA 4M5ZH 4TUKL 3TO4C 3ZE2B 1S7UB 4FQ1H 1MI5D 3I84A 3S5LG 1KJMB 2O5YH 3AXLB 3KGTA 1AHWC 1UXWB 4HH9B 4HAGA 1LP9A 1NCTA 3CDZB 4DN4L 2PETA 4K73A 3VXSE 4Z76B 3HI5L 5KVFE 5C08E 5HHXH 4R9HA 3TPUA 5EOCL 5I6MA 1CZ8H 4G9FD 2G2NA 4WWOA 1HXMB 3MJGX 2ZUSA 1Z3GH 3FF8A 3QJSB 5D2LA 4OB5H 1GGTA 1TYEB 3WMQA 1JSYA 1RJCA 3LH2L 5E1IA 2P8LB 1G6RL 2VDLH 4UV4H 3MUUA 3R8BB 1XH1A 3ARDC 3BCFA 2FK9A 1CGSH 3KDMB 3VQLA 3OR7A 1OAQL 2IIJA 3GZKA 4GG8A 5EF0A 3Q8CA 4K5LA 3QWNA 3TO4B 2QHRL 2FE0A 3VXMB 5KUKA 3LMJH 2AI0H 5C0IB 2K9UA 4P46D 3M6DA 2JLPA 1A64A 1OB1A 2VDNB 3SE6A 5D6DC 4JO1H 2QPFA 1UD3A 1TZOA 4WDIA 4HOXA 4CUCA 4W68A 1P5VB 2JB5L 2KC0A 1MRDH 3NAAL 4NKIL 1P4UA 3CFUA 4PRHE 1ZGLB 1RLBA 2A9BA 1U8IB 2LHAA 1OAQH 1HCZA 5E56A 4PS4L 5CJOH 5G4NA 4L8DB 1WZLA 4FJYA 3B3IB 4K8RC 4AQ8A 2QPEB 5MEQB 3FB8A 4JFYA 1JZHA 4ENED 4L3CA 2Z64C 1H3WM 1EBAA 5IBUG 3RTLA 2M26A 4H26A 1E27A 4Y4HA 3THMH 1GZPA 3L1OH 2OTWB 1T0PB 3P4OB 1EEZA 2VM9A 4A7GA 3NIFF 4DOHB 5FPIA 1OLLA 1RHHA 1T1YA 2X4OA 3VQ1C 1LE9A 5LBVA 1F4XH 3ARBC 2PYEA 3LZFL 4HEMA 4PBXA 2CE6A 2ZP9A 2HUHA 3QNYB 1R24A 2VMEA 2C9QA 4R90H 1HZHL 1ID2A 3X13A 5DRNB 3K72A 4LLQA 1RSFA 3NIFB 4U7MA 4LU5H 5IK3A 2NW2B 3VFVA 3VI3F 1NFKA 2ADGB 1SDDA 1MUJB 4OF3A 2WLIB 4JZOA 4I0PB 5CLWA 2VJXA 4ELKA 5A40E 5B38B 5I0WA 3S5LB 4ZTEA 1NDTA 2WANA 3IDIB 3LIZA 4K3EH 3O2WL 2W0FA 3QVAA 2CHWA 4OD3L 2NUTA 4GKNA 1YNTB 4Y1AA 3HAEG 4R2GD 1DBAL 2G5BB 4QRPA 5D1XB 1YEDB 2H2SD 3T77B 1RURL 5CJ8A 1MF2H 4X9GA 4O2EA 1DN0A 1V05A 2YEQA 5DR5L 1JYWA 3D4CA 5GGRY 2WKLA 3QYCA 4R4BA 1ZV5A 1R75A 4Q4EA 5DJZA 4M4RB 3PL6A 1YHPA 4QRRA 4MHHG 3GLAA 3P9LA 1NANH 4M61A 4NLHA 4CU8A 4YC2B 5GS0L 4Y9FA 3F8UB 3SGEH 1GRWA 1W0YT 4XP1H 4M93C 4BSVA 5D72L 1CGXA 2GC4C 4FTVD 5EU6B 2H5UA 2UY7B 4AC4A 1Y7VA 1YUKB 2APBA 2NY4C 5IVXF 3MLSL 2R29A 5C0BB 3UTTA 4HHAB 4UCFA 1CXEA 4WGWB 5FM8A 4B9KC 5T1KD 4LHUA 2VLKE 2ZOLA 4X9IA 4XVJL 3WNPA 5B21A 1NBVH 1P9MC 3QDGD 3G5ZB 5FYJL 1KPRB 1A6ZB 4XTRD 3D9AH 1RMFL 1W0WB 1SF5A 1XGPA 4W6WB 4B9JA 2UV3A 4AYMC 5B8CB 1SLUA 3MGTA 4NPYA 4JRXD 3UOAB 1BVKB 3GSNL 4FQQA 3D3VD 3QNXA 1OANA 3ESMA 4K55A 5DHVA 5HGDB 1MXDA 1JPSH 1OK8A 1E4KA 1E28B 4G9FA 3QQ9C 4CVXA 3GDCA 1D7BA 4JX0A 1HQRA 1MLCB 5BQDA 3ZR6A 1ZV2A 1IAII 3V6BR 3APMA 1T1WB 3BWAA 5BUGA 2WZAA 3GQFA 1I3RA 5DRXA 1I9IL 2OBGA 1RZIB 3IMSA 3MZTA 5ABZA 3VTTA 4E9XA 4EZLA 1J8HE 2FTAA 1VERA 3OHXC 3KPNA 2VRQA 4RRPA 5FS5A 3QR1A 3OV6A 1Q0XL 2P26A 4L4TE 4I4WB 4YHOH 3Q3GB 3ZQ9A 4BFOA 4BUQA 4X8JB 2A1WL 1EO5A 1NCIA 2RGSA 4Z7VA 4NJAL 2EIDA 4H1LH 4BRVA 1F90H 2UZIL 1AAJA 1CFBA 4TYUA 4Z0XA 3S35H 4JPKH 1RUPH 1ZHNB 4OZHA 4RBPK 4DVRL 1EXGA 4DGUA 4IDJH 3CE1A 1IAMA 3E3QC 2C5DC 2AQNA 4JPVL 1Z9OA 2H45A 4HCGA 5DXWA 3S96A 4ABUA 1UM6L 4ZTPL 5I30L 2BNRD 3AG2B 4ODBD 3I75B 2VN3A 2TAAA 4PY7B 2F74B 4UTAA 3VGHA 1MRCL 5KSBE 1IARB 3AQDA 3VD5A 3TWYA 5T3ZL 1Q72L 5DJ0A 3V5KB 5I5RA 3JYCA 1HZLA 1NCBH 2CUIA 35C8L 3VFWA 1UB6A 1WHPA 5I1LA 5IW6B 3O8XD 5GRJH 1MFUA 3QORD 2H9GA 1FIEA 5TH2B 1MN4A 5CD5C 3VRIA 3DX2A 3VWJB 5IFAH 2PYFA 2OYPA 3RRQA 5I8OH 3GSNB 5DI8A 3PQYB 5KTEH 1D5ZB 4O51A 5E5RB 1KXVA 3LQAC 4NUJA 4P0DA 1BG9A 1MF2L 5TQ0H 3BO8A 3GJFH 1N59A 4ESKA 2DL2A 2OK0L 4XBEL 4L1HA 1B2WH 3D48R 4BHUI 1JTPA 5G2NA 4AQOA 4LCYB 4WNQB 1N9PA 3VFOA 1NMCB 4AUYA 5I71C 4MQ7A 5EEZA 3LDBC 2V3DA 2B1AL 3W0WB 3MOBL 4FNPA 1GTNA 4JJ5A 1G7PB 5DU7A 5D7IE 2F68X 4DVBB 2EYSB 4LVNC 5T5FH 2XZCL 4MXQC 4NSKA 1OP3H 3L4VA 2OMYA 1VENA 5DEGB 1D5IL 4CA4A 3PL6B 3C5ZD 4QRRB 4LP5A 3K8MA 4DQAA 3IMVA 4XNXL 3ARED 4UOW1 1U95B 4DGYH 4S0SD 2YXVA 4BXSV 4Q8BA 1NOAA 1AZZC 2ZP0T 2VNCA 2IPTH 4OZFA 4MKMA 4WFFE 3BWZA 2H0EA 1Y1DA 1H6EA 3IS0X 3CLEH 3DPBB 3TF4A 1F97A 3G6DL 3QUZB 2XOTA 3FT1A 1OARL 2ZXEB 3GJFB 3ZDZF 2QSCH 1NMBL 5JHLH 2DQ6A 1YPZE 3TH4T 2IFFL 2W0LA 1C08B 4KKCD 1U8OA 2BK8A 4KI5C 4MMXB 1A4AA 1CCZA 2DQEH 4ODWA 5B1JA 3GBNL 2H2PD 3SPHA 2HTLD 1N6QL 3ISWA 1LP9E 1QFWL 1HHIB 3RL1A 4X4YA 2R4SL 4R7VA 5F6HI 3W5MA 4OZIB 5IVXB 2BP0B 4JFUA 4QXWA 1BGXH 3S8WA 4TL5A 4XOAA 2VDMB 2EDRA 4FJZA 4DEWA 2QZ5A 3MCLH 5C0GB 5LG6A 2DJMA 3NTCH 1RFDL 5C0FA 5I5MA 4M5YH 1SVZA 4OFPA 2AEPL 3AXLA 1KJMA 2Q1EA 2DLIA 4JVPA 5E8DH 5LBSH 3PL6C 1N64H 2XTJE 4ZO9A 3RWEB 3VXQA 2WNKA 2CALA 1IILE 2XLLA 4KKLD 1NCCL 2HN7B 4CC0A 4DP5X 2BY1A 2IG2L 1DSWA 1OP4A 4XH2A 1ZANL 3IFOA 1EVUA 4JPKL 3DV4A 4AE1A 1N68A 2FO4B 3LIZH 2UZIH 2MPAH 5I71B 2KLSA 4NO0B 1PU0A 2W9EH 1R3JB 4GUQA 4F37K 1VFUA 1ZE3C 2WUCL 3LZPA 4TUUA 3FUKA 1W72A 2JXMB 2EIBA 4KI5D 3BQUA 5FKPB 3JYBA 3F62A 4JHVA 5EU3B 4YHYB 3TEZA 3O2DH 3D0AA 1KBGH 1PZ3A 4KKPA 1KCKA 1MJ8H 2TSBA 1UXLA 3FQRB 3DX3A 5I8CB 4CKQA 2EDBA 1I7ZB 3MRIB 1KMGA 2WZ5A 1A4JA 2E7HA 5EOCJ 2ADJB 1AD9A 3GRWA 1MNNA 4DPCX 3KBPA 1J05A 4H26B 3K71B 3OKNB 4JDZA 1H3PH 3CHQA 3ESOA 3L3JB 2Z1KA 4RMSA 3O9WD 3VFSA 3TA3A 2DQJL 4PW3A 1UOLA 1OSPL 1QUNB 3B7SA 3NJNA 1WHOA 3FCUB 2XWBA 4QJ5B 4RETB 3TFKD 4YBQD 5FW8A 1XIWC 4NZUH 4I2XA 2AQPA 1AFVH 4HWUA 1JMZA 3NN8A 4BFKA 3P3SA 4YGVA 4UMGA 2FJGA 5K93A 1F11B 2R4SH 5DVOA 3V52H 3OMZA 4RGOL 2WLNA 3APNA 1OF2A 1X7TA 2VWEE 1DEEA 1U8KB 2ZYHA 5SWZA 4KVCL 3WNOA 4E9LA 1N6QH 5LGHH 2JCCB 3IN2A 4IDJL 1XTMA 2HXAA 1TQTA 4U1MA 3UIZA 5KBPA 1XB6A 4LESA 4P2RB 3HG4A 4LFHD 3BRGC 4Q7DA 5EC1A 5AYTA 1CF8H 4RMBA 4OT1L 3HZMB 4PJ9B 2AJUH 2EE9A 2FLBT 1ACZA 4G6MH 4C4UA 4F7EB 2VSMB 3JWOH 3NFNB 4A2LA 2EEFA 3HRZC 2CO4A 3OKMA 5K39A 4KUCD 3VI4F 3FTZA 4HXAH 1JBJA 1A7QL 4D2NA 4JG0H 5CSZB 2IPTL 3KYOA 1I1FB 3K6NA 4B95C 4ZS7H 2WSDA 4MJ2A 5H4ZA 1I82A 3QIUB 1K2DA 4JE4B 3ARVA 4HWZB 1ETZA 4PLJC 4FQXC 5HI5D 4TQHA 4MCYA 2ADIB 2EXYD 4YDKH 3UERA 4Z18A 4FA8A 1PSKH 4I9XA 1AY1L 1R3IL 5JQHC 1QR4A 1GGCH 2J1KA 3FUHA 4OGQC 1UCBH 5EBWA 5F7EL 3V0HA 4Z8FL 2A0LD 4K3HA 3AMLA 2PYFB 4H88L 2E7LC 2BY3A 3LPWA 1BSIA 1KB5L 1WC7B 1S46A 1ZA3B 2VO8A 3UTTE 2VAJA 3D9AL 5IB1A 1CL7L 2GSIA 1UWGL 1IGFL 1A4KA 3QUYA 3PWNA 4JN1L 3QFJA 3QCVH 4HVBA 3MROB 3VFGH 1U93B 3R7RA 5CUSL 3ZDYE 1TVBB 3G04A 3OAUL 1KGIA 1X9LA 2NY1D 1MEXL 1HAWA 5CGYC 3BVVA 2X4SA 2VM3A 3JSSA 4OQTA 1MFCH 2B4CH 5I1GL 2MQ3A 1VFOA 2J1WA 4JO2L 3RJOA 3F7VB 3U6RA 2WKOA 4NO5A 4PV9B 2WBJD 4R2GB 3L5WB 4TNVF 2G4EA 1HYSC 3QEUA 1CLVA 1UFUA 4TL4A 3BUTA 3FUNA 1AGDA 2A9ML 2I24N 4K3GA 4FL4B 1P4LB 5HSFA 2PPCA 1ZPUA 4YPGB 4NSKB 2ZPKL 1CLYL 4AVKA 1B0GA 4O2FB 2Z65C 3KLLA 4IGBA 1PD6A 3QZOA 3V4UH 4DF9A 4L4VB 5EIVA 5C6TL 1Z5YD 3W1ZA 1CS6A 3BH9A 1RIHL 1QABA 2Q7YB 4E0RB 2EADA 3R4DA 5GHWH 4X6CA 4DPRA 5ANMA 4M3JA 2QVTA 4DK3A 3DSNB 2R1WA 3U2JA 1RAMA 1MSPA 3FTGB 3PWUB 2IDCA 4L3EB 4PIRF 2IAND 2QDWA 2YKLL 3X14B 2XWDA 1BOGB 4M6NL 3G5XA 1A6UL 1QNZL 4LSUL 1TCRA 1UG9A 1J48A 4GW1A 1BWWA 2BP5M 3LHPH 2BSCA 4X7DC 5DD1L 3TCXA 3AWGA 1IGML 4IBLT 4W9JC 5AOZA 3LS4H 2OI9B 5TPWL 1N5AB 3SPVA 3SGKA 5AUMB 5I8OL 2VLJA 2W60A 1IO4C 4KWUA 3GM0A 4N5UA 1XTLA 3VXPB 3STLA 4B9CA 1OCZB 3L4TA 4TSBH 3GO1L 4LRNH 2O6CA 2XUWA 4N20A 1WD9A 1FRGL 4CVWA 5HXMA 5D4IA 3DGDA 1PZ5B 5F3HB 3IVKA 1N0XH 1URLA 3D1MC 4LVHC 4P99A 4KZEL 2CBTA 2ZCLL 3A0OA 1IT9H 4X7SL 1OLZA 4ICWA 12E8L 5I73B 4M1DH 2V7NB 4GS7B 3ARZA 4NKOA 2K7QA 1PIGA 1DJWA 1QLEL 1IV8A 2HJFA 4NQCE 4G3YL 4BM7A 4PGZA 2DWEA 5GSVA 3RU8H 1PTZA 3D6GA 3IGKA 5IMKA 1M9WA 4BCXA 2ZTBA 7TAAA 5EO0B 1CBJA 1A4BA 5DJ0B 3EH4B 3FHQA 1RZFL 4X5LA 4M6ML 2Q2EB 4PY7A 3NPSB 3S88L 1HOEA 4GYBA 5I8KL 5IMOB 3C8KB 1MRCH 1NAMA 3EFOA 3WIIL 5DK2B 1NUGA 2EINB 4XCEA 5H94A 2APSA 3HBGA 3ECQA 5CLZA 4L8BB 5ALCH 5DZVA 2EACA 3PAZA 2VDOH 2NY2C 5JR1L 1ITBB 1IIIA 3KWWA 5TDPA 1MW3A 5D1QC 4NUMA 4YHMH 5D7EA 1O5PA 3QH3A 4RWYH 4GI9A 1R5WA 2YMOA 3O8XA 1ZLSH 1WAPA 3TESA 3EBIA 3DX7B 2K4WA 4PVLA 4HISA 5BV7L 1JZ6A 2WXLA 3PWLB 2V8LA 1KYOK 2VXUL 3QC5X 2VDPL 5D7HA 4ZOCA 5LNEA 3OAYK 1ETA1 4BFEA 5HD8C 4D94A 3QQDB 4W70A 4C83A 1WFUA 2PTTB 5KS9F 5I6KA 5DS8B 4NUGL 3QNZB 3QQXA 3MJWA 4JG0L 5DUMH 1T7ZA 1G0DA 1C08A 1WYJA 1JXGA 1INEH 3F5WA 3DRTA 4JR9H 4L2LA 3MJ9A 2H7WA 3ULVL 4X6DA 4I1RA 1IC4L 5D9SA 1J9TA 1BOYA 2I07A 3A22A 3IS1X 5AYUH 4ZFQA 1JD9A 5I6OA 4HFWA 3RNKA 5C3IA 1HI6B 4TM9A 3KCWA 4LPUA 3IJYA 1FNEA 2NY2D 1MCFA 4UILL 3FPXA 3HBPA 3D33A 1OT1A 4X6CE 3WNIA 4MRCA 2H4EA 3LKPA 3MAWA 1L9OA 3QIBB 4TNEA 3HRPA 3FUEA 4HPOL 3VU1A 2JK5A 4N86A 5HYJE 3C75A 4O00A 5FUZH 2DQEL 2CBMA 2ITCB 4E42B 3TBCA 1ZJAA 1PD0A 2V2WB 1RIVL 3H2QA 3RL1B 3K8KA 5GJSL 4KK8D 2FBRA 5IBLD 1C5BH 1RUMH 3CXHK 2DH3A 3FYIB 5CZRA 3GSOA 5DRZA 5IHZB 2X0WA 5IZ7A 3T0AA 1MVUA 2UXFA 4F80A 3QCUL 3JWNC 1DVFA 3AW5A 1M71A 4G7YH 2A6DB 4XBPA 1XH2A 4BKLA 4DKFH 3DUSB 1ORQB 2JQAA 1UOVA 4ZQKA 5BV7B 2AXFB 3RPIB 5JPMB 4KVPA 2XWJB 2YUWA 5D7JC 2ED7A 2MCPL 1DLHB 4XP9H 4X99A 4Y4HC 3RP1A 1CLCA 1JXFA 1RK1A 1HKLL 3M1BB 3H3PH 4ZMXA 4PG2A 3TBBA 2GCYA 4G7QB 3WUWG 4IMLA 5T5FL 4HCRL 3O81A 4WQOA 1NC4B 4WWKC 5FAAA 1BYPA 2X6UA 3K1DA 4QRSA 1U8LA 2WNGA 4FFZH 4DN4H 4YIQA 2Z35B 3N2JA 2IBGA 1AE6L 3WFHA 1U8PB 4QLRA 2C7UA 4M5ZL 3HVNA 1GZHA 3AABA 1IMHC 2P42B 4Q89A 4LDLB 1CFQA 4M29A 1ZVYA 1LO0L 5F1NA 4K5OA 1A14H 1FL6B 2J57A 1L7IL 3X1EA 4WW2C 1T21B 4K23L 4TN9A 1T22A 5FA4B 1IGYB 2F54B 1YAZA 4PUBH 3THML 3M8OL 4QHLA 5LQBL 2BMKB 2Z3FA 2DLGA 4AK1A 4AYSA 1EBPA 3FCGA 2CA3A 2JB6B 3OAZK 3RL2B 3V0VB 2VTFA 1R3LA 3ZDWA 4YHYC 4CADB 1KF9B 3GXPA 5KUMA 3O4LB 4RMTA 1CD0A 3F6LA 4YHLL 1T6BX 3VXTB 2VR8A 1O7DE 3ZHFA 2RBLA 1BVOA 1AKJD 1T7XA 4ZFOL 5KJ4A 3U9WA 3W39B 3LN5A 5TE7L 2R4RH 4HPYL 5EF2A 4JKPL 1DDTA 2MCAA 3OJVC 4N0CD 1MIMH 4NO3A 4EBQL 5C0DA 4NENB 5C0ND 1N8ZB 3FT3A 3T4YB 5F7KC 3SPVB 1A3LL 4JG9A 2ILLA 3HE7D 1CIUA 4WUUB 3VH8G 5EDSA 3BW9B 4G5ZH 4AJVA 5AQ0A 2WJ7A 3L9RA 3PWJB 1VF5C 2A6IB 1ZMYA 4B5ZA 2OR9H 3FO9A 1W91A 2IVFC 5CUSH 4YWGL 5DFVD 4OQTL 5JW3L 3V2AR 1CDCA 3KPOB 1JHKH 4GAJL 4RRPM 3FUMA 4UB0H 1A6AA 2K9FB 4Y16B 3BH8A 5IVOA 4F7MA 4XAWH 5K9JH 1DBBL 1JRHH 1O7SA 4FLOA 1KACB 5DWUH 5A2KH 3MO1A 4K3JL 3HRZB 3ZRFC 3IXAA 3OB0K 5C09B 1P2CB 1IKOP 2EDNA 2X4QA 1VLXA 4GSUA 4PJEA 4RWYL 43CAB 4AT6B 4MX7A 3BKJL 4NO2A 1HILB 2YC1A 3N41B 2VR6A 5J11C 4QRAA 1KGXA 4XP6L 2Y1VA 4G83A 4ZT1A 3PFQA 5IFAL 5DJ8A 4OD1H 3SODB 4RZKA 2H2PC 4X6EB 2F58L 2Z8SA 2YGQA 4X4ZA 4B50A 5GGVH 4DP9X 1MAKA 3FCSB 3SYAA 4IGBB 1CD1B 3O8XB 4UIKL 2WLJA 1WFIA 3RIKA 2E8YA 2VLRB 3FU7A 1BEYH 4XCNB 1NIBA 4YK4B 1A6TB 3SBRA 5GGRB 2R2CA 1AGDB 3B7UX 4PJ5E 1MCDA 4QRSB 2BC4A 2Q0ZX 4NQTA 4PJ7B 2JSFA 4G59C 3FB7A 5JLZA 2QQKL 4ZOEA 2X88A 4CN6A 5LXGH 2JKXA 2I9LA 4XX1E 5EBMB 1CLOL 3CBJB 3FFCE 3KGRA 4Q97A 4Y4KC 5B1BB 2AK4B 1N67A 2FQDA 4HW6A 1XSIA 2ZP8A 4ISVA 5CCHE 2B1HH 2GI7A 3VDCA 1EXUB 2GB2A 1S5IL 2O6PA 5DF0A 3ES6B 3NZ8B 1BAFH 1I9EA 1JGIA 1OSPH 3UH8A 3T3ME 4HZLA 5IOKA 2DYPD 4PJCF 2A38A 1GGBH 2DWEB 4OKVA 1CXKA 5KAQF 4N2DA 3HLAB 4HFWB 3QPQD 3EHBB 1UOKA 5ESVB 2J8UB 2BIQA 2EIJB 3EJSA 4RISL 1ACCA 4PGCB 5CLTA 3TVMC 2EKSB 3BPOC 5E8PB 2XN9A 3WTXA 2DQGL 5JA9A 3VG0L 3ALPA 3K91A 3K5SA 4QKTA 1GAFH 4Z9KB 1TUPA 5JQ6L 1YEJL 2CKBA 1F18A 3GRWL 3EJTA 3PF2A 1T7WA 5DK3A 3WO4C 1OB1B 2XQYK 4NCC1 1FBIH 5DMKA 1P84K 1MFDH 2E27L 3RIAK 1CG9B 1FVCB 1XF5A 3MLVL 2CLVA 3ZE2E 4YE4L 5D4JA 2I7OA 1SJXA 4Y4KD 4EI5C 3S5LA 3KS0H 1AKJA 2NDGA 3F5WB 3MRBA 5J06A 1IU1A 1MRDL 2H6OA 3L6FA 3NAAH 3CFJA 4NKIH 3D7PA 5E9DD 4R5TA 3PFUA 2P49B 4ZSOE 4PJHB 1BLNB 2XDHA 4MMZC 2H0FA 2DMHA 3TF7C 1QSVA 1Z3RA 3LPFA 3I6LD 2FT8A 4ANWA 5H2BB 4WY7H 5EZOH 3ZE0F 4PGJA 5CJXA 3BIAX 1IC5L 5D6CB 4XVSH 3T0DA 1Z9NA 5E0FA 4BZ2L 1WWAX 3UTSA 3S3PA 3CV5A 3GK8L 4L8SB 3NYKA 3C9NA 2XXFA 1E3XA 1XGUB 3ROOB 3MJ6A 2QZQA 1T5XB 3CX5K 3QCTH 4Q6YA 3PLYA 5KW9L 5CZKA 2VW7A 5KN5A 2XVLA 3VI3A 1AQ8A 1AQKH 1FFOB 1EUTA 5DUPH 4BQCA 2JTYA 4X0NA 2ED9A 4FFYL 4LSVL 3CZKA 3F84A 2Y07H 1CF1A 1Z1WA 4TSBL 2AK1H 2OMWA 5DD0L 4OLEA 1NFDE 2MFNA 4AIEA 5MP6L 3R1GH 3MUGA 5JDSB 1NMCC 2B1AH 4Z7OB 1U8IA 4IOSA 4OFKA 4U1LB 1KENH 4EI5D 5LBGA 3D2UA 3NFPB 3NRPA 1VZIA 2AHIA 4JGMA 5B39G 5TPWH 2J88H 2CG9X 3BFWA 4GRMB 4WTXA 2H8PA 4Z3FA 4HGWA 4CNIB 4K3DL 4DP7X 3ZU8A 3BP7B 3LN4B 4ZS7L 4B9PA 2V5YA 2WVSA 2NY3B 3CFCH 1EEUA 4KUCF 4UUJA 5GGUA 3S5ZA 4JDVA 2J12B 5D1XC 1T2XA 2FYYA 2ZD0A 2NNCA 4XVUD 2ALWA 2R0WH 4J7RA 1WZMA 1WF5A 1M7XA 4AXWA 4C58B 4G2AA 1U3HA 4UT9H 1GPOL 4H1LG 5KS9B 1SXZA 1RZPA 1OGAA 1DVTA 1T0MB 4DCQB 1QZ1A 1V55B 5E1HB 1J1PH 4AYEC 3X11B 3P1VA 1CXFA 4U1HB 2WGNB 4OZ4A 3ZKSD 1QFWI 3NCEB 4ZYKA 2A74B 5I76B 3U48A 3SY0A 3K3QA 1EIBA 4IKNA 4FEIA 2YK1L 2QTVA 1BLNA 2Z6FA 3O11A 3D3VA 4RFEA 3QQ3A 4HWBH 3W38A 3VFPB 1JF1B 5DJ6B 2B9BA 2W65B 3WLBB 3BZ5A 3F7RA 3X1FA 2CBQA 4MB3A 4O02B 5JUEH 2Q10A 4FQ2H 2NNAA 1XH3A 4PJEB 3EFDL 1F3RB 1O6TA 4LPTA 1TITA 2VDRH 4M03A 3MKKA 2AXFA 4QGYA 4AITA 2FHBA 1CICC 2UZXB 4FQXA 2YSSB 2IJ0C 3IEAA 4HEPA 2AZAA 5GRZA 2ITFA 1E9PA 1FAIH 3N40F 1LVEA 3NJIA 5I15H 4FFVC 4AG4H 1KG0B 3HI5H 3HA0A 2GBVA 4D0DA 3ASWA 1TT6A 3BUDA 4FZ8L 3E1ZA 5F9OL 1JZFA 3MXVL 1ID5I 1NCUA 4ZXBB 4Y5VA 4OV6F 1CB4A 1ODUA 5LG1A 4BK5A 3IE9A 1JDAA 4BFIB 4AGOA 1JGDA 5IREA 1B2WL 2GCYB 3MRPB 1KGUA 3RWDA 5JQIB 5CNHA 5BCAA 1A6ZA 2YQGA 1UB6B 2CHDA 3DURB 4S1DC 1P6WA 3NSDA 2P5PA 2VDLB 2ZF9A 4KMTH 4M3HA 3FC8A 1B4JH 2NDFA 3IXAB 3VD3A 4I85A 5BZDA 1UT9A 3SDXB 4JFDA 1JS4A 2H26B 1YNTF 3HS0B 4PCSA 1A1OA 5LCVH 2C7UB 4XP5L 2EYRB 3JWOL 4PAZA 5D2LE 3RIFK 4N68A 4G82A 4ODTL 4G9FB 5B8CA 4CVZB 4BSVB 2AJ3B 5L2KA 1EK3A 3PS6A 4OCXL 5KZCD 4KZDH 3GSOB 5DK0A 5DRZB 3U25A 2QKSA 2G5RA 1KN2L 4U6VH 2E8ZA 1OB0A 3KM2A 2EKSA 3NK4A 1A3ZA 2FWOB 3MXWL 4JO4H 5DJ2A 3NCBB 4I5BA 3GHBH 4A6YB 1FC1A 1A3RL 3I3EA 3CFQA 3QEQE 4LSRH 2ATPA 1A5FL 1DEDA 4WKZA 5CEYB 2IV9A 4UM9D 2A3TA 4LLWB 3AAZA 2BIIA 2Q8AL 4B27A 2Q3XA 3BN3B 1N6VA 1Q9KA 1WAAA 4HJGB 1FP5A 4Q0XH 5C0GA 2X42A 1AG0A 5DMKB 4KMQA 4BWTA 3FOMB 2PP9A 1QMUA 3TIDA 1XCTA 1D2PA 4DZ8A 1JPGB 4GJTB 2WQUA 4TULL 4XXWC 3CFCL 3OJMB 4TLSA 1R17A 3QXWA 4JHUA 3WFHB 2I9TB 4E41B 2FB4H 4POZC 4RA3A 1JN6A 1L6PA 4HQQH 4RAUA 2XWTB 1C16B 3B2UC 3OR6A 4OFYD 4QXTB 4ZNCD 1G9NC 4LLQB 3BRDA 5T3XL 2FWUA 2QQLH 3QT2A 5JDJA 3AT0A 1CFVH 1TKWA 3TBWA 3RVUC 3Q3GA 1NTDA 5MHSD 4U6XA 4FABL 3VGAB 3OZ9L 2KDGA 3MC0A 1J10A 1KGWA 1ZLSL 5CCKL 4M7LH 3RQ3A 3F04A 5DJ8B 4PJ8D 3UYOD 1NDGA 4I3SH 2DQIL 1BW8A 4NN6C 5GS0D 4N4YB 4PD4J 4KQ3L 3HCVA 4XXCA 1WG3A 1A1MA 4XN2A 3RJDA 5FO7A 3T09A 3MRHA 1SMDA 2QSQA 3KPRB 3GSNA 4NBZB 1ASQA 4M7LT 2YAFA 5DHVH 2WIIA 4K4KA 1PZDA 4XO9A 2APFA 4HJ1A 1LDPL 5DS1A 2OMVB 4MDRA 5KSBF 4DIXA 5DSCB 5GGRA 5DC2A 1LNUB 4TQ8A 2FDBP 5DZJA 3ABMB 2J8UA 4DVBA 2W1NA 4QO1A 3ARGD 1A3LH 2IANA 4HD5A 3GEWB 4JO2H 1QWHA 2B3RA 3SJVB 4YEEA 4BJLA 2YIHA 2NLJB 4I18B 3DHJA 2FGWH 4A7UA 2BPBA 1YEIH 1AQHA 1Q0EA 2BNQB 5EIIA 4YMPA 3PCYA 5C0FB 1T83A 3ZTJG 3EGXA 1BQHA 3S35X 4WHTB 3MV9D 3NSYA 4HIJB 2LLNA 4X5WB 3JTSB 4ILDA 4JHAH 1X6LA 2X1XR 1I8IA 3BZFA 4DOHE 3QUGA 4PJ8C 4MD5A 1VPOH 2HMID 4LRNL 2EJ1A 2LTQB 1LD9A 4N3TA 5ICXA 1WBXA 1PZUB 3II1A 4XC1H 5LWYH 4I9WD 5D7IF 3WS6A 5MHSE 4QRBA 3AB0C 1JGLH 5FUOL 4NN7B 3Q7JA 3JVFC 4JM4H 4JFDB 4JMNA 4YGAB 1HKLH 2FVNA 3E80A 5JORB 4HKZA 1H6UA 1GKEA 3ZSSA 2Y7SA 5CEZL 3IDXH 3CXDH 3P9MA 1JE6A 5EOQL 2P45B 4X6BA 2H0JA 2O1AA 5T1JA 3AXIA 3M88A 1UKQA 4PFEA 2BZCA 4OIBA 4P23C 4ZUVA 5C0JA 3O3BB 3SOBL 5EBGA 2ENQA 3UMNA 5GXBB 5AW9B 2FX9H 3D51A 4HAKA 5ES4B 3QUMB 4L23A 1U30A 2VXQL 3NIDB 3UCRA 4WGKA 3BUYB 1Z0MA 3CK0H 3WS3A 4LLMB 4ATWA 3RDTD 1ACYH 3QK0A 4GAFB 5AOKA 5F7WC 4L4VD 1XT5A 1A6VL 1OTUC 4NQSB 1UD4A 4NQXB 2L7EA 3O2VH 1QSFA 1ZVSA 1XF3B 2BVEA 5EN3A 4R5XA 2XWTA 5ESQB 1QI4A 2CHXA 2W9LA 3ARRA 5AW1B 1RKRA 3V55A 4XMXA 3DOSA 4H5SB 3V0DA 1IKFH 2LABA 1ZV9A 4JFOA 4V33A 4WHTA 1FFNB 2BNRB 4GRLB 2LW3A 1MI5E 1CIDA 2A83B 4DGVH 1S7QB 3RTQB 5C07D 1IVLA 2C3VA 3HAEA 3HS0A 5GS1A 5J4MA 4RVBA 4AZ8A 2XKSA 3REVA 2Z91A 1D9KA 4B60A 4JRYA 2AEWA 1F90L 1LD9B 1EJOH 1MAMH 2DMCA 3O3UN 3L1GA 2VB5A 3ZE1B 3WTWA 4K3EL 1PDKA 4OLVL 3VFPA 5KOMC 1XQ4A 1FNGA 5IEKA 2JJUA 2C3XA 3EJZC 3MLWH 4I5BB 5CIPB 4E68A 3S2AA 4WJ5B 2FYYB 1T04A 4XHJD 3MV9A 5I19H 3VFMA 4XAWL 4FG2A 3N1QC 2GJJA 5DK0B 5DRNA 3NH7L 3PWPD 4G9DA 5KSUA 2OJ1A 3FTXA 2VE6B 3KJ4B 4U0RC 1RJZB 1WCBA 1GW0A 2MQ0A 4N9GB 4CNIA 1JWSA 4JY6A 2DICA 1OF0A 3IRZA 1WP6A 4ZDHA 2H0PA 3DVNA 4ELME 2KHAA 3DHPA 3HZYB 3MLZL 2ERJB 3DX7A 2AMUA 4GSXA 4PBDA 5F7DB 5AW0B 3EYOB 4P46B 4Q2ZA 4ZUTB 1L7TH 4ZMAT 2G9HA 3MBWB 3I6KA 3HPLB 4I2XB 3SJVD 2R27A 3JUZA 2YLKA 4ONFH 1PEZA 2BWIA 2KQMA 3SZ6A 2AJUL 5F7YC 3WN5A 4ZS6D 4F5CA 5BMFL 3FB8B 4KTEL 4AGLA 3SYQA 3WFCH 3HNVH 1PLAA 5SX5K 2AJYH 4XO5A 2EDEA 4PV9A 5T5FA 3WEMA 4NN5B 5D1ZC 5ALCL 5C0BD 2ENSA 4JM0A 3SSGA 2BRRH 4OCWH 1SLXA 2GABA 5HHME 4N28A 3F7LA 1YDPB 1XZ0B 3CZFB 2OJZL 3FQRA 4JCLA 5JO5A 2XV2A 5J12C 4NXSA 2Q86B 2ZX5A 2FJSA 5GJTH 1HHJB 4OY9A 3WKYA 1C5DB 1CURA 2CO1A 1XBDA 4F27A 1NC2D 4NQDD 3IKCB 4N8VB 2NZ9D 3J2PA 2RFXB 2VR9A 2B59B 4U1NA 4DAGH 1DANT 3GB7B 1YEHH 1DFXA 3B83A 3C6LA 3L4UA 4KJPC 4N26A 5DMGC 2JJWA 3H55A 5LNGA 4NNPH 1KEMH 2DEXX 1WZAA 2ICCA 1SZNA 2CRIA 1BQUA 3ISYA 1W0WA 4UV4L 4Y5VC 5F3HA 4AW7A 3CVIH 5B4MC 3TT3L 3CXFA 2BNUB 2O6FA 3ZRSA 2D7TL 5DUBB 2X05A 2ZKMX 4RAVB 4H0GA 3ATFA 2DWDA 2MEJB 3T6XA 5ISZB 2A6DA 4WJKB 1W72B 2NW3A 2XSKA 4FD0A 2NY0D 1SPDA 3QUYB 4UQAA 1KTBA 4ZX6A 4F7TA 3GSUB 1WICA 3NP3A 5DURD 4AYFB 1JGDB 1WE5A 3RGHA 2GHWB 2E9WA 3S8GB 3MACL 1D9KD 4FHKA 3F01A 1DVXA 1KPVB 5KBKA 2J44A 3D2TA 4N2FA 4MQXC 1SY6A 2UZYA 2IPKA 5IV2B 2DWYA 4KV5F 4GW5B 3PNWA 3QJFB 1EAJA 1U2YA 3PGCA 5D5ME 4LLAA 5F7FA 1UTDA 3FSAA 1RK0A 3CFBA 1K2DB 3CZGA 2VISB 3VJ6B 3QJTB 1J18A 1FNEB 1Y6KR 3EDJA 1JZ2A 1BBDH 3AT9A 3I9GH 5T3ZH 2P8MA 4XPBH 1AANA 2OTWA 4Z7AA 3BT2H 1T20B 4JN2A 3MCKB 4DTGH 4PP1C 1FZOA 1LWHA 4X6DB 4BQ9A 3MRDB 3OAUH 4UI2A 3UZEA 2DM4A 1DQDL 1O75A 3IFNH 2WVTA 4YN3A 3BZDA 2IWGA 1IUZA 4IGBC 4IRJB 4N25A 1BZ9A 3BJ91 4HHWA 4X9HA 5E6IA 3ZT7A 4E41A 4AQZA 2EZ0D 1JDCA 2BERA 2E6PA 3NQKA 5ANMB 2Y5EA 2WY3B 3RZCD 5HGAB 4BZ2A 4FGMA 4ONFL 4PJFE 4Q6IA 2ICEA 4R7XA 4BH8B 1S7WA 3UEZA 5CP7A 2Y23A 3FOMA 3FN3A 3S36L 1LDPH 1LILA 3ZT6A 1O6SA 4QNPF 2A6KB 4MVBC 3O4OC 4ALAH 4G8GD 3FH5A 1AD0B 4F8OA 1BF8A 3B2XA 2Q3AA 4D3CH 1CI5A 4V1DB 3V5DB 4Z5RB 3QB7C 2HJLA 3HOGA 5IHUH 2GEQA 1YLBB 2KLRA 5KBMA 4URKA 5AVQB 4NJ9L 3SGKC 4LLVB 1EFXA 3BP5A 5KSBA 3CWGA 5B7FA 2YPLE 2ESVD 2YGPA 1OP9A 3UJTH 4Y1SA 3F85A 4PWHA 2QPUA 1AZNA 2JCCE 4XVUC 5GISL 1HXMA 1SVCP 1F8TL 1JF5A 3CDGB 2H1LM 3BH9B 1JPFB 2YOAA 4QTIH 1XGQB 3QS3A 3WO4B 4NM8H 5LAXA 2EZ0C 3SE8L 1FFRA 2CD0A 3P0YL 3B37A 5C0RH 2ZONA 1AZUA 3N9GL 1BBJB 1P5UB 3UABA 4TVUA 3SPJA 4ECNA 3IMWA 4Y2NA 2V9UA 3TO4A 1U2CA 5DI8B 3UGEA 3CUPB 3MRMA 4XCYA 4C4BA 2G2RA 1NAKH 2BRQA 3V0VA 4N0UE 2P8PA 1KXTB 5K9QG 2J5LC 3RVWC 3IF1B 5ICZB 5HJ3A 1MJ7L 1TZ8A 5LUMA 3VWJD 4JAMA 1NIFA 2UX6A 2F53D 3N1PC 3GRBA 3WGVB 5HGBA 4UIMB 5FUZL 3WS3B 4MNQB 4UZGA 4XT1C 4HWEH 4H8WL 2XN2A 4IK6A 2OCJA 3DMMC 4PU2A 5E7BA 4Z7WA 3U9UA 2D4DA 4QHUA 3L17A 3NIGF 4WEMB 2HKFL 3D4ZA 4KTDH 1PYWA 4C4KO 2VIRB 3ARGB 4PJAE 4P2OD 4PGEA 5K9OB 1I4FB 1CT8B 3MOQA 4LMQE 3RGVB 2CM5A 4Z7WF 1NC4A 1R33A 2V37A 3AY4A 1IFHH 1E7VA 4NQVA 4RGNC 2AABL 3DUUA 2ZCZA 1B3IA 3D50A 4NFDA 3SBWC 3FTGA 2TRHA 5HYJB 1I9IH 3L7EB 4NENA 4ETYA 4WNSA 2J6EH 2R69A 2X44D 3LX9A 3O8XC 2F7QA 1EX0A 4U3XA 3VWKA 3QORC 3KYNA 3NH7H 2ZAIA 4UT6L 1NCWH 3MRFA 1MHHA 1QSFE 5CWSA 1A7OL 5KAQG 2DBJA 1SXBA 3MLUH 3FB5A 3VE0B 1WZ1H 3VFTB 2X9YA 3GHEL 2BSRA 3G3LA 4M8QA 4WWKB 4CILA 2LOEA 2XICA 4E9YA 1CC3A 4GKOA 4PMFA 4X8XA 5CINH 3S5YA 3QYNA 4HIHA 4Y1AD 1CR9L 1D6EA 1ZHLA 3TX4A 1WEJH 3NCYP 1V7ML 1OAZH 3Q9PA 3TC9A 1XGPB 5F1KC 2G3NA 3QRGH 3WD5L 2H9GB 2ZWKA 1WZKA 1EGJA 1H3TA 2DQMA 4FC3E 1HEJC 2AQSA 1EAPA 1QACA 1AGFA 4UOQA 3UZQB 1IC7H 1SYVB 2ZAGA 4G8EA 4KI1A 3CFIC 4Z7UF 5F7DA 1KEGL 2YXFA 3FUFA 4YJZL 1CK0H 3SE9L 3FH7A 3V0GA 5LJYH 1AGBA 1U8JB 4LOVA 3VNZA