2VMGA

The structure of cbm51 from clostridium perfringens gh95 in complex with methyl-galactose
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
TSVYLSELEWKSASTGYGEIQKDASCDGNTITLKGENGEKVSYDKGIGTHAHSEIVYSLEGLDYYDYFETFVGVDQEMAGTVASISFEVYLDNEKVFDSGLMTGDTTQKHVKVPIAGKNTLKLVVKDGGDSIGSDHGSFGDAKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN TYPE III DOMAIN PROTEIN
publication title Divergent Modes of Glycan Recognition by a New Family of Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
total genus 37
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2008-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08305 NPCBM NPCBM/NEW2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1060 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vmgA00
2VNOA 2VMHA 2VMGA 2YGLA 2YGMA 2VMIA 2VNGA 2VNRA
chains in the Genus database with same CATH superfamily
4ZONA 3S5QA 1VRH2 2TUNA 3H7YA 5E89A 4YVWB 1JZ2A 2PXJA 2P4EA 5FMDA 3VBRA 2B9VA 1PGSA 1HB4A 2VVFA 3QBQA 5A32A 5K8SA 3TBDA 1GWKA 2ENRA 5DAQA 4QB6A 1H4HA 5JMCA 4Z82A 2NM1A 1WUVA 5LATA 4LEJA 4Y24A 3EHKA 3LWCA 4BA6A 4BIOA 4BQWA 1RUF1 1HV1A 4KQ7A 2OUJA 2QQLA 3FLRA 3WW2A 1MS8A 3RNSA 3BN6A 2YC0A 3ACIA 1OQEA 5K4LA 3KB5A 3ZXKA 4A42A 3H8RA 3B00A 3UV9A 3WD5A 1JOPA 3G6JB 5T54A 1XYOA 3WW4A 3I2GA 3O1UA 1UIJA 3FUOA 4D94A 3POGA 3IN9A 2WNVC 5EQUA 5A3UA 2VZOA 3PU8A 4QXBA 2LW8A 5DUXA 5GJ6A 3RJ2X 3ME2A 1FMD1 2OA2A 3QLQA 4IV3B 4B4QA 1XNKA 3SITA 3NJZA 2VUDA 5CNAA 1YC61 4LHKA 3GGLA 2WWJA 3V0AA 3A7QA 3GJAA 4K8RB 1VB4A 5EV7A 2WLPA 3WG2A 3SH3A 1OHFA 1TNRA 4JKKA 5CKQA 3LFIA 1N1YA 3VZJA 2HEWF 2A6WA 2NQYA 1CZSA 2DTYA 1CAXB 2V4AA 4CXWA 1GP5A 5F7UA 2JICA 2Y38A 2Y6FA 1VBB3 2ZX2A 3VKNA 4ZZ8A 3OD4A 3H3ZA 3VB9A 5J7MA 3S57A 1UZ0A 4QDRA 2NMNA 2FDIA 1ASJ2 1DGWX 1UU5A 1S0JA 1XBFA 3THDA 4UWDA 1M06G 1W28A 1DZQA 2XJRA 1YIPA 2WZR2 1JYIA 2BWCA 3CJIA 4JDOA 3KCXA 1QJX2 3BVCA 3OBTA 3RZGA 4KG0A 3W58A 2VOVA 4NIAA 2GDFA 1W0PA 1VJ2A 3RGBA 3WQ7A 1PMIA 5IUQA 4CVUA 5FQ0B 1JW6A 4AFBA 4LO7A 1OURA 4HK8A 4UFLA 4EZHA 3WCRA 1LECA 4NPLA 3A22A 2PAKA 3ZFEA 1PVC2 4ZXEA 2DU0A 3AC0A 1AF9A 2DV9A 3NV4A 2VZ3A 3ZYHA 2VC9A 1I1EA 3NQHA 1X82A 2IWGB 3P6BA 2OVUA 2FMDA 2AR6A 2WJSA 2PHRA 2VO5A 5LWBA 1F8VA 1G6NA 3RJRA 5ABJC 1C4RA 3VDDB 4HPKB 4Y1XA 3ITQA 1VBC1 1BMV1 1VAVA 3PU3A 3THTA 4B8EA 1J58A 3WEZA 1WCUA 1VRBA 2GN7A 3VUOA 3AJYA 1C8M3 3ZXAC 5A3MA 2GH2A 3OGGA 4JKMA 1ZZ8A 2PHTA 4YGEA 4FPOB 4CDUB 1PO13 3L9JT 2HWB3 1LRHA 4DEQA 5KXCA 2XL7A 3TAYA 1OA3A 5FLJA 2W1QA 3UL2A 1WW7A 3MFAA 3WDVA 2A71A 4CP2A 2D6PA 4TXWA 4LKEA 4E4SA 4EJRA 1YQ6A 4P9GA 4QMAA 4XFGA 1RUOA 4QM8A 2VBDA 2W1WA 4E2SA 2DUPA 4IXLA 5FYZA 1JODA 1K3IA 4FT8A 1UY1A 1Z7S1 3EJKA 3OGRA 3PTRB 4AGRA 2RS32 4LJHA 1CAUA 5FYMA 4CDQB 2VM9A 4CRQA 4CUCA 5FP3A 1XRUA 4E4ZA 3VBOB 4MGZE 2XBO2 4UW3A 5F3EA 3V56A 3AP7A 4NAMA 4BQ4A 2KXLA 1CX4A 1QJU1 1SCSA 1DGRA 2Y6JA 3TEZA 1PO11 1QJY3 1AL22 1UN1A 4ARXA 2HWB1 3VGIA 5A3OA 2BU9A 5A80A 1HXS2 1OA2A 2VMDA 5FYSA 5C4WC 2Q8DA 1QOTA 3UK9A 1IPSA 1TZOA 3OGSA 1PK6B 3PVBB 5IFTA 1OQDA 5FKBA 3LAGA 3WP5A 1DCSA 1OA4A 2B5HA 3TEYA 1UZYA 4CCCA 5JPMB 3AYEA 1H8TA 2GNTA 2VVEA 4AVCA 1DQ5A 1ENSA 1FNYA 4XMAA 5A7NA 4B4PA 3O1MA 3LOBA 5LRSA 4NIDA 3LSEA 3ZSJA 2D6LX 2EXJA 1MQTA 5FY1A 4DFSA 2PQSA 4A44A 3IB3A 3I59A 1QJY1 1LOAA 1CAVA 3AJZA 2D44A 3O1PA 1EUUA 3I8TA 2QQKA 2JG9C 3RI8A 4ES9A 1L7LA 3WP6A 1QJEA 5KBFA 1SLLA 4EN6B 1NCQB 1AYM1 2UWAA 4MLOA 4NN0A 4XUOA 4LBQB 2ZXQA 3VHOA 5IT6A 1HB2A 4QKBA 2WYSA 4UF0A 2VZPA 1FT9A 3O0VA 4JV4A 1RUJ3 4BZ4A 1NLQA 1EAH3 2EXKA 1ULGA 5F2SA 4Y3OA 5JZGA 1PNFA 4KMQA 1TNFA 2BERA 1JOBA 2R1DA 4Q4V3 1VE0A 1OC1A 1EYBA 2XVGA 3PDQA 4K1YA 3VD7A 1XE8A 2Y0IA 3TN93 3ZMOA 4FTBA 4LO4B 1OBNA 1RC6A 1I9RA 3AFKA 4HBNA 3VL9A 4WBBA 3ILRA 1XNDA 2EAAA 1WLWA 2XJUA 5FFOC 2WNUA 4MGTA 1MPXA 4K21A 2BW8A 4O9EA 5E6HA 5FYIA 1ZRDA 3BPSA 1A3KA 2GNMA 3DPRB 3AKRA 4UW6A 2X5IA 5FZMA 2WBKA 1OXCA 3I49A 1CWPA 3ENRA 4M3CB 1W8TA 1ND2C 5IATA 2RJ2A 1CVNA 2VMHA 2PLV1 5JXGA 4QDQA 3FBMA 4LQRA 2E26A 4NPMA 3FN9A 3WQ1A 4Q4V1 3D8CA 2ET1A 5C7GA 1JTZX 1CIWA 3IBMA 3WNXA 2XWBB 2QFEA 4MADA 2D7FA 4OHYA 5JSPA 1JZ4A 1DP0A 3MIFA 3AXDA 1KD7A 2YXSA 3KCCA 5TSWA 4COZA 1IPJA 1GQPA 5HBAA 1UYYA 3WDTA 5KHJA 1PO23 4HVRA 4C0BA 4HXCA 1UZVA 4QQLA 2GNBA 3UETA 1R1A1 2NPIA 4ATEA 5K0UB 3CF6E 2JE8A 4FPYA 4XHXA 3T09A 1R093 1WMFA 1ZZCA 4XF3A 3B5LB 2DVGA 2VZUA 3RPQA 3DYOA 3H50A 1RXFA 2R062 2W39A 2DVAA 3FC0A 1RMU2 2VECA 4DPNA 4IGQA 3MBWA 3R0RA 4KG8A 3H3LA 3IMMA 5F9TA 4X8NA 3U07A 1AJOA 4OZOA 3GJBA 1PM7A 1JBCA 4BXSV 1FAYA 1F5JA 2QQOA 3DYPA 3AFGA 2CDOA 3AMNA 1FPN2 3IIIA 4OVEA 2VVDA 5JOYA 1Q5OA 1A8DA 3PTYA 3AVSA 3PHMA 5FTTC 4A45A 1UY3A 2WWSA 4WVMB 3FJSA 1XNTA 2CWSA 2D6NA 3GZUC 4XUTA 4YVSA 5LB6A 3U75A 3I2DA 4PCRA 4M3CF 2P3YA 5FPLA 1KFUL 2ATFA 4FOQA 3MPPG 2C0ZA 2YBKA 4N43A 3D3AA 3VBRC 3MO4A 4NO4A 1K42A 4QPGA 2RS13 1DYPA 1R082 2R072 5IVFA 2W2IA 3P3NA 4D6SA 1N3QA 2CSGA 4JHTA 3PUSA 4EE2A 5GZFA 2D3SA 2JX9A 1NZIA 4D6RA 4ZS2A 2AEYA 2D93A 1DIWA 1KJLA 1YCIA 5FBZA 3WHUA 4CEWA 5HCHA 1ZZBA 3KQRA 4GJZA 3VBUB 4P14A 1OD5A 1S0IA 4D8MA 2QUOA 3W5NA 5ERLA 3M3OA 5BNPB 1IS3A 3Q8AA 2YG0A 4BYYA 4TSVA 4FXGB 1QOOA 1DGWA 1H6XA 4RQPB 3BU0A 3NL1A 2ZMLA 1US2A 4JRAA 2ZGUA 2H0BA 3U4SA 3OBRA 1APNA 3NV1A 4JGZB 3ATGA 2ZGTA 4OQ9A 2YC2A 2UU8A 1GICA 1U0AA 3C3VA 4RGKA 2BP6A 3CLPA 1WMEA 2WINB 2DTWA 3D4KA 5LRRA 4IGPA 4BLIA 3AP9A 4QGLA 3N35A 5JOWA 2EAKA 2R30A 3OEAA 1ZBE2 4XF4A 1KS5A 4LBKA 4V1PA 1Y7BA 3TNQA 1NLRA 2G4IA 1XC6A 1OVSA 2PHFA 3OY8A 3Q8FA 1QY4A 1UMZA 2D97A 2EIGA 2OZJA 1NXMA 5I0SA 2QZ2A 4MX3A 1WA4A 2AEZA 3OF1A 2EIBA 1QH6A 3N9PA 2PHXA 1DYKA 2C4XA 3BB6A 2BGCA 3LOIA 5DAVA 3CJIC 4YWAA 2VW2A 4UOJA 3KSCA 3B7MA 1V6NA 2QQNA 2YDEA 1STMA 1RVF1 4R9AA 4OZXA 1OD3A 3PVNA 4AQ6A 1MEC3 2JDMA 4DXZA 2Y6HA 2YPDA 1H1IA 5EHDA 2A75A 4NHKA 3HQUA 2PHWA 3I2HA 1PVC3 1RHI1 1YYNA 5IVVA 3ZFEC 2ZGLA 2V72A 3N7MA 5EIYB 1EV11 2WN2A 1HB3A 4XEZA 4RHV2 5FRAA 2YB7A 1W6NB 2E31A 1MS0A 1WGPA 3MLLA 4QGMA 2A3WA 2XONA 5CBLA 3GYDA 4BMEA 1FMD2 3JB8A 4GKYA 5AVPA 2VOXA 1VB2A 1W8FA 2RDNA 1LHVA 2OX0A 3NAPA 4FPEA 4RR3A 3BKZA 3LIGA 4XBLA 4BJ0A 3INAA 1I3HA 3MEPA 4OULA 3WY6A 5HCAA 4PDWA 1ZBA3 1WMXA 1LESA 4R9CA 3J8F3 1UX7A 3A21A 5A7WA 5LBCA 4Y1ZA 3O1TA 3HWJA 3MW3A 3ILNA 3TWIA 2WZEA 5L73A 1NQDA 3VN4A 5J96B 2JKXA 4L9BA 3KF3A 2VCCA 2RM21 3LEMA 3PVEA 4FOVA 2UY8A 3CJXA 2E6VA 4HSJA 4PIXA 4FSJA 5GLTA 5LW9A 5CU1A 3J7MA 3LEGA 4G3YC 2F17A 3GBFA 4TLFA 2FDGA 4C8DA 2FCTA 4JAAA 3KV6A 4HK9A 1AL23 4Y4YA 3MIGA 2CY6A 1FOD3 1LODA 2CYFA 4O9GA 1QOSA 4WZCA 4ZXKA 3M3CA 1TG7A 2WAOA 1Q8PA 2JKBA 2VQTA 3J8F1 4BU2A 4CUGA 3ZXGA 1UPSA 4MVTA 1CQ9A 4Y22A 2YROA 1DDLA 1H0BA 1SACA 4ORFA 4EN8B 1CX1A 3WZ1A 1PZ7A 2D6KA 4DB5A 4CCNA 3ZYFA 1H8TC 1X9TA 1W6OB 3RZJA 4KH9A 4CCMA 1GZWA 1NA1A 1TME1 4QHZA 3ZX7A 3RZMA 4HETA 1SEFA 3NV2A 3EQEA 1LOFA 2JD9A 3K3NA 2VH9A 5FPVA 1MQTC 4I2OA 1O4YA 4LTAA 1NE6A 1FOD1 2D43A 1VBC2 4B1LA 3USUA 1PIV2 4R9BA 4ZU7A 1RUE1 1HQWA 4RSUA 4YM0A 4AQSA 3CKHA 1POQA 3CBNA 3SLIA 3ZFGB 2D5FA 4HFSA 4I01A 4GULA 4XDOA 1BBT2 4AR2A 3AMMA 4CDXC 3MV01 4BQXA 5A1LA 2BPA2 4RL7A 4XJAA 1ALYA 5FY8A 3HR9A 4R4XA 1AR73 3PUIA 1AL0G 1BYHA 1K5MB 3GXUA 4WVVA 3T4HB 1L7RA 2BBAA 3U37A 4YW3A 4KGQA 3SKVA 5FZGA 4W4ZA 2DVBA 1UZWA 2AC1A 1DU3D 1YI7A 3MHZA 2LRPA 1OFSA 4XXAA 2XOMA 1WLTA 2HWE3 1D2QA 1SG3A 2IXIA 4IEVA 5LY1A 4CXYA 1Z7S2 3H8XA 1H8VA 4HOOA 4PF5A 5ISLA 2GAUA 4JC1A 3K2OA 5JZGC 1GNYA 5JUVA 2G9GA 3KGZA 4LO5B 4CP9A 1E5RA 1QHDA 4Q4W1 5IJRA 4M00A 1WCDJ 4CU6A 1QJU2 1VBE1 3HIFA 4P9LA 5FK8A 1GZ9A 4DXSA 1RUC2 3N7KA 3OYWA 5FZ8A 3KWVA 5BNPC 1AR71 4WM8C 2IXLA 1HQNA 3QACA 2QQJA 3NJXA 3ZXEA 3KT7A 4AI0A 3M7AA 3PL0A 2WNVB 4X6RB 4AYUA 1HX6A 2QZ3A 3W59A 2C9AA 2FZ1A 2X5IC 5DMYA 5L7OB 1CZVA 3AKQA 2AZ5A 2HWE1 3JQXA 5DABA 5DDJ1 5I91A 2XH6A 3URFA 3ZYIB 5BNOA 1B35A 1F9KA 3HOBA 1H9WA 3JCIA 5FYVA 3D5OA 4EQVA 4S2FA 5C9AB 4JQRA 1FATA 1OPOA 5C3RA 3CL1A 2XVKA 2IXKA 1BEV2 1J83A 3MIBA 3FMGA 3OPZA 3AKPA 5EYXA 2RVAA 3VKFC 4AEDB 1IG0A 1OLRA 1IS4A 5CB7A 3PMEA 4LUKA 3FHAA 4RFT0 2W1UA 2LALA 3J7LA 4Q0UA 2XB6C 3KLSA 2J1RA 5FYCA 3ZKYA 1NAEA 1OMIA 3WQBA 2B7YA 4A3ZA 1N47A 4YVWA 4D7YA 4AVSA 5F3CA 1AYM2 3SHRA 4P9YA 1VIWB 5D8AB 1FI2A 5FZ4A 4LBQD 5LASA 3HAGA 4CYDA 1JYVA 2D5HA 4IEQA 4KU7A 2XHNA 3AZYA 4IERA 4IE7A 2HWD2 2Q8EA 1GQGA 4QX5A 5A3PA 1GP6A 4I02A 4Q4X1 4LITA 5B4NA 3WF4A 4Q0VA 5ACA3 3CDZB 1UXXX 3I3EA 5AC92 4G9SB 1O4TA 4IE0A 4IEOA 4DEVA 2XL9A 3IAPA 5A70A 1W6PB 4AEJA 3PLQA 2JDZA 1FNZA 5KHGA 2YUEA 1SPPB 1UMIA 4YVSC 3SNMA 1F2NA 4GWNA 2VZTA 1LOCA 1WKYA 4CP0A 2ZPXA 4IV3A 4URTA 5BPXA 2FBEA 2V5YA 4N43C 4AGVA 1KRIA 1RUI3 1VBA2 4CCJA 4QPGC 2JJ6A 5BV6A 4GWJA 1K5JA 4MH0E 1VBD1 5ABJB 3AMQA 2ZX3A 2PLV2 3EYPA 2W9XA 3H7JA 3B9CA 3LE0A 4FQ4A 5ACA1 3LDKA 4XACA 1ZM1A 2BOIA 4WVZA 4NPRA 2VZQA 4DMIA 1JU4A 2VW0A 5LBBA 3WF3A 4CEWC 1O59A 1W06A 4BQ3A 1S0CA 5H9QA 4Q0QA 2XQRA 4UAPA 1H30A 1CAXA 1WCQA 1URXA 4I30A 2VUJA 4QPWA 5GZEA 1W2NA 1D4M1 1PGW1 2HWC3 2W0XA 5A1AA 4I0AA 3TEWA 3VD5A 5FCCA 3M8LA 1RUD1 3AVRA 3OG2A 3HMYA 4YFZA 1X8EA 3HQXA 1R1A2 3WG3A 4OI0A 2VUAA 4M3CE 3AMHA 3DF0A 2RS51 4PQ9A 4N53B 4QB1A 4HN0A 5BNNA 4LOTA 5FPAA 4WM7C 2IUWA 3ZFFB 2X10A 1NY71 2AH2A 4AHYA 1HRV3 1O3RA 2XGXA 3J9SA 4PLNA 4BHPA 3NNMA 2R0HA 3M3EA 5FQ0A 4FPHA 4Y20B 1ZRRA 4CP1A 5E8AA 4NRQA 3ZN6B 5FBJA 4CA9A 5FYUA 1AR62 5FZ1A 5HV4A 2VNRA 1NXD1 2NN8A 2EALA 5CISA 1YFYA 3LKJA 5I8YA 5FZBA 4Q4Y2 2ZEZA 3AZVA 4Y1UA 1G86A 5D21A 3VL8A 2X8KA 5FP9A 2WS93 3ZSLA 2XJVA 4NRPA 3VZNA 1G8WA 2AUYA 3NVCA 4QXHA 1HRV1 2MPFA 4MGYE 2ZGPA 2XMLA 4HPKA 4XIOA 5C5UA 1PGL2 3I54A 4RA0A 3M4FA 2RR12 3KM5A 4INDA 1VALA 5F39A 3ES1A 4LKFA 1JYXA 3USSA 1ND3A 2MNGA 4YW2A 4Y1YA 5I0TA 5CFCA 1FX5A 1TMF2 1W6MB 2J1UA 3T0BA 3HNMA 4XXPA 4ISRA 1REFA 2XWJB 2JG9B 2HYKA 5CFDA 5EP9A 4NIHA 1Y4WA 1XQNA 2A6ZA 1XSRA 2WS91 1V6IA 4A7ZA 2ADEA 4OHVA 2DWRA 3NSTA 2OIIA 3GZAA 1W3VA 1PX4A 5FZHA 3L2HA 4RD7A 2JECA 1LGCA 3V0BB 5JDBA 4CPBD 3BCWA 3VZKA 4ZS3A 4YGCA 3C7GA 3JD73 1XSQA 2ERFA 4CDQA 2WLQA 4XOGA 1CAWB 1JHNA 1Q8VA 1H2NA 3NAPC 4P08A 4RR3C 5JIAA 1SDDB 3T1MA 4D3WA 4FPFA 2WAAA 4JTNA 2R042 4PDWC 4OLLA 4BISA 4FP2A 5JXJA 2ADDA 1NCRB 2HKXA 3K4DA 4N9HA 4XUPA 1ZNPA 3GBWA 1XNAA 1ODNA 2IC1A 3OEBA 3WDYA 3WDXA 1PK6A 1RL3A 3O12A 4CDWA 2QNKA 2KD7A 2OUHA 5FMOS 2WA3A 2WFF3 5LA0A 1WCSA 2Q1MA 3J7HA 3WQ0A 2Q1FA 4R9DA 1SFPA 3BALA 3JD71 3LPGA 4COVA 5SV8A 5J09A 1HRI3 1O5LA 2J22A 4XJ9A 3IIAA 4PF1A 1G9FA 2WFPA 4K8FA 4D69A 2ZS6B 3RG0A 4GH4A 4XJZA 2VCMA 3O1RA 3K77A 1BXHA 1RVF2 1W03A 3LD8A 5H9PA 5C6CA 2A6YA 1HLCA 2WT1A 3OGJA 4W6WA 3KQ4B 3KGLA 2ZKNA 2BDRA 3VD9A 1VBB1 2AGSA 3DL3A 1NCQA 4AE2A 1AXZA 5HXMA 2ZGMA 3LQCA 1AR82 1EV12 1YJLA 3O0XA 1W2UA 4JGYB 4XHBA 5FK7A 4LBQA 5C71A 1A78A 1CPNA 2VXJA 5FP8A 4BIFA 3RZLA 1HRI1 2W08A 1VMFA 2VNGA 4Z2WA 4CUAA 1V9U3 2Z42A 2VNVA 1NA1C 4QPIA 5GZDA 4NIGA 2Q8OA 3DYMA 3ZKUA 1LOFC 4BK5A 5FY5A 5BXXA 4NHXA 3WF2A 1ENQA 1PIV3 4AQTA 4AW7A 2W46A 5DAWA 2OS2A 4B1MA 4FP3A 4QX7A 3RSJA 4XAEA 1N3OA 2H0VA 2P17A 4LK6A 5FAXA 1POV0 1COV2 5LCWL 3N7JA 4HL0A 4DRRA 3VLBB 2VGDA 3C8XA 3O14A 3ZPOA 4BPZA 1QNYA 5EYYA 3AZZA 1MS3A 4KBZA 3M1HA 1ZRCA 4O65A 5C33A 2XUEA 1YO8A 3FHIB 3GF6A 3BODA 3OCPA 5FXVA 3DPRA 3SCFA 2K2SA 4AK3A 4NRMA 1V9U1 1MS9A 5FZ3A 4Y5SA 2QCSB 2D6MA 5JOZA 2E32A 2YBPA 5L19A 5AVAA 3VBRB 2RM22 3GALA 2JG8A 4U36A 3VBHB 2B46X 4B7KA 4BQ1A 1CZTA 4GWMA 1NKGA 4Q29A 2OPWA 1DLCA 1H2MA 2IXJA 2WO3A 2WZ8A 3Q8EA 4KWUA 3SCGA 1IQAA 3BYWA 1C8M1 1D4VB 1O91A 4MHRA 1OOPB 3BPZA 5FYHA 3HQRA 4OUSA 5B4XA 3J26N 5FY7A 5GALA 1RUH3 2VUCA 2YU1A 3PUHA 3ZYPA 2O14A 1RYYA 2ARAA 2EA7A 2VMIA 3GBGA 3LSDA 5FIXA 5T5LA 4DY3A 2EICA 3CZJA 5FZAA 1KEXA 1UL9A 2Y0OA 5BNOC 5M0TA 1B35C 1ODMA 2A7AA 3MLJA 4KL1A 3AKTA 3LB9A 4PJYA 3U10A 1TME2 2VCBA 2JE7A 2VQUA 3FL7A 5IW0A 2XDVA 1GUIA 3V0AB 1GBGA 2JB4A 5IWFA 5GLZA 4ZY9A 5EPAA 5A3LA 3VHNA 5L9VA 4BDVB 3H8UA 1RTVA 4LMFA 4ATFA 4YG0A 1WD4A 1RUH1 1NQJA 4RS5A 4EROA 2RJKA 1DF0A 5FOBB 2VL4A 5J98B 1Y43B 4CDXA 2W87A 4LHSA 1BCXA 3S5AA 5A3TA 3ELNA 4QDSA 4LKDA 3PUAA 4YVWC 5J3UA 2C5DA 1MZ6A 3NNJA 1BHGA 1UOFA 3D82A 3T2QA 2WABA 3ORJA 4DXRA 5FPUA 2OQ7A 2YPJA 1L7QA 2CGOA 4CEYA 5LA1A 4ARYA 1KXGA 3BIWE 3WINE 1Y9QA 3B9IA 2XHKA 2J42A 2A3XA 5KC5A 1AYN2 5H9SA 2F4PA 4FPJA 2WN3A 1CN1A 4JVAA 4FVVA 1QQP3 4FFFA 1SBDA 2ZX1A 1GU3A 4A7KA 1PZ8A 2NZ9A 3K4ZA 3KHBA 4S2GA 5A1FA 5BNPA 5DG1A 5E1RA 5GLWA 4META 3MIDA 3ZYGA 1OT5A 4CUBA 1V0AA 2RMU3 4WM8A 5FZ7A 2Z79A 1POV3 1Y9MA 2W1SA 2AENA 3UYJA 1AX1A 1S1AA 4IV3C 1VBA3 3WW3A 4CPBA 3HVDA 2CHHA 4BM8A 1IPKA 4ASLA 3UGFA 1RUJ1 1JUIA 1EAH1 5CYYA 1A6CA 1PNGA 1U5ZA 1DQ0A 1H6YA 2VPVA 1J1TA 1UCXA 5D2AA 5T50A 3WR0A 4HKLA 2VZRA 1DQ6A 2Q5TA 4XABA 4AHZA 4TLGA 2JDNA 2WRAA 4GB33 2B9UA 3TN91 5IVCA 4K9SA 2ET7A 1VR3A 3SKJE 5CADA 3RFRA 5HPOA 4C1XA 1GOFA 1POV1 2K0GA 4P5HA 5EWSA 3RS6A 2I07B 1AJKA 5AFBA 2VD7A 2UWCA 5BUVA 1OKOA 1UPIA 3JBG3 3NWKA 5C5TA 1C57A 4YLZA 5KC6A 5JSOA 5FUPA 5BNNC 3E1F1 4P9JA 2WKKA 3RYPA 1J3RA 1OF4A 4F7ZA 4AZZA 1NZCA 1QIQA 2YBSA 3UKNA 4QQHA 2YMZA 4A7YA 5IYYA 2HBUA 2ZX0A 1LHNA 1V6MA 5DAXA 4Q4X2 1FV2A 5A7SA 3SISA 3WXPA 3O1SA 2DVFA 3B3QE 4E2GA 4Q4Y3 5F37A 3NKGA 1PO21 2QQVA 2BGOA 2X53S 3JBG1 2XLFA 3ASIA 1WWYA 1AR92 2ZGRA 1DHKB 1VRH3 2W95A 4QD2A 1R091 2Z2SB 4XVHA 5DQ0A 3IWZA 2JDUA 3N36A 1RUG2 4N7IA 1UQXA 2DU1A 3I3BA 2D3RA 4AHXA 2NP0A 3VBSB 5A6YA 2DBIA 4QX0A 4I3GA 1VBD2 4XZPA 1XNCA 1T6GC 2MEV2 4OMCA 1ND3C 1SLIA 3ROUA 2DCKA 4E27A 3P5BA 3I59B 5CFCC 1CAVB 1S2KA 1XPWA 4CCEA 1LHWA 1OH4A 4IE4A 5B2GB 5CZKA 5ANNA 1LCLA 4AVAA 3D0JA 4EV0A 1UAIA 1F5FA 1W6QB 3ZPYA 2A73B 5CFDC 4Z8BA 1D4M2 3POFA 3E5XA 4S2HA 3B69A 2VW1A 2OT7A 2DVDA 2JDAA 1RUD2 2W52A 3UJQA 4D7TA 4NJ4A 3TOJA 2ZGNA 4W8JA 4Z92B 3KV9A 1AX0A 4LBOA 3ZO0B 1OLQA 1REDA 5KHKA 3IKWA 1LOBA 2RS11 4NE9A 2VULA 3KD4A 1AX2A 4CDQC 4QPYA 4WM7A 2BNOA 3VBOC 1NY72 3POWA 2O8OA 1HQLA 4XC9A 4J1XA 4DNYA 5IHRA 2QQIA 3KF5A 5AFEA 4C90A 2VMEA 4IEUA 4WV8A 2HWF2 1VMHA 4HKOA 5HCFA 1B09A 3B02A 1ONAA 2BFUS 1Q56A 4NHMA 5HXVA 3WUCA 4X8PA 2XVLA 1XE0A 1Q8SA 2QTWB 1PK6C 5DUUA 4CDWC 2XLGA 4LE3A 5EJZB 3I97A 3GNEA 2QDRA 1O8SA 2FMYA 2GSYA 2WNUB 4PBPA 4QXKA 5A3WA 5KHHA 4LIUA 1ASJ3 1YEWA 3I7DA 2PHUA 2VZVA 1CD3G 1LHOA 2QQWA 2X5IB 1JYTA 5E16A 5LBFA 3SH4A 3KS7A 4SLIA 2VZSA 2HEVF 2WZR3 1GKBA 1W8UA 3CO2A 2ILMA 4WVWA 4XILA 3VBFA 2YC4A 3F2ZA 4N8MA 1QJX3 1RXGA 1O6UA 2F4LA 4GH4C 4OUMA 5EZWA 3WUDA 4W6XA 3AP4A 4TYSA 3U1XA 1MZ5A 4LBMA 1HB1A 2GC0A 4LLFA 4XFBA 2ZZQA 3RZKA 1LHUA 1WW6A 3ECQA 1RUF2 3M3QA 4LULA 2Y64A 4QAWA 4YGBA 3BIEA 1AHSA 2DYCA 1NCQC 2BTVC 4AFDA 4M01A 3ES4A 4QQOA 2Y6GA 1ASJ1 4HKWA 4Q5OA 1F31A 3OPTA 4P9XA 3OD0A 3ZOIA 2NYYA 3BUCA 4P5YA 5T55A 3K75B 4QPIC 2JWPA 5IVYA 4XZUG 1QJX1 3LPFA 3Q8CA 3KT4A 4NWWA 3WLUA 3MGUA 4Q1PA 4Y26A 1W8ZA 4XUQA 5F6KA 1O8PA 4AG4A 1O4ZA 2JE9A 5C8CB 2Q30A 2Q8CA 3KT1A 4M4RA 1QH7A 2BVVA 2G9FA 1BQPA 1MEC1 2P6HA 5JR7B 3ZYBA 2VXRA 4U2AA 1D7PM 3LIHA 1RB8G 3KVAA 3AL6A 1PVC1 4JX0A 3AZWA 4XFIA 1OLME 4Y33A 1PZ9A 3N3HA 4YVSB 2ZAAA 3AKSA 3DPRC 4J25A 5L7OA 3WNPA 4DXTA 3NW4A 3VHRA 3R4DB 4B29A 4N43B 4AXOA 5FZLA 3CU7A 2JG8C 2XLAA 2RS33 1YNAA 4QPGB 5JR2A 4H7MA 4XW3A 1GLHA 2FZ2A 1JU3A 2IZWA 4GMP0 4XF0A 2DDUA 4HSLA 5DXDA 2XBO3 1SCRA 5FOJB 1C3HA 5A33B 2BJSA 3UKVA 5JOXA 4PI0A 4XTPA 1ZRFA 3LA3A 4IE6A 1LKNA 1DBNA 1ZBA1 5CVRA 1DGRN 3GDBA 3WNKA 5A7QA 2FHRA 1XU1A 4ZKTB 1S2EA 1HXS3 1UX6A 4IV1A 4AFCA 1JN2P 5FY0A 3UNPA 4AI2A 1GWMA 2N7GA 4XAAA 1SQ4A 3RI9A 5BY5A 1VBB2 5K0UC 2FDJA 4QB2A 4A4AA 4IEWA 5EFUA 5D8AA 1X33A 4A2UA 5KXEA 5DAPA 5JPNB 4ET7A 1GFF2 1I5ZA 2HEYF 4UFKA 2KA3A 1YFXA 4FOWA 1M4WA 1ZA4A 3VV1A 4XQWA 4I0WB 3LF7A 1JH5A 2LUWA 3H42B 4AAPA 4FI9A 2CTVA 2D3PA 1AL21 5DZGA 2Z4FA 4I0BA 5G05L 2ZMKA 2IFWA 3WX5A 3ZSMA 1XYPA 1XYNA 2E7TA 1BMV2 1RJ7A 1W6PA 2GP3A 3RMYA 4RS5C 2JD4A 5LEKA 4PHZA 3AYDA 1O3TA 3POEA 2PTMA 1SPPA 2SBAA 5JWPA 4QKDA 3OY8B 2UYBA 4I09A 3O1VA 1W90A 1GOGA 4TWTA 5FZOB 3RZHA 2DCTA 2UY9A 4BK4A 4QKNA 4DIQA 4FFGA 1UY2A 2DCJA 1NX9A 4HN1A 1QGLA 3HT1A 1V6KA 4QQPA 4YW6A 1QXJA 3B94A 1QXPA 5FXXA 4ASMB 1W2OA 1GNHA 1WLDA 2Y6KA 2YGMA 2WIIB 3IM0A 4CEYC 3BTXA 1UOBA 1UYXA 2GMEA 3RZZA 1SLBA 3AYAA 3E6DA 4WZFA 1KDMA 1UIKA 1IOAA 1ULEA 2B42B 3KMHA 3N9NA 4Q2FA 4D6QA 1AYN3 1T6BX 2ZJCA 1IS6A 3Q8BA 1DGLA 5FDBA 4EN0A 2JDPA 1UW8A 4URAA 4NMIA 1C8M2 4CXXA 3N9MA 5FMBA 3PNAA 1WZXA 3VHPA 4XFCA 1E57A 1NUKA 1PO12 1US3A 2EXHA 5E88A 3MUY1 2DCYA 2HWB2 4OHXA 2VTXJ 3SC7X 4AHWA 4DINB 3WV6A 2A1XA 4PQQA 3N7LA 4YARA 2E33A 2FDHA 1S2BA 3AP6A 3W21A 4HZFA 4UBHA 3APBA 4HANA 4UFIA 4N53A 3S6PA 3MDPA 3TEXA 3ZFFA 3ON7A 4ZPIA 2I2SA 3VZOA 4V2WA 3PIJA 1IZ3A 1QDCA 2LROA 3MI8A 1W9FA 5FYTA 3VD4A 1ZYBA 3NAPB 5FO8B 4RR3B 1R1ZA 4KI5M 1E5IA 3DXUA 1KDKA 4Y20A 3VDCA 2J7MA 5KXBA 2PFWA 2CU5A 2WUHA 4GMP3 5BNQA 1QJY2 5FZ6A 4LO8A 1UY0A 2W47A 4MUVA 3RYKA 4XPVA 5GZCA 3DEMA 2C1FA 1HDKA 2XR4A 4QU1A 5A7WB 5IAXA 1O3SA 1WBFA 3ALQA 2J1AA 3MZHA 3NNFA 1W39A 2IVJA 3WDWA 2CAUA 1LGBA 5JMOA 2HLEA 2GALA 1S0EA 3IMNA 2ZOEB 2BNMA 4RGGA 1CJDA 3LEIA 1GP4A 1CR7A 1V6OA 4QGNA 2FDFA 2J1TA 2R063 3AK0A 1QXRA 1RMU3 4ZU5A 4AEKA 3A23A 2RDQA 3FLTA 1IHMA 4Y5TA 4N9IA 1JYCA 2KR2A 5T3NA 1G9CA 4UXAA 4XQ4A 2VCAA 4OHZA 2JB8A 2GC1A 3QH6A 4YGDA 3WOGA 5HCBA 1S0GA 1W6MA 2VY0A 4OHWA 1BK0A 3AL5A 4EWDA 2A3YA 1FPN3 1MZFA 2VU9A 2WA4A 2XG3A 3N9LA 4FXKB 5F6LB 1Y3TA 3BOPA 4Y22B 3WVJA 4OQ8A 1GANA 2V73A 3MUZ1 2B4KA 4LIVA 4CU8A 5IK4A 4JZRA 4JTOA 5JXIA 1UD1A 1X9PA 3PMSA 1AUYA 4P02B 3IDEA 1RUG3 4LR4A 3MIEA 1SFNA 2R16A 3BOWA 1UYZA 4YYOA 4OI2A 4K6BA 4COUA 1GZWB 1R083 2R073 1CAWA 2ZKLA 1HN1A 1YFUA 1ZA7A 1RUJ2 2MEV3 2PA7A 3U11A 3VKMA 2BNNA 4CCOA 4MXWB 4OCTA 2Y26A 2FCUA 2J1SA 2R7EB 3K3OA 3BI3A 3I2JA 2P2KA 4GAZA 3R05A 3HNYM 2BZDA 5BYNA 4G4FA 1WD3A 4DRVA 4Q4V2 1NCRA 2QVSB 2WT0A 4E9KA 2XUMA 3E6CC 1XJAA 3L2YA 2VJXA 1HW5A 3DUIA 1MZEA 3LA7A 1W2AX 4AI9A 1CJPA 4JDMA 4L8QA 5F3IA 3IPVB 5A7OA 3AZXA 3DXTA 1OQ1A 2HYXA 3IAQA 4FPKA 1IG3A 4P00B 4XJWA 3C7FA 3G7DA 3DGTA 4NHLA 4L97A 5FWEA 2FDKA 4IE5A 1RUI1 4QX8A 1R081 2WO7A 3JU9A 4JCKA 1GOHA 3VDAA 1ULCA 1UKRA 2P37A 1A8MA 2B8MA 4XFAA 5FJHA 1XNBA 2VTXA 5FZDA 3AX4A 2WO1A 4DUVA 2R49A 3OBAA 1GZCA 5T5OA 1O5UA 4NROA 5FMOL 1CIYA 1ZREA 1ZBE3 5FZ0A 3GHNA 2XJSA 3FZ3A 4M0HA 4FFIA 2RHPA 2W91A 4W50A 1D0HA 2HWC1 2Z69A 4BXFA 2OKXA 4XYXA 1EPWA 4O7XA 3ZXFA 3FUQA 3H1YA 5C4WB 4XTMA 2JIGA 1PO22 1UOGA 3B93A 1PX3A 4JGYA 3W9AA 4XDPA 4SBVA 3NNLA 3EXUA 5DUWA 1R092 1V6LA 1SLCA 3ACFA 1U5YA 3VBFC 1B35B 4PI2A 1VMJA 2WSUA 3VDDA 4XBNA 3OUHA 1R64A 3MW2A 2ES3A 1GQHA 5H9RA 4R52A 4PBOA 2A5ZA 2EIEA 4NHYA 5FYYA 4AF9A 3I2IA 2Y34A 1RUF3 4NAOA 4I3PA 4C1WA 1UKGA 4LPLA 2ZZJA 4CDUA 4IQPA 2BV4A 4QKFA 1PVXA 3NJVA 3FHQA 3JUUA 3WSOA 5JXHA 4K1ZA 4A3XA 1G9BA 2ZHMA 3O7OA 1TE1B 2LTNA 1OF3A 4A6SA 5LZ6A 2QE3A 4RHV3 3LEKA 2Y60A 1QJFA 3EB7A 4H7LA 2FQPA 1C1LA 3BTAA 1QKQA 3ZIXA 1FMD3 2G19A 3VBHA 3I4IA 2ETEA 1UF2C 4E2QA 1ZX5A 2RS12 4LBLA 2Z5WA 3ZR5A 1CPMA 2IFRA 2VZ1A 3HEIA 4IUGA 4AEMA 4ONUA 4QWNA 5A6ZA 3S7EA 4COWA 3VBOA 4HVOA 2BOJA 2RDSA 1OOPA 2O1QA 1I5PA 1LR5A 2YFZA 5GLVA 3MV11 5C3OA 4XCAA 3H8OA 5CG8A 2E63A 4BCUA 1QEXA 1I6XA 2VAUA 2WZPP 1F35A 2P5BA 5DZFA 3RWNA 4IESA 1S0BA 2D40A 4JDNA 2DUQA 2P34A 4Q26A 4RHV1 2I45A 5FZEA 3FX3A 2OQ6A 5CAZA 1DZRA 1KQRA 3T0DA 3AYCA 5L7OC 3GZTB 4OUEA 1SZBA 1LU2A 2JIJA 3TNPB 4FAGA 1KITA 3UGGA 1LENA 3WDUA 5C9AC 4XF1A 2P6CA 1ND2B 1X7NA 4BLJA 4GKXA 3X29B 5FMCA 3ZN4A 2QJVA 4K7JA 4AEDC 4KWJA 1AZDA 1GR3A 1UOJA 4GALA 4KNCA 4M4PA 3WNMA 3WP4A 4EN9B 4Y4RA 2QKDA 2VMFA 3S7IA 4FTSA 4IV1C 2MHFA 4FQZA 3NJYA 3S0MA 1QDOA 2RJLA 2D6OX 1GV9A 2DUOA 1F4AA 2WFF1 4LOSA 1RHI2 4W6YA 5GKAC 3PJQA 1CESA 3WG4A 5K7PA 5D8AC 2V09A 3U0ZA 2K9ZA 2ARXA 4Z2AA 2R0FA 4MYEA 4OI4A 3GZEA 5BNNB 2C6SA 3E6BA 1ZZ6A 3OJBA 1NG0A 4MV2A 1QNWA 2OZ6A 1OUSA 4UFMA 3T1LA 1VBC3 2XKOA 4AFAA 1IGOA 3JQWA 4ZZ5A 5K9YA 4OYUA 2OYZA 2H6BA 3K48A 1MEC2 1OH3A 3WT3A 4GXLA 3PJYA 2VE1A 1BBT3 2BUKA 3FWEA 2ZACA 3MICA 5IAVA 1ZZ7A 2W92A 1UWWA 1FXZA 1UXZA 3FFQA 3MPBA 4GD4A 2GC2A 4F83A 4FPLA 4LT5A 2PAEA 1L3JA 1RITA 4IEXA 1HJFA 2CGNA 2ZEWA 2ZHLA 4HLTA 2YY1A 4M0NA 4GJYA 1EPZA 4M3CA 2Q1ZB 2ARCA 2L9LA 1Z7S3 2PAMA 2B45X 4AI8A 2CV6A 1VAKA 5A32B 2UYAA 1ULOA 5F5IA 1PIV1 2CNAA 4QM9A 4DQAA 4F8AA 1W0NA 2WR9A 1ND3B 3DV8A 3WF0A 1QJZA 2ARBA 5CFCB 1QJU3 2XPJA 1T2XA 1WMDA 1BBT1 1YQ8A 4KGGA 5F1RA 1ZBA2 1RUC3 1W0OA 1ZVFA 3WW1A 4BOWA 5CFDB 3SH5A 3J8F2 3WNNA 4CSWA 4XJUA 2WQZC 4IEYA 5FXZA 4LLOA 4BB3A 5K0UA 4AWDA 4XURA 1RJ8A 4ITCA 4N53C 4EWEA 4DUWA 3ZFFC 1JYWA 3MIHA 3POJA 4NWVA 2TNFA 5LA9A 4RN5A 2TEPA 3THCA 3QD6A 3JXSA 4H3WA 3NNGA 5F5AA 3ZM8A 1JZ5A 3POBA 4XFHA 4LHLA 3LZZA 5J48A 1X8MA 3PURA 4YZ3A 1J1LA 3VKLA 3I2OA 1AXKA 4N7UA 2PHLA 5JI7A 1BEV3 2WL1A 3EMRA 3Q9OA 5FPZA 5FV3A 1RUC1 1YQ5A 1N1VA 1Q8OA 1FOD2 5FY4A 4YZ1A 4BWOA 2W94A 3HPNA 1RUE2 1MVQA 2RG4A 2ZEXA 4MGSA 4J1WA 3RWKX 1IQDC 2GMMA 4FCAA 1W05A 2PYTA 3CEWA 2IXCA 4KWKA 4FPCA 4WVMA 4CDWB 3POIA 4YFWA 5F8PA 4Z1VA 4JHZA 2ORZA 1K45A 3SMHA 1AYM3 1BJQA 5C8WA 3FLPA 4QU2A 1EUTA 4YW7A 4E4DX 1MVEA 3QCWA 1YWKA 5KWRA 3IDCB 1GMMA 2Q0AA 3VBSA 4XMIA 4XJ8A 1NT0A 1S4CA 3CZUA 2HWD3 5F5CA 3C7HA 1BEV1 2XJTA 1HN0A 3HJRA 2F6BA 4HONA 5FLHA 3CJIB 4Z07A 2FCVA 3IDBB 4GH4B 2P3IA 1XXNA 2DBNA 1YIFA 4YNIA 2NMOA 4NVPA 5T52A 1H9PA 2B39A 5I8SA 5AC93 3SQOA 1W6QA 1S0FA 2JDKA 3VBUA 2WT2A 3H1WA 4Q4W2 4TZDA 5FP4A 1VBE2 1VPHA 1W3XA 2AACA 1JZ3A 1QMJA 5L36A 1ENXA 1LOEA 2E51A 3ZFEB 1AR72 1LU1A 3IDAA 1SDWA 4BH9A 4RQPA 3CIHA 3E5UA 3P3PA 4S2DA 3WF1A 4BE3A 1YXWA 5EXOA 4ZHNA 2CL2A 1DQ1A 2HWD1 4JGZA 4QPIB 4YW5A 4JKLA 4X6QB 4Y1VA 5A6XA 2HWE2 5DDJ2 2PLV3 2ZHKA 3MF9A 4XFFA 3S30A 3SEEA 1WW4A 3C7EA 5FY9A 5GLUA 4XUNA 3SXWA 1OSGA 5AC91 1OUXA 1DQ2A 1W9YA 4L2NA 3ZIWA 4AQ2A 4BMBA 2QQPA 1EP0A 1NCRC 1QQP1 4AI3A 1TVGA 5ANQA 3P1IA 3ZSKA 1JI6A 1XU2A 1YRZA 2RDRA 1WA6X 4MHUA 4XE9A 4W65A 4CU7A 3JB4C 2RMU1 1UU4A 2E9QA 4GWIA 4E8CA 4C91A 2QQUA 2D98A 1VBA1 1R1A3 1TQ5A 1V6JA 5JAXA 1Z0HA 3N4MA 2CAVA 3AMPA 1S0DA 5IVJA 4CTEA 2ZHNA 1S55A 4MOAA 3VZLA 2JG8B 4LA3A 3K4AA 5JCTA 2BFUL 2LM3A 2O8QA 3U4XA 4AL9A 1Q43A 2WWUA 3MFCA 1CAUB 1U5IA 1UMHA 4GZ9A 3FE5A 2GU9A 1LOGA 1IKPA 1W8HA 3O0WA 4BQYA 3QH7A 4LK7A 4JQTA 2XKPA 2A6VA 4GB31 4K20A 5KHIA 1YQCA 2BWAA 1BKZA 3BGAA 1AR63 1WW5A 4ISQA 2VQ0A 3C2UA 3H3UA 1C5HA 3NV3A 4H14A 3ZYRA 4E4HA 5FPXA 2ORXA 4YM3A 2VOWA 5FLIA 2O0OA 4JGYC 1HKDA 1W04A 4L92A 4LUMA 1W6NA 3AB0A 4Q27A 1FV3A 2ID4A 2RE9A 1SBFA 3RQ0A 4QX1A 3GCXA 1H8TB 1CONA 5C3SA 2ZABA 3OBZA 3R6SA 4AI1A 3VDDC 2VG9A 2RR13 5IK7A 3GM8A 1ENRA 4B7EA 5C8CA 2KM2A 5J1XA 3OUJA 2XQXA 3BTYA 2CWMA 1MQTB 5CKMA 1BLZA 5D1IA 3RVHA 4YRDA 1TMF3 3NMBA 5ACA2 1AR61 4UW5A 3RMXA 5IK8A 2WYFA 4CDUC 3ILFA 1W8OA 4RS5B 2UWBA 4Q4Y1 1ULPA 4CCDA 1KS4A 3LGRA 4CDXB 5FPBA 4J6GA 1PGW2 2BQPA 5DZEA 1U12A 5KXDA 4LA2A 1O3QA 1VRH1 4AFMA 1MR5A 1UU6A 5L9RA 4IEPA 3UT0A 2FD8A 2P3KA 3T2PA 4UFJA 3LCPA 1PGL1 1EY2A 3VBHC 1RUI2 2RR11 4CEYB 1VP6A 4MGIE 3D0SA 4UF0B 5DPNA 4DY5A 2RS52 5JVVA 5A33A 1SMVA 1OKQA 1BZWA 1TMF1 1NYWA 4IEZA 4YZ2A 1OOPC 5JZGB 4IDZA 2R043 1LULA 5LK7B 3OOXA 4AOCA 3KCYA 1A34A 1JOJA 3NO8A 3EBRA 3HD8B 3V64A 3DKQA 5IVEA 4YPJA 1BVP1 3J4UH 2HWC2 4PLOA 4Q8LA 1NE4A 1Y9GA 2OW4A 4QX3A 4CZSA 1Q8QA 5FZIA 4NUBA 2X05A 4WM8B 2W68A 4GIQA 3CNAA 2PQQA 3O5SA 1OVPA 3H0OA 2VNOA 5FR3A 1JZ6A 1ULDA 2VMGA 1W6OA 1V00A 3E97A 1D0GA 3MYXA 1JZ7A 2IXHA 2CDPA 2DURA 4P9IA 3RYRA 3B01A 4Q1RA 2QBXA 1KJRA 1HRV2 2DCZA 2YYOA 2R041 1YQ2A 2VQAA 4IGOA 5KR7A 1RVF3 3KHCA 1SBEA 4CU9A 3GCWA 1RUNA 3ZXDA 3T2OA 2X09A 4YG6A 3T0AA 3GHMA 3WCSA 3ZFGA 1VAMA 1JXNA 2VOTA 4PIYA 2OPKA 4EZ4A 2PHDA 4YZ4A 1FYUA 2VOKA 1RHI3 2GP5A 2VBPA 5FZOA 1NLSA 5HV0A 1C8NA 2DF7A 3ETPA 2YV8A 1AR83 1EV13 1K5MA 4FOYA 4UT5A 3HBKA 4ZU4A 3O1OA 3ZDSA 3KV5A 1PMJX 2WO2A 2WS92 4O61A 1C5IA 4XBQA 2WZR1 5T5JA 1DLLA 1E5SA 3POSA 4MXVA 1W99A 3T4VA 2WQ8A 3IT8A 1LAJA 5I0UA 1X36A 1G9AA 2BRTA 3HNBM 4Y5Z0 5C70A 2R32A 4L0PA 1N1SA 2ZGQA 4H2AA 2HBTA 2G9ZA 2JDHA 4LBNA 4MZUA 2YFUA 1COV3 2ZEYA 3A0KA 4Q0PA 2GH8A 2QDNA 3DN7A 4YZ5A 4B4RA 1AR81 3K46A 3W20A 3QOPA 4QXCA 3MLKA 3SCHA 2R6QA 5DG2A 1BK1A 5C3QA 2WNVA 5EJ1B 5EJ3A 3ZR6A 4YSFA 2PMWB 3OSDA 5F5QA 2BBVA 1RIRA 2EVXA 2XJQA 2RM23 4E8DA 4MG2A 1J84A 4PT6A 5FZCA 2ZGSA 3ETQA 3JD72 1OFNA 5C9AA 1XE7A 2GMPA 5CG9A 2XXZA 4YW1A 4XDQA 2PELA 3U78A 3I3QA 4AEDA 1SLAA 2WQ4A 3M3IA 3SEPA 1COV1 4R8HA 4DO0A 1JZ8A 1UZZA 5LK5A 4CEWB 5FZ9A 2ZMNA 4AVTA 4DOUA 5CEHA 4MO3M 3ZVXA 5IFPA 1W8WA 4OFGA 2Y33A 5FUIA 3DKWA 3T3YA 1DZTA 2E7AA 1AXYA 2WFF2 4RGAA 3RDIA 2R1BA 4UI9L 3UJOA 5IK5A 3VDBA 1ZZ9A 3VKOA 2J1EA 4NIIA 2RS31 1GZTA 1HRI2 1OI6A 3ABZA 3NKTA 1BVVA 1K12A 1TME3 3HN1A 3AP5A 3ZMNA 1XOYA 3I3MA 4WM7B 2OXBA 3LFMA 4DS0A 3ZSEA 2XBO1 1GYKA 4AVVA 1QU0A 3ACLA 4YM2A 1D2SA 4K3UA 2P1BA 1F15A 1RUE3 4LO6B 5FO9B 1WLCA 1HXS1 3C7OA 1MS5A 3TRSB 1YLLA 2Y6LA 4XETA 4CCLA 1JMUB 4TN7A 3V65A 2UURA 5FZFA 4TTGA 3A0NA 3DECA 2JEMA 2HJIA 3N9QA 4UW4A 5T5PA 4JRLA 1C1FA 1F4HA 2WNEA 2BVBA 1IKQA 1H4GA 2C24A 4LE4A 1V9U2 5APAA 3VBSC 1CGPA 4IL7A 2E53A 1YHFA 4MXWA 3VBFB 3ACGA 5ABJA 3UKTA 4PLMA 2K46A 3KZ4C 1SFYA 3WG1A 4F3JA 5SV5A 1ACCA 1U5XA 5DUVA 4Q4W3 1UYPA 3VBUC 1VBE3 5GZGA 1W9TA 4EN7B 5C3PA 4LBJA 5I93A 3IPVA 5FYBA 4EWAA 4ASKA 4FBFA 5A7PA 1UO9A 4IETA 3OGVA 3WHTA 1J3PA 1MACA 4EYUA 3OUIA 5JLVA 1SLTA 3ZLIA 4N90A 4RQPC 4H55A 2I74A 1N1TA 1ST8A 3LDBA 1YFWA 4JGZC 3A4UA 5DDJ3 4AAXA 5FWJA 4FPGA 1PHMA 1KFXL 2EXIA 2GZWA 2V4VA 2WDBA 3OB8A 2BEOA 2JXAA 1JYNA 1AYN1 1JUHA 3TB0A 5I0DA 4XCBA 1H2LA 3D6EA 4MGKE 3PUQA 4OI1A 3ST7A 3PIGA 1H1AA 3ZYJB 4QQ2A 3PVOA 3ZN6A 3OPWA 4PDWB 1VLNA 2HH9A 3LDRA 1Z78A 1IS5A 2GC3A 5C4WA 3T30A 4PIZA 4HT1T 1RUH2 2WNUC 2YHJA 4MGQA 4BQ2A 2IVIB 1JS9A 2VR4A 4RFRB 3ZDVA 2VBBA 1ULFA 5F2WA 3FBYA 2G1MA 4LHNA 1W2TA 5FUNA 4YM1A 4QT6A 1WBLA 3CQOA 5FO7B 4YG3A 5I0RA 2ZA9A 5CKNA 1H2KA 1LEMA 4L11A 2X29A 2EIDA 2Y8KA 1YUDA 5FREA 1XB9A 3ZXJA 1J59A 1SHWB 4V2VA 1MS1A 5DN2A 4LKSA 4GQ7A 3AM2A 4R4ZA 4Q4X3 4HMZA 4CCKA 2YZ4A 4GMP1 4XIKA 3DCQA 1LJ7A 5FXWA 3RRDA 3W5MA 1DYOA 3MF6A 2CGPA 4NR1A 5HI0A 4IV1B 5J37A 2JG9A 2A70A 2A6XA 5FKCA 2Q4SA 2DFBA 3E5QA 5I8TA 1G9DA 1HIXA 1OLMA 2GNDA 3F95A 1TEIA 1N3PA 1W9WA 1AR93 2BGPA 2J1VA 2JENA 2WC2A 4UFHA 1QWRA 4YW4A 3K51A 3LA2A 2C9KA 1W8NA 2R061 4DZGA 3V0BA 3AXEA 1RMU1 2H6CA 2V5DA 2W5FA 2GN3A 4FAHA 1GSLA 4KU8A 2VTFA 4CE8A 4ES8A 2QQMA 2WSVA 1AVBA 1PMHX 1LGNA 1NA1B 2SLIA 3H9AA 1VBD3 4P9WA 3WNOA 5C8CC 1EAH2 3OTFA 1YI9A 2PN5A 4BQ5A 1UY4A 3I2KA 4L99A 5LA2A 3UESA 1GWLA 3FFZA 3USUB 5LEJA 1FPN1 1QQP2 4A6OA 3BTZA 1DG6A 2RV9A 2W3JA 3CMGA 4QHBA 4XQDA 1D4M3 4K40A 5G04L 3TN92 3WNLA 4UBGA 1AR91 4FFHA 5L9BA 1O7FA 2EF6A 2RMU2 3HT2A 3EO6A 3KV4A 4FO9A 1RUD3 4AVBA 2ZCWA 1V70A 1RUG1 3J7NA 1LNSA 3N9OA 5F32A 4COYA 3MW4A 4RYDA 4MSVA 1OPMA 1W9SA 2WNOA 4QHOA 1HV0A 3CHXA 1JHJA 2R071 1ND2A 2RS53 2ZX4A 4HVQA 2MEV1 1LTEA 3HN3A 3NRUA 4GA9A 5JIUA 4XF9A 1PM4A 3ZN5A 5LY2A 1C28A 3POYA 5A6QA 2E7QA 1HJGA 1QF3A 5IVBA 2HWF3 4CP9B 3IZOA 2NLRA 4Q8KA 2ZGOA 5GM0A 4GB32 3UGHA 4D0QA 3M2MA 3OYWB 1GNZA 1Q3EA 3I2FA 4LORA 4B3NA 1J3QA 1E5HA 1X50A 4KWLA 5CIRA 3VZMA 5A3NA 2LS6A 5FJKA 4AGGA 2BYVE 2ZAHA 3I3DA 3ZXLA 5JSRA 3BU7A 4Q0SA 5J36A 1RGSA 1LB2A 3JBG2 4HG6B 3H1MA 1H1MA 2VMCA 4DUXA 4KBBA 1YJKA 3M70A 3HBZA 3R4SA 5FZKA 4A41A 5FP7A 5F3GA 4NOTA 1RINA 1UNBA 4UYBA 1WCKA 1NOVA 3T08A 3U14A 4C0HA 4D7SA 5BNOB 1DQ4A 2AYHA 2ZBJA 5JI9A 1LEDA 2AREA 1G7YA 2HWF1 1P8JA 2TBVA 5CA6A 2P3JA 2ZTNA 4IW3A 3ACHA 4OMDA 4QX2A 1ZBE1 3JZVA 1DFQA 3TYJA 2ZGKA 2YGLA 3ZFGC 3VD3A 2XJPA 2JDYA 5LBEA 1KGYA 1REEA 2YU2A 1ZRIA 3R4UA 3KVBA 2DFCA 1K5MC 4LXLA 3T2TA 1MS4A 3THPA 4LNVA 4FTEA 3WP3A 2C26A
chains in the Genus database with same CATH topology
1VRH2 2TUNA 3H7YA 5E89A 4YVWB 3VBRA 1PGSA 2VVFA 3QBQA 5A32A 5K8SA 3TBDA 2ENRA 1H4HA 5JMCA 4Z82A 2NM1A 1WUVA 4LEJA 4Y24A 3EHKA 3LWCA 4BA6A 4BIOA 1RUF1 1HV1A 4KQ7A 2OUJA 3FLRA 3WW2A 1MS8A 3RNSA 2YC0A 1OQEA 3KB5A 3ZXKA 3B00A 3UV9A 3WD5A 5T54A 3G6JB 3WW4A 1XYOA 1UIJA 3FUOA 4D94A 3IN9A 2WNVC 3RJ2X 5DUXA 5GJ6A 3ME2A 1FMD1 2OA2A 3QLQA 4IV3B 4B4QA 1XNKA 3SITA 3NJZA 5CNAA 4LHKA 3V0AA 1VB4A 5EV7A 2WLPA 3WG2A 3SH3A 1OHFA 1TNRA 3VZJA 1N1YA 2HEWF 2A6WA 2NQYA 2DTYA 1CAXB 2JICA 2Y38A 2ZX2A 1VBB3 3VKNA 3OD4A 3H3ZA 5J7MA 2NMNA 1ASJ2 1DGWX 1UU5A 1S0JA 1M06G 1DZQA 2XJRA 1YIPA 2WZR2 1JYIA 2BWCA 3CJIA 4JDOA 3KCXA 1QJX2 3OBTA 4KG0A 3W58A 2VOVA 2GDFA 1W0PA 1VJ2A 3WQ7A 1PMIA 5IUQA 5FQ0B 1JW6A 4AFBA 4LO7A 4HK8A 3WCRA 1LECA 2PAKA 3ZFEA 1PVC2 2DU0A 1AF9A 2DV9A 3NV4A 1I1EA 1X82A 2IWGB 2OVUA 2FMDA 2AR6A 2WJSA 2PHRA 1F8VA 1G6NA 3RJRA 5ABJC 1C4RA 3VDDB 4HPKB 4Y1XA 1VBC1 1BMV1 1VAVA 3THTA 4B8EA 1J58A 2GN7A 3VUOA 3AJYA 1C8M3 3ZXAC 5A3MA 2GH2A 3OGGA 4YGEA 1ZZ8A 2PHTA 4FPOB 4CDUB 1PO13 3L9JT 2HWB3 1LRHA 5KXCA 2XL7A 3TAYA 1OA3A 5FLJA 3UL2A 1WW7A 3MFAA 3WDVA 2A71A 4CP2A 2D6PA 4E4SA 4EJRA 4P9GA 4XFGA 4QMAA 1RUOA 4QM8A 4E2SA 2DUPA 4IXLA 4AGRA 4FT8A 1Z7S1 3EJKA 2RS32 1CAUA 4CDQB 4CRQA 1XRUA 4E4ZA 3VBOB 4MGZE 2XBO2 4UW3A 3V56A 3AP7A 2KXLA 1CX4A 1QJU1 1SCSA 1DGRA 1PO11 1QJY3 1AL22 1UN1A 2HWB1 3VGIA 1HXS2 1OA2A 5C4WC 3UK9A 1QOTA 3PVBB 1PK6B 1OQDA 3LAGA 3WP5A 1OA4A 2B5HA 1UZYA 5JPMB 3AYEA 1H8TA 2GNTA 2VVEA 4AVCA 1DQ5A 1ENSA 1FNYA 4XMAA 4B4PA 3LOBA 5LRSA 3LSEA 3ZSJA 2D6LX 2EXJA 1MQTA 4DFSA 3I59A 1QJY1 1LOAA 1CAVA 3AJZA 2D44A 3I8TA 2JG9C 3RI8A 4ES9A 3WP6A 5KBFA 1SLLA 4EN6B 1NCQB 1AYM1 2UWAA 4MLOA 4NN0A 4LBQB 3VHOA 5IT6A 1FT9A 3O0VA 4JV4A 1RUJ3 4BZ4A 2EXKA 1EAH3 1ULGA 5JZGA 1PNFA 1TNFA 2R1DA 4Q4V3 1EYBA 2XVGA 4K1YA 3ZMOA 1XE8A 2Y0IA 3TN93 4FTBA 4LO4B 1RC6A 1I9RA 3AFKA 4HBNA 3VL9A 4WBBA 3ILRA 1XNDA 2EAAA 1WLWA 2XJUA 5FFOC 2WNUA 4K21A 2BW8A 4O9EA 1ZRDA 1A3KA 2GNMA 3DPRB 3AKRA 4UW6A 2X5IA 3ENRA 4M3CB 1ND2C 1CVNA 2VMHA 2PLV1 3FBMA 3WQ1A 4Q4V1 3D8CA 2ET1A 1JTZX 1CIWA 3IBMA 3WNXA 2XWBB 2QFEA 2D7FA 4OHYA 5JSPA 3MIFA 3AXDA 1KD7A 2YXSA 3KCCA 5TSWA 4COZA 1IPJA 5HBAA 3WDTA 5KHJA 1PO23 4HVRA 4C0BA 4QQLA 2GNBA 4ATEA 1R1A1 2NPIA 5K0UB 3CF6E 4FPYA 4XHXA 1R093 1WMFA 1ZZCA 4XF3A 3B5LB 2DVGA 3RPQA 3H50A 2W39A 2R062 2DVAA 3FC0A 1RMU2 2VECA 4DPNA 3R0RA 4KG8A 5F9TA 4X8NA 3U07A 1AJOA 1PM7A 1JBCA 1FAYA 1F5JA 3AFGA 3AMNA 1FPN2 4OVEA 2VVDA 5JOYA 1Q5OA 1A8DA 3PTYA 3PHMA 5FTTC 2WWSA 4WVMB 3FJSA 2CWSA 2D6NA 3GZUC 4YVSA 3I2DA 4PCRA 4M3CF 1KFUL 2ATFA 4FOQA 3MPPG 2C0ZA 4N43A 3VBRC 4NO4A 4QPGA 2RS13 1DYPA 1R082 2R072 3P3NA 1N3QA 5GZFA 2D3SA 2JX9A 5FBZA 2D93A 1DIWA 1KJLA 1YCIA 4CEWA 3WHUA 1ZZBA 3KQRA 3VBUB 4P14A 1OD5A 1S0IA 2QUOA 3M3OA 5BNPB 1IS3A 4BYYA 4TSVA 4FXGB 1QOOA 1DGWA 4RQPB 3NL1A 2ZMLA 4JRAA 2ZGUA 2H0BA 3OBRA 1APNA 3NV1A 4JGZB 3ATGA 2ZGTA 2UU8A 1GICA 1U0AA 3C3VA 3CLPA 1WMEA 2WINB 2DTWA 3D4KA 5LRRA 4BLIA 3AP9A 4QGLA 3N35A 5JOWA 2EAKA 2R30A 4XF4A 1ZBE2 1KS5A 4LBKA 4V1PA 1Y7BA 3TNQA 1NLRA 2G4IA 2PHFA 3OY8A 1QY4A 1UMZA 2D97A 2EIGA 2OZJA 1NXMA 5I0SA 2QZ2A 4MX3A 1WA4A 3OF1A 1QH6A 2PHXA 1DYKA 3BB6A 3LOIA 2BGCA 3CJIC 2VW2A 3KSCA 3B7MA 1V6NA 2YDEA 1RVF1 4R9AA 4OZXA 3PVNA 4AQ6A 1MEC3 4DXZA 1H1IA 2A75A 4NHKA 2PHWA 1PVC3 1RHI1 1YYNA 3ZFEC 2ZGLA 3N7MA 1EV11 4XEZA 4RHV2 5FRAA 1W6NB 1MS0A 1WGPA 3MLLA 4QGMA 2A3WA 5CBLA 3GYDA 4BMEA 1FMD2 3JB8A 4GKYA 5AVPA 2VOXA 1VB2A 1LHVA 4FPEA 3NAPA 4RR3A 4XBLA 3INAA 1I3HA 3MEPA 4OULA 3WY6A 5HCAA 4PDWA 1ZBA3 1LESA 4R9CA 3J8F3 4Y1ZA 3HWJA 3MW3A 3ILNA 3TWIA 5L73A 1NQDA 3VN4A 5J96B 4L9BA 4FOVA 2RM21 3PVEA 2UY8A 3CJXA 2E6VA 4HSJA 4PIXA 4FSJA 5GLTA 5CU1A 4G3YC 3GBFA 4TLFA 4JAAA 4HK9A 1AL23 4Y4YA 3MIGA 2CY6A 1FOD3 1LODA 2CYFA 4O9GA 1QOSA 4WZCA 4ZXKA 3M3CA 3J8F1 1Q8PA 2JKBA 3ZXGA 1UPSA 4MVTA 1CQ9A 4Y22A 2YROA 1DDLA 1H0BA 1SACA 4ORFA 4EN8B 3WZ1A 1PZ7A 2D6KA 4DB5A 1H8TC 1W6OB 4KH9A 1GZWA 1NA1A 1TME1 3ZX7A 4HETA 1SEFA 3NV2A 3EQEA 1LOFA 2VH9A 4I2OA 1MQTC 1O4YA 4LTAA 1NE6A 1FOD1 2D43A 1VBC2 3USUA 1PIV2 4R9BA 4ZU7A 1RUE1 1HQWA 4RSUA 4YM0A 4AQSA 3SLIA 3ZFGB 2D5FA 4HFSA 4I01A 4GULA 4CDXC 1BBT2 3AMMA 2BPA2 4RL7A 4XJAA 1ALYA 3HR9A 4R4XA 1AR73 1AL0G 1BYHA 1K5MB 4WVVA 4YW3A 4KGQA 2DVBA 1DU3D 1YI7A 1OFSA 4XXAA 1WLTA 1D2QA 2HWE3 2IXIA 4IEVA 1Z7S2 1H8VA 4PF5A 2GAUA 4JC1A 5JZGC 2G9GA 3KGZA 4LO5B 1QHDA 4Q4W1 4M00A 1WCDJ 1QJU2 1VBE1 3HIFA 4P9LA 1GZ9A 1RUC2 3N7KA 3OYWA 1AR71 4WM8C 2IXLA 1HQNA 3QACA 3ZXEA 3KT7A 4AI0A 3M7AA 2WNVB 4X6RB 4AYUA 1HX6A 2QZ3A 3W59A 2C9AA 2FZ1A 2X5IC 5L7OB 3AKQA 2AZ5A 2HWE1 3JQXA 5DDJ1 5I91A 2XH6A 3URFA 3ZYIB 5BNOA 1B35A 1F9KA 3JCIA 1H9WA 3D5OA 4S2FA 5C9AB 4JQRA 1FATA 1OPOA 3CL1A 2XVKA 2IXKA 1BEV2 3MIBA 3OPZA 3FMGA 5EYXA 3AKPA 3VKFC 3WDYA 4AEDB 1OLRA 1IS4A 5CB7A 3PMEA 4LUKA 4RFT0 2LALA 4Q0UA 2XB6C 3KLSA 1OMIA 2B7YA 1N47A 4YVWA 4D7YA 4AVSA 1AYM2 3SHRA 4P9YA 1VIWB 5D8AB 1FI2A 4LBQD 3HAGA 4CYDA 2D5HA 4IEQA 4KU7A 3AZYA 4IERA 2HWD2 1GQGA 4QX5A 4I02A 4Q4X1 5ACA3 4Q0VA 5AC92 4G9SB 1O4TA 4IEOA 2XL9A 1W6PB 4AEJA 3PLQA 2JDZA 1FNZA 5KHGA 2YUEA 3SNMA 4YVSC 1F2NA 4GWNA 1LOCA 4CP0A 2ZPXA 4IV3A 4URTA 5BPXA 2FBEA 2V5YA 4N43C 4AGVA 1KRIA 1RUI3 1VBA2 4QPGC 2JJ6A 5BV6A 4MH0E 1VBD1 5ABJB 3AMQA 2ZX3A 2PLV2 3H7JA 3B9CA 4FQ4A 5ACA1 1ZM1A 4WVZA 4NPRA 4DMIA 2VW0A 4CEWC 1S0CA 5H9QA 4Q0QA 1H30A 1CAXA 1URXA 4I30A 2VUJA 5GZEA 1D4M1 1PGW1 2HWC3 2W0XA 4I0AA 5FCCA 3M8LA 1RUD1 3HMYA 4YFZA 1X8EA 3HQXA 1R1A2 3WG3A 4OI0A 2VUAA 4M3CE 3AMHA 3DF0A 2RS51 4PQ9A 4N53B 5BNNA 4HN0A 3ZFFB 4WM7C 1NY71 2AH2A 4AHYA 1HRV3 1O3RA 2XGXA 3J9SA 4PLNA 4BHPA 2R0HA 3M3EA 5FQ0A 4FPHA 4Y20B 1ZRRA 4CP1A 5E8AA 3ZN6B 1AR62 2VNRA 1NXD1 2NN8A 2EALA 1YFYA 3LKJA 5I8YA 4Q4Y2 3AZVA 4Y1UA 1G86A 3VL8A 2X8KA 2WS93 3ZSLA 2XJVA 3VZNA 1G8WA 2AUYA 3NVCA 1HRV1 2MPFA 4MGYE 2ZGPA 4HPKA 4XIOA 1PGL2 3I54A 4RA0A 3M4FA 2RR12 3KM5A 4INDA 1VALA 3ES1A 3USSA 1ND3A 2MNGA 4YW2A 4Y1YA 5I0TA 5CFCA 1FX5A 1TMF2 1W6MB 4XXPA 4ISRA 1REFA 2XWJB 2JG9B 2HYKA 5CFDA 1XQNA 2A6ZA 2WS91 1V6IA 4A7ZA 4OHVA 2DWRA 3NSTA 2OIIA 3GZAA 3L2HA 4RD7A 2JECA 1LGCA 3V0BB 5JDBA 3BCWA 3VZKA 4YGCA 3JD73 4CDQA 2ERFA 2WLQA 4XOGA 1CAWB 1JHNA 1Q8VA 1H2NA 3NAPC 4RR3C 5JIAA 3T1MA 4D3WA 4FPFA 4JTNA 2R042 4PDWC 4OLLA 4FP2A 1NCRB 2HKXA 4N9HA 1ZNPA 3GBWA 2IC1A 3WDXA 1PK6A 1RL3A 3O12A 4CDWA 2QNKA 5FMOS 2OUHA 2WA3A 2WFF3 1WCSA 2Q1MA 3WQ0A 4R9DA 3BALA 3JD71 5J09A 4COVA 5SV8A 1HRI3 1O5LA 4XJ9A 3IIAA 1G9FA 2WFPA 4K8FA 4D69A 2ZS6B 3RG0A 4GH4A 4XJZA 1BXHA 1RVF2 5C6CA 5H9PA 2A6YA 1HLCA 2WT1A 3OGJA 4W6WA 3KGLA 2ZKNA 1VBB1 2AGSA 3DL3A 1NCQA 4AE2A 1AXZA 2ZGMA 1AR82 1EV12 1YJLA 3O0XA 1W2UA 4JGYB 4XHBA 4LBQA 1A78A 1CPNA 4BIFA 1HRI1 2W08A 2VNGA 4Z2WA 1V9U3 2Z42A 1NA1C 4QPIA 5GZDA 2Q8OA 1LOFC 5BXXA 1ENQA 1PIV3 4AQTA 4AW7A 4FP3A 3RSJA 1N3OA 2H0VA 2P17A 5FAXA 1POV0 1COV2 3N7JA 4HL0A 4DRRA 3VLBB 2VGDA 3O14A 4BPZA 1QNYA 5EYYA 3AZZA 1MS3A 3M1HA 1ZRCA 5C33A 1YO8A 3FHIB 3GF6A 3BODA 3OCPA 3DPRA 3SCFA 2K2SA 4AK3A 1V9U1 1MS9A 2QCSB 2D6MA 5JOZA 5L19A 5AVAA 3VBRB 2RM22 3GALA 2JG8A 4U36A 3VBHB 2B46X 4B7KA 4BQ1A 4GWMA 4Q29A 1H2MA 2IXJA 3SCGA 1IQAA 1C8M1 1D4VB 1O91A 1OOPB 3BPZA 4OUSA 3J26N 5GALA 1RUH3 3ZYPA 2EA7A 3GBGA 2VMIA 4DY3A 3LSDA 5T5LA 1UL9A 2Y0OA 5BNOC 1B35C 2A7AA 3MLJA 4KL1A 3AKTA 3LB9A 4PJYA 3U10A 1TME2 2JE7A 3V0AB 1GBGA 5GLZA 5A3LA 3VHNA 3H8UA 1RTVA 4ATFA 4YG0A 1WD4A 1RUH1 1NQJA 4RS5A 4EROA 2RJKA 1DF0A 5FOBB 5J98B 1Y43B 4CDXA 1BCXA 3ELNA 4YVWC 5J3UA 2C5DA 1MZ6A 3D82A 2YPJA 2CGOA 4CEYA 1KXGA 3BIWE 3WINE 1Y9QA 3B9IA 2XHKA 2A3XA 5KC5A 1AYN2 5H9SA 2F4PA 4FPJA 1CN1A 4JVAA 4FVVA 1QQP3 1SBDA 2ZX1A 4A7KA 1PZ8A 2NZ9A 4S2GA 5BNPA 5DG1A 5E1RA 5GLWA 4META 3MIDA 3ZYGA 2RMU3 4WM8A 2Z79A 1POV3 2AENA 1AX1A 1S1AA 4IV3C 1VBA3 3WW3A 4BM8A 1IPKA 4ASLA 1RUJ1 1JUIA 1EAH1 1A6CA 1PNGA 1U5ZA 1DQ0A 2VPVA 5T50A 1J1TA 1UCXA 3WR0A 4HKLA 1DQ6A 2Q5TA 4AHZA 4GB33 2B9UA 3TN91 4K9SA 2ET7A 1VR3A 5CADA 4C1XA 1POV1 2K0GA 4P5HA 5EWSA 3RS6A 2I07B 1AJKA 5AFBA 2UWCA 5BUVA 1UPIA 3JBG3 3NWKA 1C57A 4YLZA 5KC6A 5JSOA 5BNNC 4P9JA 2WKKA 3RYPA 1J3RA 4F7ZA 1NZCA 3UKNA 4QQHA 2YMZA 4A7YA 2ZX0A 1LHNA 1V6MA 4Q4X2 1FV2A 3SISA 3WXPA 2DVFA 3B3QE 4E2GA 4Q4Y3 3NKGA 1PO21 2X53S 3JBG1 2XLFA 3ASIA 2ZGRA 1AR92 1DHKB 1VRH3 4QD2A 1R091 2Z2SB 3IWZA 3N36A 1RUG2 4N7IA 2DU1A 4AHXA 2D3RA 2NP0A 3VBSB 4I3GA 1VBD2 4XZPA 1XNCA 2MEV2 1T6GC 1ND3C 1SLIA 3ROUA 2DCKA 4E27A 3I59B 5CFCC 1CAVB 1S2KA 1LHWA 5B2GB 1LCLA 4AVAA 3D0JA 4EV0A 1UAIA 1F5FA 1W6QB 3ZPYA 2A73B 5CFDC 4Z8BA 1D4M2 3E5XA 4S2HA 3B69A 2VW1A 2DVDA 2W52A 1RUD2 3UJQA 4D7TA 3TOJA 2ZGNA 4Z92B 3ZO0B 1AX0A 4LBOA 1OLQA 1REDA 5KHKA 3IKWA 1LOBA 2RS11 2VULA 3KD4A 1AX2A 4CDQC 4QPYA 4WM7A 2BNOA 3VBOC 1NY72 3POWA 2O8OA 1HQLA 4J1XA 4DNYA 5AFEA 4C90A 4IEUA 4WV8A 2HWF2 5HCFA 4HKOA 1B09A 3B02A 1ONAA 2BFUS 1Q56A 4NHMA 5HXVA 3WUCA 4X8PA 2XVLA 1Q8SA 1PK6C 5DUUA 4CDWC 2XLGA 4LE3A 3GNEA 2QDRA 2FMYA 2GSYA 2WNUB 4PBPA 4QXKA 5KHHA 1ASJ3 3I7DA 2PHUA 1CD3G 1LHOA 2X5IB 5E16A 3SH4A 3KS7A 4SLIA 2HEVF 2WZR3 1GKBA 3CO2A 2ILMA 4WVWA 4XILA 3VBFA 1QJX3 4GH4C 4OUMA 5EZWA 3WUDA 4W6XA 3AP4A 4TYSA 1MZ5A 4LBMA 2GC0A 4LLFA 4XFBA 2ZZQA 1LHUA 1WW6A 3ECQA 1RUF2 3M3QA 4LULA 4YGBA 1AHSA 2DYCA 1NCQC 2BTVC 4AFDA 4M01A 3ES4A 4QQOA 1ASJ1 4HKWA 1F31A 4P9XA 3OD0A 2NYYA 5T55A 4QPIC 1QJX1 3WLUA 3KT4A 4NWWA 3MGUA 4Q1PA 4Y26A 5F6KA 4AG4A 1O4ZA 2JE9A 5C8CB 2Q30A 3KT1A 1QH7A 2BVVA 2G9FA 1BQPA 1MEC1 5JR7B 2VXRA 4U2AA 1RB8G 1PVC1 3AZWA 4XFIA 1PZ9A 3N3HA 4YVSB 2ZAAA 3AKSA 3DPRC 5L7OA 3NW4A 3VHRA 3R4DB 4B29A 4N43B 4AXOA 3CU7A 2JG8C 2XLAA 2RS33 1YNAA 4QPGB 4H7MA 4XW3A 1GLHA 2FZ2A 2IZWA 4GMP0 4XF0A 4HSLA 5DXDA 2XBO3 1SCRA 5FOJB 1C3HA 5A33B 3UKVA 5JOXA 1ZRFA 4XTPA 3LA3A 1LKNA 1DBNA 1ZBA1 5CVRA 1DGRN 2FHRA 1XU1A 4ZKTB 1UX6A 1HXS3 4IV1A 4AFCA 1JN2P 4AI2A 2N7GA 3RI9A 5BY5A 1SQ4A 1VBB2 5K0UC 4IEWA 5EFUA 5D8AA 1X33A 4A2UA 5KXEA 5JPNB 1GFF2 1I5ZA 2HEYF 2KA3A 1YFXA 4FOWA 1M4WA 1ZA4A 3VV1A 4XQWA 4I0WB 1JH5A 2LUWA 5DZGA 2CTVA 2D3PA 1AL21 3WX5A 4I0BA 3ZSMA 2ZMKA 2IFWA 1XYPA 1XYNA 2E7TA 1BMV2 1RJ7A 1W6PA 3RMYA 4RS5C 2JD4A 5LEKA 3AYDA 1O3TA 2PTMA 2SBAA 5JWPA 3OY8B 2UYBA 4I09A 4TWTA 2DCTA 2UY9A 2DCJA 4HN1A 1QGLA 3HT1A 1V6KA 4QQPA 1QXJA 3B94A 1QXPA 4ASMB 1GNHA 2YGMA 1WLDA 3IM0A 2WIIB 4CEYC 2GMEA 3RZZA 1SLBA 3AYAA 3E6DA 4WZFA 1KDMA 1UIKA 1IOAA 1ULEA 2B42B 3KMHA 4Q2FA 1AYN3 2ZJCA 1IS6A 1DGLA 5FDBA 4EN0A 1UW8A 1C8M2 3PNAA 3VHPA 4XFCA 1E57A 5E88A 1PO12 4AHWA 2EXHA 4FBFA 4OHXA 2DCYA 2HWB2 4DINB 5BNPC 3WV6A 3N7LA 4YARA 1S2BA 3AP6A 4HZFA 4UBHA 3APBA 4HANA 3S6PA 4N53A 3MDPA 3ZFFA 2I2SA 3VZOA 1IZ3A 1QDCA 3MI8A 1ZYBA 3NAPB 5FO8B 4RR3B 1R1ZA 4Y20A 1KDKA 5KXBA 2PFWA 4GMP3 5BNQA 1QJY2 4LO8A 4MUVA 3RYKA 4XPVA 5GZCA 2C1FA 1HDKA 1O3SA 1WBFA 3ALQA 3MZHA 1W39A 3WDWA 2CAUA 1LGBA 2GALA 1S0EA 3IMNA 2ZOEB 2BNMA 4RGGA 1CJDA 1CR7A 1V6OA 4QGNA 2R063 3AK0A 1QXRA 1RMU3 4ZU5A 4AEKA 3FLTA 1IHMA 4N9IA 1JYCA 5T3NA 1G9CA 4UXAA 4XQ4A 4OHZA 2GC1A 3QH6A 4YGDA 3WOGA 5HCBA 1S0GA 1W6MA 2VY0A 4OHWA 4EWDA 2A3YA 1FPN3 1MZFA 2VU9A 2WA4A 2XG3A 4FXKB 5F6LB 1Y3TA 3BOPA 4Y22B 3WVJA 1GANA 2V73A 5IK4A 4JTOA 1UD1A 3PMSA 1AUYA 3IDEA 1RUG3 4LR4A 3MIEA 1SFNA 2R16A 3BOWA 4YYOA 4OI2A 4K6BA 4COUA 1GZWB 1R083 2R073 1CAWA 2ZKLA 1YFUA 2MEV3 1RUJ2 2PA7A 3U11A 3VKMA 2BNNA 4MXWB 2Y26A 2P2KA 3R05A 5BYNA 4G4FA 1WD3A 4DRVA 4Q4V2 1NCRA 2QVSB 2WT0A 4E9KA 2XUMA 3E6CC 3L2YA 1HW5A 3DUIA 1MZEA 3LA7A 1CJPA 4JDMA 4L8QA 3IPVB 3AZXA 1OQ1A 4FPKA 4XJWA 3G7DA 3DGTA 4NHLA 4L97A 1RUI1 1R081 4JCKA 3JU9A 1ULCA 1UKRA 2P37A 1A8MA 2B8MA 4XFAA 1XNBA 3AX4A 2R49A 1GZCA 5T5OA 1O5UA 5FMOL 1ZREA 1ZBE3 3GHNA 2XJSA 3FZ3A 4M0HA 2RHPA 1D0HA 2HWC1 2Z69A 4XYXA 1EPWA 3ZXFA 3FUQA 3H1YA 5C4WB 4XTMA 1PO22 3B93A 4JGYA 3W9AA 4SBVA 3EXUA 5DUWA 1R092 1V6LA 1SLCA 1U5YA 3VBFC 1B35B 2WSUA 3VDDA 4XBNA 3MW2A 2ES3A 1GQHA 5H9RA 4R52A 4PBOA 2A5ZA 4AF9A 1RUF3 4I3PA 4C1WA 1UKGA 2ZZJA 4CDUA 4IQPA 1PVXA 3JUUA 4K1ZA 4A3XA 1G9BA 2ZHMA 3O7OA 1TE1B 2LTNA 2QE3A 4RHV3 4H7LA 2FQPA 1C1LA 3BTAA 1QKQA 3ZIXA 1FMD3 3VBHA 3I4IA 2ETEA 1UF2C 4E2QA 1ZX5A 2RS12 4LBLA 2Z5WA 1CPMA 2IFRA 4AEMA 4ONUA 3S7EA 4COWA 3VBOA 4HVOA 1OOPA 2O1QA 1LR5A 5GLVA 5CG8A 2E63A 4BCUA 1I6XA 2WZPP 5DZFA 3RWNA 4IESA 1S0BA 2D40A 4JDNA 2DUQA 2P34A 4Q26A 4RHV1 2I45A 3FX3A 5CAZA 1DZRA 1KQRA 3AYCA 5L7OC 3GZTB 1LU2A 3TNPB 4FAGA 1KITA 1LENA 3WDUA 5C9AC 4XF1A 1ND2B 1X7NA 4BLJA 4GKXA 3X29B 3ZN4A 2QJVA 4K7JA 4AEDC 4KWJA 1AZDA 1GR3A 4GALA 4KNCA 4EN9B 3WP4A 2QKDA 4FTSA 3S7IA 4IV1C 2MHFA 4FQZA 3S0MA 1QDOA 2RJLA 2D6OX 1GV9A 2DUOA 2WFF1 5GKAC 1RHI2 4W6YA 3WG4A 3PJQA 1CESA 5K7PA 5D8AC 2V09A 3U0ZA 2K9ZA 2ARXA 2R0FA 4MYEA 4OI4A 5BNNB 3E6BA 1ZZ6A 3OJBA 1NG0A 4MV2A 1QNWA 2OZ6A 3T1LA 1VBC3 2XKOA 4AFAA 1IGOA 3JQWA 5K9YA 2OYZA 2H6BA 3K48A 1MEC2 3WT3A 4GXLA 3PJYA 1BBT3 2BUKA 3FWEA 2ZACA 3MICA 1ZZ7A 1FXZA 3FFQA 3MPBA 2GC2A 4F83A 4FPLA 4LT5A 2PAEA 1L3JA 1RITA 4IEXA 2ZHLA 2CGNA 4HLTA 2YY1A 4M0NA 4M3CA 1EPZA 2Q1ZB 2PAMA 1Z7S3 2B45X 4AI8A 2CV6A 1VAKA 5A32B 2UYAA 1PIV1 2CNAA 4QM9A 4DQAA 4F8AA 1ND3B 3DV8A 1QJZA 2ARBA 5CFCB 1QJU3 2XPJA 1WMDA 4KGGA 1BBT1 5F1RA 1ZBA2 1RUC3 1W0OA 1ZVFA 3WW1A 4BOWA 5CFDB 3SH5A 3J8F2 4XJUA 2WQZC 4IEYA 4LLOA 5K0UA 4AWDA 1RJ8A 4ITCA 4N53C 4EWEA 3ZFFC 3MIHA 4NWVA 2TNFA 2TEPA 3QD6A 4H3WA 4XFHA 4LHLA 3LZZA 5J48A 1X8MA 4YZ3A 1J1LA 3VKLA 1AXKA 4N7UA 2PHLA 5JI7A 1BEV3 2WL1A 3Q9OA 5FPZA 1RUC1 1N1VA 1Q8OA 1FOD2 4YZ1A 4BWOA 1RUE2 1MVQA 4J1WA 2GMMA 4FCAA 2PYTA 3CEWA 2IXCA 4KWKA 4FPCA 4WVMA 4CDWB 4YFWA 4Z1VA 3SMHA 1AYM3 1BJQA 5C8WA 3FLPA 4QU2A 4E4DX 1MVEA 3QCWA 1YWKA 5KWRA 3IDCB 2Q0AA 3VBSA 4XMIA 4XJ8A 2HWD3 1BEV1 2XJTA 5FLHA 2CGPA 2F6BA 3CJIB 4Z07A 3IDBB 4GH4B 2P3IA 1XXNA 1YIFA 4YNIA 2NMOA 4NVPA 5T52A 1H9PA 2B39A 5I8SA 5AC93 1W6QA 1S0FA 3VBUA 4TZDA 2WT2A 3H1WA 4Q4W2 1VBE2 1QMJA 5L36A 1ENXA 1LOEA 2E51A 3ZFEB 1AR72 1LU1A 1SDWA 4BH9A 4RQPA 3P3PA 3E5UA 4S2DA 4BE3A 1YXWA 5EXOA 2CL2A 1DQ1A 2HWD1 4JGZA 4QPIB 4YW5A 4Y1VA 4X6QB 2HWE2 5DDJ2 2PLV3 2ZHKA 3MF9A 4XFFA 3S30A 1WW4A 5GLUA 3SXWA 1OSGA 5AC91 1DQ2A 4L2NA 3ZIWA