2VMJA

Type 1 copper-binding loop of nitrite reductase mutant: 130- capegmvpwhvvsgm-144 to 130-ctphpfm-136
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
326
structure length
326
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCTPHPFMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title The Importance of the Long Type 1 Copper-Binding Loop of Nitrite Reductase for Structure and Function.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Oxidoreductase
total genus 83
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vmjA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vmjA02
2P80A 1WA1X 3C75A 1MG2C 2A3TA 4E9VA 1AZRA 2QDVA 2BHFA 2FT8A 2BZCA 1AANA 1OE2A 2PPEA 2GB2A 4AZUA 2XUWA 5I6NA 4GP8B 5AKRA 4WTQA 5B3SB 1CC3A 1J5DA 2OV0A 1M56B 2FWLB 3AG2B 3BQVA 3CVDA 3H4HA 4FAAB 3MX0B 4YSRA 1JZEA 4HCIA 4A66A 1ADWA 3FYIB 4DP6X 5B7MA 1NTDA 3CVBA 1PZCA 1A4CA 3QJRB 1AZBA 2QPDB 2EIKB 1FFTB 1A65A 3GDCA 3T9WA 5AFAA 2UXVA 1YLBB 1AG6A 1JXFA 3S8GB 4YSSA 2VW6A 2MRYA 3WNJA 3X1EA 2YAFA 3CDZA 1NIDA 4DPAX 4UAHA 1RZPA 1HAWA 1SFDA 4K9JA 1SJMA 1J9RA 2XX0A 3UABA 4G7QB 1I53A 1BYPA 2W8CA 4A2GA 1SFHA 5I6MA 2P80D 1WA0X 2DY2A 1ASOA 2PCFA 2UXFA 3UADA 1AZCA 1ET8A 1CUOA 3CZUB 4KO5A 4FA7B 1PNCA 2ZWNA 1IC0A 2IDTA 4A2EA 3T6ZA 3AW5A 2PPFA 1NIEA 1BYOA 3OMIB 2QDWA 5PCYA 5AZUA 3DTUB 2FNWA 3QQXA 3IE9A 4AX3A 1ZPUA 2HX9A 4BWTA 4CSPA 1SDDB 2CALA 2BP8B 1PNDA 1PZBA 3PLYA 2YXWA 3OQRA 2LLNA 1JZFA 4RH4A 4QLWA 3FSVA 5I26A 1ETJA 2CJ3A 2QPEB 5I6LA 1JZHA 1PLAA 3OD3A 1AQ8A 2IDQA 2IDSA 2WSDA 3EH3B 1JOIA 3FQ2A 2EILB 2XV0A 2XXFA 1AR1B 4E9WA 4GYBA 3OM3B 2IDFA 3DIVA 2PP8A 1NIFA 4G70B 1BXAA 4BXVA 2JXMA 2J5WA 1A3ZA 1CURA 1NIBA 1OE1A 4E9YA 1WS8A 2JFCA 1V55B 2B08A 1GYCA 3V9CA 4F7KA 3TBBA 3ERXA 1SHWA 1EHKB 4G7RB 4GP4B 4JHUA 1XB8A 4DP4X 1KCBA 2XX1A 2N0MA 2PP9A 5B1BB 2BP8A 3UACA 3WI9A 1GS7A 1J5CA 1KDIA 1WS7A 3NSFA 1JXDA 1J9TA 1QLEB 2IWEA 1UATA 1EZLA 1VLXA 2RACA 3EF4A 1ET5A 4KO7A 3UAAA 4E9SA 4TXVB 3FSZA 3V9EA 1JZGA 1SHXA 3CDZB 3FU7A 3S8FB 8PAZA 5F7AA 5IY5B 2DWSA 1HFUA 4HHWA 3DKHA 2Y1AA 2CCWA 1MZZA 4A67A 2XWZA 4HCGA 1TU2A 3SBQA 3NYKA 3PAVA 3T71A 3ZBMA 3T6XA 1SF3A 1SNRA 2XVBA 4GXFA 1NICA 4YSTA 3NP4A 4DP8X 1KV7A 3AG4B 4NAJA 2AFNA 2VSMB 2FT7A 2HRHA 2VMJA 5I6PA 1IKOP 1X9UA 2BW4A 1GY1A 1MDAA 7PCYA 2GSMB 5B1JC 2YAHA 2AZAA 4BDVB 2BWIA 3S3BB 4UANA 1KDJA 3WNIA 1ILSA 2YAMA 4W1TA 2FTAA 3BVDB 2FQGA 2VM4A 1J9QA 1IUZA 1PLBA 1HAUA 1DZ0A 1L9TA 2PPCA 2BWDA 1NDTA 1OCZB 4KNUA 2YXVA 1NWOA 2WO3B 1T5KA 2DWTA 1BAWA 2YARA 2FQDA 4DP7X 4A68A 1KBWA 2WO2B 3S3CB 4M4RB 2GC4C 1AG0A 1QNIA 1PLCA 1WAEA 5D4HA 2NRDA 3KW7A 3SQRA 3T6VA 3ZIYA 1E65A 2PPDA 4DP1X 2J57A 1KBVA 3AY2A 1PY0A 3NJGA 1ZDQA 3OMNB 3X1NA 1L9PA 4KOBA 1GS8A 1ASQA 4G7SB 4YSAA 1QHQA 2ZOOA 1ASPA 4BDVA 3WKPA 4E9RA 2H5UA 2HX8A 3ABLB 5FC9A 1ZIAA 4HZ1A 1AACA 5B1AB 2ZONA 2GI0A 4ENZA 3FS9A 3ASNB 4UF7C 3WG7B 4G71B 1BQ5A 2DYRB 3NJIA 5E9NA 2I7OA 3QJSB 3U25A 2HZHA 1AZUA 1SF5A 4KNSA 1W6LA 4JHVA 1PMYA 2TSBA 1M57B 3FU7B 1PAZA 4YSPA 4DP9X 3TBCA 1BEXA 1OV8A 4DPCX 3IN2A 4A2HA 1TEFA 4YL4A 4GY4A 5I6OA 4Q89A 2YAPA 2J55A 3NT0A 4BXSV 3FQYA 2XV2A 3JT2A 2QT6A 1ILUA 1GSKA 2IH9A 2GBAA 5B1JA 2X87A 4HIPA 3FT0A 1OOWA 1KYAA 3SBRA 1KCWA 2HLEB 1ZDSA 2UX7A 9PCYA 3TA4D 1ZIBA 2PPAA 4KO6A 3AZUA 2Q9OA 2Q5BA 1JVLA 2GC7C 2YAEA 1M9WA 1ZV2A 2AZUA 1E30A 3FU8A 2VW4A 1KGYE 3ASOB 2VW7A 4AI7A 4F2EA 3HEIB 4DP0X 1BXUA 3FPXA 1A4AA 3ABGA 2IH8A 3PAUA 1E5YA 2HRGA 1RKRA 3FYEB 3L45A 1GR7A 3TU6A 1URIA 2GIMA 1W6WA 3GYRA 2R7EB 2FQEA 3QPKA 1OCRB 1OF0A 3WIAA 3QJUB 1AIZA 2PP7A 4MFHA 2BP0A 3T6WA 4DPBX 3UAEA 1N70A 4A2FA 3H56A 3IEAA 1NIAA 1L9OA 1L9RA 2CBPA 3OMAB 2FJSA 1GW0A 3ABKB 3NJFA 4YSEA 3X1FA 1JXGA 1V54B 2X88A 3ZX1A 4HAKA 4A2DA 2I85A 3N55A 5I6KA 1J9SA 4YSDA 4E9QA 4X4KA 3FU9A 1AOZA 1FWXA 2HXAA 2XV3A 2XYBA 5I5MA 3GXUB 2JKWA 1BQKA 4HALA 3NJHA 2XU9A 1TEGA 5EHFA 2J56A 1JZIA 4DP2X 1JVOA 2FT6A 2H3XC 1AS8A 1B3IA 2PLTA 4DP5X 3X2QB 4JKNA 3PCYA 4L0PB 1XB6A 3NJMA 4YSCA 1FA4A 2MTAA 2UXTA 4KO9A 2EIJB 2R7EA 1ET7A 1R1CA 4BK5C 4YSUA 3MBWB 2IWKA 3CG8A 3NSDA 1OCOB 2Y69B 2B3IA 1RZQA 2YAQA 3PAZA 1PZAA 2I7SA 3EH4B 5PAZA 3ZDWA 3EHBB 1WA2X 1OCCB 4ZK8A 4N4YB 5ANHA 3TASA 3IN0A 2AANA 3UGEA 1NZRA 2EINB 2IWFA 3AG1B 4GP5B 4P5SA 2E86A 1V10A 3WKQA 3FPYA 4AKQA 2XXGA 3AG3B 3FSAA 2H47C 1IBYA 2W88A 4WKXA 3NSYA 1ID2A 1RCYA 1X9RA 2TSAA 1JZJA 3FQ1A 5B7FA 5I5JA 2ZXWB 1AS6A 5B1KA 3RYMA 4KNTA 1NINA 2VSKB 3ABMB 1CYWA 3NP3A 5D4IA 4AKOA 1IBZA 1NWPA 3FSWA 1BXVA 2BO0A 1AAJA 1PF3A 1NPJA 1E5ZA 4BWUA 2BZ7A 4E9XA 3SBPA 1F56A 5D4JA 5I5IA 1W8EA 5F7BA 1MZYA 1CYXA 1N68A 3KW8A 3N2JA 6PCYA 4Q8BA 3HB3B 4E9TA 1GY2A 1OE3A 2IAAC 2IDUA 4BWWA 4F2FA 4YSQA 3H4FA 1E67A 2BP0B 2DYSB 4YSOA 2BW5A 5B7EA 4EF3A 3IBOA 3QJQB 3JTBA 2VN3A 1AS7A 3PXLA 2YQBA 4YVUA 3X1GA 4M3HA 3CVCA 2YAOA 3D12B 1XMEB 1GS6X 3NJKA 3NJNA 4AKPA 1PCSA 2UX6A 5TK4A 4HCFA 1MG3C 4CSZA 1L9QA 2XLLA 7PAZA 3G5WA 2CAKA 1L9SA 4N8UA 3S3DB 2HX7A 2GHZA 1AZNA 3EH5B 2FQFA 4NB7A 5A7EA 4W9ZA 2OJ1A 1DYZA 3QJTB 1XB3A 1A4BA 2EIMB 4P5RA 1SDDA 4PAZA 3NJLA 3NJJA 3QJVB 1TKWA 2AVFA 2DV6A 1BQRA 2CUAA 3NSCA 5I28A 5LDUA 4G72B 2VM3A 6PAZA 4KOCA 2PCYA 4NERA 3X1BA 4PCYA 4HHGA 4YVNA 4QKTA 5TK2A 3PPSA 1NPNA 1A8ZA 1JERA 2UXGA 2OCCB
chains in the Genus database with same CATH superfamily
3F83A 3N91A 3MFFB 5IFJA 5D5MB 5BRZD 5DUBA 4E9VA 5AW8B 2AXGB 4LLDB 1AP2B 5I2IA 5C8JA 4WRLA 5JHDD 1T22B 4Y4FB 3MMEB 4JM2A 4FFTA 2Q20A 2GHWB 4XMUA 1FLRL 3QUHA 2QKSA 1BF2A 2QPUA 4CRPA 5E1QA 5L9DH 2QVFB 1OSZA 3GHEH 3S36X 4PHZA 4LMQE 4LNRA 4ZMZA 4YSRA 2UV3A 2YBRB 2OMWA 1KUMA 4P9HL 2X44D 3ZTNH 1UD4A 4LOUD 1PZCA 4XOEA 2WLKA 1QZ1A 2EIKB 4IK6A 3OC8A 1B9ZA 5IK3B 4EXPX 5LAPA 1MWAB 1IL1A 1RK1A 5DMIL 4ZBJA 3QHZH 5DT1L 4JK0D 3OKYA 4YH6A 1DJIA 1DJGA 5FO9A 3SE8H 2ZXEB 3NQIA 3VH8B 4F15B 1L6ZA 2F6AA 5IQMA 2PO6C 2M1KA 1A1MB 1VENA 1BVOA 1C1EL 1XGRA 4OY9A 4EEEA 3GD1C 3RIFF 1R9FA 1HE8A 2P80D 3VFOA 2LW3A 5TGBB 4U4IA 1OQOA 5CJQL 1RZGA 2DLGA 1CUOA 4H4NA 2A9CA 1JZ5A 4HEMA 4JJHA 1PKQA 4HIEA 3L3GB 2DOCA 3RWEB 5KJRH 3QQ3B 3OTTA 4BCXA 3QQ9C 3O4LB 5JOFA 2OMTA 2V5SA 3EAKA 2D7TL 2WM0A 2NXZC 4HJ1A 2VDPB 3CD4A 5EEWA 4AQ1A 1CGSL 3BW9A 4S1SH 3I3BA 3SY0A 1JGVH 1K8IB 1QATA 2W07B 4BH7A 4TLSA 4Y9FA 3MCKA 3AWFA 4ZS6D 3KPOB 1Q9LA 4BWTA 2VR9A 3K6SB 4OR1A 4LPUA 3TBTA 2DJSA 4WDIB 2HRPH 3I50L 1N0XH 4G8GE 1MIEH 4J3SA 2IPTH 4K8RH 2JJVA 4JX0A 4CJ0A 4WGKA 2C4XA 4HBCH 1N12A 3NZHL 3H6JA 3QHFH 3CK0L 4P57B 3GJFB 1IGJB 1DSWA 2WYTA 1ZLWK 2ITEA 4PG9B 4PJ5E 4DH2A 1RLBA 3PGFL 1BXAA 1BVNT 3L3DB 3HZMB 2B08A 4PJ9D 2NDGA 5DD6A 5KZCB 1QBLH 1ULVA 3ERXA 4R96B 2QGEA 2NY5L 1PDKB 5C0GA 4P4RA 3CLFL 2LE9A 1ZHKB 3KCPB 5JUEH 3VX0A 4OLYL 1FZMB 1XB8A 2QSQA 4Z7WE 5FCUL 4JFVA 1HQ4B 1MW2A 4HS8H 1ZSDA 6FABH 5IWLC 4S1QL 3Q1SL 2E3VA 1JHTB 1VAHA 4DK5A 1R24A 2LVCA 1T5XA 4NKQB 3QYMA 5CZVL 5J6HA 1C08A 1FO0L 3RGVB 5KBNC 1UFGA 4R83A 1QVOB 1A5FL 2XG4B 2R39A 3HTLX 4XWOD 2NXYB 3EH2A 2IWEA 4D0DA 2PO6A 1AZVA 4N0RA 5EEZA 5DZJA 3DI3B 3HI1A 3FRUB 2NY7L 3VXTA 2BWQA 2VC2L 3QDGE 3TEWA 1VZGA 3HHSA 5I16B 1A7NH 3EBHA 1FZKB 5F7AA 3WTWA 3WFCH 4FA6A 1U58B 2ZD0A 3CN0A 3DV6B 3RY6C 2CR3A 2J1YA 2OX5B 5E5MB 5H94A 5HDQH 3DARA 3FKUS 2HG5B 5A2IH 4JFUA 4PWGA 1GGBL 4NI6A 3RJQB 4PV9B 5EO9A 4P5TB 3SDCB 3E6FA 2XVBA 1I3RB 3DYMA 3MLRH 3HLAB 4J8RA 3U36A 1LMIA 3QIBD 3QXTA 2AERT 2J1WA 4L0ZA 1I7ZA 2H26B 4JFEB 4HLEA 3A0OA 3BKMH 3LAFA 1WWBX 5FHBH 5E4OA 1IKOP 3HPJA 4B9CA 5CIPH 3C8KA 2X53A 2YR3A 2D0HA 4FL4B 4JREB 1D6VL 3VXNB 1KDJA 3HE6B 2C7UB 2WCPA 4DGYL 5CN2A 3T3MF 3TYFA 4KUCD 3ZO9A 2N3JA 2BK8A 4L8BB 1YQ2A 2F74A 1XGQA 3DJTA 4EI5B 4JMNA 1JWMB 3VD9A 2BWDA 1CE1H 3PAYA 3S3PA 2HKAA 5DFAA 4NUGH 3WHE1 5G4NA 2PW1A 1EO8L 1N2RB 3QG6B 4D94A 3SODB 2LV4A 3QRGH 1H8NA 5E9AA 2OULB 5IW6B 4IBUA 3FFDA 2XWJB 2I32A 1CFVH 1P69B 3U2JA 5DD1H 4PVMA 3NZSA 3UBXB 1V7MH 2GY5A 4LLVA 5KSUB 4A6YL 5GS0L 3T8MA 3N1FC 4WJKB 5IWLA 3QUYC 3MRCA 1NCCL 2HVKA 4KZ0A 1JSYA 5LJYH 2F53E 5F3HB 5IREA 1CDCA 3IAPA 2RCSH 3QIUC 4PRDB 1OKEA 3WKPA 2W9LA 4U1GB 4GKSA 1RZIA 2JMRA 4NN7B 4B0MM 4NO0A 4EN3C 2KLTA 3VJ6B 4W9HC 2GI0A 2R2BA 4JN1L 4U1KA 4NQEE 4P9ML 1T2XA 4O5LL 3P1VA 3L3JB 4FRWA 4I3GA 4AGOA 3RY6A 1YEFH 2JCCE 4K9EC 2YPKB 1WISA 3P9MA 4Q2ZA 4RRPA 3WOVA 3VA2C 1CGVA 3E8VA 3CH1B 2A4EA 2E9WA 4HPYL 4DPCX 4YDNA 1UZ8A 2O5XL 4YL4A 4Q89A 2AV7A 3LKNB 1SN5A 1GPOL 1JRHL 2C1PA 4TVSa 5DFVC 5E2WH 3Q8EA 4MNQB 2LU5A 3QUMB 1J8RA 1WAAF 3UPRB 5IM7A 2ZUQB 1S9YB 2YD4A 4MZIA 3PL6D 2YOCA 2XACC 3B5GA 2FIKA 4X98A 3EYVB 2DIEA 1F1DA 3SBRA 2X41A 4N3UA 1CDBA 3V79C 1R3LA 1XCXA 1ZV9A 2UX7A 2ZZUT 3UTTB 1YNTA 3LEXB 3HNTL 4JDVA 4GMTH 2WOBA 3MGTA 4OLEA 4YLBA 2E27H 5C0JA 2AK4E 3RWIA 4PBVC 2WZ5A 2ZCKL 4ZMAT 1H0DB 3FT2B 2Q8BL 3P0YH 4H13C 1UEMA 4JFHD 4AI7A 1KGYE 5J6SA 3CCHB 4UT9H 4WTZA 2G3NA 4GRMA 4ZFZA 1KGXA 2ZPKH 2XG5B 4HUUA 3L45A 4K7PX 1ZLSL 5HYJB 5IHZB 1AGEB 1URIA 2R0ZH 3D6GA 3QPXH 3F58H 3QPKA 2OJZH 2P5EA 1KF9B 1FDLH 2ZOTA 3S3JA 1W15A 5ALCL 1RZKL 1TTCA 5IHHA 2ZXCA 2IV8A 5D2NA 5BXFA 1G5GA 3CZFA 2CBPA 5CWSB 3QUYA 3RNQB 5I0WA 1UM5L 4I9WD 3QUZC 5EMYA 4B9YA 4R97C 3QIUA 1ONQB 3LKSB 4POUB 5IMOA 5F7EL 1Z0MA 3ZTJH 3MUGB 1MFDL 4NKOB 4XXDB 4E9QA 2RMNA 2WQSA 4GNKB 4EN3A 3FO2A 5I1LA 4AYFB 1QHPA 3P73A 2CUMA 3RFZC 1TEGA 3L5XH 1JZIA 1QBBA 1SXZA 3EJRA 3NPZB 1VIWA 2WXGA 1X3DA 4OCXH 3HN5A 4UAOB 2ZUSA 1I8IA 2PXYB 2PLTA 2R1WA 3ZRSA 1IC4L 3GEWB 1F90H 2ZCLL 1V7NL 1XSIA 1D5MA 1S7TB 3BAWA 4UIMB 4KJPD 1KXTB 4BQ6A 2IWKA 1MJJB 4LU5L 3AY4C 3WIIH 5CLYA 4PBWD 1M7IB 1AE6H 1NCDL 2C3VB 3EHBB 2DH3A 3BSZH 3OG6B 3SY6A 1E6JL 2ARJA 4OZIA 2EC9U 2WW8A 2ZOWA 2YKLH 1E27B 2UY6A 4RDBA 4XCEB 4AKQA 2BCKA 2XXGA 5F9OL 1IC5L 3ARDB 2G3XA 4WWOA 5MENB 4N0CD 4XODA 3TH3T 4G9FE 1KBPA 1XFPA 2H4EA 4XC3H 5I74B 1YSOA 2Q7YB 2GEQA 1RCYA 4WJ5B 5F0MB 4N8PA 4WO4B 3HIZA 1YNKL 1FBIL 5IESH 1XXDC 4HH9B 3O3UN 1JHLH 1NINA 3FO1B 4OGZA 1HE7A 4G6JL 4O9HL 4OFYA 3TT3H 4M1GH 3IF1A 5DD0H 4ZMWA 4KTEH 2N56A 4ZW5A 4EVNA 4HJEA 2JKRM 3DOSB 1MN4A 1KIQB 1A1OA 2P47B 2BS9A 1AO7D 3F7YB 4GT7A 5HHME 4FEMA 1Z2KA 4JFXA 4NUJA 5DRZB 5BV7L 4GKZB 5I5IA 1MFAL 1MCLA 3HNSL 4J1UA 5HJGA 5JPNB 1N68A 1RUKH 3OG4B 3VD2A 5EPMA 5FYKD 1JV5B 3VMPA 4Q8BA 2GTWB 2IDUA 3QUZA 5JNYA 4X6BB 4XNQB 3HZYB 3WENA 3IJ8A 3CFJB 2H2SD 4DOHE 4E5XB 4AVHA 2D03H 5IB1B 4FQXB 1QEWA 2GABA 2GQHA 1J10A 3GXFA 5E7BA 4JRFA 1Y0LB 2OTUB 3MODL 4N68A 1FPTH 3RFZA 4K7FA 3D8MA 1FE8H 2AGJL 1G7MA 4AG4H 1HXMB 1B0RA 1BAFH 3N40P 4AK1A 3KM1A 3N3EA 2R8SH 1WTLA 3EJYC 1IC7H 3V6ZB 3B9KC 1JFQL 1KB5A 2WNXA 5SWQA 1UWXK 3KJ6L 5FYLH 2XLLA 3AS2A 5GISL 3KWUA 1Q1PA 5LDSA 3I2CL 1L9SA 4M7LH 2JIXA 3C2AH 4L8CB 3AY4A 2FL5B 2BVOA 3EJJX 3X12A 2EVIA 1YNTF 1MCNA 1S9VA 1UWFA 3RTQB 2AV1A 3UJIH 5GSRB 3U9UB 7TAAA 4JY5L 2BC4A 4OZFA 4IKJA 2DQTH 1KIRB 4P46D 2ICWJ 4ZTOH 4XX1E 4Z7QB 1DVFC 1CD8A 4L5FH 4QTIH 2OTWA 4J3VA 2R1XB 5GGVH 5TJWK 3UPCA 3PPSA 1A8ZA 2A9BA 3UO1H 2XUWA 3CXFA 4MA1C 5AZEL 4HULB 3FJTA 4NRZA 2YD8A 2B2XH 4ZMLA 5D7JD 4XT1C 4ZUVB 3QEQD 4LNVA 2H6PA 3TIDA 4PM1A 3TWCH 2XQYG 1JK9B 2BVYA 5IIEA 2P5WE 4NQDE 1J5DA 2YD0A 2D9QB 2MPAH 2NZ1A 1VFMA 4YOKA 1HNFA 3WIHH 3V4UL 1TTGA 3NEXA 3VXMD 2XZAL 1JJUA 1T5WA 1A4JA 1BD2E 2OL3H 4CVXA 1FVDB 4MD0B 1ADWA 1DN0B 1XH3A 2DD8L 4POZC 3CZJA 3OJDA 3GZOA 2Y9RT 5DR5L 4BZ1A 1B4RA 5J12C 1ZA6B 1XCTA 2R69L 4ACPA 3RVVD 1H5BC 5MI0B 1XD0A 5EOTA 3TJEH 3F7VA 4X6FB 1KCRL 1A25A 1KN4H 3LZFH 1L0XA 2L7EA 4YXHH 1CLVA 1CF1A 4H0HB 4NPYA 4R26H 3X1EA 4Z8FL 1NIDA 1JGUL 3ILPA 2B9AA 3IMRA 3MREA 2CNZA 3P3TA 4PJ7B 1OAUL 2P8MA 3B9KA 4FD0A 5IQ7L 2NW2A 4G7QB 4K94C 1EEUA 3C5ZC 3ATEA 2V5YA 2TRYA 5DEFB 1JYVA 2DI7A 4OJAA 3VXSE 3V0HA 1IQWH 5FYLD 4NOBA 1M1SA 3LS4L 4NT6A 5GRUH 4LBEB 1RK0B 3DXAD 4O2FB 2XVKA 4P2QA 5E1AA 5HGAB 5BOJA 2PPFA 2BNQE 1DVFA 4OZHE 3QZPA 5PCYA 3BKYL 2X7LB 5DUMH 1KXQA 3S37X 2WUCL 4LVNB 3QISA 2PTTB 3ME0A 1QABA 2HX9A 2XJLA 2EO1A 4HG4J 3WUZA 3S9DB 3ETBJ 2HMID 1FO0B 1LE9A 1DSFL 3P4MB 1VCAA 4HFUL 1QPXA 3MJ9H 4FFYL 4N5UA 4PLKD 1TMQA 5INDA 3BP5B 2KDGA 1PLAA 5I1HL 1NBVH 2XFGB 1A3QA 2A99A 3BPOB 5JIPA 2IFFH 2VC2B 3VG9C 1R5WA 4XMKL 4XGZA 5KVEL 5C0BB 4I3RH 4WWKB 3WUWA 1T80A 3A6CL 2WWKO 4MAYB 2PWHA 2PP8A 3CE1A 3FC8A 4UV4L 2Q2EB 3GLEA 5D4QA 3RHWK 2BVQB 1XF4B 5E51A 1CURA 1LO3L 3T2QA 4CNIA 2J5WA 1VZHA 3GJEB 5DJCB 5ECJE 2KPNA 2BS71 5JA9A 3OLEA 5IROC 1MHCA 4Y89A 4M43L 2EH7L 5H35A 1H5BA 2YSSB 3D2UB 5D96B 1KC5L 4FP8L 4QXTB 2GK0A 2EVFA 1ML0A 4PUBL 4RGNB 3ULUD 3H1ZA 3DX8B 4MA3B 1SUHA 4ZFFA 3MLPA 3GSWA 1SY6L 3C8DA 1GZQB 3NPSC 4J4PC 2IANE 5IBUB 1WS7A 2XZQL 4BM7A 2UUDH 4YQXH 2UZIH 3WFBH 1T6VN 3X3GL 3CNKA 4MA8H 4Y5XC 2QV2A 3QQNA 2DQ6A 4JDEB 5I82A 3C5ZA 5ICYB 3LZRA 3B3IA 4NQQA 4MJ5B 2WN2A 3O0RL 2E6QA 3O8XC 1AQDA 3SO3C 2C9XA 1KIUA 2UZXB 4D0CB 2A2QT 4UCFA 4AM0Q 3KS0H 3L81A 4WNJA 2ZP9A 3BXNA 3ROLB 5L88H 1X5ZA 2Y1AA 5B38G 3U4EB 2FO8A 3U6RA 1SMDA 5AW0B 4IU3B 4JCWA 1Z32X 1JMZA 3WN6A 3IWVA 1UGKA 3VYPA 4AJVA 2YHGA 5EZPA 5F7HA 2PCFB 1VEOA 4GAGH 4YFLF 1MNNA 1CDUA 1EGJA 2ZOLB 3OR7A 2VSDA 4MA7H 5DJXA 4RNRB 1OP3K 4IGBB 4A6YB 2W60A 1A9EB 4QNPF 3FTXA 1EEZA 1MVFA 2R23A 2YUWA 3L4YA 4IRZL 3EYFA 1OW0C 5HDOA 4MD5B 5LNEA 1P2CA 1SBBA 3NGBC 4Y19A 4YGVA 5FDWA 4F33A 4Z7VF 1E8YA 4NKIH 1U93A 3ZHNA 4P3WA 3EO9H 3ZKSD 3GO1H 3BVDB 5AB2A 4XCYA 5H8DA 5AG8A 2WWMC 4KKLC 4RGMB 4DN4L 2H9GA 3MRNB 3B2XA 2PO6D 2VSCA 5FUCC 3T0DA 1T03H 1Q94B 3KGTA 5JW5B 5I18L 3ARPA 4JO4H 3QRLA 2ATKA 1TXKA 2J1KA 1EK3A 1JDCA 4L1SA 5IROA 1FIGL 2OJEA 1BVKB 4BJLA 1V3JA 4B41A 4F9LC 3DSFH 4G2AA 3OKEB 3QQ9D 3RLSA 4L9DA 3RVXC 4JDTL 2NXZD 5C09A 3RBGA 5BZDA 2VLJE 3BKJL 1HXKA 4LSRH 4J4PA 1LP9A 3K6DA 1U6AL 3SE4C 4JHAL 2ZOOA 3MV9A 5EU5A 4Y5XA 5F88A 3BUIA 1E4XH 4LOFA 4GW1B 3NSJA 1KB3A 4U6VH 3NEEA 2Y7QA 3CSYA 1NOAA 3MA9L 3O8XA 5AD0B 4QTHB 5BQDA 3LZNA 1XBDA 2GJRA 4W4OA 3ZMNA 4FCAA 1F13A 3BVTA 1HHHB 4JHVA 3MVSA 5JR1L 2AJXH 1F4XL 2TRHA 2VDRH 1DDTA 1PMYA 4LCYB 2NY2D 1ZEAH 3RWDB 1M2VB 3OZLA 4OFQA 2YQGA 3IN2A 1JPEA 4HX1B 5CN3A 4P5MA 1XCQB 1KBGL 3MR9A 2X1QA 4Q52A 2ADIB 1KLFB 4HKZA 4HP5A 5ACMA 3IPFA 2IH1A 2Q86A 3WTSA 3NCBB 4AEEA 4WV1B 5I6XB 2C3HA 1J0ZA 4OUUB 3NIDF 4H1LB 1OW0A 3U0TA 3UTQB 2VAAB 4Z7VB 2XSKA 1T89C 3DDGA 3QUGA 5DRNB 3QJOA 2Y07H 2CO3A 3W9DA 5B39B 2EKSA 3PWUA 2Q10A 1HHJA 3A24A 1SJHA 1OPGL 3KS0J 5HTSA 3B5TA 2GC7C 1U8IB 4AE1A 2YAEA 2XCMC 5JHLH 4IEFB 5TDOA 1CL7L 1DUYB 3UYPA 4NO0D 2CHNA 3K8KA 4XOCA 1NBCA 3FCSB 1UYWL 1BVNP 2EE2A 2ZCHH 3BDYH 3TTYA 2WLIA 5C0FB 2PKDA 1F58H 5DYFA 1IGYA 1FGVL 3VDCA 4F2MA 1K8DB 1OAYL 1NC4B 4ADGA 2EC9T 4XPHL 1OCRB 4JO3L 3MZGB 3WIAA 4A55A 2C1OB 3RPIB 4F9LA 3ABZA 2BP0A 2YD9A 4GQPH 1KPRB 1U9KA 1M05A 3I9PA 1N3NA 5GGTH 4OSUH 5DVMA 5JW3L 3ABKB 4HISA 2CKBB 1RVFL 4PB0L 4R4BB 4JVPA 5CZRA 2GVYA 3SE4A 1B4JH 1YECL 1A4KA 1B0IA 1KFAL 5F1SA 4E36A 1R75A 5CILH 1P6FA 4Z3GA 3IK2A 2O5YL 4ZW6A 1I1YA 4F7CA 3JYCA 5AVSB 1A7QH 3QG7L 1G7PB 4EIGB 1PYWA 1AMYA 1JVOA 3HW7A 3O3EB 4O2EA 5AYQA 2CRYA 4GW4B 4LZKA 4BH8B 5KSVA 3V6OE 1HHIB 4JKWA 3GXMA 1T1ZA 4M7ZC 4AMKL 4XMZA 4AVKA 5ILTH 3CXHJ 5IV2B 3HA0A 3RG1C 1AGCB 1CFSB 2CM5A 5AOLA 2V4LA 4U0RC 2A6JB 3JXAA 1O7DC 2CO6B 3F7QA 4YDJA 3J27A 4U1HB 1OGAB 1F6AB 4WHYH 2KLRA 3QDJA 4MQ7A 2X4TA 4W9IC 2Y1YA 1T89A 2DQDL 2P5ED 1D7BA 5DHMC 2ARWA 2OYKA 4Y9EA 5DJDA 3TURA 1J1PL 4BE5A 2I24N 4WKZB 4YZFF 3FO0L 3QUYD 4F8LA 2LLGA 1BQHA 2PMZA 1OY3B 3MRDB 3QIUD 5DHEA 1A1NB 3NSYA 4N90D 1X9RA 2QR0B 1ZTXL 4N0YH 5B7FA 3H53A 2Z4TA 4BSWB 5DI8B 3QYCA 5B1KA 3LYRA 4OLVH 1TTFA 3PUUA 4EN3D 5HYQB 4FF9A 1P4BH 3LNGA 4GG8A 1IO4C 2VTFA 5CJBA 4NQSA 3QCTH 4Z7UF 3OC5A 3ZKMC 4Z76B 5DGRA 3D0VB 3BJ91 5BS0A 3Q05A 5HI3C 2VO5A 1KGCD 1RUPH 2HVBA 8CGTA 4P3DA 2NW3B 2JB5L 1CXFA 2ZUVA 3WHXB 1MZYA 3ZYJA 1YC8A 1OF2B 3NIFB 4G5AA 4JG1H 1R5VA 4J8QA 2IAAC 3MRGA 2WTRA 1XXFC 3WDJA 3FFCA 3MV01 5DFVD 1IE5A 4U1LB 1S8DA 3IBOA 1PG7X 3BLBA 1F3RB 5K9JH 1HCVA 3B34A 3SJVE 1OOAA 2XTJB 1BLNA 4IKKA 1N0LB 3D2TA 2ITCA 5D1XD 1EFQA 3MV7A 1BQLL 2ZSVB 1UJ3B 4RESB 3BKCL 1RMFL 3RTLA 1G7HA 4ELMF 2MCPL 4Z3JA 1VPOL 2ZKHH 2EXWC 2GJZB 3L1GA 4ZD3L 4QRQB 4X6CE 1FNHA 3RUGB 3BFOA 4AQAB 4HUXA 3V4PA 3T04D 3OSVA 1IFGA 4U1IB 4WY7H 4OFYD 5TDPB 4GAYA 3HHRB 5SWSA 1BGXH 3PWPE 5DYOB 2XZZA 1UD5A 1UZ6E 4NB7A 2FSEA 2WMPB 3OGCB 2OJ1A 1DYZA 2YXMA 4W4NA 4XMLH 1X6LA 1DFXA 3KWWB 5EU6A 2NNAA 1C5DA 1EO7A 2NYYC 5F2FA 5D7KD 2MNJB 2APFA 3QXDA 1S2EA 1XZ0B 1RIUL 2NY0B 2XFXB 1BQRA 3FQRB 3NSCA 3FUHA 3RVWD 2DKUA 4PJIA 3ZT5A 1BEYH 4S1RH 4TUOB 1M71B 3QHTC 4NI3A 5CM1A 3FT3A 2GKIA 4Z18A 1ZLEA 4D9QD 2VUYA 4XVOA 2SEBA 1TQWA 3LQAC 4LESA 4Z7UB 3S35X 3TPUB 1LD9B 1WA1X 4I2XB 1XCWA 2AW2A 2H2PC 5D2LF 3APCA 4PTUB 2CH8A 2VDMH 1OLZA 2HT2C 3KLSA 1BIIA 2XWXA 4M7JL 3DNKA 2F5AH 4YFLI 4F15C 5JIKA 2UWEE 4PJDE 2F5BH 2RALA 1F4AA 3QFJA 3B2MA 1W0VA 5AKRA 4K73A 4PRBA 3K91A 4WTQA 3QDMA 4DERA 1I1AC 3V0JA 2FNBA 3D0LA 3S4SA 2GJPA 4QOKB 2P1YA 1NGXB 5ABZA 1TZIB 1AQKH 3B9EA 1LWJA 1YEHH 3FTZA 1Z9NA 2AI0H 2JIXD 1I8KA 4BFIA 4R8WH 4KMQA 5C0IA 1EFXA 1TJHH 4O58H 3L5WA 4N0FA 5T5FL 1EJFA 1F8TL 1P5VB 1GCFA 2Y25A 3IKCA 4HIIA 3GDCA 5DZ9A 1I1CA 2Z91A 5E8DL 5AFAA 4AIZA 2CDGA 4ELMB 5KYWB 1E6OH 3O2VL 4WEBH 5E9DB 1AI1L 2FJHB 3P9WB 1PSKL 3RFRA 1BHGA 4CL7A 3FQUB 4N8VB 1JYWA 1UKTA 4YR6A 3BP7A 3UBGA 4NENA 3OXSA 4GMSL 1T22A 3MMEA 2DQJL 4E9LA 1L0QA 3N1PC 3O6FC 4KV5F 2EH8H 4OVVA 3B2DC 4JFFB 4KQ3L 1AKJD 1NGPL 4OB5H 4HIHB 5CJ8A 1A6UL 4FFWC 1UT2A 4FQLH 2ZAGA 1YY9C 3QEGL 3BRFA 3WS6C 4Y5VB 5K69A 3I6GA 3UEQA 4EI6A 1NIEA 1F5WA 3BEWB 1EDYA 2AQNA 4JHBA 3BUQA 3D9AL 4JGUA 1LWRA 1NDMB 4IS6B 4JRYE 1T2QL 3EO1A 1P0SE 2B4CH 4ZUWA 4M7LT 3MUZ1 2WC7A 3MOAL 3Q1EA 4XBMA 2F18A 4DKAA 1TVBA 5F96H 4IMLB 1NCAH 1PZDA 1KYDA 2YGNA 3ML9A 5T3XH 2K78A 5EZLA 1JZHA 3VH8A 3MACL 1T21B 1GSMA 4I13B 4PGCB 4XP4H 4ZSOB 5J06A 3IGLA 4RMVA 1ZGLB 4K5PA 4WF7A 4WUUE 4NZRL 3UYRH 1JZ7A 1RJLB 2XXFA 1AR1B 3UC2A 1HSBB 2R9HD 1I1AA 4PGZA 4PJBA 4EQ3A 3WE1A 2UY7B 1BQUA 3B9KD 3HMXA 2QLVB 4XPTH 3KPRE 1OAKH 2X89A 5BJTA 3KEHA 4JRLA 3L3GA 4PMFA 3RL1A 2NY3B 3QQ3A 5EC2B 4HMEA 1V55B 2EDQA 4GRWF 4AW7A 2MOVA 5C0AD 4NZUH 5CSZB 5J11C 2EIDA 4PJFB 1Z9SA 5KOMC 2BVEA 4OQTA 5IFHL 5BMFH 3TZVB 3TM6A 4QR7A 2EDJA 3DX9B 5IVXA 2XX1A 3EGSA 4LDLB 2GFBB 3RX9A 1DVFD 1R3JB 5LUMA 2X2JA 2RH0A 3EGXB 3GSQB 1SDAB 4WDIA 4JQIH 5KBKA 3EFOB 4W9EC 1H19A 1GH7A 1HH6A 3M1BB 3VFTA 1OAZH 4NHCH 5SWZB 3R8BB 1MCCA 1S7VB 2WXMA 5DQDL 3EDJA 2LTQB 3FQXA 4J7RA 5EU3B 4P57A 4JL1A 1U8MA 1P1VA 2X4RA 3O6FA 3QR1A 4ZPTA 3DKHA 2HN7A 3L4UA 1LTXA 1FL5A 1BSIA 1Z66A 2I69A 3WS6A 4QHMA 3WKML 3HS8A 3NYKA 3LHPH 2QADC 4QY8A 3ZMRA 2I60H 4MSWA 4ZG1A 1PDKA 2MCG1 2MQ0A 5D1QC 2XVLA 1CFTB 1PZ2A 5L2JB 1T7ZA 1EHNA 4HC1H 1L3WA 1SLXA 4XP6H 2FD6H 1XF2B 4POZD 1L9NA 4ZMNA 4P23C 3L6FA 3IFPB 2YAHA 4LASL 1XGTB 1A3LL 5E1HB 2OK0H 3RGVA 2NNCA 2JJUA 1A47A 4NCC2 4BZ2L 3BE1H 2WHVA 5DQJB 3OKOB 4JZNB 3G6JE 1FFNA 1LDPH 2CR0A 3MRHB 3IDMA 3VQMA 1QI4A 3ZXAC 3KLQA 4LRNL 1S7RB 2QTVA 5BRPA 3QAZB 4W9JC 1NBZB 2Z1KA 3MDJA 4MASA 5DA0B 1OCZB 4HIXH 4JB9H 1U58A 3C5ZD 5L8KB 3FUNA 1ZVSB 1XGPA 2F19L 1P7KB 2V8MA 5E5MA 1KYOK 3GMPB 2DIBA 1H3TA 2VO8A 1GGIH 4KKAC 3N5AA 2WO2B 1QNIA 4HPOL 3RY4A 3T6VA 1HJCA 3BVNB 4GXVH 2QBWA 3GBDA 4PWEA 3C6LB 3UTPE 5K9QI 1I3RA 4QLRA 4HT1L 3VGEA 2WLLA 3WN5B 4BFFA 5C0EB 1PX4A 4JPWH 3IM1A 4TKWA 5IFAH 3S34L 1LILA 1MH5B 4YS4A 3N43F 5L4JA 3ZKNC 4EIBA 5CR8A 4YHML 1UA3A 3GMMB 1RD6A 1E4WL 2LT9A 1ASPA 1DJWA 1MCIA 3F6JA 3E2HC 3I85A 4WGVB 3CHXA 4YLCA 4QHUA 4UM9B 4BUGA 5D7LE 3TP4A 4N2KA 4MZ2A 1TJXA 3NA9H 4Q4EA 5CZXC 1HXYB 2OR9L 3MNVB 4JEGB 4Y19D 3W5MA 4MWFA 3U25A 3BT2H 1J8HE 4M1DL 1L9MA 2ZXAA 5HJDA 4D9LH 4MQTB 1XAUA 1N2RA 4L4VA 3H85A 1MI5B 3KDMB 4LFHD 3LX9A 3DRTB 2W9DH 5IW6A 1ZT7A 5DD5L 2E7HA 4Q74A 5D1QA 1X6NA 1HL9A 2QVTA 4HMCA 3UBXA 4AIEA 4NIYE 1TDQA 5KSUA 1JZ6A 3Q7JA 3RGBA 2CPUA 3T2LA 3B7YA 4RRPG 4DZ8A 3BP6B 3AXLA 3JV4A 1OOWA 2YD7A 1WCQA 4N1CA 3SKNB 3WXWH 3ZSSA 4PRDA 4MB5A 3MU3A 4R7LA 3OQ3B 4QXGH 3P30H 5LNGA 1ESOA 3CFDB 2R2EB 3RDJA 1YEJH 4PJXE 5IB3B 4HJUA 3AU1A 2BSTA 2Q9OA 4GO8A 4S11A 4AVJA 3VJ6A 3QS2A 1BMGA 2VXQH 4PTTB 3VFGH 3IDNA 3MV9D 3FQNB 3FTVA 4JG0H 1AJ7H 2VKXA 4DP0X 5DRWB 1FC1A 2YA1A 3O8XD 1SEBA 3MLSL 4FLRA 4MXVE 4RIRA 4JZJB 1BOYA 4M6NL 3GYRA 3NABH 2QKIB 4Q6IC 3B9AA 2GJ6E 1KJVA 5DJYA 5KAQG 3OB0H 3AT8A 5CKGA 3UCQA 5HPMA 2ZAIA 3N43B 1H3XA 4JAMB 1R19A 3UG3A 4PHXA 3UPRA 1OARH 3EOTL 1RJZB 3U4BH 3NCMA 4QRPD 3EHBC 3GSRB 3S96A 4PR5A 4WTZG 4DGIL 2I85A 3EYVA 4WFEE 1B3JA 2CLVB 4F24A 3EZ8A 1NGWA 1H3PL 1FNFA 3QAQA 4X4KA 2H8PB 3BWAB 4RFNC 4W6XB 3L54A 2X1PA 2X4PB 3UTSA 5FUZL 2YMXL 5ADPL 1CTOA 4U31A 1IAIM 3DTDA 5MEOA 1FNSL 4OM1H 4QHPA 3FT2A 3CN1A 3GM0A 4P2RB 4KNQA 1AS8A 4X9YA 2ATPB 4DP5X 4V2BA 1LWHA 1KNOB 2B20A 4KUZH 3NJMA 4AT6B 3TV3H 1G9NL 1HHKB 1BG9A 4JO2L 4BUQA 1ET7A 1JAEA 5CJ5A 1PX8A 5IQ9A 5GZNC 1GC1H 1UM4H 4ONOA 2K4WA 3QCUL 2K6ZA 4I1PA 3ULVC 2YAQA 2BIMA 1PZAA 3EH4B 5CWSA 3RHWF 1SOQA 1WA2X 4Q9BA 1GTNA 2AANA 5GHWL 1KPVB 3LSOB 1ONQA 3NCYP 4Y0GA 3DUUA 3HRZB 4G8EB 1TVDA 3FTUA 3MUGA 4XXDA 1YO4A 3EF7A 2FEDC 4FQXC 4CADB 4RMWA 3SQBB 3GXIA 1YEDA 2CR6A 4XE0A 4ZO8A 2Z35B 1ID2A 4A7GA 1WUNT 3L9YA 3VI4F 1L7IH 3AGWA 3FTSA 1GYUA 3V10A 3GRWA 3B7RL 1MW3A 5TQ2H 1OP5H 1GKOA 2V37A 5GRYA 3ZE1F 1U8JA 1CYWA 5L9DL 5T1MA 2X09A 1CGUA 3GHEL 4HD9A 2BO0A 5DJ8A 5HVHC 5I1DA 1OD9A 1ID5I 4LHUB 4Q6IA 4UIMA 4BHUA 3DX6A 1E5ZA 3MA7B 4OF8A 4H7VA 3ZTNL 1KXTA 4AGMA 3HC0B 3QFGA 1MJJA 4HGMA 4L1TA 3V4LA 2GSIA 1J05A 3ZHLA 3HB3B 1E8WA 1MJUH 2EJ1A 4NBXB 3S5LA 1E67A 5F71A 4U05A 1S7WB 3QHZL 4IIQB 4D3CH 4P9HC 1E27A 3A67H 4MCZB 4XCEA 2BVPB 5IHBA 1AS7A 4TVPH 5FAAA 3SE8L 5J8OA 1OCWH 4YVUA 3C5SA 4AZ8B 1QP1A 4H8UA 3M46A 4XO3A 3QEUA 1M6OB 1CDHA 2XETA 3UIYA 2Q7YA 4L37B 3IDIB 4JE0A 4PS7A 3HVNA 1JNNH 1I9RH 3DO7B 1VFAA 2MQGA 3MNZB 1F6LL 1BOGB 3FO1A 3VRJA 5I17B 3AWGA 2XQBH 4FG2A 4HUVA 5KJRL 3JSSA 5JIHA 3TVMC 3UEZA 1E9OB 3G5WA 3PABA 2MOQA 5GZNA 4JFQA 1YEGH 5D1ZB 1G9EA 4S1SL 5DRZA 1JGVL 4GKZA 1ZMYA 4LPVA 4NZDA 5EO1A 4NQCD 4XHJD 1U8PA 4G8GB 3DIFA 3DMMB 1JV5A 4CDHA 3UTZA 3LN5B 4XNQA 3UG4A 1SDDA 2HRPL 3P54A 5A16B 3NJJA 3OKLA 3TL5A 4LPWA 5IB1A 1N0XL 4F1SA 4OZGA 1MIEL 1ECYA 4FQXA 1IGFH 1WD9A 1QRNE 2IPTL 4K8RL 3VI4B 3ZL2A 5K5YA 4FI7A 4PJ5B 3FFCD 2OTUA 2PNDA 1FFRA 1WICA 4HBCL 1SXCA 3WLWD 1QA9A 5CXPA 3SPJA 4PCSA 3ZE1B 3QHFL 3QUXD 4XMVA 4Z9KB 2A6KB 4FTVD 1CBJA 1URLA 2MQ3A 4OZFG 1HILB 5F1IA 1ROWA 3FQWA 3H6AA 2J1ZA 5GIRA 3W81A 5HDWA 3WDHA 2KHAA 3V6ZA 3WS3A 3HUJA 2BSSB 3O9WD 4NWUH 4ODWA 3Q8CA 4YDIH 3KPSA 3LRMA 1IVLA 1QBLL 3MRPB 5FV2A 4BKTC 1T0NA 4R6UA 4X4ME 4L8CA 1JHKH 5JUEL 2RA1A 2YZ1A 4YK4B 4WU5A 2OLDA 1GJWA 2YC1B 6FABL 2Z4QB 4HS8L 1HKFA 2FZ3B 3Q6GH 2PCXA 2B77A 3DYPA 3FYIB 5SWSD 3QDGB 2C34A 3ILEA 1YMMA 1S7SB 5EU6D 2BNRE 3M1CA 3KLKA 1MWAH 4ZT1A 3IDJB 1DQTA 2YLKA 2ADYA 1EERB 3SKJH 1YPZA 5DJZA 3RDTC 5LGHH 1A7NL 4QHNB 2YAFA 4WI3A 3WFCL 5ESVA 1S6NA 2Z1PA 4IW4C 4ZUVA 3DJZA 3OAYK 3TH2T 3SDXA 3WE6B 1AGFB 2DWYA 3FOMB 5HDQL 1MCEA 1CXEA 1ZY9A 4PSPA 4UQ3A 1JK9A 4OCWH 1MUJA 3QH3A 4UINH 4X9HA 3MLRL 3ZKMD 5T3XE 2G9HA 3KWVA 2BY2A 4J3OH 4WWKC 2X4OB 2NMSA 2XWTA 4A2EA 3KL3A 3ESMA 4P49A 5L8JB 3BKML 1ZJBA 2VN5A 1HN1A 3ARFC 5FHBL 4DJMA 3VGDA 3QDMD 2B3RA 3PFUA 2HTKC 4FYSA 4I89A 4HXAH 2DQFA 5FM5M 4ANVA 2FWUA 2L4OA 2VDPH 3WTTA 3D07A 3VRLE 5GGSB 2CLZB 4L1LA 3CVHH 4FG4A 3L4CA 3QBTB 3U46A 1C8QA 5AYUH 2NOYA 3EXLA 1EAQA 4Y2DB 4G82A 1CE1L 1F97A 3FSVA 2P49B 2ADJB 1CPUA 4NUGL 4CC0A 1KENH 2X3CA 1KBKA 5D7IF 2CD0A 2GBUA 2VNCA 3F8UB 1F0LA 2PYEA 3L4XA 3QRGL 4HSCX 4MDIA 4QXVA 2DYPA 4OJDH 1K4DA 5DEFA 4AGPA 3GJFH 1CFVL 2F53B 3OM3B 4U33A 4IJTA 5DD1L 2PYFA 1E3FA 5CEZH 1V7ML 2YIHA 3LY6A 1MAKA 4Y4FD 1IGMH 5IW1A 3X13B 3PQYA 4UTAA 4LBEA 2CIIA 3HMWH 3RU8H 2RCSL 4HWNA 3QYNA 3TOPA 3QQ4A 4Q7DA 4NQEB 3WLBB 2QHLA 4G7RB 4X4ZA 5DJ6A 2NYYD 1I7TB 2V7NA 1J12A 5GS0C 3WUWG 4ZZKA 4PJHF 4Y2OB 3C60B 1HHGA 1E3ZA 2BSDA 3RDTA 2P5PA 3BX7C 2ERJB 2APTA 3WIFA 5CBAB 1FO0A 1OQXA 2BP5M 4LIQH 1QSFA 2DM7A 3AB0B 3P4MA 4OFPA 4Z3TA 2BM3A 1YEFL 1VLXA 1ED3A 4N1HB 3GTTA 5IOPB 3IJSA 4R5XA 4Q6YA 4CW1B 1DN2A 1UOLA 1GZPB 2CXKA 4ZAKB 3UC0H 3SEPA 1Y7VA 3GSVA 5C0BA 1THAA 4OZGF 4WWKA 5JZ7C 3SZ6A 1QSEA 2LQRA 5E2WL 1XWVA 4JFYB 2BVQA 1XF4A 3SPCA 4UZSA 3ARFA 4WFGD 3EJQA 3VNZA 3GJEA 3LEVH 1KYFA 3T0WA 3TBWB 4E41E 4UTBA 1JWSA 1DLHB 5CHNB 3H42H 2X89D 4X5RA 5AVTB 3D2UA 4WK0B 3UCRA 4F58H 2BDNH 3D08A 1BVLA 3HUJF 3I74A 2K3TA 3O4LD 4GMTL 2FO1A 4NZ8A 2E27L 4MA3A 3GKZA 5IBTH 4G7VH 4HJIA 1FZJB 2W65B 2J21A 3P0YL 3LQZB 2HJLA 3BPNB 5D7IB 3QZNA 4HGWA 3WJMA 32C2A 3RJDA 4FN0A 4HJ0C 4UT9L 3GHBH 1OGSA 2ZPKL 2CBTA 4TUJB 4PJEA 2WSPA 4MJ5A 4XNZB 2WWKT 5HI5C 3LRLA 3QPXL 1D5RA 2R0ZL 3CZSA 3F58L 4FXGC 2OJZL 4GW5A 3K3QA 4ZTPH 5ACLA 1FDLL 4N0UE 5HVWA 2GUOA 5SX5K 4TSCH 4DO5A 3ZY7A 5BQ7B 3U4EA 2DWTA 1T83C 2ZP0T 2V9TA 4IU3A 4DP7X 4A68A 1H6TA 4R4ND 1JF6A 4NC0B 2EVGA 3ALWA 4QRTB 3W38A 3EZJB 3F6LA 4G1MA 1WAEA 2GPZA 3CU1A 1INQB 3GMNA 3V7MA 4EOWH 3ATAA 1HL4A 3ESPA 4OVUA 5DC4B 1KCUH 2ZOLA 3VFPB 3LB6C 3K7UA 4FFWD 1E65A 5IF0A 3D4GA 1BPLB 3QRBA 2H3NA 4PJHB 1TUPA 1RZKC 4LFHG 4AV4A 5DS8B 1MFMA 3ESVF 5KZCD 4YDVA 3EDDA 4FQQB 4WV1C 3HCVA 3S8WA 1N10A 2IQ9H 4KBPA 2FEEI 1KWGA 3L5XL 5BZZA 2FR4B 1IGIH 5K9QG 1BG1A 3PNRB 4OCXL 5ENWB 2VJXA 4JFDA 1F90L 4J3BA 3DJRA 3RGVD 5GGRB 2XIBA 4FMKA 3VWKB 3WEAA 4ZUUB 2N1KA 5CD3B 5FWQA 4ZX3A 1IVTA 3WIIL 3RWHB 12E8H 1AE6L 5JW5A 2Y3NA 1CVRA 1QLFB 4YSPA 5GRWA 5I1CH 2CO2A 3BSZL 3ZDZE 4G9FB 5AVUB 4NC1C 4LPTA 3V8OA 2YRZA 1A6ZA 2XV2A 2YKLL 3OKEA 3VI3F 3QUMH 2ED8A 4XC3L 5LBVA 1ZRUA 5BPPA 3SDCD 1AFVH 1I7RB 4K7PY 1FG2A 2HLEB 5IESL 3D1MC 2KBGA 4DETA 1JHLL 3TT3L 3FQ4A 3H8NA 4M1GL 5DD0L 1BREA 4KTEL 3ZLQC 1JGEB 1AXTH 1LEKA 3PGDA 2FO4A 2FJFB 4XVUC 4FXGA 4QWWC 1P6AB 2XRAH 4PJGF 3U7WH 3HE6D 3KPLA 2HT4C 5KS9A 2C5DC 5IJKC 1BXUA 1Y6NR 1RUKL 3FPXA 1IGTB 1KULA 3TBYA 1IJNA 1O6VA 4M62H 4Y16C 1LEIB 4Y9CA 4PRHB 4HX1A 5EBWB 5HP5A 1MCOH 5GQBA 3EDKA 1F2XK 1OF0A 3QJUB 3QNZB 2D03L 3FTWA 4XRCA 4L4VD 1HS6A 3MLTB 5BV7C 1RHHA 3IEAA 3KLDA 1OAQH 4ODBD 5AVXB 3R4DA 4FDWA 3PU7A 5KWYC 1GW0A 4WV1A 4LEBA 2AVGA 2P8PB 1FPTL 2V2XB 3H7BB 4H1LA 1NAKH 5D1QD 2K3HA 1EBAA 2YZ8A 2EICA 1FE8L 3LKPB 4V1DB 5DUPH 4A2DA 5E6YA 2EDRA 1PJWA 4AG4L 2G5UA 5B39A 5C6PB 5FKAB 3L1OH 1BAFL 1AHWC 2J2ZB 3O2DH 3VD3A 5FKPA 2R8SL 2R56H 1IC7L 5I5MA 4U6HB 2XQ0A 2X9YA 3WFEH 4X83A 5D7HA 5EHFA 2X70A 4KI5C 5FYLL 3TYGH 1VFBB 4M7LL 3C2AL 1DEDA 1DUYA 3K6FA 2LU4A 2B5IC 3RL2B 3FCSA 5HYSA 1RUQH 2D3JA 4ZUSB 2ZNWA 3UJIL 5C0FA 2ZYHA 4XBEH 3IJEB 2DQTL 4TSBH 4DW2H 1FJ1A 4ZTOL 4I0CC 2C1OA 3DHPA 4LCWA 2WY3B 2FHCA 4L5FL 4QTIL 1E43A 4KKAD 2XWEA 4NSKB 2I7SA 5AQ0A 1HYRC 2JKNA 5GGVL 3BZ4A 3EFDH 1SLWA 2A6DB 3WKQA 5MEQB 4AOFA 3UO1L 4MNQD 1J0JA 2ED9A 2F54E 2X6MA 2B2XL 2P5WB 4NQDB 4GG6F 2WNKA 3I9IA 4B53A 3AVEA 1S5HA 4BCYA 3TO4B 2XTJC 1G7PA 2QQKH 3TWCL 4OJCA 2R1YB 4MQXD 3ZGIA 4JY4B 4AL8C 4UQDA 5F7YC 5IJKA 4TVPE 3O3EA 3UTTD 5KUKA 4B9PA 5CLTA 2VSKB 2MPAL 5CZXD 5KW9H 1HHIA 3HZKB 4QRRB 3WIHL 1PTZA 3GPEA 3JWDC 3DO4A 1AAJA 4Y16A 4Y1AA 5AW5B 3P77B 5IV2A 1DCEA 2OL3L 2PWEA 1WEJH 2Y5QA 3D39E 1BQHG 2YRBA 4LVEA 4PMEA 5CEXA 3RPBA 3ULUL 1CZ8H 4E9XA 4U1HA 2ZKWA 3T3PE 4KITB 2HFFA 1XIWB 3TJEL 4HK3J 4H5SB 5HYJD 1IB5A 2H32A 1KN4L 1Y6KR 3LZFL 2AQRA 3AAZA 4YXHL 3ZE0E 1Z9PA 2KL6A 4PSRA 4OF0A 5C0DA 1NL0H 4R26L 2XBDA 4J28A 1AHWA 4P04A 3UERA 1S7XA 2ORBH 1MKFA 3VXSB 4AV5A 2R0KH 3UZQB 3MRDA 4X8CA 4UOZA 1A1NA 4L3CA 4ECNA 1QW9A 3MNWB 3MOQA 1T4KA 3D12B 3CFEB 4FZEH 1SYSA 5DI8A 3NJKA 4OZHB 4AEIH 1NAMA 2Q76B 2IOIA 1IQWL 1DTUA 4G11A 1WZMA 1NGQH 3EJPA 3PP3H 5GRUL 3TCLA 4ZYKA 1N8OE 2GTZB 1R3KB 1F00I 3DV4B 2DWEB 2F1EA 5E99H 3WHXA 4AWJC 2BHZA 4FJZA 5DUML 3TT1H 4D0BA 1DCLA 2ZX7A 2NQCA 5DK2B 5EORH 3DUSA 1MF2H 3II3A 5AVRB 1CQKA 3P9LA 4YX2H 2DQUH 1E4HA 3G5VB 5KS9F 4QF1B 3BWUC 4NM4H 3MJ9L 5IJVB 2FJGB 3EHBD 4KRPB 1NBVL 2P52A 3QXWA 1N0LA 2IFFL 4IOIB 3PWVA 5TK2A 1OVZA 3QNXB 3ZSTA 2LAGB 3AREB 3N9GH 3A6BH 4LSPH 2OCCB 2YWZA 4I3RL 4O51B 3ARDD 4R4FH 1MG2C 3DECA 1AZRA 1FSKB 2IMNA 1SOXA 1AANA 4QRQA 3OAZH 5K9KB 4YE0A 3K6IA 4WFHE 4WO4D 2W0FA 5FF6B 2CUIA 3QFDB 1HSAA 1BMZA 2I07B 2IOOA 1F3JB 4GP8B 4AGLA 5DMYA 4GIPD 3EYOA 4C56B 3IPBA 3DX0A 2IANB 4F8TA 3J2PA 4H8PA 1T7VA 3NCEB 3NCJH 1URZA 4CILA 1YMHA 1FVEA 2Q7NA 3I6KA 1RLWA 1S7QB 3GI9H 3IAGC 5GZND 4F9PC 4K5LA 1NMCB 2J25A 5CIPB 5DC2A 1E4KC 5EZOH 5JIMA 4OFKA 3ULVD 4N2FA 1WTGT 4LLAA 1ZXQA 3OF6A 2XFXA 4TTDC 4NNXB 2R69A 4GSDH 4YQXL 2UZIL 3WFBL 5B3JF 3MO1A 4MA8L 4G6KH 1DQLH 5E8EB 2XWBA 5T1LA 2OYPA 1XT5A 4TUOA 3S4SG 3S8GB 4FQHB 1MCWW 4ZNCD 4IU2B 1KTBA 4FQXD 3QQDB 5F0LB 4KZDH 3K80A 1SFDA 4Z7IA 5L88L 4I2XA 1P1ZB 1J9RA 2NY1C 4XHQA 2VLMD 4PTUA 1I53A 5I6MA 5FYJH 1JTPA 4G8FB 4GAGL 5KEZA 1U21A 4PRNB 4MA7L 3TN0B 3OHXC 3CDFA 1ZHLB 2QZQA 3L3KB 2A77H 4QPEA 2CA3A 4GSXA 5FO7B 3U1PA 1R5IA 4KJYA 1HDMA 3U6XS 3UTOA 5CEZE 2DL2A 1C16B 3LKQB 3S36H 4G6MH 2D31B 3MUJA 1JV2B 1P5VA 2O1AA 4NKIL 3TZVC 3EO9L 4AJYV 3GO1L 4ZUTB 4IHBA 4ADIA 2DM4A 4RRPM 3CZGA 2DJUA 4ZQKB 5DGQA 2AAAA 5KYWA 4G8IB 5DTFB 3NCXA 3GSUA 5EUKB 1E40A 4TF4A 3I02B 4FFYA 5MERB 4E68A 1JDDA 2A83B 5AKSA 4JJ5A 1T03L 4MX7B 2CGZA 2EXYC 4QYOB 1HYSD 4JO4L 2R29H 3CDCA 3MRBA 1IKNC 2EILB 3TA3C 4LIQE 5JLZB 2F2HA 3KL5A 3DSFL 3KMDA 2A9DA 2L8AA 1ZANH 4F9PA 1PFOA 3E3QC 4NHUB 4PJ8B 1BYNA 4Y5VA 1E4KA 1QUNA 2HKHH 4LSRL 3VH8G 4OKVA 1GRWA 1ECZA 1X5JA 2X10A 3GDBA 3IFNH 2XA3A 1E4XL 5DSCB 4IS6A 4MQSB 2PP9A 3EGDA 4U6VL 2MEJB 3QJHA 1SY6A 3DHUA 2EZ0C 2LFEA 2EECA 2WINB 2IOMA 1J9TA 5TDNA 2AJXL 3CFKA 4JFEE 2VDRL 1GYVA 5C92A 4Z7QF 1T21A 2K6WA 3A4FA 4PGCA 1ZEAL 3GHPA 3JQOB 5IMKB 1FHNA 3NCWA 4M3JA 4JW3A 2ENPA 1A2YA 3INUH 3OWRA 2R15A 3VVWA 2YGPA 2VR7A 3OHXA 4IKLA 1R0AH 3L7EB 2PYED 3R06A 4A67A 1HZKA 2WN3A 4PGDA 5EC2A 2X3AA 1U33A 5EC1A 3U6XA 3VE0B 2WLZA 5C70A 4QT5B 1JK8A 2Y07L 1NICA 2IIJA 3D3VA 2XXMB 3NP4A 3TZVA 4DP8X 4ZFOL 3PQYD 2OTPA 3GBMH 4Z1PA 1PCXA 4HIQA 4ISVA 1EXUB 2G2PA 4JN2B 1K5NB 2NYKA 2Z3FA 4NYLB 1OWRM 5JHLL 1KJMB 4TNGA 4WSJA 2Y3AA 4LP4A 1IRAY 1UT9A 4PP2A 3RDTD 2ZCHL 3BDYL 1KJ3H 4XCNA 5SWZA 1IKNA 1S7VA 1F58L 3LTVA 3TA3A 5CZKA 1E9PA 1P7HL 3BP4A 3LIUA 5EU3A 1BCIA 3ISYA 3DC0A 4GAAA 4W9FC 4EJ1C 3I3DA 3R0NA 5C6WH 4I0PC 2P24A 4JG5A 5FO2A 4KROC 3RWCB 4PRPB 4LSSH 2Y7MA 1MNUH 1T5KA 5EDXA 5GGTL 4WW2C 4OSUL 4NJ9H 3TPKA 2CLRA 5HYFA 4HMDA 1KBWA 5C0BD 4OLUH 4RAUA 1I1FB 4WWKD 1AG0A 1G94A 2FX9H 3E9TA 3F7RA 1B4JL 4IDJH 5D4HA 2GITB 5EBLB 4DESA 5LGJB 2FWOB 1E5BA 1JNHB 5L0QB 3IU3A 2HVJA 2JXMB 3HFMH 4WSGA 5CILL 2YPVH 4ZX6A 1ACZA 1NCTA 4CSSA 3FAWA 3M88A 2R0LH 5CR1A 4QAWA 1A7QL 4LP8A 5IBLC 3OLIA 1OLLA 1U92A 3BYYA 4GRLC 3D2UD 5IHLB 5EZJA 2XQYK 2AF2A 3V6BR 2XPGB 4YJZL 4RGND 5CCHE 3OKOA 1CIDA 4JHWH 1AACA 4UNTA 5ILTL 5FYJU 2BMKA 3TEUA 4OF5A 3ETSA 3T3ME 3BWUF 1ERNA 4NCDA 4ONFH 3HAEA 5A2FA 1W6LA 2UZYB 2DMCA 1YYLH 3MBWA 4OJEH 3FU7B 1C12B 3HI5H 1CN4A 1DBAH 4H2AA 5J6GA 4XR8C 4M5TA 3LMJH 1FIEA 5FLVA 4LCCB 4U6TA 4A1RA 4Y88A 5K33A 4LCVA 4QRSA 5EWIH 3FUDA 3T65B 4EDWH 3B7UX 2GBTA 1JGDB 3HI6H 2VLRA 5C07A 5I1EH 3W2DH 1U8LB 5DK0A 1KT2B 2XN9E 1KWKA 4N0YL 2IPKB 1KY7A 3SOTA 1LM8V 1ZTMA 2OW7A 2QVKA 3PY9A 2WVVB 5GS0D 4OLVL 1ADQH 4PJDF 3Q9PA 1YEIH 1P4BL 3FUKA 3TJHD 5LQBH 4K0OA 4I0KA 3QCTL 4XX5A 1BDYA 4MLIA 3KWTA 3UBXG 4HEME 3MNVA 4CBZA 3H3KA 4ESKA 5T1KA 3GRBA 2RHEA 5E6UB 3CBRA 3IDGB 1E30A 1RUPL 5M94B 3L9RB 3GUTA 4JFDD 3QT2A 1JMXA 1NFIA 4WW2A 5ERWB 1A4AA 3OB0K 2WLNA 2WYHA 1D7DA 4JG1L 4XH2A 4W6WB 3SJVB 1DE4B 3SKUD 3S48A 4YAQA 3V0EA 3WCYA 1W6WA 3V4VA 2EDMA 4KRMB 1TENA 5L2KA 5JDSA 3UAEA 4XNAA 2C3GA 3C8HA 5K9JL 1YEKH 5I9QB 2WJ7A 3W0WB 2DWDB 2FJSA 4WI8A 4JR9H 5K1JA 4YSEA 2CKBH 3E0GA 3BQUB 1KXHA 1D9KC 4GRLA 4HAKA 4DAGH 1U30A 3DX7B 1WAAE 1JZ8A 1CLOH 1UT1A 1AMXA 1O5DT 1T0PB 4YSDA 2ZKHL 3IMTA 2E7DA 1S9WB 1DO6A 1FWXA 1NQBA 2A6IB 2XV3A 1FH5H 1D5BB 2XYBA 4O02A 3ZQXA 3I6LD 3TNNB 5IT2H 1J8KA 4WI0B 1YY8B 2E76C 4WY7L 1KTRL 5A7BA 3KLHC 4U6YB 1VADA 4PCKA 1BGXL 5MENE 3KDPB 1Y1UA 2ADGA 4PRIA 3PS6A 4HYTB 1OT1A 4YEEA 4XMLL 5ANMA 5HHOE 5H37H 5KYYA 4UT6H 1EJOH 3O45B 3NSDA 3EJZC 2PTUA 4MNGE 2L7JA 4K7PH 2O93L 1DVSA 4JAMA 2AQ1A 1BEYL 4LK4A 4S1RL 3GGWB 5GGUB 1M7DA 3LB6D 4KPHH 4H2CA 1QR4A 2VDKH 1O9WA 2UWEB 4PJDB 2WZPA 4FYQA 3FCTA 4EIZC 2XTLA 3QIWC 3PFQA 1F11A 2CLVA 2Z6FA 4Z0BH 4AQZA 5ID0A 4G9DB 2W88A 4B96A 1CICC 2VDML 5E8NB 2F5AL 4MXWH 4XNMB 1VRSA 2OMUA 3SPVA 4C55A 2F5BL 5JHMA 4NQVA 1A6AB 4IYKA 3H9SA 5IUCA 4ZXBB 2X4SA 3JTTB 3V6FB 4GIOA 5EF1A 1VGKB 2VXUH 3L17A 2ITFA 3C9NA 1AQKL 4O2CB 1KNOA 4TNFA 1YEHL 1RIVH 1RIHH 2AI0L 3EYUH 3JWOH 4K94H 4R8WL 2BZ7A 1TJHL 3S5ZA 4B7LA 4O58L 3IDYC 1W8EA 4MAZA 3K2MC 3H0TB 1IEAB 3KW8A 2DM3A 1BFOB 4JZOA 5T8IA 2H6OA 2DMHA 2AK1H 1ND0B 1D9KA 4FNTA 4LEOB 5KYNA 1E6OL 4LCWD 4WEBL 1U8CB 3LSOA 2BY1A 4OH2A 3CUPA 3OSKA 3DTXB 2V8LA 5DEGB 4D7BA 1OSEA 4WI2A 3ARGB 5FO8B 3PRZA 3S5YA 4AEHH 1HWHB 3L2MA 2AQPA 1RFDH 2BJMH 3IMUA 4OW6A 4R90H 5EUOA 2JI2A 5HY9B 1KACB 5JTWA 4XBPB 3JYBA 3Q0HA 2EH8L 3S5LG 4MBRA 1QO3B 5AVQB 4OB5L 4DEUA 1A7PH 1K3IA 1QSVA 4FQLL 4QWWD 1IM3A 3BEVB 4JRYB 2CIKA 3GS7A 3H2PA 1FFPB 4RCAA 1UH3A 3GIVA 4BKLB 4K3JH 4JDZB 1LEGA 1ZLWH 3IGAB 3P40A 4BD4A 43C9B 1WBZB 4TPRH 5CNHA 1ES0B 2HAZA 4Y1AD 4Y16D 2N4IA 4W9ZA 2G0KA 1ACXA 2B4CL 1B88A 4WUUB 3QIWA 4GJTB 2X6BA 5J9PB 5F96L 1TPXC 5I28A 1NCAL 2DQHH 2YLHA 4GKNB 4XBGB 1CICA 5D55A 5T3XL 4PB9H 4XP4L 4GQ9H 3ZOAA 3PHQB 1UC6A 1L0YA 3UYRL 2IGFH 1JERA 5GGSY 2H1LM 3KGUA 2J88H 1I8AA 1K2DA 4JFSA 3VTTA 1FH2A 4UUJA 4XPTL 1HKLH 1BOGA 1U3HB 2FT8A 1OAKL 2Y6SD 2CUHA 4KI5D 2PCPB 4ZMTA 1DQQB 1CFQA 1DQMH 1PY4A 3AADB 3MLVH 4NNYA 2FUQA 4NZUL 3SKMA 4N6QA 3EJCA 4KXCA 4Z78B 1C7TA 4XO5A 2JI3A 5BMFL 3AG2B 5EB9A 4CMMA 1JPGB 5IR1B 4G8GA 3RJOA 3CQFA 5FYJE 4I7ZC 1A6TB 4A66A 2VDLB 2VQ1B 3HFFA 3KJ4B 3VMOA 3LIZH 2EUWA 3RWGA 4JQIL 2CPCA 5A16A 2QQLH 2WKOF 2QPDB 5T5FA 5ICUA 2VXVH 1OAZL 4NHCL 5IQOA 3Q2WA 4PJ5A 1YLBB 5F9JB 1G9HA 2AJYH 5GGQH 4YSSA 1TZOA 2IJ0C 3VQ1C 2WJ5A 3PXJA 4TV3A 4FFVC 2MSPA 2K1MA 2OXHB 4N6RA 2VAJA 2DI9A 2XTJD 3JZ7A 2J5LC 2B9BA 1D5XA 4AMXA 3CZKA 4U1SB 1TLMA 3BN9C 2YUVA 2W8CA 4Z7WA 4ABWA 3LHPL 3OV6A 3QDAA 3MRPA 2I60L 1ASOA 2X05A 5I8KH 4DUXA 4AYGA 2KQMA 5DJAB 1ZHBA 4U3SB 1T0MA 5HD8D 4HC1L 1NCHA 2H0PA 4XP6L 2FD6L 3T6ZA 1OGTB 1H15B 4IRJB 4RX4A 1BBJB 2FZ3A 3K5SA 3P4NA 3KH3A 2FYYB 3MRLB 2OK0L 4PJXF 3D06A 2ZG1A 2FNWA 2HPTA 1GW6A 3BE1L 4PQXA 4TVUA 4FXTA 1S7SA 1GJUA 4AX3A 4Y4KC 1CFNB 3MBXH 3A23A 1JL8A 1LDPL 5B3NA 3OKMB 1VSCA 1UHVA 3OF6D 3PJSA 4UT7H 3STZB 3WV0A 2ERJC 3QULB 4JB9L 4HIXL 3AB0C 1U36A 1P5UC 4R3SA 4UDTA 3U7YH 2APBA 1AGFA 1FORH 1GGIL 2WXQA 3AABA 3ECBA 3FOMA 3M6DA 1JCKA 4QXWA 2DH2A 4ZDHA 3VCLB 5F7DB 2Y7SA 4GXVL 5F7KC 4WJG3 1X5MA 2E7BA 5IFAL 4JPWL 3HPLB 2YN5A 2HLAB 3QI9B 5D7LB 4CKQA 2VQTA 1SVZA 4OFDA 5EUOF 5ISZE 1QTYT 1IM9B 2OKMA 1OTSC 4QOKD 2CO4A 4Y1SA 3SYCA 2VXTH 4HHAB 5CO1A 2BIPA 4ZFOB 3D25B 4H8HA 5CAYB 3M17B 4LLWA 4CU8A 5FOJA 2EUVA 3NA9L 2DQCH 4GPVA 4WEUD 4AGNA 5A2CA 1ZT4A 4LDEB 4LL4A 3PHOB 3S37H 4DZBA 3BT2L 3DK2A 4LL9A 3VB9A 4GSRA 4D9LL 2ADJA 4PCTA 3EF4A 1KLUB 1CG9B 4LSVH 1J0HA 5DURB 4CDGC 5E9DD 1JZGA 1A9BB 8PAZA 2K7PA 2W9DL 2B1AH 3ULUH 1W0WB 2F53A 3MBEC 1KV3A 1OTUC 4QRFA 2O6PA 5KVGH 2ESVA 5GGRY 1EUTA 3BPLC 3IJYB 3SBQA 3JBG7 4PJXB 3X13A 1FNGB 3BUYB 1O6TA 5E8PA 4WVRA 4RMQA 4RVBA 3KYMB 2WZ0A 2VH5H 4JFFD 3WXWL 5IEKB 1A02N 2X4UA 3CFBA 1YJDC 4NQEA 1IARB 3WLBA 3BLPX 4QXGL 2AFNA 3P30L 4ALAH 4OLZH 4Q56A 1GTFA 4PH8A 1YEJL 2HRHA 2JCCA 1NCIA 2VMJA 4NC2B 4Y2OA 4M56A 2AJ3B 2G4GA 2BOBB 2YPLA 4QRUB 2O61B 5B1JC 2VXQL 3VFGL 1E8ZA 4OGYH 4XNYH 3BO8A 3PV6A 1WV7T 4JG0L 1AJ7L 4UILH 2C9SA 1FFOA 1P5UA 5E00B 5K1VA 4F27A 5EU7E 3L8QA 2BSRA 2WXOA 4K71B 1DZ0A 1L9TA 2EIEA 5CJOH 5IHUH 4CW1A 1PY9A 3ZDYE 2FH6A 3NABL 3ZE2F 2Y5TB 3UZVA 4RZCB 3L2NA 1M4KA 2VN4A 1FHGA 3VXPA 3LXBA 4GRWH 15C8H 1AXIB 4LVHB 1QR1A 1OARL 2YFOA 1KEGH 3HHMA 5CCKH 1TZ8A 3U4BL 2HJFB 4YHIA 1YNLH 4GINA 3W39B 4PREB 1WFUA 2NRDA 2AK4A 4FQ1H 1WYJA 2HUEA 1VKXA 3NZUA 1EJ6A 1EEYB 1N4XH 3FT4A 4S0TD 4YDKH 1KBVA 3V4PH 5IG7A 1X5AA 1EMTH 2NY3D 4OGAC 4AENA 4APQB 4KFMA 3HKZA 5DHYB 3QJZA 3CFUA 3VXUA 3N06B 4HSAC 4OZ4B 4X9BA 4YZWA 1FZJA 2W65A 3D3VD 5I8EA 4OM1L 3CXDH 3E1ZA 3TZVD 2I9LA 2OYLA 3W11D 2VL5B 5DQ9A 3C09C 1O9ZA 3ABLB 5KYXA 5DWUH 1DQJB 5I23A 3S3SA 1TTUA 3R4RA 5KN5B 4KUZL 4Z7VE 3FB8A 4TUJA 4X6DF 1JN6A 3ASNB 3TV3L 3GUFA 1BQ5A 2DYRB 4MB4A 1S5IH 4ZW8A 2HZHA 2ZUYA 2EXYD 3MBEA 5EN2A 1AZUA 1GC1L 3FTGA 1UM4L 2WBJB 3U4AA 5AZ2H 5SWZD 2TSBA 4JY6A 5BQ7A 3TA3D 4NN6C 1TEFA 1SN2A 1WBXB 3L16A 1NCJA 1ZA3B 1G9NC 1INQA 4ZS6C 4MCYB 3NIGF 4ETYA 2F1BA 1LE5B 1VFUA 3CU7A 2VZSA 1NCNA 3GMOB 1TU2B 2MHAB 2F7PA 5C7XH 4NKMB 4TNVK 3DROB 1JF1A 5B1JA 1L7IL 4P2OB 3CVIH 4G43B 1KG0A 5HHNB 4FADA 1AHKA 5TQ2L 1U4FA 1RP9A 2D0GA 4TN9A 3HZ3A 3NH7H 1GOFA 2FR4A 1YN6B 3EUDA 4X5XB 1FL3B 5ENWA 4TRPH 1H6FA 4NLAA 25C8H 2OMVA 2FX8H 3AZUA 2EZ0D 3DI2B 2K7QA 5EFIA 3ZE2B 4K4KA 4HWZA 3AXIA 1WCBA 2QELA 4G42A 3WXVH 3VWKA 4ZUUA 3IVKB 3FHAA 3OMZA 4KY2A 4P2QE 3S7GA 3U83A 4KJWC 2Z34A 5CD3A 3BH8B 4PJ9C 1KGUA 3RWHA 1INEH 2XY2A 2HRGA 4W9KC 1MJUL 1QLFA 1UWXH 4L29B 5CEYB 3FFOA 2R7EB 1PD1A 3E7JA 4FI6A 4G9FA 5ESAA 2FQEA 4D3CL 5GZOD 4I18C 4R5TA 5E4EB 5F1OB 5EBMB 2VZOA 2IGLA 3A67L 2F0CA 4TVPL 3RY5A 4MCNA 1OCWL 2ID5A 2XIIA 1KZYA 1QG3A 4XWOC 1VZIA 2IXQB 3C6LD 4RFEB 1O6SB 3EG9A 3B2UD 1OGAE 1JNNL 3NIDE 1I9RL 5C07D 1JTOA 3FH5A 4X6DB 5J56B 1BAGA 3CN4A 2XQBL 4PWHA 3T4YA 5IQNA 3MJ8B 1WBYB 1HIMH 1JGEA 2J56A 1H6EA 3CH8A 3FN3A 1YEGL 1EEQA 4PV8A 3MXVH 1UD3A 4H1LG 3G3LA 5BVJA 5CUSH 4JFTA 2XNAA 2X4QA 3LQAH 1QRNB 1W72L 5T1KD 5B39G 3NCYS 1V3KA 4WW1A 3QO1B 5CKAA 5BZWB 1P4LB 3NIGB 1LEIA 1FA4A 1R1CA 3V0VB 5EBWA 3KPNB 1MOEA 1CTMA 5DFTA 3QNZA 2YRLA 3KPQA 3FUFA 3MLTA 4ENED 1J5OH 1IGFL 4NN5B 1TTAA 5EO0B 2P8PA 2V2XA 3HMXH 2V7HB 4FHKA 3TASA 1MW0A 2XV6B 3EBGA 5HYSG 1P7QB 4QHKI 5IEHA 3D18A 3CPLB 3S6CA 4U0QB 5FKAA 2J1XA 3QC6X 4OFIA 4M02A 4WKXA 4YDLC 4F8NA 4K8RC 4GRLD 5A2JH 4U6HA 1PD6A 2TSAA 3HG3A 4LLQB 2EDXA 4NWUL 4YDIL 1AQHA 3B56A 5I5JA 2EYTB 3RYMA 3VXRB 4BSJA 4KNTA 3ILQC 3QNFA 1TZGH 3K0WA 4XO9A 4JO8A 4PJ9A 1KPUB 1JHKL 4ODUA 4ODHH 5E2JA 2LLLA 4X50A 4MXQD 1D2PA 2BNRB 3MKKA 4XB3A 4BSVA 3Q6GL 5JW4Q 4I18A 1JI1A 5ID1A 2K9UA 3IB4A 1TTBA 3ESOA 3U4KA 5E0QA 4PRID 5ITFB 3V5DA 3VDBA 4JL2A 3RB5A 3SN6N 4YLQT 2YD6A 4WHCA 1OE3A 1MWAL 2FK9A 1SZNA 1Z5HA 3SKJL 2BW5A 3AMKA 4Z3HA 4JKKA 1B0GB 1PPIA 3GM8A 5LGHL 1GA2A 3T08A 1NC2B 2FX7H 1VACB 3UIZA 3N1MC 3SGKC 4MRCA 4R2GB 1CDGA 2P5WA 1T1XA 4HS3A 5INCB 3VGBA 2J44A 1M1XB 1N18A 1G7IA 2WZPD 5DLMH 4I87A 1UKQA 4DFHA 1A22B 4R84A 3GMLB 3WAKA 1QLRA 1ETZB 1BD2A 4OCWL 5EU4A 2Y2WA 4UINL 5FDYA 1FUNA 3FOLB 3NJNA 5HDRA 1FV1B 2UVFA 1MG3C 3WNMA 1ZK5A 1U8OA 1AYOA 4XB7A 3L3OB 3PWNB 2X4NB 2C9UA 3TBVB 1RPQA 2FECI 2Y5EA 2RQEA 4XZ4A 5C09E 2OQJA 1NGZB 4P2RD 4HXAL 2OSLA 4D8PA 2VDPL 5LO7A 4JM4H 5CS7A 1AD9B 4FG6D 3IE4A 5ESQB 3MNMA 3N0PB 3CVHL 3MGOB 5TFSH 4XAKE 5IB4B 2X5PA 5AYUL 5DVKA 2EUXA 3BAYA 2OMXA 1QD0A 3FB5A 4OFVA 1MHHA 3DGGB 1KENL 1D9KD 2J73A 3L7FB 3VXSA 4L2YA 3UZQA 1PG7H 1CF8H 5AB1A 1E50A 5DDHB 3Q9QA 5HHPA 4WWNA 1SM3H 4MMZC 2E6PA 2UXGA 4YWGH 3CFEA 5E70A 3SGDI 2BNQA 1TIUA 1XQ4A 2OAAA 2BHFA 4OZHA 5CEZL 2CU9A 2BZCA 4G3YH 2X9WA 4OD2B 4ELME 1IGML 3F6IA 4DO6A 1IT9H 2XICA 2OYMA 3KLHD 4DTGH 3HMWL 4GUPB 3RU8L 1TFPA 4OGQC 4NGHH 4QD2E 3U48A 2YUXA 3LN9A 4V2CB 2G5BA 4L9LC 1F3DJ 1JZ4A 2ZXGA 4NQUA 4IHOA 1Q9WB 5KSBF 5I1KH 3N44B 3EO0B 3STBA 5DK2A 1G4RA 2OXGA 4JFPB 1ZT1B 3EJZD 3ZZSA 2PWFA 3SGKA 3G5VA 4LIQL 1GYWA 2O72A 4QF1A 2HUHA 1OP3H 5H2BB 4DN3H 2YS4A 3G5ZA 2FJGA 2AJVH 5E8OB 2APVA 5F6IC 2N01B 5GS3A 1AG6A 3VXQB 4V33A 5D6CB 5T3ZH 1BM7A 1JXFA 4IOIA 3EXJA 3L3HB 4A63A 3O6KH 3QNXA 4HJGA 3UC0L 2X9ZA 5HGHA 3WNJA 3CDZA 1CICD 4YPGB 4E41B 5EV7A 4BK8A 3GB7B 5E7FA 4KJPC 2WXJA 1AGDB 4KRNA 4TULH 4QHLB 5JHDB 5K9KA 3S35H 4UU9A 2VRAA 2H6UA 3LEVL 2IADB 5D2LE 3I3EA 5FF6A 2EAEA 3QFDA 3PUCA 3H42L 1L5GB 3ZHKA 1MW1A 2IANA 4ZSOE 4F58L 1FI8C 2BDNL 4BEIA 3VFMB 1NPUA 3K4DA 1OSPH 1XX9C 3VW3H 5IBTL 5D1ZD 4G7VL 1CR9H 1ICTA 3ATDA 4M8QB 4N0CC 3JTSB 4FNUA 1ZWIA 2ITDB 1BF8A 2YBGA 4LGSB 4G8GD 3T1FB 2EACA 1UVQB 4B9JA 4K3DH 4NNXA 5HDLA 1MY7A 4J39A 4N0UB 1BBDH 3ROOA 43CAA 3GHBL 4CSPA 1Z9LA 2BP8B 5I30H 1N5YH 5FA3A 2RFXA 2Y2TA 4HGKC 1LK2A 4IU2A 5DRXA 5HHQB 3TIEB 4LKXA 1ETJA 4PJCA 1QKZH 1G1KA 4ZTPL 4EZMA 3GZQA 1BJMA 4PJ5D 4TSCL 2WB1A 2A74C 2R83A 5IQLA 3W9EA 5E94A 1IIKA 3NJXA 4EBQH 3QDJE 4H8VA 2XKNB 5CLXA 3GSOB 3U1SH 3TNMB 2DW5A 4EOWL 5KBLA 4NZJA 4L9LA 4XC1H 3BVUA 1KCUL 5KSBB 1BMWA 1DDHA 3UGUA 2DPKA 4X5WB 4GLRI 4N2MA 4OD3H 1ODUA 4P4KB 4PWKA 4KV5E 1MCPH 4J3XA 4TNWK 1KELH 2IQ9L 2VABA 2P48B 5FO7A 2IALB 5I71C 1U2YA 5B8CC 4BFNA 1IGIL 3AT9A 5E6SB 2B59B 3G6DH 5F0JB 3KG5A 1DO5A 4FNPA 3GS0A 2D3LA 4WFFE 3QDGD 4EUPH 4L8DB 4Z0XA 2Z31B 1RZJH 3ZDZB 1AD0A 5DTFA 1X9LA 1CK0H 5BS0E 3WO3B 5JIIA 2A83A 2CDFB 12E8L 2ZQKA 3GZPA 4GUCA 5ALBH 4KUCF 3T09A 5I1CL 3LRKA 1AXSA 4H20H 3C6SA 3BPCB 4PU2A 2WQRA 2VLJA 3ZZLA 4ABVA 2EIBA 2F8OA 1AYRA 3LDBC 4HHWA 4L1DA 4X2UA 2AEIT 1SPDA 2LVEA 3IJ7A 2XKUA 3WYRA 1K4CB 3QUML 3WKNA 5H4YA 5FOBB 4HZLA 5JOEA 3AS1A 4N20A 3VQLA 4W81A 4B50A 1AFVL 2AJZA 3P69A 2F7IA 3HE7C 4RA3A 5D7SH 5A2LH 4KXBA 5IHWA 3EBIA 3MV7E 4GRWE 1EA9C 1ETA1 4FJ6A 4UQ2B 5IB2A 5ITBH 5DSCA 1QFWM 1CDJA 4PP1C 3K2KA 1AXTL 4UOJA 1DQKA 2GSMB 3U0PA 1YYCA 2D7QA 2XRAL 3BMWA 3U7WL 2WINA 5F9WC 1X4XA 2JJTC 2ZF9A 3U30B 2A74A 4ATWA 1Q1JH 4KVPA 4W93A 4UT9A 5CMAB 4G80B 1NJ9B 2D7NA 4FFVD 4M62L 1E2ZA 1XZWA 1TYJA 4WI6A 4Y2DD 4F7PB 2AJSH 2CRIA 1E7VA 1MCOL 2XN2A 4OCLC 4Y7OC 3NZ8B 1OZTG 1JP5A 3O6LH 3BN9D