2VMJA

Type 1 copper-binding loop of nitrite reductase mutant: 130- capegmvpwhvvsgm-144 to 130-ctphpfm-136
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
326
structure length
326
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCTPHPFMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title The Importance of the Long Type 1 Copper-Binding Loop of Nitrite Reductase for Structure and Function.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Oxidoreductase
total genus 83
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vmjA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vmjA02
1T5KA 3EF4A 4DP8X 3NSYA 3H4HA 5I6LA 4GYBA 2EILB 1HAUA 1ASOA 1JZGA 4KNTA 2PCYA 1BEXA 1ADWA 3NJMA 2FTAA 1ILUA 3GYRA 1OE3A 1YLBB 4DPCX 4E9SA 4YSSA 1PNDA 3NJNA 4UAHA 3WKQA 1AG6A 3QQXA 3NP3A 1NZRA 3CVDA 2UXGA 3FYIB 1WA1X 1OOWA 2BZ7A 2UXTA 2FQDA 2IWEA 1BAWA 3FU7A 3S8FB 2J5WA 4BXSV 2HXAA 2N0MA 2GB2A 1X9RA 3GDCA 2UXFA 1JZFA 3OMIB 4BWTA 1RZPA 4A66A 3ZBMA 3EHBB 9PCYA 3WNIA 3DKHA 5E9NA 3NJGA 3NJJA 4M4RB 2EIKB 2YXVA 2FWLB 3MX0B 4NERA 1QLEB 3ERXA 1L9OA 4KO9A 1PLAA 1KCWA 3SBPA 1L9SA 4DP7X 2QPDB 3QJQB 3JT2A 5I6PA 4ENZA 3AZUA 1W8EA 2FT6A 1PNCA 4FA7B 1A3ZA 1JVLA 2XXFA 3NSFA 1J9SA 1MZYA 3PLYA 2FJSA 1AZCA 1SF3A 4HCFA 3NT0A 4M3HA 2E86A 2QDVA 1JZIA 4YL4A 1TU2A 4DP1X 2J56A 2HRGA 1CUOA 1OE2A 2IDSA 4HHGA 3AG4B 3FU7B 4PCYA 1BYPA 3IN0A 2CUAA 2UX7A 3OD3A 1AR1B 1SNRA 2UXVA 3FQ2A 4A2EA 1EHKB 3HB3B 2WO2B 1ZDSA 4E9QA 8PAZA 4DPBX 3S3DB 2R7EA 1E30A 5B7FA 3FU8A 1OCOB 1URIA 2BWDA 3QJUB 5B1KA 1CYWA 2PCFA 3FQ1A 3X2QB 5TK4A 2Y1AA 5ANHA 4NB7A 4F7KA 1CURA 2DV6A 2QT6A 1M57B 1ZIAA 2PP7A 5TK2A 2XU9A 5AFAA 3SBQA 2P80D 1M56B 2XX1A 1ZPUA 2BP8A 3T6WA 1SDDB 1GR7A 4GXFA 6PAZA 3V9CA 5I6NA 4GP5B 1PLBA 1ZV2A 2RACA 3UABA 2YAFA 1NDTA 3TU6A 4DP5X 3CG8A 3QJRB 1N68A 2BW4A 3ABMB 4G7RB 4AI7A 1DYZA 3X1FA 4YSCA 2MTAA 1GYCA 2IH8A 3FPXA 2J55A 4KNUA 2X87A 4N8UA 4WTQA 4QKTA 3S3BB 2CAKA 5B1JC 2NRDA 4BK5C 4HCGA 3QJTB 1BYOA 2R7EB 1XB8A 1GS6X 3FSZA 5I26A 3SQRA 3OMNB 3QPKA 4YSOA 1PCSA 4P5SA 3TASA 4E9TA 4YSQA 4HAKA 3WI9A 1BQRA 5D4JA 3BQVA 2PP8A 4JHUA 7PCYA 1SHXA 1A8ZA 1GS8A 2HLEB 5B7MA 1J9TA 3X1EA 3ABKB 2WO3B 2H47C 1I53A 3NJIA 3EH4B 3IBOA 3CVCA 2AZAA 2FNWA 2BP8B 2BHFA 4HHWA 3AG1B 1WA2X 4AZUA 1CYXA 4WKXA 2AFNA 2VM3A 4GY4A 4G72B 5A7EA 2BP0A 3FS9A 3UAAA 2BWIA 2FT8A 3FU9A 4F2EA 1W6LA 2EIMB 1AANA 3CVBA 1AACA 4L0PB 4UF7C 1A4AA 2DYRB 4KOBA 2IWKA 2W88A 3U25A 3IEAA 1OCRB 4BWWA 3N55A 2YXWA 2OCCB 4K9JA 2H5UA 4A2HA 1V55B 1EZLA 2EIJB 4G71B 1AZBA 1IC0A 2GIMA 1PY0A 1KDIA 3H56A 1AG0A 4FAAB 1VLXA 1GS7A 2XXGA 2IDUA 1NIEA 1AS7A 2XV0A 4NAJA 3HEIB 1J5CA 1V54B 1SDDA 3PPSA 1JXGA 3L45A 3NJKA 1ETJA 3IN2A 2Y69B 1ET5A 2WSDA 5EHFA 2ZOOA 3KW7A 3OM3B 1ZDQA 1KV7A 5IY5B 1W6WA 1PMYA 1WS8A 2VN3A 4KO6A 3UADA 4EF3A 1GW0A 1ASPA 3AY2A 1SF5A 3JTBA 2BP0B 1NWPA 5B1JA 2Q5BA 2X88A 2VSKB 2FQEA 3ABLB 1NIBA 3CDZB 5PCYA 1NIFA 4DP0X 2DWSA 3SBRA 2Q9OA 3FSAA 1OE1A 2TSBA 4E9XA 4KNSA 2XV2A 1SJMA 1QHQA 4YSDA 1OCCB 1IBZA 1E5ZA 2AVFA 3NSDA 1KBVA 2B08A 2HRHA 5D4HA 2W8CA 2JFCA 3PAUA 1L9TA 3QJVB 1OV8A 2YAMA 3H4FA 4HZ1A 1PAZA 1M9WA 1AZNA 2A3TA 4BDVA 4E9YA 2FT7A 2J57A 3TBCA 1AZUA 2DYSB 4KO5A 3WG7B 3WKPA 4PAZA 2VMJA 4DP4X 3OMAB 3NJFA 1WAEA 2QDWA 2PPFA 2XVBA 7PAZA 1ZIBA 5I5MA 4HALA 3AW5A 1OCZB 1PZBA 1KCBA 2ZWNA 3KW8A 1N70A 1JVOA 4AKOA 2AANA 4E9WA 2YAQA 3CZUB 1ET7A 1CC3A 2VW4A 3NJHA 4YSUA 2CCWA 2ZONA 4DP9X 3T6ZA 4YSPA 1BQ5A 1F56A 1HFUA 1AS8A 2JXMA 1AIZA 3PAZA 1TEGA 2GBAA 4W1TA 4E9RA 1NIAA 2BZCA 2IDQA 4CSPA 3WIAA 4GP8B 1MZZA 1HAWA 2P80A 4A2GA 1V10A 4A2FA 1KBWA 3DIVA 1TEFA 1X9UA 3T6VA 1PF3A 1FWXA 1ID2A 1NTDA 4BXVA 1J9QA 1A4CA 1XB3A 5I6MA 1BXUA 1OF0A 2XWZA 1J9RA 3N2JA 3NP4A 4BDVB 4YSRA 3FSVA 1L9PA 2IAAC 1XMEB 3T71A 2I7OA 5B1AB 2PP9A 3ASNB 4KOCA 5F7AA 1PLCA 2VW7A 3FT0A 3ZDWA 2UX6A 3UAEA 4AKPA 4HCIA 2IDTA 2PPEA 4MFHA 4YVNA 1J5DA 4JKNA 2CALA 1KDJA 3QJSB 1AAJA 3CDZA 2GHZA 1JXFA 2GSMB 3C75A 4A67A 2YARA 1ASQA 3V9EA 1KYAA 3PCYA 2AZUA 3AG2B 3S3CB 2XV3A 5I6OA 1JXDA 3OQRA 6PCYA 2DWTA 4UANA 1JZJA 2XLLA 2IDFA 1IUZA 1L9RA 3NJLA 1RZQA 5B7EA 3FSWA 2YAHA 2CBPA 1SFDA 3AG3B 1E5YA 3TBBA 1BXVA 1UATA 2PPCA 3ABGA 3ASOB 2BW5A 3EH5B 1PZCA 5B3SB 1R1CA 2OJ1A 2XX0A 3PAVA 4G7QB 5B1BB 4CSZA 2XUWA 4Q89A 1AS6A 1ET8A 2FQGA 4RH4A 2JKWA 3IE9A 1RCYA 4N4YB 4YSEA 2HZHA 2GC7C 5I5IA 3X1GA 1A65A 1BQKA 1FFTB 5FC9A 4YSAA 1JERA 2VW6A 5AZUA 1NWOA 1AZRA 2FQFA 4G70B 3BVDB 2IWFA 4G7SB 1A4BA 2GC4C 2OV0A 3UGEA 3FYEB 1ILSA 1MDAA 4W9ZA 1IBYA 3T6XA 3D12B 5D4IA 2I7SA 3TA4D 4A68A 3EH3B 1IKOP 1L9QA 2LLNA 4ZK8A 5I6KA 3GXUB 4AX3A 2H3XC 1DZ0A 1JZEA 1NPNA 1TKWA 2VM4A 1RKRA 1AQ8A 2HX8A 2XYBA 1JOIA 1SFHA 1MG2C 3ZX1A 4QLWA 3WNJA 4KO7A 3G5WA 3S8GB 4DP2X 4E9VA 2HX7A 2B3IA 1E67A 2YAPA 2MRYA 4Q8BA 1QNIA 4X4KA 1NIDA 3FPYA 4P5RA 3MBWB 3FQYA 5I5JA 5I28A 3DTUB 5LDUA 2DY2A 2I85A 2IH9A 2YQBA 1KGYE 4YVUA 5AKRA 4TXVB 3RYMA 3X1NA 2PLTA 3NSCA 4BWUA 3X1BA 4YSTA 4GP4B 2YAEA 2BO0A 4F2FA 1E65A 2PPDA 2CJ3A 3ZIYA 1AOZA 3NYKA 1JZHA 1GY1A 1NPJA 2ZXWB 5F7BA 1SHWA 1XB6A 4A2DA 1PZAA 1BXAA 4HIPA 2YAOA 2VSMB 2QPEB 1GSKA 3UACA 4DP6X 1FA4A 1NINA 1WA0X 5PAZA 2HX9A 4JHVA 4DPAX 3PXLA 1GY2A 4AKQA 1WS7A 3T9WA 1MG3C 2TSAA 2GI0A 2PPAA 1B3IA 2EINB 1NICA
chains in the Genus database with same CATH superfamily
1ECYA 2WKGA 4X6CE 3MRHA 2AQNA 4DAGH 2J88H 1VGEL 3PWVA 4WRLA 5C3IA 3G5ZA 3DGGB 3NSJA 3SDAC 3C8DA 1CICC 2WUBH 2ZKYA 4PJIE 4XP9H 3VFTA 1CLYL 3VI3F 4FFVD 2WQSA 4ODXA 3AVEA 2ADFH 5DFAA 3UC0L 2NUTB 4I3SH 4IYKA 3KPPB 4JFYB 4WV1C 5FXCH 4DPCX 4ZSOE 5TDOA 1EGJH 4JDVB 2AQRA 3GO1L 2HRPH 5JQIB 3D39B 5FLUA 4GLRI 4JGUA 3HNSH 3FU7A 3DHPA 1I4FB 2JJSC 5HHMD 1Y18B 3EYFA 1LNUB 2DQTH 3IT8D 4NM8H 4BKSC 4R4NC 1FVEA 3UCQA 4F7TB 3HBZA 2WCPA 4ZFZB 4HT1L 3NESA 1CBVH 1CI3M 2EDKA 3QIUB 5DUJA 1GC1H 1UJ3C 2CIIB 3N91A 1Y6NR 5C6WH 1FIEA 3LNHA 4A2MA 4YAQA 3VB9A 4NRZA 5IB4A 3ZTCC 4ZW5A 1G0DA 1THCA 4PGZA 2VLKD 3BSHA 1R3JA 4AM0B 2C1OA 4ENZA 4HFUH 4ZMNA 3GXNA 2BM3A 3J8F7 4Z6AT 4GAYA 1Q9LA 4PJ9A 5BQDA 3BCDA 1LDSA 1QQDA 3MROA 2DMKA 3CN0A 3NCCB 4IIQA 2A83B 2XKNA 2RHEA 3C6EA 1ZT1A 3ATFA 1E42A 2EIBA 4OLUH 1ZLUK 5IIEB 5L8JB 4M3HA 3B9KD 2VZUA 1K9TA 1N0XH 4U1NA 2FECL 4I18C 2J1ZA 4R9HA 2HPOA 4Y4HC 3VXSD 2WHVA 2WVUA 5D6DA 1KUMA 3ZDXF 3LS4L 3BAIA 5D7JD 2XTJC 2ZWLT 1CS6A 3DO4A 3IJEA 1DUZA 5AYUH 3W2DL 4JW3A 2AQSA 5T3XH 3ZDYB 1TZIB 1C7TA 4NCDA 4NUQA 1CFVH 4NIYE 3PWNB 1RUQL 3I6GA 1BIIB 5EUKA 2C26A 3KHQA 5GRUH 2DYPD 1WG3A 2IAMA 3GXFA 3FSOA 3DUSA 3REVA 3VACA 3HHSB 1HHJB 3RP1A 2DOCA 3MRGB 3AXLA 3U79A 2WTRB 4UQIM 3TA3C 5HYJE 15C8H 1JI2A 4LPYA 4U33A 4UU9B 2V4LA 3JWNH 3MBEA 3SBQA 2G60H 2XJLA 3GXIA 2SODB 1URZA 2YGNA 1PBYA 5C0DA 5E1AA 4DGVL 1T5XB 2YEZA 1IKFL 2YR3A 4OB5L 3VXUA 5GRJL 4Y16D 4NO2B 5JHDA 4AGOA 4JGJA 2BS8A 3JV4B 1E9OB 3WO4B 4PJBB 3CFIC 3HNVH 5DRZA 2IALA 5DRXB 1JTPA 2P8LB 3BWZA 1F90H 2R4RL 4JVUA 4R4BB 1UB6A 1ZSDA 2CLVB 1SVCP 1XL6A 1FRGH 1J0KA 1FZKA 2R8SL 5JZ7C 2SEBA 1KMGA 4WK0B 5FO7A 4PJCE 4NZ8A 5HPMB 5FYJH 1ZLWK 4ZNEA 2WWOA 2Z4QB 2PCXA 1IMHC 4UT7H 3MR9B 4YHZL 3W0WB 1P4BL 2HKHH 5F97E 1LO3L 4RWHA 5D4JA 1MI5A 4LHQB 4BQ9A 3HG1D 2WO3B 3VG9C 3RGHA 2V5TA 3Q43A 3S36L 3MZTA 4UYPA 3LJ3A 3QCTL 3L3IB 2QKSA 5C6TL 1T1YB 1RZ7L 4QOKB 3H0TB 4Y88A 1CYXA 4WKXA 5E9DE 5KW9L 3NA4A 3B9VA 1AD9B 3LZQA 1ORQB 1AE6H 3V8CA 2DQFA 4P4KC 1KJ2H 5DK0A 2FR4B 1KNOA 2H2SD 5HHME 1A9VA 1A4AA 4M6NL 1LL1A 3GIVB 3OJDA 1SMDA 3SE4C 4LEEA 3IFOB 3BUTA 3V6FB 4PJGA 1MAMH 4Z95H 1OAQH 3WSQH 2PYFA 3MRCA 3P0YL 4HBCH 3QWQB 1IQWL 4WW2A 4R5XA 3FBKA 4XBEL 5HGAA 1MJ7L 1AQKH 2OULB 3PHQA 5DZJA 1OGSA 4H25B 2JSFA 4QHLB 1NFKA 4M5YH 1KLGA 3KVDD 3TESA 3L95A 2VDNH 4JFZH 2UWEE 4FQXB 3BISA 3TEUA 2IGFL 2HKFL 4OGYL 2E9BA 3F04A 2DIAA 3HEIB 4I77H 2VLLA 3L45A 3CZFB 2X2IA 3NJKA 1KIUA 1UWYA 4HJGB 1XF1A 3WS6A 4DKEH 1D9KD 3LZFH 2ZP8A 1DSFL 2WVVB 3M8OH 4WU5A 3UBXA 3LVEA 4DN3L 3WEAA 1HE7A 5EZOH 4CL7A 1A7OH 2WANA 5KBDA 1YNTF 2EDWA 1D5IL 2VLKA 1Y1UA 4NN7B 4OZGB 1KC5H 1XVSA 1UYWL 3FSAA 2M26A 3S4SB 5AZ2H 5IMKB 3HNTL 1W9XA 4NQEA 2DQEH 1PKQE 3TPUB 1W72A 1QHQA 3KLHD 3QSKB 2WY3B 4FRWA 4FYQA 1CXLA 1NFDE 3QUZD 4FQIL 4Z3EA 3TEZA 3NZ8B 3PP4L 4XN2A 1KSRA 4OTXH 5JO5B 2DQGH 1JZ5A 4JUSA 2VLJD 2XZAL 4LSDA 3CXFA 3BP4A 3B7UX 2C5DC 1GL4B 3MACL 3HAEG 1S7WB 3H42H 4AM0Q 3B5TA 1EXUA 1CXEA 3NMEA 2J1XA 3TBCA 1V7NH 3VXSA 2NX5D 1JFQL 4K94H 3AABA 4MJJA 5D7JA 3BSZH 3Q9PA 1MJJB 7PAZA 1JF1A 4XAWH 1X5FA 3TT1L 1JZ7A 1JNHB 2OTPA 4H5SB 4L1HA 5FV1L 5LCVL 4WW1B 3CHQA 5HHVL 2CCWA 3N1FC 1NAML 2DYPA 4P8QA 4AMKH 3GMLA 1YMME 2OI9B 2R0KH 5C2UB 3WFHB 1FO0H 2FECI 3LV3A 3OBAA 3WIAA 2Q76A 4X7EC 2OTWB 4OIFA 4U7KA 2A0LD 5EDSA 4F5CE 3C8KA 5I75C 3F5WB 3FULA 5T5FH 4DGYL 1YEHL 1NGQL 4LDEB 5J9PB 5F1OB 3QUGA 4XMPL 2ITCA 2VYRE 4Y16A 1J05B 3WD5H 4ODSL 4I8DA 2COQA 1U93A 2XWZA 2YA1A 4XR8C 2IAAC 4AOFA 5EF1A 3SQBB 4MNQB 1Q4NX 4ZXBB 1EBPA 2I26N 4FGMA 4UQ3A 3ULVD 5K9KB 1B0RA 3B9KC 3EO0B 1TF4A 2C1PB 4CDHA 3SOBH 4G11A 1DQLH 4X6FA 5K9OB 3HE7B 4LPVA 3WXVH 4CKQA 3H55A 4MCYB 5L88H 5BZWA 3B34A 4FNSA 2CH8A 2BLFA 1JXFA 2EDDA 3UTSD 3BH9A 2F74B 3K0YA 1N6UA 3HBPA 3WHE1 4MA1C 5DUBB 1SYVA 4Z0XB 4Z8FL 4OJYA 3A6BH 3ET9F 3RVXC 4IHOA 2OW7A 3IMRA 2AZUA 2VXUH 3F00A 5GGTA 3MV9D 3RPKA 2OXHB 3KPQA 3IU3A 3QFDB 1A4KA 4LSQL 4QXWA 5C07E 3UYPA 4NQCB 4WY7H 2J8HA 4LMQE 4X6DB 1A7QH 2VAJA 1INEL 2YBRA 3QZLA 1LEGA 4LSSL 1KLUA 3WJLC 2XN9D 4JFFD 2WKOF 4L2YA 5LAXB 1NBCA 2VDLH 5B1BB 1HL4A 3L4WA 1R46A 3CX2A 4Q6IC 3BT0A 2HFEB 4G80B 2XWJB 3N44F 5HVHB 4Y2DD 3FB5B 3QWOA 2QGDA 3ZR6A 3HC3L 3B5HA 4HKBB 3T8XA 2L4OA 3INUH 5KYWB 3KG5A 4P0DA 5MERB 4LPTA 3O8XA 3PAYA 1R9FA 1TTAA 4JHWL 4L3ED 4GG8A 5KN5A 3IPFA 3WJMA 1BJ1J 5FC9A 1A3QA 1A3RL 4O5LH 4G70B 5F0MB 4J3OC 3D0AA 1WHOA 3QULB 1I8IB 1UM5L 1IAIM 4WUUD 5KVEL 2WUCH 2Z34A 1CF1A 1ILSA 1D5RA 1T1ZB 2P3YA 4RMBA 2EXSA 3TA4D 2YFOA 3H3KA 1I1YA 2H3XC 2VXVH 2R51A 4FQCL 5HY9B 1RP8A 1KYOK 2QLVB 3BEVB 2XYBA 3I02A 2BIOA 2R4SL 5LBSL 3WNLA 5KTEH 5D5MF 2CJTA 2WQRA 2EDQA 3UTPD 3QFGA 4G7YH 2ATPA 2E56A 4NRYA 3HJ0A 2IXQB 3TBYB 1MCKA 4FXGC 2MRYA 4KQ4H 3VI3E 1T4KB 4HLJA 1NCWL 4P2YA 4YK4B 3ULSA 4PJ6A 4CU8A 4FP8L 2H2SC 2I85A 4Q52A 2ICEB 1C5CH 3GHEH 3RYMA 3RX8A 1QBMH 3PHOB 2PO6D 4GI9A 2VLJA 4NN5C 4YFLI 3LHPL 3ARQA 3T6QC 3P9WB 4HGKC 2A38A 3LIUA 5FW8A 5EUOA 1T2XA 1A1NB 2IOIA 2XWTA 3LQZB 5E23A 3L4CA 3VDCA 4AXWA 4FG4A 1WCBA 1JZHA 1MDTA 5C09E 4G2AA 2CK0H 2NX5A 5GGSB 2CLRB 1RK1A 3ARDA 2G3XA 3GF8A 4Z7UA 5F9DC 2NUPB 4MZRA 1D6VL 1NCAL 3ECVA 5I16B 2YD0A 2AV7A 1A1OB 1U8NB 2XFXA 2EICA 4IRJC 2BFGA 1RMFH 4ZFFA 1JV2A 5J7CC 3MOBH 3BCFA 3HPLA 4GMSL 4JFDB 4H4NA 4M43H 4JZJA 1D9KC 2UYLB 2TSAA 5DQJA 3T9WA 3ASWA 1KTLA 4NWUH 4PJXA 2VLME 4NNPL 1NMCB 4NQTA 1AMYA 5CUSL 2N56A 2C3WA 3V4VB 4MNHB 1OSEA 5CJQH 1ETZB 1U91B 4BZ2A 4KNTA 1HXYB 2KLTA 1TTBA 1WBZB 1Z0NA 2QPFA 1B4JH 2O26U 2WXOA 3OB8A 4J6RL 3ZR5A 4JO5A 5EIIG 2Y1ZA 5J6SA 1B6UA 1P4IL 1PNDA 5FA4A 4RAUA 3KLHC 1YNLL 2YD5A 1C8PA 3QUZC 3GFUA 3G08B 3ARGC 2DQCL 3BKJH 3BAYA 1WZAA 2RCSH 3S2CA 3ZDXE 4H20H 4KRPB 5F7MC 1R33A 4HUUB 2WLLA 5EOQL 1CR9H 1SLVA 4WJG3 4OCXL 4PUBH 2GB2A 3A4FA 3IETB 3QQ3B 3GDCA 3PWPE 3TFBA 3FZUD 1JCKA 2PCPA 5T1KD 4GEIA 4L5FH 1QA9B 1TPXB 3P4OB 4LLMA 1EH9A 3NJGA 4BQ8A 2HN7A 4JFFE 3TYFA 2DAVA 1PX3A 3U2IA 3VGDA 3UTSA 3BI9X 5FOBB 5JOEA 3P4LA 5DVOA 1UUSA 3IDMB 3NK4A 4LSUL 4JL2A 5E5UB 5BZXA 1KCWA 4WFFD 3QQNA 1NSNL 1G9NC 1MFUA 4X83A 2BJML 4ZFQA 3TJEH 1C08A 1JWMB 3T2QA 4B9GA 2FNBA 4GT7A 2DM7A 1YQVH 3AGVA 1HOCB 1G9HA 5DZPA 2GJZA 3W39A 4XN1A 5C0JB 2Z8SA 5IP4A 1VSCA 4NENA 4KRNA 3VD1A 5B39A 2A0LC 4LHUB 2XN9A 3EYOA 5D7HA 1WO2A 1UGKA 2OSLB 1WICA 4QRPE 2R1XB 1V7ML 4Z77B 1IEAB 4GW4A 1KBBA 2VL5B 1XF5B 4KK9C 3VFNB 4RQQA 1FH5L 1R24A 2VERA 5FECA 1RUPL 2EXTA 4HIXL 5DD0H 3APDA 1WBYA 4Y2DA 1GRWA 5CCJA 4TULL 5GGQH 1RPUA 3IJSB 1EFQA 4H26B 1QRKA 5DJ8B 4L3EA 4A39A 1UENA 2WXRA 1NL0H 4QXGL 3VSTA 3MLVH 4OKVA 1CYWA 1G7LA 4UNUA 5ENWB 3RI5K 3FTGB 3FQ1A 4FYSA 1TYEB 2X2YA 2Q7YB 5ACZA 2FJHA 2DV6A 1OAZH 2J6EA 4Z7VA 1I9JL 3H7BB 2H41A 3Q2VA 4Z3IA 5L9DH 1KGCD 5TGBB 3VO0A 4JLRB 5MEOA 5D7LD 4WI7A 2J6WA 2XKSA 3O4LD 4LGRB 2KDGA 1TSRA 1BQLH 1DBML 2XX1A 4WHDA 1N9PA 3VFRA 1M9SA 4LLQB 3NK3A 5F3HB 4GMTL 4P9HH 4NJAH 2VDQB 1HJCA 1GW6A 3V9CA 4GUOA 2DDQH 1P5UA 3C5SB 3VA6A 4H1LG 1MLCA 1NDTA 4ZW3A 2FO1A 4CW1B 1XIWD 1MFBL 3GJEB 2AP2A 1TU2B 4JO4H 3GZKA 4DWHA 5JXED 1G6RA 2ENJA 3KYMA 3VSUA 3BZEA 5F1IB 2EECA 3DUHA 1DN0B 1QRNE 3M07A 1QR1B 4ZO6A 2NT0A 1WWBX 1DJGA 1GGUA 4BA8A 2X87A 1KCLA 2GJRA 2JK5A 2K0RA 2MKLC 2XICA 1ZKAA 4K9EH 5JTWA 2X6CA 3KZ8A 2BIQA 2VZOA 3COOA 4J12A 1C16A 3PV6B 4N9GA 4XNMB 2QPSA 1KTRL 1YN6A 5E4EC 3AWFA 3OMNB 3SY0A 5E08L 3ECBA 4GRMA 4S10A 1BPVA 4LBEB 5DMGD 3VVWA 7PCYA 1XCTA 4M61B 5D1ZB 1CGUA 1OARH 1OVZA 3N06B 5LGHH 1FBIH 2Z35A 3QP3A 1IFRA 1AD0B 1F4WH 1KJ2B 4PRIB 3CVCA 4EXPX 3OSVA 4HIIA 1IAMA 4KKCC 3UAJC 1CXFA 1GH7A 4EN3B 2ADJA 2J1YA 4X6EB 3CN3A 4U3HA 4MDJB 4F9LA 3HLKA 4FI7A 3BN9D 1E8YA 3CQPA 3QDMD 4UTAH 5IT2H 1BA9A 3BPOB 3MUJA 4IKIA 2VMDA 4XNBA 4X9HA 5E7BA 2HJLA 4EBQH 3CVBA 4G43B 5HDLA 5CP3H 4G9DB 4DOHE 2EH7L 1ZHKA 4Z3HA 5KS9E 5KANG 3PL6C 2WLIA 3BP7A 3ZKND 2CMRH 4KY2A 5FX3A 3EOAB 1SDYA 3QJHB 2ZUSA 2WKLA 1CK0L 2Q8BH 3SGKA 5ISZE 5GS2D 2BOCA 5JNYA 3QG6A 4MZ2A 4ZPTA 4CU7A 1PY0A 1U9KA 5DC2A 1KFGA 1MRDH 2PUQT 1U3ZA 3UIYA 3U9PH 2YFNA 2YPVH 4JNXA 3STZA 2E27H 1AS7A 3QW9A 4S1RL 2PO6C 2XV0A 4YPGB 4L8SB 1YYMH 3FT3A 3TO2B 1ETJA 4LF3B 2NY2D 5JIKA 4EUPG 4RFNB 5EEUA 1UXWA 1CTNA 1EO8H 1I9EA 2XQYG 5EHFA 4Y5XB 5GISL 5I1IL 1I82A 4JO1H 1KV7A 2DQDH 2FAUA 4Z23A 2HG5B 4EF3A 1VACB 3QIWD 1RZFL 3UG3A 3GJFA 3PIQB 5ICYB 1XF4A 4XTRD 5DVLA 4G3YL 1NGZA 2QSVA 3VD3A 4BSVB 3C5XA 5PCYA 3LN4B 2ROYA 1F4XL 3FQWA 2QTEA 4GSQA 5K39B 4WGKA 1BW8A 2BSTA 3KLDA 4PREB 4E2OA 4XVUC 1IBZA 3QDGE 3D3VD 1CDUA 3IDYC 4HDIB 2R0LL 3VXRA 2JF1A 3WY3A 1H3WM 4POUB 1OHQA 5TE4L 5DT1H 2CJSA 4WWKA 2CO6A 2YKLL 2PXYD 3WN5A 4MMZB 1Z3GL 4ZUUA 1M9WA 4PRBA 1TXKA 3ZZQA 2EDXA 3EDDA 1YEGH 4NI3A 3WG7B 4JZOB 1H9VA 3PY9A 2VMJA 2P5PA 3QO0B 1LEIB 1KEML 1NUGA 4EZKA 1A4JA 4AITA 3ABZA 3V10A 5F9WC 5EOCH 2XVBA 3QI9A 3IDIA 3UGUA 4AKOA 5I1JL 5DO8A 1FO0B 4PJHF 1U2YA 3BWAA 1DE4A 3D08A 4L9DA 4CADB 2HTKC 1QX1A 2CDFA 3GSOB 4UDTB 4JQVA 1HIML 1N59B 1MFEH 1VCBC 1IFHH 2EC8A 3UPCA 5JOPE 5L2JB 3S0PA 3MLZH 5D7LA 2D3LA 5LQBH 2V8LA 3O4LA 4LCCA 5AWNH 4G8FA 2BPBA 5E03A 4A2FA 1U30A 4ANKA 4WKZA 2R39A 4OQTL 4XE5B 2O6PA 3E2HB 3ILPB 4GSRA 4PY7A 1WAAA 5LGKA 1HHHB 4GUPB 4QCIB 1J1XL 3QZOA 3N2JA 3U7AA 2PKDA 4NM4H 2G9KA 1F6FB 1XIWA 5CD3B 2BNRD 1I7ZA 3QEUA 5L0QB 5JXEA 5FUCE 2EIDA 5HVGB 2OMYA 3LKPB 5I19H 4QHUB 5BUAA 3HA0A 3FFCB 1ZSHA 3RL1B 1PLCA 1EXGA 3AAZA 3LIZL 3S5YA 1EUTA 4RESB 1WBXA 2EKSA 3QO1A 4R7VA 4V33A 5DMIL 2H6OA 1XGRA 4Z7QF 2BCKA 1A25A 1WPCA 3O41B 4JFEE 4AYID 4XN7A 2Q2LA 1GA2A 4M03A 3SD5A 3SBWA 2IADA 4QJ4B 4LRNH 1CL7L 2VXQH 1UM4L 4GRLC 4KUZH 2JKSA 4OT1H 1IM3B 2F7PA 1E6JH 1M6UA 3F12B 3GKWL 4N2MA 4UANA 3P1VA 1HXKA 4KMTL 1UWEL 3Q8FA 4N8VB 1ADQA 4P9ML 4U1KB 3AU1A 3GSVA 4PTTA 1NBVH 5F7DA 3TBBA 3WS3A 4DQAA 3SDYL 3AREC 5FKAA 1T2JA 4KPHH 1QVOA 5D5ME 3QDJB 3QDMA 2HYMA 3CFQA 4HUXA 5I8KH 4NZRL 1USZA 1F1GA 1OOAA 2YS4A 1MWAB 2GY7B 1FZMB 4LEOB 1JCVA 2DL2A 2VLRB 1VFAA 4TLTA 2ICWB 4FDWA 4PWFA 1GZQA 1T03H 3GRGA 4QAMB 1KB5L 5I5IA 1M1XA 4TTGA 1IZJA 2XA3A 1OAXL 1XV8A 2R1YA 4EKXA 2L0DA 1G84A 3FO2A 3OX8B 1E0OB 3VH8B 3R1GL 4E41D 1HTYA 4PW4A 1J10A 3ZYZA 1S7RB 1FNGB 2GBTA 2IWFA 3PP3K 2IANE 2MPAL 5DMKB 1HC1A 1DJXA 5F1SA 3OAUL 4JCWA 2VB5A 5DRNB 3Q48A 2ZX7A 4LVNB 4S2SB 3ARFC 3HZVA 4P46C 2Y1YA 1M1SA 2QADB 3P11H 4AC2A 1XZ0B 3OC5A 1DQJB 4G9FA 5DMGC 2YWYA 5DK3A 3FOLB 3MKKA 1NLDL 3QJFA 4TSCH 5FUCC 4AEIL 2EYSB 1W15A 1AQ8A 3QIWA 3BD5A 1VPOL 4Y9GA 3Q05A 4N6QA 4FKHA 3HAEA 4H0LC 2A9CA 4JHZA 4BKTC 2DEYX 3FB6B 1WITA 1NAMB 4GO9A 3ZK0A 5F72S 3PDOA 1R5VA 1HN1A 4IRSC 3TN0D 3HB3C 1PQZB 3CZJA 4JRXE 2O5XL 1E3FA 3VXOB 2H32B 1JHTB 1VKXB 3NEOA 3W9DA 3LCYA 3D3VA 3BKMH 5T1LD 3MLRH 2FRGP 5A40E 3ZKNC 1EVTC 5JLZA 2YD1A 5IMLB 2PXYA 4GP4B 3WUWB 3HCVB 2YAEA 1TVHA 1XGTB 2CUHA 3DX7A 4HQQL 1XO8A 3C9NB 5I30L 5EA0H 3DOIA 4NFCA 2BINA 1ZLVH 4P5TC 3KGUA 2Q3ZA 4ZZFA 4ZD3L 4HPYL 4PP1D 4NZUL 5D8JH 2FZ3A 3GNMH 5HVWA 4F8NA 1A1MB 4G6AC 3V4PL 5ES4B 1VZIA 3MRFA 5I66B 3JTTA 1QW9A 5IK3B 5T3ZD 4GAJL 1T22A 3DC0A 4AQEA 5I15L 1YMHA 2J4WH 4J4PD 4PIRF 3OKNB 5EEYA 1WS7A 3DTDA 2W65B 1LE5A 3KBEA 1IGIH 4JY4A 2XNAB 1WF5A 2IVFC 4FNQA 1KJVA 4UOW0 2RQ8A 4PJFB 4ETYA 2V9RA 1TOXA 3HG4A 1DL7H 3Q1SL 2IV9A 3FCSA 5DHVA 5KVMC 1OE3A 4NYLA 2VC2H 2H1PL 4G8EB 4MA7L 1M6OA 3HZYB 1IL1B 3DX9B 3O9WB 3MLSH 1T04B 3NJNA 4GBXB 4P2RD 3QQXA 2D7NA 4CN1A 2BNRA 1YEFH 3Q44A 4XRCA 2IWEA 4Y4KD 1OO2A 1MH5B 2Y36L 3ZHLA 4IEFA 2I9TB 4ZUVB 1NGYA 2N0MA 4Z76B 4LQFH 3KPSE 2Q86A 4GQPH 4J23A 4AIEA 4FX5A 2WP3T 3U0WL 4HSAC 4A66A 4AGPA 4X8JA 4DGIL 2Y2YA 5C71A 2LOEA 5GRVK 1GIGL 2LLLA 3WJJC 1S3KL 2Y6SD 2Y5EA 4AQ8C 2QGBA 5C0CD 1THAA 3QFJE 4P3WA 3K1KC 3SBPA 4C4KO 4Y5VA 2XG5A 3QJQB 3TBSA 4P5KA 3CSYB 4M02A 2BS71 2YPLB 1EEZB 4FA7B 1DQDH 2Y2WA 3W9EA 2Z92A 1IGFH 3H9SB 2EEBA 4Z7WF 1FYTE 3CUPB 2HFGH 4PCSA 3F8UB 4N6RB 1DFXA 1TDQA 2JE8A 1CVRA 1DQVA 3CDGA 4K4KA 1FG2A 3NT0A 3D34A 1Z66A 5DDHB 2R29A 4ECNA 1E4WH 2EDFA 4CKVX 1Z32X 3IFLH 1CI5A 4D9RD 2IDSA 4XNQA 4APQB 2GJ6D 4ONHB 3DVFA 4YDKH 5D1XA 5IQ7L 1SEBA 4FTVB 4QT5B 3D0LA 4HLZG 3ZLQC 4DO4A 1EHKB 2PR9A 2CKNA 2FWOA 3QPXH 4FEMA 5DJAA 1FGNL 2NXZC 4XOBA 5DRWA 4YXHL 3SPIA 1TZGL 2R7EA 4HS8L 5B7FA 1PDKB 4E9LA 5JHAA 4R2GD 5B1KA 4LSTH 3EOBA 3SKMA 5KSBB 2W81C 2XG4A 4AGQA 5I0YA 1E8ZA 4M56A 3SD2A 4E41A 3DYPA 3LDBB 4R83A 1JGLH 1IM9A 3GTTA 5JIMA 5EH1A 3SDCB 1RUKL 1UXMA 1KYUA 4ZMWA 4GSXA 3VD9A 1YEKL 2EXWC 3B6SA 3CQFA 4HH9B 5IG7A 1AKJB 1DP0A 3VFVB 3K46A 5AAMC 2G0LA 2ARJA 5TF0A 1KXTB 2IH1A 5F71A 3FNKA 1LEKB 4WEUD 1F2QA 5CKGA 1X5GA 5FUZH 4IW4C 4LLAA 4LLYB 1UB5A 4P5MA 2VDML 3UFIA 2JTYA 3EBHA 3WTWA 1AXTH 1U92B 1MCOH 3RZCB 1G43A 4IM8A 2NY5C 3Q5TA 5DYFA 3TN0A 1B9KA 4KXBA 1MCPH 3VU1A 1CVSC 2DTSA 3LZLA 2R27A 4GSDH 1ITBB 2L7JA 3U46A 2X4TA 4M7KH 3FF7A 5T1LA 2FSEB 4GXVH 3BFWA 5SWQA 3RQ3A 4N5UA 1VEPA 3NFSH 1YNKH 3QAQA 1PCSA 4NKDB 5DJ6B 4PHZA 1UT1A 4OZ4B 2MOGA 4JHUA 2O61A 1FAKT 5DR5L 5IEHA 1JRHL 1O5PA 3FO9A 4MJIB 1AJ7L 4CNIB 4OUUA 2GT9B 2X1OA 3MGOA 1KIRA 1DJHA 4QJ5B 5IR1B 4N8CL 5MEPB 2AJVH 1A6ZB 2PR4L 4KDVA 3TO4D 3AMKA 3ULUH 3PFQA 3VWJD 4AL8C 1TUPA 3NACH 1QEWA 4TQIA 1N5YH 4BFOA 5JQ6L 5ADOH 5IHZA 1MHHA 3DXAB 5LWYH 4PVBA 4CU6A 1EHAA 2XN2A 2B15A 4Z78A 1RV6X 3VD4A 3SSGA 1DTUA 2YUXA 4KOBA 2ITFA 1OP4A 4RGMC 3OXSA 1H8SA 1QLRA 4IGBB 1M4KA 3P4NB 4XPTL 2B1HL 4QF1B 4H2CA 1O7SA 4PFEA 4RGNE 1ZK9A 2DJSA 2GAZA 3MLWL 2BC4A 1Z6JT 2JJWA 3B7TA 5EU6B 1A6TB 1DQQA 1E9PB 3MRIA 5CLWA 4OM1L 4HWUA 4F57L 4NQXA 1OANA 1SLWA 4P2RA 2WN3A 4HLEA 4FZ8H 4PRHD 4PS4H 2OZNA 4LOFA 3C60C 4OLZL 4W68A 5E8EB 3DMMA 5BV7C 4Y4KA 2C9VA 2DBLL 4JO2H 5EEVA 3WDIA 3IN2A 3D5OF 1ZHLA 5IFAH 1ET5A 5T5NF 4KZCA 4JM2F 1DR9A 4AH2B 1R75A 1R5WA 4WF7A 5D9SB 1J9CT 1GZPA 3BGMA 3MV8B 4MAYD 3TF4A 4PJHE 3DJ9A 5DFTA 4EIBA 5F93C 4F15B 3CFKA 3B2VL 3P2DA 1P7KA 2ZP0T 3SDDD 3BVNA 4PP1C 2ATKA 3C08L 5KG9A 2ZCLL 1OB0A 1TMCB 3VX1A 1I9RH 4BUGA 1EV2E 2VSKB 5IFHH 1DBAL 5C0CA 4ERSL 3JSSA 5H4ZA 2Y06L 3C6LA 1P4LB 4XHJC 4AYSA 3MZGB 2XVKA 4J4PC 5FYLD 1AVAA 2IQ9L 4WFHD 4ZQKA 3U6XA 4ELMB 1AHWC 1JZ4A 4EQ2A 4D0BB 1YEEL 4F92B 3E8VA 1IEBB 2W8CA 3GHPA 2IDCA 1OV8A 2Z91A 1CLZL 1KCVL 1WFMA 3T77A 2XV6B 1DVFD 1JK9B 3AQDA 1DQIA 3Q3GA 2A3TA 4U1MA 4GLRH 4AEHL 5KVFH 1DDHB 3EGXA 3GSWA 1AZUA 4KO5A 3VDAA 2OMTB 3OMAB 3EJUA 3JV6A 5J57B 1FFNB 3I3BA 4KKRA 1PG7X 1LDPH 3WAKA 2C3VB 4TSAL 2QKIC 4NQDB 4UV4L 5A16B 2AABL 3R19A 1XF3B 1FORL 3IU4L 3KW8A 4HALA 5F7HA 5IESL 4IQHA 4KI5F 1RZJC 2E7BA 1F4YH 4HJUA 2UY7A 1NFIA 3DWTA 4Z7QE 3MRQA 4H1LA 3ARUA 3H3PH 4N1EA 4LAJH 4AE1A 5BO0D 1PY9A 4TPRH 3LQAH 1MCLA 5BCAA 5KYXA 1E6OH 5KYNA 1SOSA 3ESNA 1JD9A 1ZS8B 3QHFL 4RGNC 5CBEB 1EWHA 3L5IA 4P2AA 1WIPA 4BE5A 3MLPA 3MYJA 2BZCA 4CSPA 1J1OL 5JW4N 4EIUA 2YD2A 4MQXC 3FMGL 1O6SA 4IBSA 4PB0L 4K5NA 1UD3A 4J28A 3GSQA 3QNZB 3CFJA 4LNRB 2IMMA 1MHCB 4NOFA 4WWPA 3B2UC 4KWUA 5D55A 1JYXA 1W72H 3GSRA 4BDVB 4PJAA 5HYFA 1L9PA 3FT4B 4NKMA 1T2QH 4JG9A 2A73A 1R3KA 2F7QA 3T71A 4QRRA 1JJUA 4Q58C 2F58H 2FJGA 3SE8L 4E0RA 4DO5A 1P2CB 4UTCA 3ZDWA 3BYTA 2IGTA 2N1TE 2IDTA 4ORGB 1HU8A 4L3CB 2HTLC 4UM8B 3T09A 4G6MH 2CALA 4FFZL 4Q2ZA 1EDHA 4UIMB 3RDJA 2BVTA 2V9UA 3GZQA 2B4CC 3RNQB 4MMXC 2Z31C 2JXMB 3RVTC 1BBDH 4TLUA 3T0XA 3MCLH 3T0ED 4PJIA 3OZ9H 3JBG7 5JPMA 1OAYL 3KXFD 3MLXL 2LAGB 5MEQA 5KBMA 5ABDE 1F1AA 4QNPF 2HWZH 3HZKB 4UT6A 4ZSOA 2C9SA 3PABA 4MDRA 2Q7AA 3FFDA 3KGRA 1UCBH 1WGVA 4LCWB 3WFZA 4X4YA 1G4RA 2O5NA 1E5YA 3HG3A 3BKCL 4JQXC 4R0LC 4C59B 4OF5A 4EKJA 2NNAB 5CJ8A 4FA6A 1SLUA 5DGQA 4N2IA 3QUYB 2BW5A 5H37G 5B3SB 3FCGA 1IKNC 1I8KA 1W0YT 2F7RA 2ORBL 4NAMA 1PD1A 5CINH 4W9JC 1DLHB 3W37A 1JRHI 1TQTA 4LK4A 5K9QG 4PRNB 5F7WC 5E6SB 4UUJB 3NJXA 2XQYA 2WZ0A 4RNRA 3SYOA 4WUKL 2YN3A 2JKWA 5IQ9A 4XBGB 3CFDA 2EDOA 1KJ3L 1G9NL 1RU9L 4PJ7B 5FHBL 1HX0A 3SY6A 3ZDYF 4PRDB 4PCTA 1NDGB 1RJLA 1ZTXH 2E47A 3FRUB 3SGDI 1UOVA 3D05A 5MEND 2J25A 5KZCD 2FGWL 1FL6B 1HCYA 2ZAGA 2YD7A 3BVDB 4PJ8C 1TVBA 1YUKB 5TDNB 4L18A 1EJFA 2OV0A 4ILDA 1VFMA 5FKPA 4W4OC 4YHKH 1TJIH 5I6XB 2DL9A 5KJRL 2DQMA 4KH2A 2NNXA 1ETA1 2R2EB 1DVYA 3GEFA 5D4IA 4A68A 3D18B 3AITA 3EH3B 5H2BB 3Q2WA 1UA6H 4HG4J 3GSXB 4MAYA 4OFVA 3DX0A 5GGTH 5ABAA 1NJ9A 4D0CA 1PZUB 4HUVB 4Q74A 5T8IA 1LO2H 1MIML 1TZOA 2QTVA 3BPNC 4AYFA 3O6KL 1DO6A 1HSBA 2HCZX 4PJBF 1SPDA 1QTSA 1VGKB 1I31A 4U1GC 3TO4C 3ULVL 3VWJC 3AY4A 5DS8B 1U8HA 2EC9T 3J07A 1LGVA 1NCNA 2P7TA 5FYKU 4O9HL 4XAKD 2AK4E 4FG0A 2IBZY 3U4BL 3MGTA 5I5JA 1VIWA 3IJHA 5C7ZA 1CDCA 3IDXH 1TQBC 3S98A 4ZX6A 5C1MB 4RGOH 2X4OA 5D1QB 1XFPA 3CFCL 4EI0A 2F5AL 3U7YL 1N3NA 3WELA 4DVRL 2HG0A 4CC4A 3OWEA 4G8GD 2J8UA 1NANI 2ZIDA 2RH0A 3MKGA 3OKDB 4HKZA 1ES0B 2WD0A 1KGXA 1MRCH 4OCLC 3MODH 1VERA 1X5IA 3I9GL 4DP6X 3VI4A 3T8VA 2F54B 3CZSA 4H88L 1KN4L 1XMWA 1IC1A 4LCIL 2TRHA 1YY8A 3E8UH 2CR6A 2WLNA 4S1DD 4EI5D 2A6JA 3AQXA 4M4RA 4AE0A 3IDNB 4UMGA 4A38A 2VITA 4AUJA 1DJSA 4TUJA 2YA2A 3UJTL 2VC2B 2WLJA 3QC5X 1E4KC 2OTUB 5ANMA 3RY4A 1WC7B 3SDDC 5GJSL 5D7IA 3QGVA 1ZWIA 5FPIA 4PJDB 3WIFB 3WLBB 1RZKC 3NFPB 5ICZB 4IBTA 1Q9WA 5FK9A 4Z7WE 3UTQB 1FP5A 1H0DB 5DEFA 1HEZA 4EVNA 1T20A 3OHXB 3ZQ9A 5EBWA 4P49A 2PTTA 5KYUA 2E6JA 4J8QA 2X89D 3TT3L 4AY0A 3ESUF 3N5AA 1OGAB 4WI9A 1A7PL 1MJUL 1MIEH 3ESOA 4DO6A 2J8OA 4PD4J 4JDZB 3F84A 1ZA3B 1WA1X 3FYIB 1OQXA 3CJJA 4PLNC 3D1MC 3PGFH 1JGEB 1FL5A 4LL9A 4LOUD 5JIPA 2PYEB 4C56D 2PN5A 1MAKA 1FNEB 2D0HA 4P07A 3DECA 3UZQA 4E42A 2FO8A 2W1NA 4N0YH 2H0FA 3QZNA 1ODAA 1QFWM 4LMQI 3RWGA 3GB7A 4XP4L 4Y2NA 3UTTD 4YS4A 5HYIA 2K9UA 4G6KL 5LNGA 1MFMA 1BFOB 2AXHA 3K6SA 3PWLB 1KB9J 1G6RL 1KB5B 2NW2B 3BEWB 2NY0B 2ICES 3TV3H 3UTZA 4L05A 2W07B 3RNKB 1QW8A 1ZANL 4NERA 3V5DA 4MQ7B 3VYPA 4HKXA 5ESQA 3CFUA 3ERXA 3T0EA 3B4NA 1MFNA 3MRHB 4JBSA 4L0YA 1Q8MA 2X9ZA 2IBGA 2LT9A 3KXFA 3G5ZB 3AZUA 4ISVA 4G83A 4OZGF 3VFTB 3IKKA 3MLUL 5JW4M 5KBLA 4ODXB 2YGPA 1ZHBA 3BSGA 3X3FL 2ZPKL 3IXAA 3KYKL 5DSCA 2AK1L 2IFGA 4NP9A 2V3EA 4JG1L 5TDOB 4HCRA 3LB6D 4XP6H 1RIHH 1ICTA 1LQBC 3FRPG 5HHPA 4BZ2H 2NY3B 1TR7A 3WXWH 3KDMA 3LPOA 4DP1X 3L1GA 3C12A 1CUOA 1F3DH 2O5ZL 2OJZL 3FU7B 4RDBA 2ENPA 1FG9C 2EDLA 2NYKA 3ZKXB 2WXJA 1PFOA 4XBPB 4B27A 5B38G 1GGYA 3EYFB 3OKKA 2DQUH 4GIOA 3VGAB 1WDAA 4F8OA 1MCWM 3V0JA 4TLKA 4CAGA 3N43B 1FC2D 4HJEA 3T1WA 3F64A 3QHZH 4GQRA 4RAHA 3QK0A 4RSVA 2EE0A 5D2LE 4YAQB 3LXCA 5MENA 1FLTX 5CXPA 4NRZB 5IB4B 3TXAA 5ANHA 3H2PA 3U4EA 1S78D 4XMTA 4QO1A 2FD6L 2PP7A 1R3JB 3MRBA 4U3CA 1MW0A 2C1OB 3WNOA 4DETA 4R90H 4F37F 1UFGA 3JV5A 4PJ9B 5JA9A 1M56B 1QQDB 3MROB 2KQMA 4Y19B 4IBYA 2LHAA 4IIQB 4GUQA 3BZ4B 2XKNB 1P5VA 1ZT1B 1Y0LA 2AF2A 5C0BE 1ZLEA 3GUTA 4G8GE 4OJDH 4B5EA 3QIUD 5DZVA 4TOYH 5CEXA 2I32A 1PD0A 4U1NB 2V17H 2UZYA 1MCCA 2E76C 2I5YH 1GYVA 1OP5K 3IJEB 1DUZB 2B0SL 1F58H 2LR4A 5GHWL 4W9DC 3MJ8A 2YK1H 3CQQA 3FPXA 3CHPA 4PLOB 1QHPA 4M00A 3KL3A 4HZLA 4PLKC 3I6GB 5EUKB 3S88H 2ADYA 1HEJC 1OM3H 4OGXL 2IAMB 3RUGA 4MKTA 1CD8A 3D33A 2J3SA 2NLJA 3DUSB 4PGBA 3REVB 1TCRA 1FIGH 3AXLB 3QUXC 2MFNA 3D0VB 4F5CA 4AVJA 2NSXA 1NCUA 3QXUA 4WGVB 1GS8A 3MJ7B 3MBEB 2I24N 4ZX5A 1GJUA 3GINA 4U6HA 2VR5A 3K1DA 5C0DB 5E1AB 4XN8A 4XZUA 1NQBA 4XB7A 3MJ9A 2J6EH 2YGOA 3VXUB 4FQ2H 4MRCA 5JHDB 1WA2X 5ABZA 3LH2H 2OAAA 4X6DF 3X3GH 3ZXAC 4K55A 3P0YH 5DRZB 2IALB 4WHTA 4ACPA 1MJ7H 4NZDA 1UB6B 4EI5A 3OR6A 4KVCL 1ZSDB 5CLZA 4YDLC 4C56E 1I1AD 2QV2A 1TZAA 4Q0XL 2FBJH 1JE6A 2IWKA 1AGDA 5FS5A 2SEBB 1E3XA 4MBRA 3ZTEA 1J8HD 2OCCB 4FXKC 2C4FU 4WCYH 4XXWC 5FO7B 4A2HA 4G71B 4ZRGA 5CFAA 5KSUA 4FJZA 2VXSH 1P7BA 2Z65C 4KY1L 4UQCA 1CFSA 1DSFH 4P3CL 4LPUA 4F7MB 1X3DA 4TNWK 5JIHA 4DNLA 4V1DE 3E9TA 1AI1H 1MI5B 1GS7A 4BUQA 4R8WL 4HS3A 5GJTL 3JWNG 4ZTOL 5DQDH 1JHLL 4HJSA 3OXRA 2D3VA 3LEVL 3ZT6A 2OMVA 1KTCA 1ZY9A 3QUMA 1RULL 5CGYD 3X11A 3A6CL 1V54B 2XA8L 3L2LA 1F3JA 5E5MA 5C7XL 3CVHL 3HHMA 3N1MC 3WEMA 1CT8A 1DHKA 4KI5E 4XNAA 2YGQA 3RBGA 1HWGB 4UOW1 1ZDQA 3O3AA 5CSZA 4A63A 3UTTA 1P7QD 3G7TA 1GW0A 4ONGH 3GS0A 2JKTM 2DQFB 2WWMD 5J1TC 5DK0B 1NCCL 2DI9A 2W95A 2Q5BA 4JY6A 2YMOA 4N2CA 1NIBA 4P2QD 3MACH 3ML9A 5J8OA 1G4MA 3OJDB 5AW1B 2Q9OA 4J7RA 1QFPA 1MRFL 3II1A 4DZBA 4YEFA 4KNSA 4G5ZH 4FN0A 4PY8J 4X7DC 2ALWA 5HI5C 2HMID 2R0ZL 4PJGB 2NY4D 3DJTA 4YUEL 2PYFB 5IVXA 3MRCB 1FPTL 1FFOA 4WW2B 4PRAA 2V2XA 5D4HA 1GGIL 2CA3A 5HGAB 1SXBA 2FJUB 3PHQB 1CMOA 4CMMB 1BZOA 1KLGB 2B1AL 5HHVH 1GCFA 4JM2C 3KL0A 2XIBA 3U83A 3L95B 5F89A 4ODWB 2J57A 2DYSB 4Y2LA 3D39E 1A5FL 3V95A 3VFMA 3VTTA 1C5BH 2VDMB 1T0OA 3BGFC 3SJVD 3T1FA 5I2IA 1KIUB 4J3VA 1WTLA 2ZOTA 1OW0A 4LLUA 4QHKJ 1F42A 1DUYA 1J1PL 1Y6MR 4XVJH 5E00B 5I5MA 3KYNA 4HETA 2D73A 2E6PA 4WU5B 3UBXB 2QQNL 3JWDC 1A3LL 1ED3A 3EDFA 4LIQH 1JWUA 2ZKXA 3SN6N 4DQOL 4XMPH 5CP7A 3JZ7A 1AS8A 4NWTH 4XPBL 4IKJA 2VLKB 5ADPH 5KVGL 2Y3AA 4L9LC 2NXYD 5L7XL 3A3YB 3RIAK 5AW5B 5HTSA 4NQEB 1N5AA 3GJFH 4JPWH 1JS4A 1W72B 4FQXD 1KCSH 4HK0A 3GRWH 4OCYH 2MQ3A 2XQYK 3T6VA 5INDA 1IC4L 1FNAA 5LXVA 5DD6A 5T1DH 3BP4B 3B7RL 2HSIA 1NAKL 1VFBA 3G04A 4M7LL 3TFKD 1AIFA 1YCSA 4XT1C 2YUWA 4DZ8A 5BXFA 1EXUB 3LEYH 3EJRA 4W9LC 1MFDL 3VXSB 1QSED 5D71L 3LB6C 3CFMA 1J18A 5D7JB 4YXLH 5BOJA 2YRBA 3ZZSA 1JF1B 2J71A 4N90D 4W9IC 1QI3A 3ZDYE 5E2TL 4M48H 4MA8L 3QJSB 1YECL 5J6GA 3CE1A 2DYPB 2WXFA 4A7GA 1LHZA 3F7PC 1JG9A 3GMLB 1LWRA 4M62H 4AJYV 1BAFL 4UWQB 1I8LC 4KZDL 3RVUD 2E4TA 4XZ4A 4RISL 3T0AA 3LV3B 2Q76B 4TV3A 5CBAA 1U58A 3CLEL 3OQRA 1KYDA 3C8KB 1A9EB 3UEQA 3TCLA 1I7TA 3HMWL 4KC3B 2CBPA 4OJFL 5HPOA 2ITCB 4Y16B 4F80A 2JQZA 2A9MH 4PGEB 2FEEL 4JO8A 1U93B 4L37A 2G2PA 4O58H 4PJBE 5EOCJ 2W5PA 4O2FA 1JPFA 4GI6A 3MVSA 3EG9A 2D2OA 4S11A 1I1AA 4UQ3B 4FFYL 4S0HA 1B0RB 3QIUC 3KH3A 2ZQKA 4XP1L 5A3ID 3QNFA 2CKBL 4F91B 2AI0H 4F7PA 4X6FB 4N4YB 4YSEA 3ZOAA 2DD8L 1J8HA 3KDPB 1RJYA 5EZPA 5BZWB 3FF8A 4KROD 2XPGA 1A6VL 4MYWB 1YPZA 3T0BA 3SO3B 4YN3A 1KELL 3GBLA 3BH9B 5EZIH 1I7UB 1SYVB 2Q6WA 2MHAA 4OI8A 2AAVA 4IHOB 3GMRB 3UO1L 4HV8A 3W0WE 1G1OA 2F5BL 2W38A 4KZEL 3KPQB 3IU3B 1BREA 4GQ9L 1A4KB 4W9ZA 3H7LA 3UYPB 4WHCA 2NY7H 1WEJH 1QG3A 4DKFL 2E59A 2YBRB 4JAMA 4QRPA 4BA0A 1LEGB 5GS0H 2PW1A 2F7IA 1KLUB 3OZLA 4QOKE 1INDL 5JIQA 1P7QA 3HOGA 2DI8A 4QGTA 4J39A 3HE7D 4ZPVA 1K6QL 4AT6B 3QBTB 5FUOL 1MCFA 1ADQH 4P2QA 1MXDA 5J6HA 2Y6TE 2AJSL 5BPPA 3Q06A 1OTSD 3QWOB 3T8XB 4WDIA 5I28A 1ZVHA 5KN5B 1NCAH 4GG8B 1CN4A 1KGYE 2CO7A 2H2PD 3GXTA 3LRKA 3WJMB 5I18L 3X1NA 1A22B 4M5SA 4TVPD 1D7CA 4LARL 5FFOA 4BWUA 2YZ1A 3NH7H 3O2WL 2VT0A 5TFSH 3ZIYA 1HZHH 2ZXBA 1GY1A 1RURH 5GS2H 4AIOA 1FV1A 3ZYOA 1MY7A 4OF3A 4NQSA 2GITA 5E2VL 5C0AA 2E0PA 5ALBH 1PS3A 2KI6A 4Q6YA 1PG7L 1JNNL 1QBLL 1R6VA 1NBZB 4J6RH 2NY5L 1KPVA 2WZPD 3I02B 3DPBA 5DURB 4ZOBA 3STLB 3M45A 2YEQA 3O2DA 4PV9A 3CK0L 5GGRY 1G7MA 2ATPB 4NRYB 3OLIA 3T0DA 1QFHA 4OZGE 5HYSG 1Z5LB 1JN6A 3HN8A 2LV4A 4PQXA 5EOQH 3T4YA 3ULSB 5KUKA 5EORH 3JWOC 3HI5H 1N8ZA 3SCMA 5J1AA 1ILUA 3AT9A 1NA8A 3G6DH 4H8HA 4ATWA 1CD1A 1X5AA 4FHKA 4E9SA 2VLJB 1G7HA 1MCQA 4OVUA 4PGJA 1OSPH 3BW9A 4GKOA 4UAHA 2PNDA 4XPAH 4WVRA 2X1XR 2VZVA 5EUOB 3MRNA 2XWTB 2D0GA 1FVCA 3QEHA 4M29A 4AXWB 2EE2A 1FAIL 1WCBB 3FH5A 1QSEA 1G0YR 2C8NA 3KBFA 3KM1A 4J8RA 2NX5B 4QXTA 3V6OE 3CBKB 3V4LA 1RK1B 2QGCA 3WKNA 2X1WL 4Z7UB 1X9RA 3DURA 4EI6B 1JZFA 2UZXA 2YJQA 2AV7B 3CWGA 5GGVL 2XFXB 3HMXL 4Y0GA 2VJ0A 4ZFFB 2VRKA 1JV2B 1HS6A 4KDWA 3BIKA 3HPLB 1IVLA 3ZO9A 5KS9A 2X9XA 1AZZC 4JZJB 5DQJB 3W1ZA 4U4IA 1KTLB 3EYUH 4XCNA 4PJXB 5M95B 1ETB1 1E4JA 3EFFA 4N20A 2A7BA 4QTIL 1VDGA 4DK3A 3JT2A 1WIOA 5INCA 3SKOA 1V3LA 3HZMA 1PAMA 1PNCA 1IGCL 1SVBA 4KDTC 4XP5H 1RLBA 2P28B 4MNGB 1WWAX 2XXFA 4WFGE 3PJSA 3NSFA 4B9PA 5AUMA 2DWEA 4OW6A 4XX1G 2VKXA 5I0XA 4X7SL 2L3BA 4RAUB 4V11A 5FA4B 3QQ9D 4FQXC 2J2ZA 4IIZA 4LSVL 3DX8A 2K7QA 4HC1L 2MNJB 4EPSA 5KBNC 1LO5A 1OAJA 2WLLB 4MNQE 2Z4TA 3TFKC 2BX5A 1TJHH 2W0KA 1KENH 3EKCA 4PM1A 4M8RA 2PCPB 1SNRA 1UD6A 3IKCA 3ML8A 4WO4D 5T3ZL 3VWKD 5E2WH 2PW2A 4A2EA 4Y1SA 4LLMB 2CLZA 2HN7B 1EAQA 1AC0A 5LKNA 3O6FD 3THMH 3QHTC 3TYFB 3UTSB 2CK2A 3S96A 2KS0A 2FEEI 4WFED 4NB7A 2QT6A 1M57B 1WZKA 4OSUL 4X99A 3MV9B 3QEQA 5HI4C 5IBTL 4GAGH 5TF1L 1E8XA 4AIZA 3W39B 2GJZB 2HT2D 5CCKH 3UJIH 3ZMEA 2FATL 4ODTL 3RVUC 1MVUA 4NQCE 2BSBA 4X6DE 4NENB 4TVPE 3BZ5A 5B39B 4KJYB 3P54A 5E5RB 1IC7L 1P4UA 3EH1A 3JUYA 2XN9B 3EYOB 3V6OC 4B3EA 3TJHD 2DJ4A 4S1SL 1IARB 2EVJA 2R2BA 3PQYE 3FUKA 3CHOA 1DYZA 2FCBA 4GW4B 1ZJAA 1BFVL 3MU3A 3NCYS 4MJ4A 1R24B 2XIDA 4RQQB 2AJ3B 3UPRA 1QZNA 2X4SA 2IPUG 3HIZA 1WBYB 4P05A 4Y2DB 2R29H 3ROOA 4BSWA 4MX7B 3WGUB 1IBDA 3U2JA 3SE3A 4HIHA 4PLJC 2NSQA 4L3EB 4TTDC 1QBAA 2OI9C 2XTLA 4IOSA 5I26A 1K5WA 1G7LB 1M71A 1W0WA 2QSCL 4K23L 3V6BR 1S46A 5ACZB 2FJHB 3LNEA 4Z7VB 1YDPA 1YEWA 2OMZA 3LNDA 3KCPA 1MKFA 1SHXA 2ISDA 3G6JE 1JAEA 5T3XD 1DBBH 2O6EA 2XY1A 4J3UA 4DN4L 5MEOB 4NFDA 4XPFH 1I53A 4JPVH 2ADGA 3VFRB 4UT9L 3NQKA 1KLFA 4HHWA 3FO1A 5IMOA 3RURA 3S5ZA 4JY5H 5KOVC 1KYOJ 4A6YH 1J48A 1P5UB 1U8OA 4B50A 4ES9A 1MLCB 4XCCL 4ZXBC 2WZPA 5A7EA 5H94A 2BP0A 1OP3K 3UAAA 3NDYE 1G6RB 3BZEB 4MS8C 3P2BA 5D2NA 5IHHA 3HS0A 4JRYE 5JHLA 1JMXA 2EACA 3OWRA 3OAYH 4O2EB 3VXMD 3HE7C 1OCRB 2JK5B 3TC9A 3CH1A 3BH8A 4JFEA 3CZLA 1IE5A 1KCUL 2YXWA 3WE1A 1C16B 2WXHA 4GRWH 5GISH 1DCLA 3ULAB 1J0JA 2X9YA 2FYVA 4NUGL 2FUQA 1YN6B 3SY0B 4ZODA 4NJ9H 3UC2A 5JHBA 3ZE0B 2XOTA 1OPOA 4GRMB 3TIDA 1XF2A 1XCTB 1UWXH 1UASA 5FDWA 3MRDA 4NAJA 1UKSA 2Z35B 3BE1L 1J5CA 4YX2H 3WDHA 1UEMA 1F4XH 4Z3JA 3CD4A 5DEGA 5KSAD 4HIIB 4U0RB 5FYJD 3AT0A 1U42A 3KW7A 5I0VA 3G5YA 3QC6X 4HPOH 2ADJB 4AK1A 3MPCA 5I1KH 3MNDA 4N22A 5FGBA 2DLHA 3FRPA 2IWGA 4IU3A 5IBUG 4KTEH 1GKEA 2F8OA 4JFHE 4ZFGL 2DQJH 3SDXA 2HJLB 4M1DL 2FQEA 4JFDE 3CDZB 5HVHC 1MWOA 1LD9A 2ZWZA 5B38A 3FH8A 1ZHKB 3PE9A 4YBQD 1IGML 3WFBL 1FZJA 1T5WA 4WK2B 4OM0H 3RKPA 1BFTA 5JA8B 4A7SA 2WLIB 3BP7B 3S37H 5CLTA 2X05A 1KEMH 4YSDA 1OCCB 4G6JL 4U3SA 4ZMPA 2HP4A 5AD0A 5BO1L 1WP6A 2XZCH 4P2CG 3RGVD 4UTBA 5DD1L 1OCWL 1UZ6F 2IANA 2JFCA 2X41A 3QG6B 4ZPTB 5E6UB 1ZLSL 4DUWA 5JNYB 5JW3L 3H4FA 2QJDA 4EN3D 3L5JA 4XXCC 2CD0A 4UT6L 3STZB 4F3FA 3MOAL 1KZQA 4O00A 2VZTA 1KTJA 2X42A 3FT3B 4NUMA 2J5LB 1XTLA 2HRLA 1RUAH 3ARVA 2PPFA 1UXWB 2IPTL 1T3FA 2CGYA 3N40F 2O72A 3IB4A 4WO4A 2AEOA 2AMGA 1EGJA 3VWKA 4TUKL 1GMEA 4E9WA 1AY1L 3CSFA 1CC3A 5AVSB 5EWIL 5I0ZA 1XF4B 4JRFA 1F11A 1FLRL 1NGZB 3O6FA 4K2UL 1F97A 2JCWA 2FLBT 2AJUL 2B59A 3TH4T 3ILDA 3QXDA 4M9PA 3FQWB 1NIAA 1JWSA 3K8MA 3N9GL 4GKZA 2ICEC 2BSTB 3UZVA 1MZZA 4PJFF 3PGCA 5ALCL 1N7ML 1MNNA 2KQNA 4IJ3B 4G42A 1O7DE 4AGLA 4JDTL 4Q4EA 1GSMA 2OA9A 2CO6B 4U31A 4WWKB 4ZS7H 1NTDA 1D5XA 2QMJA 1SN5A 3EOYG 2B2XL 1KFAH 3WN5B 5F2FA 3MNMA 3DV6A 1A4CA 5FB8A 1NGPH 4ZUUB 2XN1A 4XH2A 1CDBA 4PRBB 1T21A 2ESVD 2I60L 3NP4A 3FSVA 2G75A 3C87A 4XMXA 2NT1A 4WEEA 2BNUA 5GS3A 1JPGA 3QQ9C 4XVTL 3U1SH 1A4JB 5LXGH 2PP9A 1RLWA 4IDJL 4X5PA 1YEIL 3QI9B 1OK8A 1WD8A 2B1OA 2IMNA 2WM0A 3IDIB 2AJZA 4HCIA 3BDBA 4AENA 1NCBH 3PDGA 3FQNA 3BWAB 4D9QD 4Q9CA 1DE4B 1RZKL 2HT4C 3QRFM 2CDFB 2VQ1A 3DBXA 1CFQA 1NMCC 3SDYH 2CPUA 2YARA 1ASQA 5B21A 4IBLT 4HXBL 4J3WA 1AGCA 3LPGA 3DHMA 5FYLL 1EIBA 2RJMA 3ILQC 1J8SA 4XCEA 2WINA 4JN1H 5GZNC 5D7LB 6PCYA 2DWTA 3O4LB 3QWRD 4LCCB 4UZSA 4G8FB 43C9A 3PXHA 4WKZB 5B7EA 3VMOA 1QFUH 3CVHB 3ZTNH 4QDGA 2W60A 4DJMA 1C7SA 2ZAHA 4PY7B 3FFOA 2Z0BA 3F7VA 3RILA 4KRPC 1A6WH 1XIWB 1I7ZB 3QEUB 2OJ1A 1EJ8A 2V3FA 2I69A 3CVIL 3QPQC 4JM4H 1A64A 1D5ZA 3K5RA 2JMRA 1JZDC 2K7PA 3OAUH 1TPXC 5DUML 5TQ0L 3VXMA 4AJWA 2NMSA 2EVFA 1RUML 1LO4L 3FK3A 2DQHL 3QFJA 5FDYA 1WBXB 1ZOXA 2EKSB 3QO1B 4U6TA 1R3IL 1XGRB 1MF2H 2NTFB 1JPEA 2BCKB 3MA9H 4L0ZA 3AS0A 3UXFA 5AZUA 3O3DA 4J2XA 2O1AA 3ZKSD 2CWRA 4F7CA 1ERNA 1A4BA 3IK2A 1O7DC 4XCFL 3OKEA 5KSBF 2FX7H 3V7AE 4ZMAT 4KMQA 4HUMB 1SEQL 4HWBL 2AJYH 5JDSA 2I7SA 5KSAA 2LLNA 3WKYA 3O3BA 3CLFH 2XPYA 4ZK8A 4PRIE 1HYSD 3AU1B 1DSWA 2M2DA 3GSVB 3FFCD 1RVFH 4N2LA 4PTTB 5F7DB 4JZNA 4UCFA 3WS3B 2YMTA 5FKAB 3L4UA 1QVOB 2E9JA 2F9BT 2VR4A 3UDWC 3QDMB 4GAAA 3V0IA 4YHYB 4CVXA 4MAUH 3VRLE 4LSRL 4YWGL 3CPLA 1O0VA 5I17A 3G5XA 4KXZI 5DJ2A 1MHPL 1BZEA 4KUCF 4EO5A 5FF6A 5MP6H 4P23A 1ZE3H 2HT3C 4KHXL 3CBRA 3E6FA 1UA3A 5LG6A 1IT9L 4FQJL 1SN2A 1MCHA 3NVQA 5ICXA 1M1XB 3IMUA 3RGVA 3CN1A 1XSIA 2R1YB 2VWEE 3NSCA 3FO2B 3V4PH 5FO8A 5ITBH 1ZT7A 1OL0A 4GFTB 4YGVA 4GAJH 4HSQA 1BD2D 1HVXA 1XH2A 4TRPL 3BQUD 5DVMA 3U9WA 4UQAA 2PF6A 1CGXA 4LKCA 1WCQA 2J44A 5EO0A 2G30A 3QDJD 4HIJA 2CO3A 2CUMA 1A6PA 3HZVB 3QCVL 1PZAA 4FNPA 1M7UA 2NNRA 4MXWL 2L04A 2NY2B 1OZTG 1R3LA 3BVUA 3K72A 5H8DA 3TWYA 4HCRL 1RFDH 2MQGA 4HF5L 4QAWA 4X5LA 3BFOA 3QJFB 3ECQA 4HPHA 1WA0X 1XAUA 5AW8B 3QIWB 2NYYD 5TPWH 3MRJA 3FUDA 3HAEB 1WV7T 4U6YA 1XQ4A 3RPIA 3GI8L 3BKYH 4NAQA 4ANXA 4I9WD 4AQ1A 4NZTL 2E74C 5E70A 3PDOB 1R0AH 1R5VB 5TDPA 3VFUA 4URTB 3RZWA 5IVNA 3AB0B 4I0PA 3S9DB 4PSRA 4U1JA 3CFNA 3KL5A 3W9DB 5HHOD 3D3VB 2YJLA 2J20A 3OJMB 1CO1A 3SKJL 3DBSA 2QQKH 3KPOA 3QS2A 4TNEA 2PXYB 5D1ZC 3EYSL 4BFFA 3B3BA 2Y7SA 1TVHB 4MVBC 4NKIH 2ESVA 2YBGA 4O51A 1BAWA 3S8FB 1CPUA 4K3EL 4EN3C 3R18A 2YQ3A 1MW1A 2QVKA 4LSPH 1VESA 2FZ3B 3LZPA 4FERA 4JB9H 4GQZA 4ABQA 4YBLB 1SOKA 2DRUA 2ZWYA 5I1LB 3BPOC 3MRFB 3JTTB 3GI9L 2ZUYA 1T22B 3EGDA 3ISYA 1ZK5A 2VDOL 4AQEB 1QFOA 1YMHB 3NJJA 6TAAA 3RRQA 4LAQL 4X5XA 2BVYA 4LB8A 1LE5B 3RG1C 4R97B 5AW7B 2ZSWA 2G3NA 4JY4B 3WN6A 3IWUA 1KJVB 4KO9A 3BSZA 1E27A 3KEDA 3LKQA 2Z6FA 2JKLA 1H6TA 3EH2A 2DKMA 3FCSB 5C92A 5DHVB 4JE0A 1YO4A 2RBLA 4NYLB 2OYKA 3HBGA 4IBZA 4ELMF 4KKLC 4OCRH 1TZGH 4RETB 4L2LA 4M4PA 1C1EL 4L8SC 3BXNA 4OCWH 4IMKC 2BNRB 2X7LA 4XRCB 4RFNC 4HHGA 3AG4B 5C0IA 1TITA 4IEFB 4Y5XC 1NGYB 4OZIA 3MJ9L 4ODVH 5T5FA 1XH0A 2EP6A 3OD3A 4YGAB 2Q86B 3FUEA 3HRPA 4X8JB 2JKXA 4GPVA 5JXAH 1CQYA 5CEZE 1MY5A 3BAXA 1KN2H 1F13A 4ATTA 8PAZA 3MXVH 3WFCL 1QR4A 3NPSB 3W5NA 3NGBB 4JN2B 5E4OA 4QRUA 2Y1AA 5LNEA 1ZVSA 2NCMA 2OPCA 3NEXA 1YY9C 4GBXD 4Y5VB 1A7NH 1ZIAA 2XG5B 3BLKA 1HYRC 3TBSB 4P5KB 2XU9A 3TWCH 5E24E 5CU5A 1U3YA 3BYYA 3W9EB 3AUWB 4KKBD 2Z92B 3HVDA 1CCZA 4K7PY 4XVOA 3VW3L 2ITDA 2BP8A 4MD0A 4MMZC 4ODBD 1JIBA 3CDGB 2KZ1B 1FG2B 3UABA 4DP5X 1MQKH 4MSWA 3RU8H 3EW3B 3QDJE 1YN7B 2WLYA 3JWDL 4XNQB 1NC2D 3FUJA 5FO2A 3NG5A 5IJKA 4Q9QH 5DGRA 1G5GA 1SEBB 3K0WA 3OF6D 4XNZB 1QSVA 4PWKA 3D0LB 3O2VL 3D51A 4N8UA 4OD3H 2VLRE 5HDQL 3EYVA 4QKTA 3DGDA 1Z9LA 2GTZA 1B0IA 2FWOB 5DJAB 4G1EA 2YPLD 5K9JH 5DRWB 3FONA 1L5GA 2R7EB 3KPTA 1HH6A 2DKUA 3SGDH 1BPLB 3SQRA 4HIEA 3EOBB 3SKMB 3QPKA 4I9WE 3GT6A 3MA7A 3WIHH 3O6LH 2XG4B 1BD2A 5EN2A 4E41B 4NO0D 3BQVA 1IM9B 3BQUA 3U9UA 2XZZA 5IOKA 1Z9NA 5ILTL 1PG7W 3HFFA 2V2WA 5HYSA 2F1EA 2XHNA 1H3PL 5IG7B 3E2HC 5LDSA 1OXYA 4WWNA 2ARJB 5DK2A 1NCHA 2IH1B 1BEYL 3DSFL 1TQVA 2VAAA 2WGXA 4FTVD 4WI6A 2AEPL 1RPQA 3MLWH 3OLDA 3VFWA 1FZOA 1MJ8H 1SY6L 4KK8C 1LJMA 5L0QC 4RGMB 4GY4A 4GG6A 4P5MB 1UB5B 3UEZA 4NSKA 5DWUL 4F57H 5BMFH 1BVNP 4GRWB 4OZFG 4GG6F 3HFML 4OJAA 4OLZH 3TN0B 1JYNA 2DBLH 2ZWKA 3T2LA 1XDTT 1T0MA 3N55A 5C0EA 5HHOA 2G4EA 3BC9A 3U46B 2X4TB 4AW4A 5T1LB 2X6UA 3V5HA 3WBDA 5SWQB 1XWVA 4MB4A 3OB0H 3IDJA 4JR9H 4PJ7F 4FAAB 4HGWA 1NANH 2EDTA 3ECUA 4UBDD 2O61B 3BFQG 3FO9B 2L7UA 4Q56A 2VN4A 4OUUB 3EFDL 3MGOB 4KUCD 4WI0A 3VQ2C 4X6BA 3N1QC 4RWYH 4B97A 1OAUL 1HHIA 2OZ4L 3HVNA 1OIOA 4J3OH 1E3ZA 1QHOA 3RZCD 3UPAA 5D7EA 5EIIB 2NQ3A 4DW2L 1QEWB 5IHZB 1MHHB 3FH7A 1ZS2A 1B9ZA 1BLIA 1OLLA 2AW2A 3HS8A 5AG8A 4FMFA 1CLZH 5HGDA 4Z78B 1Q1JH 1AHWB 2R56L 5KOMC 2TAAA 1HK6A 4XNYL 1G7QA 3SBRA 1PCXA 4LNVA 2F19H 1QLRB 4PJFE 2XV2A 4DEWA 2GAZB 4ZMOA 1JP5A 2BC4B 3ARZA 4N2HA 3IU4H 1FORH 5IESH 1B4RA 1JTOA 3EJYD 1DQQB 2VUOA 3MRIB 2BXZA 1QASA 5EU4A 4NQXB 1ND0A 4P2RB 1XGYL 3EADA 4LVNC 3RX7A 3DUUB 3TIEA 4TQEH 2QADC 3SGJA 2X4UB 3DMMB 5FO9A 4Y4KB 2ZXGA 4PPTA 5LGJA 1ZHLB 1J1OH 3MO1A 2Y3NA 1BFSA 1R5WB 1PZBA 1GZPB 3BGMB 4M1GL 2Y25A 4H8WH 1JZ6A 4BKLA 3CFKB 1KGUA 2P42B 1P7KB 3AMLA 1I3GL 3EDKA 3IJ7A 2XQBL 3QUMH 3T2OA 1XGPB 4YQXL 2ATKB 5KG9B 1BQ5A 2H0PA 3QXWA 2AK4A 5C0CB 3P9LA 1GHFL 4ICWA 3KR3L 3U7WH 3RVWC 2EDHA 1RXLA 1TJGH 1CFNA 4ZQKB 2R0WL 2YPLE 4WIQA 1KBWA 4PJDF 4WTZG 5KVEE 4FABH 3KHOA 4YDIH 3H9SE 3EJCA 2EADA 4RA3A 5TE7L 2Z91B 1WVZA 4I48A 3FUIA 4FFZH 4DTGL 3T77B 5DJ0A 1JPSL 3Q3GB 4U1MB 4RZCA 1EZSA 2F1BA 5IKCB 3EGXB 3GSWB 4KVNL 3I6LE 1OTUD 4X0NA 1OD7A 3OSKA 3JV6B 3RY6C 2OFQA 4XMLH 2YMXH 1KJMA 2ZNWA 1E8WA 1H9DA 4ANWA 2JLPA 2K6YA 4KOCA 1AR1D 1FNLA 5F7AA 5JUEL 1UOWA 3FT0A 3VFOA 1LK3H 3VSVA 4FTVE 4XWOC 2FX8H 4YVNA 1NFIB 1U8LB 2CZNA 3MRQB 3HHRB 4H1LB 3TNMA 1NDMA 3RAJH 2GI7A 4YHPA 5DUPH 3JWOL 4R2GB 5KYXB 3TF7C 1T0NA 2DWXA 5CWSA 5GRXG 1SHSA 1OALA 3PCYA 3MYJB 5KSBE 4OLWH 5CN3A 1PZSA 2OP4H 4BK4A 1P0SE 1SM3H 2ORBH 1O6SB 2MH4A 5HI3C 5BOPA 4KK6C 4H7VA 4F20A 2VNCA 1S7UA 3O9WC 3NJLA 4W6XB 3GSQB 2JB5H 2DTMH 5JR1H 1WZLA 4GBXC 3CFJB 3RKDC 1RHHA 1FYHB 1Z5YD 2X4NA 4HVBA 1TZHA 2L8AA 3T4AA 1RU9H 1DBJH 5JW5A 1J0HA 5EEXA 1DQKA 3QARA 4JREB 3VMNA 2VO5A 3GSRB 4L1DA 4PJAB 3DJZA 4OCSL 4NKMB 4U1HA 4G7QB 2A73B 1R3KB 5F7YC 3WTXA 5FCSH 4QRRB 4FNUA 1GPOH 2FJGB 2WLHA 3C5ZD 5HJ3A 4E0RB 3GSNA 4KXDA 3BAEH 3PUCA 4MXQD 5LNDA 4LE8A 3IE9A 4HWNA 4F9PC 4Q2ZB 4WEMB 1SDAB 3NN8B 3O6MH 4HZAA 3N43F 4JKPL 2QZ5A 1VADA 4LOVA 3BIBX 2PMZA 4KTDL 1JERA 2A77L 2LU4A 3S8WA 1HHKA 1P84J 4PJIB 4MCZA 5CIPA 1UOLA 5AKTA 3D25A 1UXLA 3EBIA 4NNXA 5JPMB 3UERA 5FHAH 3ZKQD 3UGEA 2QQLL 5MEQB 4AC4A 2YXFA 1M53A 2FBRA 3AU0A 4EDXA 3FCTA 4ZSOB 1MN4A 3QEGL 2H9GA 4MJIE 1H6UA 3DA0A 3PABB 4Y4FA 4A1RA 1EERB 4BGLA 1MELA 3FFDB 1TQUA 3CX5K 3N1GC 3QJXA 4CVWA 2F61A 2LFGA 1A14L 4X4YB 4U1GB 1RKRA 3C2AL 5CO1A 2EE9A 4X4ME 5LBGA 4HU2A 1QP1A 3CFCH 1JOIA 5CILH 5C08E 3ZX1A 4APQC 4QLWA 3M1CA 5DD3H 2BY1A 1EAPB 1I8KB 3DXAE 5BQ7A 4RMQA 3ALWA 4E9VA 3W5MA 2W9DH 3HI6L 2NZ9C 4HIQA 4XPHH 4B95C 25C8H 3HJEA 4HXAL 1CGVA 2F8VA 4Q8BA 3U0TA 4XNUH 5D2LA 2LU7A 4RNRB 5IQ9B 2I07A 2WPGA 3CFDB 3WNMA 1S7QA 1MCJA 2WVSA 3I9GH 1SLXA 2KBGA 4UTAA 1E4XL 4H88H 1KN4H 3LDBC 4L23A 3DHUA 3TZVA 5EU6E 2ZYIA 2O6DA 3CHXA 3SDCC 4LCWD 4JPSA 1HKLL 4HEPA 4XOEA 4JCLA 1TVBB 3HN3A 2VIRA 2EH8H 1GJWA 5FKPB 5JOFA 4CDGC 4KRMB 4M1CD 2JJTA 1GKOA 5CJOL 3ULUF 1LM8V 1FJ1A 4HUWA 2YAOA 1GAFL 3IE4A 2BXYA 4MAYB 4QY8A 5E8DL 4B60A 1NJ9B 4D0CB 4K9EC 4MD5A 4R26L 3MV8E 5C8JA 4YDVA 5SWSD 3V7MA 3FQXA 4AYFB 2C9PA 3ZHFA 2YPVA 1HSBB 3RZCC 1QLFB 2BVOA 1NICA 2XWCA 1U8HB 3NSYA 2NR6D 2ID5A 1TETH 3LKRA 2P7TB 1KPUA 1I9IH 3C6SA 2E7LC 5I6LA 5IWLC 4RMSA 5IMMA 3MGTB 1H5BA 4JO3L 1KEGH 3IJHB 3TVMD 3SIKA 1A9BA 2WWKO 4WAFA 4ELME 2WYIA 1YC8A 1N3NB 3VB8A 2GFBA 2X2JA 2Z1KA 2B5IB 3L9RA 2XZQL 1VFOA 2Z3FA 5DZ9A 2YKKA 1N64L 2J8UB 1DVFB 4HG4K 4HJ0C 2X9WA 3QYNA 3CSPA 4HKZB 2XSKA 3EJYC 4Y1AE 3GK8H 5AZEL 3BVWA 4EIZC 1F6LL 2YA0A 3F7RA 3I3DA 4U7SA 5BRZD 3RWHA 1YUHA 2OW6A 3ZUCA 3VI4B 3QH3A 5FOJA 1IAIL 4N0FA 3GLAA 4NQDE 4UV7H 2GCYA 3WNIA 1YY8B 3IRCA 4DCQA 3DKHA 3EGSA 1D7DA 4I3RH 4OIIH 5HDOA 4L8CB 2A6JB 4M4RB 1RI8A 2YXVA 3RI5F 2VITB 3TBTA 4PYGA 1JGDA 3I2CH 4TUJB 1DVSA 4FNLL 4L1LA 4IGBC 2DLIA 2XRAL 3RVVC 1V5JA 5ANMB 2X6AA 1FC1A 5D7IB 3O3EA 4NZJA 1ZWIB 2F1AA 4Q9BA 4BM7A 3RFZA 4FF9A 1Q9WB 5FK9B 1OB1A 3PYCA 1ORSA 4NKOA 3O2DH 3GXPA 5DEFB 4EVNB 1T20B 2AVGA 4TVPL 5C0GA 3FAWA 4PJGF 2PTTB 5GS1A 2BVUA 3TYGH 5KYUB 1GGCH 2FLRT 4IRZL 3DVGA 4WW2F 1NH6A 4PB9L 3RB5A 4S0SD 5I8CA 2OX5A 3STBA 3MJGX 3CN2A 5DHYA 1FL5B 4ODUA 3L3OC 2LFEA 3UZQB 1E28A 4E42B 4M7ZB 4JHAH 5BZZA 2DIBA 3C5ZA 3CMGA 4FG6C 4F15C 3CMOL 1ZGLP 4YLCA 2Y7OA 3MV01 3GB7B 4BZ1H 4C55A 3K6SB 1G9MC 1E30A 4R5VA 4O4YH 5D72H 5HGHA 1PIFA 2BSDA 3BGAA 3BOVA 3V5DB 4W9EC 4HKXB 3PJNA 5ESQB 3EO9H 3T0EB 4PGDA 2WYZA 2R69H 5BUPA 1X5HA 2XKUA 3KXFB 1EHNA 2B39A 4MWFA 4ISVB 5EOTA 3ARBD 4XWGH 4Z7NB 1RP9A 2B0SH 3JVGC 4PD4K 5KEZA 1BYNA 3D52A 1ZHBB 3QT2A 3H85A 3L9YA 1A02N 3SO5A 5DSCB 2BNQD 2VRAA 4B9ZA 3MBXH 2Q8AL 1U4FA 4ZMQA 3V2AR 4P59L 4R3SA 5HHPB 1SOXA 1CZ8L 3EOTH 1U95A 1E5AA 4K7PH 2E9WA 3KDMB 5DD5L 3NABL 4C57C 2BW4A 3KWWA 2GBVA 5CGMA 4N0UA 2V37A 3BDYH 1MVYA 3LYRA 4OLYL 1YEJH 4F7TA 3BRGC 3GBNL 1EBAA 3OKKB 1FFQA 2XXMB 4OLXH 3U0PA 1MFCL 4ZTPL 4XVSL 1J5OL 1OEZW 2I27N 2OL3H 4WNQA 3A23A 4EOWL 1BYOA 3U2SA 3UG5A 1L6PA 4KAQL 4PJ7E 4MXQC 1B88A 4FQ1H 5MENB 4YSOA 5FV2A 2C4XA 1U6AH 3KPRA 4QO1B 4IKNA 2D7TH 3MRBB 4TL4A 1A8ZA 1UGNA 4N8PA 3X1EA 1E4HA 3DDFA 1KBGL 4M6AA 3M1BA 3K80A 4OFYA 5BVPH 5IGXH 1FNSH 1P5VB 4RBPK 4ZJ9A 1R17A 1UZGA 4HX1A 3GUTB 4DAGL 2J88L 5E9AA