2VMJA

Type 1 copper-binding loop of nitrite reductase mutant: 130- capegmvpwhvvsgm-144 to 130-ctphpfm-136
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
326
structure length
326
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCTPHPFMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
molecule tags Oxidoreductase
source organism Alcaligenes xylosoxydans xylosoxydans
publication title The Importance of the Long Type 1 Copper-Binding Loop of Nitrite Reductase for Structure and Function.
pubmed doi rcsb
total genus 83
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vmjA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vmjA02
3D12B 4A68A 1IBZA 5F7AA 2HLEB 3PAUA 1W8EA 2FT8A 3WNIA 2Q5BA 1PAZA 4NERA 3AG2B 1AACA 3NJJA 4W1TA 1AAJA 4F7KA 1PCSA 3FT0A 4M3HA 3NJHA 2J57A 3FYEB 3UAEA 1A4BA 3NJLA 3PCYA 3HEIB 3IEAA 3KW8A 4M4RB 1XB6A 2PPAA 1PNDA 3EH3B 1AZUA 1MG2C 1ETJA 3NSDA 1OCCB 2AFNA 2XUWA 4G70B 1JZEA 2DY2A 4HCFA 3T9WA 1FA4A 3AG3B 9PCYA 5EHFA 2IWKA 4AZUA 4E9SA 4HHGA 2WSDA 2GHZA 1GW0A 3N2JA 2CAKA 5I5JA 4JHVA 2HRGA 2VSKB 3ERXA 2XV3A 3S3CB 2I7SA 2XYBA 1ZDQA 1JZIA 4AKQA 1JXDA 1N68A 1OCOB 2IDSA 1JVOA 3CVBA 2GBAA 1AZBA 4KOCA 2J55A 1SFHA 3FS9A 3CVDA 1TU2A 2BP0A 2YXWA 2YAPA 4A67A 4E9WA 2DV6A 3FU9A 3FYIB 4QLWA 1BXUA 1PF3A 3OMIB 1RZQA 3FQYA 1MDAA 1BXVA 3ASOB 1R1CA 1FWXA 2CJ3A 2TSAA 4F2FA 2GC4C 5I26A 2UXVA 1SHWA 4E9YA 1HFUA 4A2DA 2B08A 3FSVA 2QPEB 3DIVA 2UXFA 1PZCA 4A2HA 1JXGA 2H5UA 2VW4A 4DP6X 1L9TA 3CVCA 3S8FB 3H4HA 3WI9A 1DYZA 5B7FA 1GS8A 4YVNA 1BEXA 4G7QB 6PAZA 1WA1X 3AG1B 1I53A 3ABMB 2PCFA 3GYRA 3QPKA 2XXGA 4TXVB 1TEGA 5B3SB 1WS7A 5I6OA 1OE3A 3DKHA 3MX0B 4YSAA 4AI7A 2W88A 4Q89A 3FSZA 2P80D 1A65A 1ILUA 4DPCX 3EF4A 2A3TA 3BQVA 2YAOA 3QJSB 4DP5X 4FAAB 2UXTA 1EHKB 1ZV2A 2YXVA 3NYKA 3SQRA 4BWTA 5PAZA 1ET8A 5D4IA 4NB7A 3EHBB 4GY4A 4KNSA 1NIEA 1CYXA 3S3BB 1AZRA 2CBPA 2FQDA 4F2EA 4BK5C 1GR7A 1OE2A 2P80A 1KCBA 2LLNA 3G5WA 1ILSA 3WKQA 1RKRA 2PPCA 3PPSA 3T6ZA 4DP0X 1E5ZA 4YSTA 1JERA 1W6LA 1KBVA 4DP8X 5AZUA 2DYSB 3NJGA 1KCWA 1N70A 4E9XA 1E5YA 2UXGA 1ID2A 3EH4B 3FSWA 1HAUA 2IDTA 2R7EB 1PMYA 3BVDB 5FC9A 2TSBA 2VN3A 2E86A 3OM3B 1AG6A 1A4CA 1PY0A 1NDTA 3PLYA 5LDUA 2I85A 2XU9A 2BW4A 3NJMA 2GB2A 1IKOP 4HZ1A 2XX0A 2JFCA 2VSMB 3AZUA 3ZIYA 2FJSA 1A4AA 4PAZA 1E30A 1X9UA 2B3IA 2HXAA 5I28A 1DZ0A 2EIMB 4FA7B 1SJMA 1AZNA 2J5WA 2H3XC 4P5RA 3AG4B 2ZXWB 3FPXA 4KNTA 4G7RB 4DP7X 2FT7A 3X1NA 1FFTB 3GXUB 3TU6A 4E9RA 2FWLB 1SDDA 1L9SA 1CUOA 1WA0X 3FU7A 3QJTB 2JKWA 3PAVA 4A2FA 4DP1X 1ET5A 3FU8A 2FTAA 3NSFA 4A66A 4YSCA 1QHQA 6PCYA 5AFAA 1GS7A 5AKRA 4HIPA 3X1BA 5IY5B 1QNIA 5B7MA 1GSKA 3L45A 1OV8A 1PZBA 4DPBX 2BWIA 3GDCA 2GC7C 2QDVA 2OJ1A 2VMJA 4W9ZA 5D4JA 3IN0A 2IH9A 2XV2A 4DP4X 2HZHA 2Q9OA 5D4HA 2XVBA 4KO5A 1GY1A 5B1JC 2FQEA 1AG0A 3CZUB 3OD3A 3T6XA 4DPAX 1BAWA 1KBWA 1RZPA 1PNCA 4HCIA 5I6MA 2IDQA 1GYCA 2AANA 5TK4A 2AVFA 2X87A 4HHWA 4JKNA 1JZHA 2N0MA 2YAFA 2XLLA 4YSEA 2XXFA 3PXLA 3X1FA 1SF5A 3FU7B 4YSUA 4YSSA 2PPFA 3U25A 2IDFA 2BZ7A 2VW7A 2ZOOA 1EZLA 7PCYA 1M9WA 4KOBA 1T5KA 2BP8A 2XV0A 1XB3A 3JT2A 2PP7A 5I6KA 2EINB 3V9CA 1OCZB 2JXMA 4A2GA 1JXFA 2QDWA 2OCCB 2YAEA 2EIKB 1J9SA 2WO3B 4P5SA 1NPJA 3SBQA 1AR1B 3V9EA 1E67A 1AZCA 3EH5B 2UX6A 3NSCA 4A2EA 1F56A 2HRHA 1AS8A 5ANHA 2PP8A 3DTUB 3ZDWA 3QJRB 2BW5A 3KW7A 5I6NA 3FPYA 2XX1A 1PZAA 2BWDA 4ENZA 4YSQA 3NP4A 3T71A 2XWZA 2YAMA 1A3ZA 2X88A 4YSPA 4WTQA 1KGYE 2EIJB 3NT0A 4DP9X 2IAAC 2Y69B 1HAWA 1OCRB 1URIA 2QPDB 1V55B 1L9PA 3CG8A 2YAHA 3AW5A 1TKWA 5I5IA 2HX8A 5I6LA 1AIZA 3ASNB 1XB8A 1X9RA 4E9VA 2H47C 1NWPA 3QJVB 4CSPA 1YLBB 3FQ2A 2RACA 3UACA 2FNWA 1J9QA 4N8UA 4GXFA 1TEFA 1AQ8A 1WS8A 1ASPA 1NWOA 1J5DA 2VW6A 1M56B 4DP2X 3NSYA 2UX7A 1SNRA 1SDDB 1IUZA 3ABGA 3QJQB 4BXVA 2ZONA 5PCYA 3T6WA 4PCYA 2CCWA 1ZIBA 4BDVA 3NJFA 1V54B 1NIAA 1AS7A 2BP0B 1JZJA 1RCYA 4HAKA 4BXSV 4UF7C 1NTDA 1A8ZA 2PPDA 3HB3B 3N55A 3PAZA 3S3DB 1QLEB 2IWEA 3SBPA 1SF3A 3ABLB 2QT6A 2PLTA 1BYOA 4RH4A 2FQFA 1PLAA 2IWFA 4YSRA 1E65A 2VM3A 4BWWA 2GIMA 2PP9A 1IC0A 2YQBA 4QKTA 1L9RA 2I7OA 1W6WA 1NINA 3WNJA 1JVLA 4N4YB 3WG7B 3H56A 1MG3C 3UABA 1BQRA 2EILB 2J56A 4GP4B 3ABKB 3TBBA 3JTBA 1ASQA 4YSDA 1J9TA 2PCYA 4UANA 2GSMB 3UADA 5A7EA 2BZCA 3UGEA 1SHXA 1WAEA 1KV7A 2BP8B 1BQ5A 3H4FA 2R7EA 4MFHA 5E9NA 2DWSA 4E9TA 1OE1A 2DWTA 3X1EA 1J9RA 1OF0A 8PAZA 3CDZB 3SBRA 3AY2A 1NIDA 5B1BB 1CYWA 1ZPUA 1L9QA 4KO7A 2BO0A 3QQXA 4ZK8A 1BXAA 7PAZA 4YL4A 3MBWB 4L0PB 4E9QA 1NICA 1ASOA 3C75A 5F7BA 3X1GA 5TK2A 4G72B 2FT6A 1J5CA 3OMAB 3IBOA 4WKXA 5I6PA 3QJUB 4G71B 2CALA 1BYPA 1M57B 1MZYA 1NIBA 3NP3A 2CUAA 4UAHA 2AZUA 4GP5B 1UATA 1NPNA 3NJNA 2Y1AA 4JHUA 2HX7A 3IE9A 1GS6X 3WIAA 1CC3A 3FSAA 1SFDA 3FQ1A 3CDZA 2OV0A 1IBYA 4K9JA 3TBCA 1BQKA 1OOWA 1WA2X 2BHFA 2YAQA 1JZFA 1L9OA 4EF3A 4CSZA 4AX3A 3RYMA 1PLBA 2HX9A 3WKPA 1JOIA 5B1KA 3UAAA 1AANA 1NZRA 4HALA 1ADWA 3NJIA 4BDVB 3T6VA 1AS6A 1V10A 2WO2B 3TA4D 1CURA 1VLXA 1XMEB 1ZDSA 3TASA 4BWUA 5B1AB 2DYRB 2IDUA 4YVUA 1GY2A 1NIFA 4AKPA 3OMNB 3ZX1A 4YSOA 2PPEA 1PLCA 2IH8A 2NRDA 2MTAA 5B7EA 3X2QB 4AKOA 4G7SB 2AZAA 4GP8B 3NJKA 5I5MA 2MRYA 1ZIAA 4KO9A 3S8GB 3OQRA 2W8CA 2FQGA 4KNUA 1AOZA 1KYAA 4KO6A 1JZGA 4X4KA 2ZWNA 2GI0A 1KDJA 1ET7A 1MZZA 4GYBA 1B3IA 2VM4A 4HCGA 2YARA 3ZBMA 5B1JA 1KDIA 4NAJA 4Q8BA 3IN2A
chains in the Genus database with same CATH superfamily
1IMHC 3QXAA 2ZCZA 3IDUA 3R1GL 4PRHA 3T4AA 1JZ4A 1KXHA 3D85D 4OAWB 3WBDA 3BP4B 1WEJH 4CL7A 4AGLA 1DBKH 4JUSA 2AQ1A 4PV8B 1KFGA 3NJLA 3K8LA 2GT9A 3IDJA 3R7QA 1MW2A 1NCWH 2YOCA 3UBGA 3QH3B 1A14H 4M4RB 3T6QC 5E2VH 4OSUH 5FECB 1Z0NA 1DUZB 1AZUA 3DO3A 3NFSH 3U2JA 3RA7L 5E2WL 1BEYL 5EHFA 2VAAA 2IWKA 3V4PH 2WSDA 4FYSA 2X4QA 1CGSL 2PR4L 4CC4A 3CN4A 1A4KB 3ARFA 4NOFA 1RZFL 4WWKC 3U6XS 2Y06L 4OQ1A 4KRPB 5FO2A 2GCYB 4MCYA 4OF0A 4NQUA 3FOMB 4BYHA 1OPOA 4ZTEA 3TO2B 2KQNA 1R24A 4JGUA 3QEQB 1HNFA 2NXZD 1CG9A 1JVOA 4MKMA 2EUVA 4J4PD 5ECJE 3PDDA 4QTIH 5F7FA 1CFQA 2V17H 1GH7A 3LRSA 5C0FB 2W59A 4JL2A 3UTOA 1TU2A 1NCCL 1FPTL 1KTKE 4O02L 5IMKA 2EEFA 4P23A 4P3CL 5CLYA 4FCAA 3D39B 1BXUA 4JG9A 4K7PH 5I1LB 2ADIB 2LAGB 1JV2A 3MLUH 5IHHA 4POZC 1QRNE 1NMCC 1HQ4B 2X3BA 4RMBA 4BE6A 5I9QC 3MNMA 2LU4A 1QMUA 3D85B 3K0YA 4KHTL 5EWIH 1RJLA 1WWWX 2NY6D 2AEPH 1CFVH 6FABL 5CSZA 3S4SA 2WYHA 2DLTA 2WXPA 1KIUB 2GJ6A 3IGFA 1X7SA 4H5SB 3TC9A 3LQMA 3F84A 4TNWK 2Q1EA 3NABH 2GTWB 1LK2B 1RXLA 2ZX8A 3DIVA 4LARH 4JQVC 2UXFA 3OLEA 1TSRA 3WELA 5AW0B 1D5RA 1KUMA 1S9WA 1TITA 2YGQA 4Y19D 4WW2C 3O6ML 3PNRB 3L2LA 3KS0H 3FT4A 4G7QB 2FSDA 4C47A 5DFVC 4XOAA 1N0XH 2PCFA 3GYRA 5GIRB 5ESQA 1CWVA 3W9EB 5MEPB 3KYKL 3BAIA 1OAKL 2Y7NA 4S2SA 4N2AA 5MEOA 2FH6A 1FZJB 5E6YA 3OAUH 4FXTA 2D7PA 3GB7A 4RGNE 2AJVL 1XF4B 3SDAB 2BVQA 1LM8V 1J0JA 5J4MA 2PUQT 4M5ZH 4DPCX 2VDRB 3P4MA 2B4CC 2F58H 1HQRB 2Q8BL 4KZEL 2DWYA 4LDEB 1R33A 1OAXH 1P4LB 3CPUA 3MTXA 4NO0B 4YHNB 1IM9B 3BZFB 1FG2B 1D6EA 4I9XA 3UPCA 3QRLA 1ZK9A 5DS8B 4PJBF 1IGIL 1DQTA 1BD2D 1H6TA 1T1ZB 3H1ZA 1JVKA 2ZOLB 1FN4A 4ETQB 3V95A 3GEWB 4ZW7A 1LYQA 1AKJA 2XZZA 1QRND 4WI0A 4YSTA 1JERA 5DHDA 3SE3C 4BSJA 1MXGA 2XA8H 2AAVA 4UQCA 5AZUA 2FX9H 3P9LB 4PLNC 3BAKA 2FLRT 5FKPA 3QUGA 5IW6B 4YBLB 3BI9X 3MV7E 3A6CL 4NCC2 5HD8C 4FC3E 3W39B 1VADA 4FLOA 4QWWD 1DJWA 3SDXB 3SIKA 2XT1B 4ANXA 4ALAC 3HI6L 3NJXA 4NHUB 4OD2A 5CO1A 5GS0C 5AQ0A 3MJ8A 5DEGA 4OUUB 3V4LA 3WEXA 3DHUA 4H26B 2XX0A 5IHBA 3G7TA 3B6SA 4N2EA 1C5CH 3EBIA 4FLSA 2P1YA 3DJTA 5D93C 4G6KH 2HVKA 3C8HA 4FS0A 4HLZG 3T3PE 3K6SB 1AZNA 2C9VA 2G3ZA 4OCWH 4LVOC 1KJ3L 3V0DA 5IT2L 2JIXA 2GK0B 4G7RB 4DP7X 1FDLH 4O58L 2FECI 3DURA 5ESAA 2H3NB 1Q9OA 3E80A 4UQ9A 2VMFA 4NDMA 5HHNA 1LGVA 3UYPA 3OPUA 1G0XA 4N3TA 2Z3FA 1EZVY 1LE9B 5SX4I 4DP1X 1AQKL 4LEEA 3OX8B 4RA3A 2BHZA 1LMKA 4YSCA 5DVPA 4MQXD 4U1HA 4QHPA 3SE9L 1KTJA 5GRZA 1IV8A 3S37L 3VXOA 5JQIB 2VABB 2ZUSA 2H6OA 1ZVSB 3M7FB 1BF8A 1CFTA 3MODL 4N87A 2AXGB 3C8DA 4F5CE 4ZZKA 2GC7C 4XVSL 5DDHA 2OJ1A 3R0MA 5SX5H 5JQ6L 2B1HL 4K71C 3HUJA 2K6YA 2XV2A 3KHOA 1JFQL 2N7AA 2YPLA 3PWPA 4NKOA 2DWXA 2ITDA 3CZUB 3OD3A 4P2RA 3DRQB 4DPAX 1BAWA 1U3YA 2V3DA 4WTZA 5IVZB 1RJYA 2Q6WB 1PNCA 1H8LA 1RD6A 2IDQA 4OZFG 4A2LA 2NUPB 2GEQA 1BX2B 5JDSA 3BIKA 1M42A 1RI8A 4MJIB 3L9EA 2OL3H 3LZRA 3X12A 1AE6H 2ERJB 2EDXA 2YKLL 3X1FA 5GS0D 4CRPA 2OMWA 1EEYB 1Q72H 4Z18A 3ET9F 4MDJA 3D85A 5A2FA 2XRAL 3KJ6L 3L5XL 3OJDB 1P7BA 4UTAA 2F08A 3H3KA 4UI2A 5EIVA 2BNUA 2HT4C 3CFEB 4OV6F 35C8L 4JPKH 4BJLA 4MVBC 4JK0D 4ORGB 1A6ZA 3T2OA 5D7SL 2IADB 4B60A 2P5EB 2QDWA 1FSKC 3DBXB 1S5HB 1RLBA 4MMYA 1UWXH 5AW9B 4EI6A 1AR1B 3BQUA 3EH5B 3E7JA 1S5IH 5KS9E 5FKAA 1F02I 4GMSL 1HH9A 5GHWH 2ZJSH 5B38A 2KH2B 1A1NA 2OI9B 2ZOUA 2HRPL 1MDTA 4WK2B 4UQ2B 3EH1A 4KK5D 3FPYA 5EMYA 3BKJH 3T2NL 5IREA 4PJBA 2JELH 1ZGLA 3NP4A 5SWQA 4JFFA 4S2SB 4XBGB 4P3DB 2YUZA 5T1DL 5JZ7D 2YD5A 4UM8B 2ADYA 1BD2E 1P6AB 3O6FC 5KVEH 3MLTB 3H6JA 2LFGA 2XKNA 1DQQB 1X9LA 1TKWA 5L4IA 1AD9B 3FQTB 1T0NB 1OSPL 3GMNA 2XOTA 3JWNC 1GAFL 4ZFGH 1AD0A 4GXUM 1NAKL 2CCVA 4PJ5B 2DYPD 1DSYA 1UWEH 2LTQC 1HWGB 3GXIA 3OR6A 3D34A 3U36B 4KH2A 4N0UA 1I8KA 1MXDA 2BZDA 3IKKA 3D51A 1OTUD 2GBUA 1OP9A 2HSIA 3ULVD 1JWUA 4AITA 4RFNB 3ZGHA 4IOFC 5FGSA 1U41A 5BQ7A 3H3PL 1A7NL 2K78A 1XH0A 3FO1A 3KPQA 4YDMA 1BJ1H 5IP4A 5EN2B 4MXVE 3PPEA 4GKNA 5FYKE 2WTRB 3FFDB 2Z93B 3WFEL 5FGCE 1A8ZA 2Q86B 1JHKH 2VDRL 2I9TA 1MCOH 1M2VA 5KJ4A 2EXWD 5FHBH 3UJIH 4APQB 4RNRA 4HWZB 3ABLB 4HK0B 5D6DA 3AQZA 3KLDA 3FU0A 4NKQB 1CZ8H 2GJZB 1S9XB 5E9AA 1HJCA 2XBZA 4QDGA 3RNKB 3FDWA 3OAZH 5SV4A 1NINA 4IYKA 4YGVA 4Z7NF 3WTTA 4IU2B 5HHMB 3RL2B 1SXNA 4J4PA 3QQ4B 3BWZA 4RQQA 4N4YB 4BK4A 4FRWA 4RGMC 4S0HA 2J4WH 3AU1A 4LDLB 1MG3C 4HS3A 5C0RH 4QRBA 3E2HB 1TQUA 3RWHA 4AXWB 4Y5YA 4PRNA 4R4FH 1V3JA 2WW8A 2Z0BA 1EWHA 3QNZB 2GSMB 3D9AL 4N9GB 3WSQL 4FZ8L 4MMXA 5JUEH 4HEPA 5FUCE 3O2WH 1UM5L 3VB9A 1GCFA 3LN5A 5C08D 2ZXAA 5F7EH 4LBAA 1ZVYA 3HI5H 3IDMB 1D5BB 4DGYL 4F5CA 4TS6A 4NRXA 5KBPA 1M7XA 4OZ4A 4Z0BH 3ULVF 1YNTB 1KACB 3K74B 4HKZB 3RFRA 2K3TA 5GXBB 3NVQA 3LKSB 4B9KC 4LLDA 1QSVA 2YN5A 3DSFL 3I50L 2HP4A 3JWOH 2IH1A 2OYMA 4EUPA 4NXKA 5D93B 3RJQB 3IFOB 4J4PC 4ETYA 4UQDA 1ASOA 2BJML 3X1GA 1X5IA 1DN0A 3TJEL 1C08A 2RMNA 4KZDH 2MQGA 1COBA 5KSAD 5C0BD 3VXMA 1UG9A 2X0VA 3SODB 2WUBL 5E8OB 5HI3C 3OAYH 1FORH 4K7FB 1OWWA 2AJ3B 1OHZA 1TQCB 2NCMA 3W9DB 4JANA 4ZS7H 4YN3A 2ZKYA 4HJ0D 3LRGA 4O02B 1JPGA 5DJAB 3LV3A 2KERA 4MJ6A 3O9WD 4OGQC 3T2LA 1IGIH 3OX8A 5JOFA 3LIZA 1ZWIB 4OY9A 5C0AB 2B0SL 2VNCA 4XN5A 2VN6A 5CMAB 3D3VA 2HFGL 3VTMA 2JNZA 4WLCA 1QABA 3LNIA 4XN2A 4ZSOA 4ZG1A 3KWUA 2QHRL 3WTYA 3L3KB 3R7RA 3VGDA 5GGSY 1HQRA 2F58L 4U49A 1S7WA 4UU9B 3WCYA 2NXYB 4HKXA 4GUOA 3WDIA 1YNTF 2APXA 1ZTXE 4OZIA 2CO3A 4YHYC 1Z9OA 4GAJH 4PRPB 1ADWA 4KKBD 3QJHA 5DI8B 4APXB 4DGVH 4KXCA 5AVVB 3D69B 2KHAA 2IDUA 2EIDA 3AWEA 2QKIA 4LPUA 4OV5B 3OAZK 4TNVK 1BM3H 2Y7LA 3DJRA 2X9ZA 4DOHB 1L7TL 1QFPA 2VDQB 2YPVA 4BRJA 2WXNA 5DMGC 5KYYB 1NCDH 3HC3H 3F7VA 2AVGA 2HKFH 3BCDA 2FCBA 2ENSA 3QNXB 1KJ3H 4D7BA 5L7XL 5DRXB 2W65B 3NABL 2OR9L 3L5IA 1WIOA 1QRNB 1JTPA 1KC5H 4RA0C 3MJ7A 2NX5A 2XQ0A 4UB0L 3U4BH 5BOJA 3A22A 4RGNC 2UZXA 1GOHA 4Y2DA 4IMLA 3ARED 5EBLB 2M8XA 2MIZA 4M3JA 4CVZB 5FUOH 5KVMC 3RVXC 3PHOA 4YS4A 1EJOH 1FZMB 5JQHC 4FQXA 2HAZA 1WQVT 1R3HA 4Q9QL 4KFMA 3AREB 1YEEL 3IN2A 3D12B 4N1CA 15C8H 4YXHL 2CR6A 3DI3B 3L4CA 1NKGA 1AY1H 1IAOB 2FX7H 2APBA 3CX5J 5JPNB 2I5YH 4M5TA 3AG2B 2GSGB 5I76B 4O2FB 1AAJA 3DJ9A 5CBEA 4PCSA 2PWEA 5KVDE 2AP2A 4APQA 3TWCH 1E0OB 5DU7A 1CD0A 3W0WE 3OKDB 4KKCC 1QTPA 2FHCA 3U9PH 5GGSA 4PRIA 1OP3H 3S5LG 4L4VE 1HINH 3I75A 4K3HA 2Z8RA 5I17A 1RAMA 3HZMA 2R9HD 3K72A 4W4NA 3KEDA 1WTLA 4Z3IA 4HYTB 4RQQB 1OQOA 1F8TL 3NDYE 4AC4A 3VDBA 4ZTPH 4OCYL 3BKML 2R2BA 3UTTB 2IPKB 2Q0ZX 3NDZE 5ERWA 2HG5A 1UA6L 2XYBA 4N8PA 1I7ZA 5DEGB 4Y4KA 5L2KB 4XO4A 2EYTB 4GW5B 5FB8B 3FRUA 3WFHA 4BH8B 1C5DB 3OGCA 4J12A 4D0DA 2WM0A 2G2RA 3QDGE 1EO8H 5EU5A 3MRDA 1S7TB 2Z93A 4A67A 4WEBL 3H54A 4FYQA 5E8DH 1A1OA 5LGYA 1E90A 4GRMB 5I0ZA 2UWEA 1N0LB 4JFHE 4FQIH 1BQUA 2A73B 4PB0H 4UT9A 4HGKC 3I85A 3U0TA 4YHIA 4M9OA 1SYSB 3RIKA 3MRPB 3K6NA 5FS5A 5IHWA 3OSKA 1CICA 1TETH 4UAOB 5HHXH 1SEBA 2NY7H 3PG2A 5B4MD 1MIMH 5DTFB 5DHMC 4EUPG 4PYHA 5T3ZH 3QRBA 5E6IB 1H8SA 3JTSB 4TQEL 2XZCH 4IGBA 5TE7L 4PGJA 4O02A 3BIBX 5D2LF 2D7TL 1JWMB 4UYPA 4PRNB 1SXBA 1ZGLB 4MSWA 4ZQKA 3C5ZD 1I85C 3LXBA 3STBA 3CCHB 1E5BA 1Z1WA 4XNUL 3BIKB 5DD3L 3QJFB 4ODHH 2ZNWA 4N2GA 3CX5K 2ENPA 3MX0B 3K1DA 3VQ1C 2P7TB 4Q89A 1HIML 2OMWB 4MAYB 3JWDH 5KUKA 4Y5VA 4BSVB 2IFFL 5J57B 4XO9A 5BUGA 1MFCH 3PREA 3ISYA 1RZKC 2Z92A 3BQVA 1TO5A 1UT1A 5E9DA 3WUZA 3BAEH 2CHXA 3C6SB 2VDRH 3HE7D 2R0LH 2EEBA 3MBEC 1R3JA 1T5XB 3OZ9L 4LHUB 3VI4E 4IJTA 5ISZD 1J0YA 1OT2A 5ITBH 4CN1A 1DEDA 3LSOB 5EA0L 43CAA 1B88A 2W38A 3RTLA 2PYED 3PPSA 1UZ6E 1F58L 5CNHA 1W6LA 3CAFA 3ARQA 3A3YB 4KX8A 2XTJB 3LQZB 2CK0H 2HT4D 3O2DA 1BQLL 1DLFL 4XXDB 3U9UB 2DQCL 2YUXA 4FNUA 3ZJAA 4Z7AA 4PN6A 3APCA 3SDYL 5C0EB 3DMMC 3HZKB 2BJMH 2E86A 3F2LA 3BX7C 3OM3B 4N2FA 1VZIA 4H0HB 1XSOA 2E76C 3IRZA 3L3KA 2GB2A 2VGLM 3RTQD 3FNKA 4HKJB 2ZOWA 3QDMA 3TPUA 1UJTA 1RSYA 2JKSA 1YYLL 5DD5H 4YHML 1EFXA 3RTQB 3FQNB 5DMYA 3ARFD 4FQXD 4YFLI 3QARA 5I28A 5AOIA 5I74C 4DW2L 3KXFE 2Y2TA 2C5DC 3QIBC 3AG4B 1RUMH 4GAGH 2PW1B 4CADA 3E1F1 5F8RC 1A6PA 2OI9C 4I48A 1CVRA 1EFXD 2DEXX 3QNZA 4A39A 3GXUB 4BA0A 5C3IA 5IZ7A 4YEEA 2NY0C 1CUOA 1WA0X 1DBML 1TDQA 3EYOA 3ZUNC 2CZNA 2GIXA 1VCBC 1H9DA 1Z32X 1HCVA 3P77A 3ES6B 1T1YB 3TIEA 3MHZA 3GRGA 1Y07A 4DO6A 1TZOA 4HSAC 3L45A 2X4TA 2IJ0C 3LKQA 3GZOA 2YBRA 3NCXA 4LLDB 3TH3T 3WY4A 4PGBA 2GFBB 5G5DB 4Y2DB 3L17A 4W9ZA 1MCWM 5BV7B 4YX2L 4WWID 2HZHA 5D4HA 2G75B 2EYSB 3UDWC 4NO3A 4G6JH 1LK3H 4LU5L 5HGHB 4D0DB 2Z64C 3U6RB 4X5PA 3MQIA 2F5BH 4HUWA 1UQSA 4Z7VE 4YAQB 5G55A 5JYMA 4BFIB 3V0AC 1FO0H 3LEVH 3NTCH 2PWFA 1EEZB 1JGDB 4FULA 4RFNC 4NBZB 5I19L 4LP4A 2JCWA 2PTUA 2D3NA 2IPUK 4JRYB 4YSUA 4L9DA 5LG1A 2XZAH 3HPJB 3S96A 5T1KD 3T65B 4OTXH 5FCUH 1YPZB 4PY8J 5C0BB 5KSAB 1EZLA 4PR5B 1IFHL 1KPVB 3V4PB 2BSTB 5D1XC 1VPOH 2RCSL 3B1TA 4TQPA 4QHUA 4HDIA 1E4XH 1EDYA 5FPIA 1OCZB 3V7AE 2EJ1A 3IDMA 2FYYA 3IDIA 3P3UA 2WKOA 1TKWB 1RHHB 3JT0A 4MA8L 4PJAF 1DVUA 2EIKB 5T1JA 2GABA 3DTDA 3QUZA 1C5BH 1K8IA 3ME0A 4HIEA 5I66A 3S5ZA 1XEDA 2OMUA 1AH1A 5D7IE 4XN1A 4A2EA 2UUDK 3C2AH 3LEXB 2X6UA 5DHYB 4LKCB 1TIUA 5I1KH 5J1SC 3DOHA 5DEFB 1UWYA 1G0DA 5TH2A 5H35A 1T0PB 4RVBA 4NQCA 4RAUA 3HHRB 5F9JA 4AH2A 1AZVA 1U8NA 4X8CA 4ENZA 1E42A 3KPMA 3FFOA 4ERSH 2Q3AA 3ARGC 5C0DB 2CBQA 2BRRL 3DIDA 3GIVB 3VI4F 5F7WC 1UM6L 4L8BA 2WUCL 3EJJX 3VYPA 3ABZA 2AJUH 4G6KL 4QNPE 1QO3A 3AW5A 4NZFA 2K8MA 4J3OG 1RHFA 1TZGL 2R1YB 1JYWA 4LOUD 4WF7A 2OYKA 2VH5L 3RWGB 5CN2A 4N9OB 4HQQL 5DGQA 3MRCB 1IAMA 2WQUA 4N6RA 1WICA 4OJYA 5CZVL 1QEWA 2Y36L 3N5AA 1KBBA 4UWQB 4OFKA 3QDJA 4P4KA 3E38A 4Z95L 3VX0A 5JIKA 4TRPH 4LIQE 4KQ3H 4PWJA 1C8PA 3FXIC 2DQJL 3EYQC 3VYOA 1HDMB 4G8IA 1PZ2A 3IFLH 1NIAA 2AMUA 4JFDE 3WNNA 2Y06H 2CJUL 2VDPH 2X4UB 4OZFB 4ODVL 1UOWA 3H6AA 1OM3H 2F74A 2P8PA 4WTWA 3NESA 2X7LB 3CQPA 1I9RL 4PJ7E 3MV9D 1X6LA 3R06A 2MEJB 4MLSA 5I17B 4I77H 2PP9A 4WJ5A 3DROA 1CLCA 1NGZB 3RJOA 1KTLB 3S7GA 1QSEB 3D3VD 5EIIB 1BZEA 4NUQA 4PJ7B 4UTBH 1PZUB 5DJZA 5JR1L 1KENL 3BE1L 5E9DD 3IETB 3G08B 3HS0B 4BCZA 3TJHC 4GSXA 3UIZA 3ABKB 4BH8A 4TSBH 3FC8A 4JFQB 2X4OA 4UANA 5FAAA 2DQGL 4PFEA 3V0HA 3V0IA 2BZCA 4TUUA 5CGYD 2C1PB 4KPHH 4RFOL 5F9WC 3BKYL 4MFHA 3QG7L 3FUIA 1CDYA 4NQDD 3OJ2C 1I3GL 1DQVA 2WLLA 4G43A 4XPHH 5KJ7E 1KY6A 2X4QB 4I0PB 5DD1H 2XN9A 4YHOL 4NO0A 3KE0A 4ELKA 1F1AA 1BQHA 2CO7B 4I13B 5CZRA 3FO9B 5HPOA 2IF7A 3BC9A 5IB1B 2RFXA 5E7FA 5SWSD 1KEML 1FYHB 3QQXA 3RVUD 1WD8A 1R47A 2ZF8A 4OKVB 5CLXA 4B9YA 4WJG3 3U6RA 4EKJA 4YHPA 4DKEH 1CFNA 5TK2A 3BO8A 4OLEA 4Z7VA 3EHBC 1RUML 2OW6A 5KYXB 4KZ0A 3QHTC 3QFDA 1BZ9A 2NY3B 2ZCHH 2BY2A 2DICA 2A83B 4NIYE 4NN5B 2ZUTA 1T2QH 4L2LA 4JB9L 4I48B 4K23L 4OB5H 3U83A 1FL5B 2IBGA 3IE4A 4Q6YA 1EHLH 2JKIS 4K5MA 2BVPA 2L7JA 5KSBE 5E6ID 1G7LA 1BFVH 5MERA 3S35H 1MCHA 1TYEB 5T1KA 1PD0A 3KLHC 3FQ1A 4KJYA 2GBVA 1X5YA 2ZCLL 4LLVA 1WUZA 4QRTB 2XPZA 4U6VL 2NOYA 3INUL 3TBVA 1YN6A 1WBXA 1YMMD 3M1OA 4FG6D 4AW7A 1RUQL 1T1XA 5BMFH 1MJ8L 1WAPA 3QNXA 3CC1A 1RP8A 5E0QA 3EFOA 3O0LA 3OAUL 1T20A 5GRYA 2YUVA 4B9PA 4AGQA 2GK2A 4U1MB 1CU4H 1RJCA 3KPSD 4N22A 4E5XB 1R34A 2F5BL 2XFGB 4F8TA 3HUJE 4OZGF 3WUWA 2DBLL 3L7FB 1JF1A 1YNLH 4WFGE 3PWPD 2V7HB 4LLMB 3OMZA 4EBQL 4EZMA 1GVIA 4FLRA 4HBQA 4OT1L 2EYRB 3ETBJ 2NY0B 2VXVL 4NZUH 2NSQA 4P23B 1KXQE 4P5KB 5J12B 1E9QA 3WN6A 3CXDH 4HIXL 4HUUB 5D1QB 1KXVA 3DJSA 3S8GB 4MYWB 3FN9A 3BH4A 4EDXA 3ZMNA 3QS2A 3RL1B 1FNLA 5D1ZB 4YHNA 1H3PH 5C71A 2JCCA 5IMLA 1EGJA 2YKKA 5CSZB 2VXSL 5CCGE 1ET7A 4IK7A 3HLAB 2ZOLA 5FO7A 4Z7WE 3HG1E 1P1VA 4GMTL 1NMAH 4XO3A 4UT6H 3UTZA 5DHYA 3DECA 3L3GA 3RWCA 3VFOA 2XQYK 2W07B 4JFDA 1VENA 2DQFB 3L4TA 4CDHA 4AYFB 5J9PA 3G9AB 4CMHB 5AENA 3VQ2C 5L2KA 5HYSA 1RZIA 3HR5A 2BSCA 1AXTH 3IU3B 3NJHA 4QRPE 1EEQA 3UTPD 1CGXA 2JJVA 3GMRB 3NIFB 2J5LB 4OFQA 5CU9A 1ZJBA 4N68A 3LXCA 2PPAA 1FL6A 5CFHA 3V4VL 3CSPA 1UGNA 5CIPH 1U3JA 1CDUA 1U8OA 2B1OA 2DY2A 3COOA 4L5FL 4W9EC 4XHQA 3F6IA 1A9BA 2GKIA 3O11B 2XICA 5ADOH 2IGFL 2A1WH 4ODWA 2OTWB 4GG8A 4OCXL 2H9GA 3GHPA 6CGTA 3WN5B 1F2QA 2DJMA 3FUHA 3I6LD 3IU4H 3T1FB 3RWJA 4F7EA 1FFNA 5E4EB 1BXXA 2WVTA 3KEHA 4U3HA 4XNMB 3IGAA 2J55A 2F8XC 4P5MA 3J7HA 4HG4J 4X98A 4XB8A 1WZKA 2H32H 3Q5YA 4OZGE 4KZEH 3QUXB 4HGWA 4KHXH 5K93A 4YK4B 4J39A 1QBBA 4NQDA 2QGCA 4PWHA 2YSSA 3SKMA 1XXDC 2UZYA 1JMXA 5HI4C 2E4FA 3OKOB 4OLUL 1J1XL 2H7WA 3GMQB 1GPOL 2O1AA 4UINH 1TTBA 1UCTA 5I26A 5EC2B 5GGUA 3VI3E 1CF8H 1ZHLA 3OKMA 4JN1H 1TCMA 1BOGB 1R4XA 5KVEL 4M7KH 5CCJA 5LNDA 2WBKA 4A2DA 3IJSB 2QPEB 4HWBH 1HXYA 5BPPA 4NUPA 1LEKA 3STZB 3L48A 3ROOA 2GPZA 2JSFA 1XCXA 3H4HA 1KTRL 4ZX6A 4ZRGA 1NJ9B 4LCWE 1SLWA 1U8NB 5JXEA 3L1GA 1HH6B 3QFJA 4LL9A 5FUCC 4O2CA 4Z8FH 2L7QA 2WV3A 1L0QA 3ZE1F 2Y2WA 3B9KD 3HZ3A 3QPKA 1RVFL 1MWAH 4GBXA 3QIUC 3SKOB 5C7ZA 4K94H 3GMOA 2EXYD 4X8JB 3FQRA 3LEYH 1UHVA 3DBXA 3V5DA 2V3FA 5D96B 1B2YA 1H3GA 4YDLC 3B9VA 1WHPA 3IMBA 1NGPH 2AV7A 5F9OL 3VFPA 4YIQA 3VQLA 4K5OA 1A2YA 2X2YA 3D25A 3VFRA 2X4SB 1QUPA 1LEGB 5FYJD 2UXTA 1EHKB 3GI9H 4U1GC 2CRZA 4NB7A 5IV2A 2LR4A 3OXRA 1UB6A 4GY4A 2R4RL 4XP9L 1JXKA 3FFCB 3OPZH 4YHYB 3T8XA 1S5IL 3BD5A 4FABL 1FCCA 3T0ED 3DX1A 4PJ9D 4GI9A 3X17A 1UGKA 2HLAA 3D52A 4GFXA 1KNOB 4EIZC 4PCKA 5JW3H 1N70A 4OCYH 4XX5A 3F65A 2IPTL 3TPKA 1DUYB 3VGAC 4WNQA 3PWNB 5FC9A 5JIQA 4EI5B 3KPTA 3GWJA 5T5FL 4AUYA 3MLRL 4LLVB 1A4CA 1KBGH 4M93C 3B5HA 3GS7A 3W11C 1QHPA 4R7XA 2B5IC 1BA9A 2I25N 3FB5B 1G9NH 4HZLB 5GJSH 3L3GB 3SE9H 3D33A 4WI6A 1J8HA 3QHZH 5DJ8A 1IQWH 3TIEB 4OI8A 1QFUH 1QSEA 1CTNA 2DPKA 3EBAA 3UO1L 4U1MA 4XO5A 1DZ0A 4JR9H 4PRBB 1JTTA 1L6PA 3FAWA 1IGYB 2AJUL 4P5TA 3TZVC 4N0FB 2XTJC 5F7HA 1YDPB 5GRJH 1CD1A 5JQ6H 2OQJB 4ZFZA 5SWQB 2P8MB 1YEGL 3O41A 4BGDA 5KVEE 3UZVB 1FFRA 4UDTA 4KRNA 4XT1C 5GPRA 5J13B 2J43A 3ARZA 3VXSB 2OZNA 5EH1A 3Q8CA 1JNNL 3EXLA 3QSKB 4JRLA 1AQKH 2XN9B 3SJVB 4LF3A 1D2OA 1T6WA 4KX9A 2EDFA 3BEWA 4DPBX 3O2WL 4QOKD 1NFDB 2CNZA 4PLKD 4QGYA 4R96B 3P3RA 3WNOA 2FBJL 4U4IA 4UILL 1K5NB 1U33A 2VXUH 3T1FA 3ZKND 4F7CA 4DP4X 1WRFA 1LO5A 3U4AA 1H3TA 2Y5EA 4NLHA 5AYUL 4P07A 2WNGA 5A2IH 3TBSB 1ECZA 3FMGL 3Q9PA 1OALA 1GYCA 1B0GA 3SD5A 3CFBB 3IPFA 4J3OH 2YEZA 4PREA 3DX2A 3DUHA 3V4VB 2DQEL 4O4YH 4DOHE 4OZ4B 3SQBA 3MRNA 5F0MB 4JG0H 4UIMA 2PPFA 4D3CL 4OQTA 2IDFA 1UJ3C 2XWXA 5I71B 1D5ZB 2F6AA 4HWZA 1M9WA 5AVYB 5KG9B 4PCTA 3RIAF 5ADOL 3F3HA 1U8OB 1IGMH 1BMWA 3TFKC 1UD3A 4NCC1 5CEZE 4M48H 2AHIA 3L81A 4Y5XA 4P5SA 2WO3B 1LO0L 5D6DC 5INCB 3X3FH 1HOEA 2EE2A 3C5XA 3PQYA 1NPJA 1UH3A 4ZW5A 3QIBA 3N9GL 5DMKA 4M6MH 2UX6A 2FJFA 1KTBA 3BAWA 5AZ2H 2AK1L 4YXLL 2VXTL 3OF6A 4KI5F 3O2VH 4AGNA 1CMOA 1DDTA 4K23H 4OB5L 2R2EA 4D0BA 1G7MA 2W0KA 5GGSB 4KJWD 3RWIA 2IAAC 4ACPA 3TS8A 2VRQA 3QA3B 4UT6L 3TVMB 5DCCA 4I7ZC 4Y0GA 1U8CA 2CIIB 4IHOB 3UXFA 4NQDB 2QSCH 1KYFA 5D1QA 3MRLB 2HX8A 5LXGL 1QR4A 3B9KC 3FCSA 4QY8B 4OZIF 5EU6D 4Y2OB 2AJZA 3BPOB 3PWUB 1YNTA 4IEFA 3HFMH 3O6FB 8CGTA 4F92B 2UWEE 4EE2A 1YEJH 3IM1A 4P2RE 1CBJA 1GIGH 2VAJA 3K4ZA 3ARDD 5DJYB 1O9ZA 4HMDA 5EEVA 4IKJA 3VWKD 4GXFA 4M43H 4UIKH 4AQZA 2VW6A 1KMGA 5JW4Q 1HL8A 5IWLA 2BNRD 4WUUE 4K7FA 2MNJB 3SYOA 1F4YL 4N0CD 2YRBA 1H6FA 1UCBH 1GGUA 5JIHA 4FFZA 4XI5C 3VXME 3VRJA 3UERA 1OAYH 2K4AA 1QRNA 5ID0A 1JD9A 2P5WD 3DX4A 4KI5D 4WFEE 5CCKL 2EYRA 3VWJB 4KTDH 5EUOF 4ZDHB 4WW1A 4NJAH 5A6IA 3BIAX 2BC4A 2CO4A 1E3FA 3GI9L 1FC2D 4BM7A 3WJJA 5CILL 2V9RA 3O11A 3K3QA 2X41A 3RU8H 2E3VA 3NSXA 4KK8C 4NZTL 4XOEA 1AGCA 1SM3H 5EF0A 1LNUA 3TYFB 4KK8D 4MASA 3GSXB 3DUUA 4L3AA 3WG7B 1HHJB 3GXFA 3KPSB 1LO4L 4HMEA 4ONOA 2N3JA 3NZUA 5DZAA 5EO9B 3VXSA 1L0YA 4X9HA 4MAYA 2FX7L 2IAND 1QNZL 4LCIH 2V2XA 3CIQA 3F58L 4R90H 4A6YL 3ZL4H 3QUXA 3DIFA 4ANKA 3N40P 2EEDA 3VACA 3GLEA 4KU1A 1IVTA 2Y25A 3KPRB 3ECBA 4OSUL 4FL4C 1ORQA 2VC2H 3SKMB 5DSCB 2VERA 4QD2E 2OMTB 3EGDA 4G8FA 4E41E 2PF6A 4N1HB 1N59B 3EJZD 4LVEA 4MNQE 2Y7QB 3CFKA 3QEHB 2DYPB 1BJMA 1PVHA 3E9UA 4HZLA 4UINL 3B4NA 4X9FA 3UGXA 5L88L 4I88A 5I1EL 1QI3A 5B3SB 1SMDA 1P7HL 3UTQB 5F7BA 4F58L 4NI6A 4XTRD 5L6YH 3TBVB 4RZKA 5IBTH 3QUZC 1I1RA 2CHDA 3IBOA 3SY0A 2QVTA 2HVJA 4NNYA 1IC4H 2WBXA 3MXVL 3SE3A 1A1MA 3VSQA 3WAKA 3O81A 4XN9A 1WZLA 2CUAA 2NLJA 2N7SA 2QQNH 3DVNA 4R4BA 1IVLA 3VGEA 1I82A 2WXFA 1P69B 2OL3A 4P59L 1NPNA 3UJTL 3ZRFC 5JHDD 5IJKC 1ADQA 2VZSA 3PGFL 4G1EB 3WIAA 3ASWA 3EGSB 1XH3A 5GJSL 4EAEA 4EOWH 4F57L 3QW9A 4U7SA 3S0PA 3CDGB 1CLYH 1FVCB 2RD0A 2W92A 4PS8A 1WA2X 1IGML 4JDTL 3FF8A 3V6ZB 2V8LA 1OK0A 2DQIH 1XT5A 3FBKA 1U3HB 4Z7UE 3VG0H 2FJGB 2VLRA 4H8HA 3DHJA 3U82B 4U6HA 1LO5B 5CUSH 2VDPL 2G4GA 3EOAB 1JAEA 3BW9A 3WKML 4P5TC 3AC0A 4NYLA 3QXAB 3T6VA 1R5WA 2E9JA 3G6JF 1R46A 4RMTA 4Y2DD 5EZJB 3ZHKA 2HFFA 4HHAA 4XGZA 4GKZB 1ZV5A 2DQTH 3BP4A 2ZAHA 3HRZC 1X5HA 5D1QE 3CBRA 4F37K 3O6LH 1PLCA 4KC3B 3ZMEA 1AC0A 3C6LD 1I3VA 4LPYA 3NQIA 4G7SB 4WHTA 2QPUA 3VE0B 5I1AB 2XWTB 4S0TD 2BOLA 4LLWA 2VXQA 4NNXA 3PWNA 1BAFH 1ZIAA 2DW5A 3WGVB 5D7LD 3CFDA 1V7ML 5HHOD 4Y4HA 3UBXG 3UTSE 5AOJA 1CK0H 2CLRA 2NY1D 3B7UX 3D7PA 1CE6A 3CSYA 3MDJA 4MHHI 1UURA 2FEDD 2GI0A 1KJ2A 4YMPA 2Y5QA 4NI3A 1BZ8A 4POYA 1EXGA 3CLEL 4CU6A 2LFEA 2VZ1A 3MBWA 1QSZA 5FV1L 3QNYB 3TO4D 2AQSA 4Z8FL 4YBQD 1XGUA 4U1GB 1YA5A 3VW3H 2YPKB 3P11L 1LO2L 4HISA 2G2PA 2KUTA 3B83A 4J27A 4OCRH 1L5GA 1PAZA 4D0BB 1JWSB 2EXTA 1LE5B 1EH9A 3ZW3A 4NKIH 4NQCE 4UDTB 3FYEB 3P0YL 3GB7B 3IMWA 2NDFA 1P2CB 3G5YA 4JPWH 3B9KB 2AQNA 4KHTH 1T4KA 2O5YH 3B2UC 3UZEA 5C0IB 4JRFA 5C6TL 5FM5M 3QIUB 4GBXC 1IILE 4HAFA 4I4WA 3FQNA 3TA3A 4KUCD 5T1MA 1ONQA 2E6PA 1LQSR 2EC9T 2CAKA 4OLWL 4JHVA 3ULSA 3AGWA 4HOMA 4IBQA 3MUGB 2CE6A 4XMZA 1EXHA 2DM3A 4C56A 4PLKC 3VFWB 3QUYD 3UTPE 2Q8AL 2FEEL 1F11B 1X4ZA 2H26A 3I02B 5JW3L 3W82A 3VTTA 2Z35A 3HS0C 2BVYA 1N68A 2K7PA 2IDSA 3I2CH 3RJDA 5JHMA 1OGSA 4AQOA 4TMPA 4K5NA 1ZVHA 4IDJL 4HS8H 4A7QA 3RE0A 4G8EB 3CLFL 3KPPA 3KNBA 2X05A 4NHUA 4UOQA 4JDEA 5FLVA 4TUKH 5C07A 3SGKC 2VITA 1Z5YD 3AXIA 5TQ2H 4AG4H 4MNQA 1MCOL 1FGNH 4M00A 3MAWA 1ZA6A 1DUZA 1R5VB 4ABWA 3ILQC 2ZTBA 3LPGA 3QDJB 2QVIA 4GO8A 4BEIA 4IOFD 1UYWL 4KKLD 3JZ7A 1UUSA 2JXMB 4E9YA 1DN2A 4HXAL 4HP5A 5E4EC 3FFCE 5GRWA 3R1GH 5DVOA 4M1DL 1RJZB 3L95A 2ADGB 4U1JA 3KBFA 3W11D 3VFNA 1QR1A 1Q9KA 1A3LH 4NUGL 3HPJA 1Z3GL 3S96B 2X2HA 5B7FA 2F74B 2WB7A 4WO0A 5E6IC 3K6FA 4U1HB 2VLJB 1DJHA 3BLKA 2W9EH 3U46B 2V8MA 4HWBA 5HTSA 3QAQA 1BLIA 3VXOB 4HULB 1ZLDA 5EU3A 3SDXA 4B9ZA 5BJTA 3B43A 1QI4A 2QSCL 4FG4A 1A6AB 5K39B 3MMEB 3UG4A 3Q1EA 1NEZB 3ME0B 2DQHH 3QEGL 2UWEF 1TYRA 3GKWL 1KGJA 1VPOL 4Z78B 1M71A 3VM5A 3UAFA 2BCKB 3JTTB 2DN7A 4HJIA 3MKGA 1KIQA 1BFOB 1SQMA 4AL8L 4DAGH 4P2AA 5JW4M 3NCJL 1NL0L 3DHPA 4LCWD 4NPYB 4KVNH 2WKGA 5HPMA 1HSBA 1I7TB 2Y1VA 1OP5H 4CVUA 4JZNB 1ILSA 2AJXH 43CAB 2FEEI 1XAKA 5DGRA 5E2VL 2GJRA 3ULUE 2PW2A 1PFOA 2NY6B 3M45A 2X4PA 3MRFA 2AXHA 5TFSL 5FGBC 5LXVA 4I0PA 3TO2A 1F18A 1F3DJ 3BGMA 3N85L 3NJGA 3QPXL 3T4AC 1UFGA 2YPVH 1MI5B 5AYUH 4RBPK 5KSUA 3ZYJA 4QRAA 1CD1B 3Q6GL 4LNRA 1KB9K 4YNYA 4MS6A 4HFWB 1IBDA 4XC3L 5KYWA 3QBTB 2BW4A 4LSSL 3VGBA 3FF7A 2Z31B 1TZGH 3SBWC 3B7YA 2XPYA 4AEHL 2VSMB 4XWOC 1ESOA 5I0DA 3SJVA 3BT2L 2NNCA 3V2AR 5ESVA 3UEQA 4PJ8C 1I3GH 1VIWA 2XN2A 5DF0A 5DEFA 2APVA 1SY6A 1V3MA 2A77H 2NYYD 2WWMC 3GJEA 3MXWH 5FYLD 4P5RA 1YEIL 4KBPA 4RGMB 5GRVK 3Q3GA 3MLUL 5J1TC 5D7IA 1F4XH 4GAYB 4K55A 2V5SA 3DJZA 5DVMA 4G9FA 4QRTA 3A6OA 1A7PL 4GAGL 5T5FA 2J6EL 2NUTB 5I1DA 1MCQA 3TEUA 3THML 3FU7A 1DDHA 4U6YB 3D87B 2ETWA 5AOMA 5EU4A 4A66A 2WSPA 1SZNA 2VUKA 2YMXL 2UUDH 4UNIA 5I1KL 3QO1B 1IARB 4E0RA 1G9ML 3MOAL 4OW6A 5ACMA 4JKLA 4G5ZH 4I2XA 4PV8A 3W38A 3QIWB 5D7KD 4QRPB 3W9EA 1Z9SA 1SBSH 1OGAD 4GXVL 1CE1L 1F90L 1RERA 3TP4A 3WUWB 4HWNA 2IAMA 5TGBA 2IV8A 4WFHD 3V6OA 1A6UH 4UBDD 2YPLD 2EDDA 4XAKD 5FWQA 1QLRA 4S1RL 5HGHA 1WG3A 4F33B 1PW3A 1MCKA 4OIBA 4J8RB 4DF9A 4AIOA 3APNA 5F1NB 1URZA 3QZWG 4AM0B 2FO4B 3OQ3B 4ZFOB 1OT4A 1WT5A 1Q90A 3WJLA 1WK0A 3TT3L 1QFOA 3T3PF 4R83A 3MLVL 2VN5A 4P2QD 4K5LA 5A6MA 2BNQD 2RH0A 4TTGA 3T65A 2D4FA 2HT3C 4X2UA 4LSVL 4QXWA 4Y89A 1UD6A 4HW6A 2DMBA 2IALA 4R7NA 5E8EA 2XV0A 2GBTA 4UDUA 1ES0B 2EINB 3P9MB 4X4YB 3QWRD 1H0DB 5I8EB 4A2GA 4P49A 2VLJE 4EN3D 2H0EA 3LIZL 2WZ5A 3K0WA 4X0NA 3AAZB 4OLVH 4CKVX 4D9QD 3Q05A 3WKYA 4Y88A 2B3RA 2HRHA 3DARA 1AMYA 2G3MA 3CQFA 2VLJA 5IFAH 3KG5A 4TLSA 4LCYB 2HLFC 2BWDA 1BSIA 3T71A 3L7EB 5FO9B 1FC1A 4TQEH 1UEYA 4JFFD 4L4JA 4WTQA 1FVDB 3NT0A 2O5XL 1IKFH 4FZ8H 3X3GH 2L4OA 1KB5L 1HAWA 4JM0A 3EYFA 3IWVA 3CG8A 1OWRM 2YAHA 4L4VA 4I87A 1VACB 3F64A 2QVFB 2F54D 3KPLB 4W9KC 1WO2A 1HHGB 2MPAH 1XB8A 2IANA 1L6ZA 4LPCA 1PIFA 3D39E 3ZUCA 3MREB 4W6XB 4LQFH 3IK2A 1FVEB 2CGRH 3BYTA 3QUXD 1UEMA 5E99H 2R23B 1FL3B 4FQQB 3SN6N 3PXJA 1EHNA 1FFNB 4R90L 5DWPA 4FCHA 1TG8A 3OC5A 4NJ9L 3I9GH 3LKPA 1JZ7A 3VU1A 2XCMC 1A1NB 2UX7A 3UGUA 1J8SA 2R0KH 3QJQB 5JTWA 1F86A 4DIXA 3DO7A 5HVWA 4ZW6A 2BS71 4HJEA 3U0PB 4KDWA 1KPUB 3CGTA 4FFZH 3W5MA 4QTHB 5JR1H 5IVXF 1AS7A 2Q20A 4PTUB 1JHTA 2FIKA 1T03H 1Q0YH 3N55A 2XKNB 3PAYA 5IF0B 2C9RA 4XMUA 3ZHFA 2VJ0A 1TQSA 5LGJA 2XIDA 2OZ4L 3KS0J 1VF5C 5FKPB 4LLYA 2QT6A 3ULAB 3POHA 4FE9A 4GUCA 4JEGB 1OM3L 5I8KH 3I9IA 3TA3B 1MUJA 4BWWA 4FTDA 2IQAB 4JO3L 3HR6A 3VQMA 3PJSB 4OZIB 2WXGA 1D3CA 4GOSA 1MFBH 4QTIL 1A6VL 5TDNB 4N0UB 1JVLA 3VWKA 1PPIA 2YFNA 3EAKA 3H56A 2Q7YB 1M6OA 2Q8AH 4BFFA 2YEVB 3J2PA 2GY5A 5ALCL 4EI6B 1FFQA 3C6LC 2EILB 5JOPD 2P42B 1E4HA 3Q01A 4Q4IA 1KGCD 3ZRSA 3P1VA 4M8QA 4KI5C 1JK9A 3BPLC 3W81A 5IUSA 1OAZL 2LVEA 2WXQA 3FTZA 3H55A 3QGVA 1NC2A 3MA9L 3WIHL 1B2WH 2KS0A 4GS7C 2ITFA 2Q86A 3NIGB 3Q2VA 5GRVL 4DGIL 5HVHB 1W15A 4TNEA 4ZFQA 3RY6C 1NAKH 5D55A 5DWUL 4CVZA 2IAMB 5GHWL 3WGUB 2WXIA 4NM8L 1LP9A 1Q94A 4YHOH 4JFOA 3LN9A 4JM2D 2ATKB 3II1A 3WN5A 1HNGA 1TFPA 4KO7A 3APMA 5CHNA 4ZK8A 1BXAA 4L2YA 1CD8A 1XSIA 2Y6SD 4ZOCA 3NA9H 4UTAH 1VFAB 1T4WA 4JM2B 5SX5K 3V0GA 2AGJL 3IGAB 3CUPA 4YWGH 4JQIL 4UZGA 4IHBA 4Y9BA 3EO1B 3K2UH 1GZPB 1QOKA 4ZFOA 4UBDC 3OR6B 5DJCB 3QJUB 5J9PB 4Z7WA 4HFUH 3KPRE 2CALA 1AO7D 1KJVB 4XCNB 3JV6B 5I1CL 3O9WB 2AZUA 2AQPA 3T1WA 1AKJD 3ARBA 2V9TA 2XA3A 1N6QL 2P28B 3I6GA 4KUZL 1D7DA 4BUGA 3CVIL 1H0DA 1D5BA 2AI0L 2JJWA 3ECVA 4OJCA 3VI3B 5B39G 3GT6A 4L3ED 4NZUL 1XMWA 3EJYC 3LH8A 1M2VB 2XBDA 4TN9A 4CSZA 4KK6C 4XBPB 5B4MC 1SQ2N 3OLGA 4JQVA 1KSRA 3MLXL 4N2BA 3LMJH 4JMXA 3VXRB 5FEBA 1GTFA 1E27B 3DXAA 1T3FB 4JO5A 2HN7B 4ORGA 4YUEL 3UAJA 4AENB 3KBHE 4ZFOL 3JUZA 2M83A 3WFEH 3TT1H 4G6FB 1QUNB 2ALWA 5HDBF 1FVDA 5FFGA 3WHE0 1S5HA 4XP6H 2DYRB 1CT8B 4LVNB 2J44A 4XWOD 3UG5A 3VNZA 1DSWA 1H6EA 3QP3A 4W9JC 1I8AA 3CFJB 2VDMB 1KBKA 3CH1B 3CBKB 2WLMA 4P5KA 1HHGA 2GVYA 4UZSA 4Z77A 2XWJB 1X7QA 4L8DB 4EKXA 4KO9A 1HKLH 4LBEA 4ZBJA 5JYLA 2K3HA 5GS3A 4N85A 1F6LL 4UV4L 1HVXA 4X4YA 4JKWA 2XQYG 2CGRL 2ZWNA 3BQUD 5JW4N 2LOEA 3LKPB 4GW1B 2R0WL 5J6SA 1A7OL 2KZWA 3N1QC 1W91A 3S88H 1NSNL 2YARA 3MSPA 2XTSA 4HKXB 4I9WD 1B0WA 3ZL2A 4B50A 2IH1B 3PQYE 1KNOA 3PDOA 5IKCA 1UM5H 2HLEB 3CHXA 4MJJA 1FO0A 3Q8AA 4LSDA 1BF2A 1KB5B 1XR9B 2GW5A 1EO8L 4LCYA 4OM1H 2QKIC 2CH8A 1AGDA 3MRBB 3FJTA 4U1LB 4XMLH 5I75C 4KRPD 4CMMA 1EZSA 1BM3L 1K9TA 3Q6FA 2GJPA 4HJJH 3G5VB 3HEIB 1WZMA 3KW8A 3OR7B 4PRHE 1MRCL 3N41B 4OLVL 3ECQA 4FERA 5IK3A 3KPLA 5INCA 1ETJA 3NSDA 1JUFB 2ZSWA 2KYIA 5K69A 5IR1B 1NCGA 4GKNB 2FEJA 2EO1A 2BMKA 4EEEA 4HGMA 1O9VA 1JZ2A 3SDCB 3BP5B 4F3FA 3D2TA 2CO6B 5FUZL 1ZA6B 3PHOB 4PGDA 4NWTH 4LGRB 3GLAA 2G3NA 5T5NG 1JV5A 3PV6B 4PI0A 3P69A 4MYPA 1H5BC 2RQEA 3QZWB 3CZGA 3GJFA 2LU7A 3GMMA 2M26A 5AAPA 3IAGC 3NZHH 2WYTA 4ZD3H 3DO7B 4ADGA 3QXDA 3HVNA 4QHNA 5CBEB 4YDJB 1C1EH 3TBYA 3EDFA 3EOTL 3FN3A 3ARDA 4P2OA 3RIFK 1IEBB 1MF2L 1JFQH 1YY8A 4FMFA 3GKZA 1MFDL 1FP5A 3L3JA 2N1KA 3OMIB 1PJWA 2CM6A 1WD9A 3FQYA 4N1EA 2WQXA 4LKXB 4IOSD 4A7UA 4K3JH 1FWXA 2EVIA 1ADQH 1MWAL 3D06A 2NT1A 1AGBA 2YWZA 2FK9A 1SHWA 4XCFL 1I7ZB 3BVNB 3G3LA 4TUOB 2P8LB 5KSBB 3QORC 4OVVA 1V7MH 4NENA 5AVZB 4EUPB 4KMQA 4L18A 1DQLL 4RISL 2DWDB 4NC2B 4TSBL 3VFTA 1BVKA 3DMMD 3FRPG 4WIQA 5EEXA 1ZLSL 4O2CB 3GBMH 4WO4A 4EIBA 2HMIC 1I53A 1LP9F 1J11A 1NGWA 2HMID 1W72B 1MCLA 2E9IA 4FQ1H 5AAWC 1TEGA 2BXZA 2DIEA 1QASA 4NM4H 2XY2A 4YSAA 3W9DA 5DD1L 1FNAA 1LNUB 2W88A 3O3BB 4TLKA 4TTDC 5E03A 4ZS6D 3TYFA 1F1GA 3ZZSA 2XG4B 1A9EA 3VFPB 5EN3A 3GPSA 3QT2A 2VL5A 2V2WB 2WLYA 3EF4A 2GQHA 3IXTA 5DRNB 1H3VA 1SYSA 3H7BB 1FYTB 2PYFA 3RVUC 2ARJQ 2JI2A 1G43A 4N90E 1UASA 4OJFL 5BUPA 1CYXA 1P5VA 3BH9A 1AZRA 2Z8VC 4WW2B 2Z31A 3S3JA 4Q97A 4OGXL 4CC1A 3ZKSD 5K33A 3KR3H 5KVFH 3AFLA 4QAWA 2ZZUT 2VJ8A 5EOTA 3T0AA 3O4LB 1YAZA 5DUPL 1QBLL 3DTXB 4JHWH 2EE9A 1X5LA 3DWTA 5I1GL 4RWYL 3VVWA 1Y1UA 1SJXA 3P77B 4FGMA 4ZTPL 1VGEL 3LKOB 1YCSA 3ZT7A 2XWEA 4UTAL 3VI3A 5DJYA 4JO1L 2E9BA 2P43B 1V27A 2PO6C 2YBRB 5AW6B 4PJ8B 4Q4EA 3IFNL 3QI9B 1TO4A 3SCMD 4NKMB 5CEXA 3VYNA 3WO3B 4E0RB 2A74A 2FJSA 2ED7A 3D8MA 4C54A 3DVNB 3HC4H 1E28A 2UZIH 4K9EC 4CW1B 3JWNE 2KLSA 4MDRA 4GEIA 2EIMB 3KVDD 4Z95H 2QPFA 1SHSA 2DL2A 2OTUA 4GUPA 4KNTA 1BVNP 2KBGA 4M1GH 4OM1L 1DFBL 4PJ6A 4LO9A 3HW7A 2VRAA 2FL5B 2VDQH 4JHZA 3ML8A 2Q7AA 4FP8L 1S7RA 1IE5A 1BBDH 1HCYA 3FU8A 1JPSH 3NSFA 5EO1B 3GTTA 6PCYA 2FE0A 5MP6L 1RPKA 3F5WB 5F9DC 5CEYA 3ZKMD 1TZAA 1D6EB 2PETA 2W0FB 4NAMA 4WU7A 2W60A 4X8XA 2J8UA 4ZFFB 1XGTA 1ODUA 1XGZA 5CILH 2J8UF 3UAJC 2NY2D 2Q9OA 2IDCA 2HKAA 5D7KE 4K73A 4NRYA 1LVEA 2R51A 5EO9A 1IAKA 3WEOA 1DJYA 2AANA 3QXVA 4LLWB 4XCEA 2PW1A 4LPTA 4MAUH 4CADB 5I1JH 1MQKH 2N0MA 4IMKA 1EPFA 1P5UA 3PU7A 2CLZB 4EI0A 5K9QI 1WAAA 1RFDH 3DK2A 4YSSA 2QADC 3B2XA 2C1OA 2NZ9D 1ACCA 3OR7A 3QEHA 4NWUH 1X5ZA 4NKDB 1M1XB 3EFDH 3ZZ1A 1XB3A 4D3CH 1OXYA 1EDQA 1K2DA 3CZNA 1X5MA 4ODXA 3SGEH 3LKQB 4AQ1A 3NIDF 4KXZI 1K6QL 1KT2B 3D0VA 2VN7A 3DDGA 2V4LA 4AW4A 4EOWL 4F57H 2NXYC 3IETA 1G1OA 3OVUB 4J3BA 3P0VH 1Z9PA 3BXNA 3A23A 3NCYP 4OUOA 1NCOA 2GK0A 3WUWG 3D2UB 2N0KA 4WUUB 2HN7A 4HKJA 1Z5HA 5ANHA 5I0VA 3VD4A 2VAAB 4R8WH 1A25A 1W0YT 4GQRA 2SEBA 4FFTA 3K8KA 3GXNA 3PE9A 5K9JL 3V55A 1XF1A 1UZGA 4G1EA 2ED9A 1YEHL 3NK3A 2J8OA 4B0MM 4BFIA 3RZCA 1TTAA 4YAQA 5JHAA 3F58H 1TU2B 3MRIB 3VRLF 3ESNA 4IGBB 4I4WB 1URIA 5DVKA 1NEPA 3QUHA 1N8OE 3FOLA 43C9A 1DP0A 1FGVL 3V6BR 5LCVA 3S48A 2WQVA 2OJEA 4NBYB 4Y1AD 1BZDA 5H37G 4L9LC 4J2XA 3WFCL 1EBPA 1LO0H 3BH9B 1RHHA 3BUYA 3IDIB 4AC2A 1CI3M 1MCJA 3MA9H 4OGAD 2DQIL 4Y16A 4MA7H 5I1HL 3GMLA 3CZSA 1RQ5A 2H32B 4OVUA 5CEZL 3KNBB 3PDOB 5IOKA 5IKCB 3FTSA 1L9MA 3DLQR 4I3RH 4M7LL 1SNRA 3C12A 3WJLC 3ABGA 4ODVH 1H9VA 1RZGA 4X7TB 4MD0B 2ZONA 3AS1A 3SQOH 5HI5D 2FGWH 1IAIM 3VGAB 1IC5H 4ATTA 3FQUA 1UXMA 4PP1D 1LE9A 5ESQB 2BP0B 4NSKA 4QRRD 4G42A 2H6PA 5B22A 1NTDA 3LB6C 4LGPB 4MJHA 1KZQA 3HB3B 3BYYA 2CD0A 2Y1ZA 1E7VA 1S2EA 3RVTD 4U1NB 1TJXA 2GUOB 1V3LA 2IO5A 1IC4L 1MFUA 2R1YA 2DH3A 1BYOA 1DJIA 5GIRA 1Z7JA 5K1NA 1TTGA 5DDHB 3DGGB 1T1WB 5AYQA 2QELA 3RB5A 3HE7A 3QPQD 4KUZH 1AHWC 2CDGB 3NTCL 3LXUX 4QXTA 4KK9D 5F1OB 4B41A 3T3MF 2WXJA 1UOVA 4BV1A 4PJ9B 5ID1A 1F4WH 4GSUA 4RSYA 3EYSL 5DLML 1CR9L 1K8IB 1DQJA 1FIEA 3HBPA 4M4PA 5CU5A 3UABA 1BQRA 4TRPL 4GI8A 4HUCA 2J56A 2EXWC 4XPFL 1CVSC 1S7RB 4LMQI 3NCCB 1S7QA 3SEPA 3US9A 5KYNA 2KPNA 3TFKD 2CHNA 1IBBA 2ZIDA 5JXED 4ZT1A 1OE1A 1ODAA 1EMTL 4MB1A 5E95B 3TA3C 3B2VH 3K71B 2KZKA 3N40F 4M5YL 1AI1L 3BUDA 2AERT 2EDHA 4W93A 3SB3A 4ATWA 4ENEC 3ZDZE 5CKAA 4R3SB 4ZMYA 5KN5B 4JZNA 3RHWF 4H26A 1L9QA 4FTVA 4K15A 5EULV 2OMXA 4LSQH 3U2SA 4JJ5A 1P7QA 3I3EA 5E1AB 3IF1A 3P3TA 1B4TA 1SRDA 4K7PL 5EO0A 2EO9A 5SWSE 1NOFA 1MREL 3FO2A 3BKCH 4Z0XA 2KLRA 2DB8A 4WY7H 4XVOA 5GJTL 5DZNA 4WTZG 1U8KB 3RVTC 4UAHA 1OF2B 1TCRB 3ZYIA 3CDYA 4XP4L 2VZUA 1FBIH 4MD5A 3RNQA 2QMJA 4LNVA 4E68A 1NL0H 1I1YB 4A55A 5AW4B 3W5NA 4H8WL 4ES8A 2CU9A 4O9HL 5H2BB 4IBWA 2D2CC 3VGFA 2W94A 5CJOL 3LH2L 1WIPA 2A6DB 2EQDA 4M03A 4QLRA 4CGUB 3RYMA 1GJUA 3TCLA 3WTWA 2AK4A 4F9LA 3JV4A 4BKLB 4FI7A 3HKFA 4IKKA 4EN3C 5HHOE 3GSNA 2W9LA 4KGLA 4QTFA 2AXJA 1EHAA 4UNTA 4OGXH 5DMJB 4BWUA 4KJQD 4ANVA 5GGTA 4O51B 2AK4E 2WXMA 2ZWYA 1OARH 4Q7DA 3ESPA 3LQAC 5D1QD 4ZO9A 1CBVH 5HHOA 2IH8A 4KZDL 4MHHG 2OYLA 5B7EA 1PKQE 1N3NA 2WLHA 3HOGA 3MFFA 2J8HA 5D70H 4QF1B 4Y4FB 2J2ZA 1ANUA 4PWEA 4JCWA 2R56H 5C0CE 1MNUH 2ROYA 3PWLA 1F4AA 3QDHA 4GMTH 1V8HA 4CU7A 3S36X 3MPCA 5CR8A 1KYOK 4NHCL 1RPQA 2Y6TE 4NZRH 4ZUWB 3V4UH 3CPLB 4J3OD 4JO2L 2WKOF 4YGVB 5ICXA 2HT2D 3OAWA 2OMVA 3RURA 4KJQC 2VXQH 2V5MA 4CC4C 4HCGA 4EN3A 4WHYH 4HCRH 5IG7B 3TGXA 3RBGA 5BVJA 3FU3A 4X4MA 4PG2A 1FAIL 4N8VG 5JHLL 4LESA 3TWYA 3FO0H 4WK0B 2A9NL 3IFPB 2F5AL 4FTVD 2ATPB 2OR7A 2H0PA 3NQKA 3TVMD 5BOZG 2EIBA 5HJGA 5HDBB 5DHEA 4M3HA 3L9YA 3T2PA 5CGMA 1P2CA 1UYWH 4KWUA 5C97A 5CJXA 1C5CL 1MFNA 1NDMB 1E40A 2WAQA 4LZKA 4M62H 3H9ZA 5KW9H 4HT1H 1QWUA 3DX6A 4LSRL 4PD4K 4JW3A 5AL0A 3HE7B 1LK3L 2JIXD 1ZT7B 3DNKA 3CN0A 4ZW3A 3BEVB 1XZ0B 1ZSDB 4PJ9A 4P23D 4UMGA 5FCSH 5TQ2L 5IFJA 3N04A 1DQML 1DVXA 2P8PB 4R7DB 1CLOL 2YSTA 3S3CB 5FYLL 4S1SL 3GSOB 4KUCF 3I6SA 3QCUH 2C34A 2EDJA 4AKQA 1JRHI 1ZTXH 2DQFA 3GDBA 1CCZA 2OKMA 4H8PA 1I1AC 4J3OF 2ZKHL 1R3IL 3WEAA 1ZSHA 4EJ1C 4PQXA 4DERA 3HBQA 3CVDA 4Y7OC 2BP0A 4NSKB 4JDVA 1HEZB 2B1HH 3AMKA 4PJXA 4OIIH 3TCXA 4DAGL 1ZCRA 2UZXB 1JE6A 5K9KA 4PPTA 1MDAA 1BIIA 4TUJB 2GJZA 4FQXB 5CCHE 4P5TD 4ZX4A 2G0KA 5TF1L 2ICEA 1A9BB 2JV6A 4U7MA 5DZ9A 4AJYV 3VFRB 3KYAA 4BFJA 3C2SA 5SWSA 4DGYH 4ELKB 4KKQA 1IGYA 4P5TB 3ARUA 2CDGA 2QZQA 4QXTB 3TO4B 5F1NA 4I0KA 2VYRE 3E6FA 4DZBB 1A9EB 2B08A 3SBWA 2R8SL 3OLDA 4WUUA 4YFDB 4XP5H 3QZMA 3RNKA 1IE4A 1PZCA 1GMEA 1DQJB 2PO6D 2CBOA 1P4BL 1B9ZA 2H5UA 5TE4H 3VB8A 4U0QB 4ADJA 2H45A 3WIIL 3FB6A 3RDJA 1NOAA 3L3DB 5HHMD 2NY4D 3RL2A 3QG6A 1HHHA 3WDHA 6PAZA 4AVKA 3AG1B 4J23A 3V8OA 3ABMB 3B9EA 3GHEH 4MBOA 3Q8EA 1EVTC 4OD3L 5KSVB 2BK8A 2AQTA 2X6CA 5TDOB 4C83B 2VLLA 5F7EL 1G9NL 5DZPA 3RB7A 1NPUA 2VLRD 1KXVC 1FL6B 2X1WL 4OCXH 3CU1A 4U2ZA 4N25A 1OQXA 1LDPH 5LVEA 1GGYA 3ARTA 3KJ6H 3L5XH 3MA7A 4HH9A 4AY0A 1P7QB 3LDBB 3F12B 2FX8L 2WLIA 1QLRB 3MGAA 5CWSA 2W80C 2IPTH 1OD9A 2C3VB 1FZKA 3X14B 1BZ7B 2HJLB 4H8QA 1U2HA 4MCZA 5JHDB 3W57A 1OCWH 1RKRA 2N01B 5KBKA 2QGEA 5T5NF 1SN0A 1KLGB 2KKQA 1KCWA 5FECA 4MMZA 5FUZH 3L7FA 1MI5A 4OD1L 1TF4A 1Y0LB 1WBZB 4N2DA 3B34A 3CHSA 4TOYL 5DQDL 4J8QA 4GBXB 1MCRA 2X09A 4LSTH 3BUQA 5FV2A 2C3XA 1GC1H 4MNGA 4WK4B 5CZKA 1PY0A 4F8NA 1S78D 4BINA 5IMMB 2H2SC 3MR9A 1FNHA 1X5FA 3FOLB 4WDIB 5F7NC 1NGPL 4K94C 4XZUA 3NJMA 8FABB 4UZUA 2P44B 2ESVD 4HZ1A 3E3QC 1C12A 2A4ZA 3ILDA 1MOEA 3SE4A 1P53A 4PAZA 4NQSB 4YHLH 4ZPTA 1D9KB 4BK5A 3MLZL 3U4EA 1A0QH 1ZANL 2JKJA 4Z7NB 3WS6C 3EDDA 1U8HB 3OWEA 4RZCA 4HLJA 5T3XL 4M61A 3VW3L 5F1IB 5D70L 1LO2H 4Q9QH 1ITBB 1ZHKB 2APWA 2X2IA 4ZMWA 3MNDA 1N4XH 1Q0XL 4FFVD 4IGBD 1TMCB 1X9QA 5L8KB 4JRXB 1MRDH 1WFIA 2R27A 3Q1SL 4HIPA 5FOJA 4FF9A 1CICD 5B7MA 1QD0A 5F7DB 4UQBA 4DN4L 1QUNA 2L3BA 1WCQA 3P30L 2QLVB 4HD9A 3JYBA 4QIRA 1DQMH 2IH9A 2BS9A 3QIWC 2FVNA 3ULUL 3SE8L 4PWKA 4LK4A 3IXAB 4KO5A 1AQDA 4UUJB 3WS6A 3VI4B 2VDLB 1KBWA 2NYKA 3LQZA 4KXDA 5CZXC 4ODWB 5AAMC 4QOKA 4L8DA 3S35L 4KMLB 2ATPA 4HHWA 5FGCB 4B5ZA 5MEPA 3BH8B 5KOMC 3V7MA 2JKTM 4KXBA 1XTMA 1ACYL 4Y4FC 4UM9B 4JN2B 4K7PY 2XNAA 4XNXH 2Y7SA 4XCYB 4NPJA 2M2DA 1MCSA 4I3SH 3RZCB 1QLEL 2BDNL 1BYNA 3JT2A 4KKAC 3OKEB 4HGWB 3MOBL 1AOHA 3QJZA 1A7RH 3S34L 3X13A 5I15L 5DO8A 2BXYA 3UTTE 1ID5I 3HAEB 5ICZA 5C2UB 4PRPD 5H94A 2L7EA 2JE8A 3W37A 1MN4A 1YMHB 2FEDC 2F7RA 4EVNA 5C09D 2XPGB 5EOCH 1QEXA 4CSSA 4NNPL 4PRHB 4XBEH 3T4AB 4D8OA 4Z7VF 2YK1L 4NJ9H 1MHPH 2EABA 4KRMB 3PNWB 1O6SA 3C6LA 4YSPA 3Q2CA 3SGEI 4ZQTA 2WXRA 2J5LC 1P7KA 1E5CA 1YG9A 3O3AB 4S11A 1NC2B 3S88L 3MRNB 4A37A 1NKOA 3SGDI 1E6JH 1NMCB 5E2TL 5EB9A 2R59A 3F62A 5HVGB 4X5XB 1X9RA 2IV9A 4JDZB 5HYFA 5KS9B 5GZNA 3ROLA 4IRZA 2EACA 4NHCH 4FQJL 1S7SB 3QXWA 5FR3A 1FLRH 2XC8A 2VB5A 4N2CA 4X5RA 2YD1A 2R29A 4MJ5A 3UACA 2Y5TA 1OAZH 4NNYB 1BLNA 5BV7L 1J9QA 3QULB 3CXDL 4HIXH 4KKCD 4KV5F 5E94B 4MA3A 4ZYKB 2Y3NA 3MCG1 4PGEA 4KK6D 1H6UA 4XCCL 2QHRH 5IEHB 1M56B 1FN4B 2PTTB 5DJ2A 1X4XA 3UYPB 2VRKA 1WGVA 4O4YL 3TIDA 2DQDH 1TJMA 2XJKA 4BFOA 3HG0A 5G4OA 4E9LA 2F8OA 2OPCA 3BAJA 3FU6A 3LHPH 1LQBC 1OKEA 4X6DB 3NJFA 4TVSa 5E6IA 3L3IA 2VLME 1XCWA 3CDGA 5KOVC 3KWWB 3BJ91 3DYMA 3T3PB 1UM4L 4JHAH 1T04A 5L4JA 4XWGL 3ORJA 2PWDA 3V4PL 4KZCA 3BKCL 3ELAT 3MV8E 2MSPA 4HIEB 4ONHB 5I66B 5IESH 4G8GD 4NS0A 1TVBA 3D4CA 4D7PA 4RH4A 1BQLH 1DLFH 4JDTH 1F41A 3VSTA 1QBMH 2BSRA 3DGCR 2XG5B 2WIIB 3N1PC 5H35B 4HG4K 5KZCD 4WNSA 3TNMA 1HJBC 1N8ZB 2K4WA 4Y16D 5BO0D 3GHEL 3WXVH 4PVBA 1KCSL 1XIWC 3TN0D 2O5NA 2R15A 4JG5A 1V5JA 1PS3A 2ZOKA 3MRKA 3HCVB 4ZO7A 4H44C 1CDHA 3FZUC 4P48A 5DJ0A 4CDGC 2AQ2A 4V1DD 4YWGL 3UGEA 5D7JD 5HJ3A 1MCCA 7TAAA 5B21A 3H4FA 4R5XA 4P57A 5E9NA 1Y0LA 3JVGC 5D7JC 5C0BA 5KSAA 2CPCA 3F83A 3X1EA 3ZY7A 2DOCA 5LBSL 4AV4A 2IADA 8PAZA 4Z1PA 4KKPA 4DGUA 4ZXBA 1MHEB 2VR7A 2WNKA 5K9KB 1CFVL 4LLQA 3F00A 1O9WA 1J8HD 3RWDB 3SPGA 3ZDYB 2AXGA 1EX0A 1BM7A 1RZJC 5TF1H 5C0BE 1ZLSH 4XB7A 1A6VH 3FQ4A 3ATFA 1SMAA 1UXWB 2EP6A 5EUOE 3IRPX 4FFYH 4CVXB 1P4LA 3ARFB 1A4KA 3ML9A 2ZX9A 4HJ0C 3MN8A 3C9NA 4FXKC 4QHKJ 4XE5B 4LASL 4LVHB 4MWFA 4O2EA 1N26A 3MXWL 3WJMB 1IFHH 4ILDA 4P2OB 4AH2B 1R3IH 1RURL 4HPYH 2VLKE 4YEFA 1AGDB 1BDYA 1MNNA 1BYPA 4IDJH 3C5ZB 3GBLA 3II2A 4JFTA 5D2LE 4WCYL 4BIKA 3GIVA 3I84A 3OV6A 3L3OC 1MFAL 3AQDA 1PG7X 5EDSA 1J0HA 3IB4A 3JVGA 4H2CA 5AZ2L 4ALAH 4H20L 2BIPA 2VR3A 5M7QA 1IAIH 1BWWA 4EI5C 2WCPA 1CPUA 2OA9A 5IM7B 3FT4B 4L29B 3DROB 4P8QA 2NQ3A 1CLOH 5EZOL 4F7PA 1S46A 1SXZA 2XWCA 2YEZB 3ECBB 3H0TB 3HI6H 3V4VA 5FYLH 2X40A 1QVOA 2E4TA 3L4ZA 4N6QA 4HPOL 4PJXF 1BQKA 2ZWKA 2QV2A 4XRCB 5ICZB 4FA8A 5K59E 3L1OL 4ZDHA 4EF3A 5KSBA 3P2BA 1SPDA 2YXFA 4V2BA 4HF5L 1BIIB 1KWKA 4WKZB 2BVQB 2CWRA 2XTJD 5B1KA 1KIUA 3EOBB 5IQMA 2E59A 2HVKB 4OIAA 1BFVL 4HT1L 1HOCB 2YPKA 2RA1A 4PRID 3PNWA 5ACZB 3ARWA 4LRNL 2ZG1A 2MQ0A 2D2OA 3AY4A 1CT8A 5B1AB 1W72A 5ADPH 2BNQB 3QXDB 5DJ6B 3IBEA 1NH6A 1JJUA 3TEYA 3QAZB 4F20A 2NRDA 1P7QD 3NEOA 5SWZE 3X2QB 1CG9B 3QEQE 4PHZA 4DH2A 5L2JB 4LEXL 1TTRA 3PGDB 1YPZA 1OP3K 2B15A 3NAAH 3CVIH 4XCYA 4XHJD 5FDYA 5B8CB 5IW6A 4YPGA 3DOIA 1SN5A 4NRYB 1VEPA 4IRJA 1WAAF 4XZ4A 1USQA 3CXFA 1A4JA 2ADIA 4ZYKA 2HH0L 3V52L 4GYBA 1D6VL 4PB0L 4H8UA 3L4YA 1S8DB 2ZD0A 2UVFA 4H88L 5T3XE 5FYLE 4YFEA 4X99B 3GNML 1W0VB 5EEYA 4XMKH 4QRSA 2C9UA 4LT7A 2C7UB 3VFUA 1MHPL 2HCZX 3NRFA 1MFEH 4NQCB 4RAUB 4RZCB 5AG9A 2FO1A 2X4OB 4OFYD 5TQ0L 2DIAA 1BX2A 3O2DH 4J3SA 2QV4A 1ZHKA 2PCXA 2WMPB 3DX7B 2CJSA 1DBAL 1EERB 1WH0A 4PJBE 2LV4A 4A63A 1A4BA 3PCYA 5I16B 5J1AB 3O3AA 3ULVC 2M1KA 2VMDA 4UT9L 5HDQH 4NGHH 4TVPE 1TJGL 2XWTA 5EA0H 3HI5L 3QI9A 4POUB 1HL9A 1OCCB 3MUJA 2H6UA 3QUXC 4XC3H 4ZPVA 3T9WA 3EGSA 1NBCA 3CHPA 4L8BB 1ACXA 5GZOD 5C7XH 4PJXB 1BG1A 1TQBB 2MCPH 4X6CF 3BP5A 1S9VA 1YUKB 4F3FB 3L13A 4OUUA 1MVFA 4TULH 1U8JA 3IDGB 2JB5L 1FF5A 4PW4A 1TVHA 4WDIA 3UC0H 1WZ1H 3FQWA 5ITFA 4OZGA 3QFDB 3ULUC 4ODUA 3UROR 3AXHA 1U3HA 2WQWA 1OTSD 2HTLC 1L0XA 3WFBH 4DVRH 4BQ6A 4X6EB 4KOCA 3NSJA 1IM3B 4OZHB 5ITBL 5IVZA 4EDXB 2PCPB 1SFHA 2JB6B 2AJYH 3HS9A 3WOVA 4AEIL 5KBNC 5MERB 4UTBA 3IVKA 1HHIA 1PF3A 3LZLA 3VI3F 1M2OA 4RISH 3N42F 1TZHA 1P6FA 3IJEB 5I0YA 3H8NA 2FHFA 4WFFE 3BFQG 2ZCKH 3ULVH 3L3HA 4QO1A 1BXVA 3BN9C 3GMPB 1Q1PA 2NR6C 3RDTC 2NTSP 4QRRB 1G84A 4GQ9L 2GC4C 3UJTH 2UXVA 2JI3A 1CLZL 3JUYA 2YD0A 1WDAA 3EO0A 4M3KB 3R4RA 2D31A 4NM8H 4O2EB 5FM4A 4H25A 4LIQH 1ZE3C 1HFUA 2R56L 1HCFX 3G08A 1D9KD 3HS0A 4LASH 2ZSVA 2AGJH 2VR9A 3S8FB 4X42A 5LDSA 2CSPA 4NNPH 12E8L 3GI8H 3MGTA 1TZ8A 5CJXC 3QORB 1GL4B 4YVNA 5D72L 5DJDA 2ZP9A 1RZ7L 4WO4B 3EOTH 1PEZA 1ND0B 4K8RC 3RLSA 2DMCA 4M6ML 4ZUVB 4JN1L 1NFKA 2AEPL 2VOTA 1QYGH 2CGYA 4TPRH 4YR6B 3HC4L 1B3JA 1NAMH 1PZ5A 1TQTA 2ICWB 1OE3A 4IDLA 3NEXA 4JPIA 5D1ZA 3E6HB 4X4XB 1DEEB 4AQAB 1YSOA 1IGJB 2PYEA 3S34H 1ICTA 3FSZA 1FJ1A 1IM3D 4J7RA 4P05A 4KTEH 3SCMA 3KGTA 5A6LA 4MNHA 2A3TA 3QJSB 1CFSB 4XVTH 1CGSH 1ET8A 4BFEA 2G5RA 5C09E 5B39A 1OE2A 2WPGA 3QJHB 2NY3D 3G5WA 4N8VB 3UYRL 3P40A 3VXQB 3G9VA 1MFAH 4LRNH 5SWZB 3V6FB 1C12B 3NPZB 1E5ZA 2DQDL 4RGOL 1T22B 3MJ9A 4OLYL 1I1FA 3PWPE 4PJGB 2PABA 4Y5YB 3VFMB 4Z3TA 3A24A 1JL8A 5G4NA 4JREC 5EEWA 3AACA 4JFPA 3BPLB 5CEZH 3KPSE 4M43L 1EAOA 4UIKL 4U3CA 3NCYS 3GFUA 1BFSA 4LHQB 3NIDE 3LRMA 5HP5A 2LW3A 1WAAE 4ZMZA 2OX5B 4ODXB 2OMNA 5JZ7C 5ERWB 2F15A 2PWHA 1D9KC 3ILPA 4X0KA 2GYSA 4OLZL 3JWDL 2H2PC 2HPOA 5BZDA 1DSFH 3ZIYA 1KN4L 1LEKB