2VN7A

Glycoside hydrolase family 15 glucoamylase from hypocrea jecorina
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
599
structure length
599
Chain Sequence
SVDDFISTETPIALNNLLCNVGPDGCRAFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDRFTETYDAGLQRRIEQYITAQVTLQGLSNPSGSLADGSGLGEPKFELTLKPFTGNWGRPQRDGPALRAIALIGYSKWLINNNYQSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEEVNGSSFFTVANQHRALVEGATLAATLGQSGSAYSSVAPQVLCFLQRFWVSSGGYVDSNINTNEGRTGKDVNSVLTSIHTFDPNLGCDAGTFQPCSDKALSNLKVVVDSFRSIYGVNKGIPAGAAVAIGRYAEDVYYNGNPWYLATFAAAEQLYDAIYVWKKTGSITVTATSLAFFQELVPGVTAGTYSSSSSTFTNIINAVSTYADGFLSEAAKYVPADGSLAEQFDRNSGTPLSALHLTWSYASFLTATARRAGIVPPSWANSSASTIPSTCSGASVVGSYSRPTATSFPPSQTPKPGVPSGTPYTPLPCATPTSVAVTFHELVSTQFGQTVKVAGNAAALGNWSTSAAVALDAVNYADNHPLWIGTVNLEAGDVVEYKYINVGQDGSVTWESDPNHTYTVPAVACVTQVVKEDTWQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCOAMYLASE
publication title Three-Dimensional Structure of an Intact Glycoside Hydrolase Family 15 Glucoamylase from Hypocrea Jecorina.
pubmed doi rcsb
molecule tags Hydrolase
total genus 209
structure length 599
sequence length 599
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2008-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2vn7A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vn7A02
4U33A 1AXIB 2JIXB 2LU4A 1CFSA 3CSPA 4UTBH 4DCQA 2EXYD 2XA3A 2ZWLT 1PX4A 3L5XL 4FABH 4H1LB 4D9LH 3X14B 5J6GA 4ELMA 4RQQA 3QPXH 3QO0A 1MWAA 4XTRC 5EU6E 1N26A 5EFIA 1W72B 3AFJA 1JN6B 3QDGD 4I48B 3K46A 5MERA 1NUDA 4JQIL 3HE6A 3WFEH 5DD0L 3HHRB 3IS0X 3ISWA 3BP4A 2DTMH 1CFBA 1EO8L 3TFKC 4WCYL 3I02A 3CVHL 3MODL 4LSDA 5EN2A 5HHME 1MCQA 2FEDC 5KANG 2NYYC 1F02I 1FFPA 2HT2C 2X4UA 1T5WB 1V3MA 2VN7A 2MPAL 4NRZB 3S4SG 1SEQH 4WVRA 5J8OA 3VXOA 2V5YA 1NMCB 1K8DB 1YPZA 1ONQB 5FEBA 3U7WL 3BAEH 2OZ4L 4GAYB 3TNMA 2B1AL 3W2DH 2CUIA 4GKOA 2GH4A 3SE4A 1WV7T 1JF6A 3QPQC 5IFAH 5MP6H 2QQLL 3BRDA 1DTUA 3S35L 5HPMA 3SPVA 4Y5VA 2R69L 4WV1C 3C2SA 1ZLUK 4RGOH 3R1GH 2DQTL 1JGDA 4LSVH 4DEPC 3R4DA 2VQ1B 4L3EB 2H1PH 4DKFH 3H42H 3VFSA 5JORB 4X4XB 4Z7NE 3WHXA 3GHBH 3QEGH 4MD4B 5BCAA 1RULH 4XMPL 3MO1B 2HMIC 2WBJD 4LVEA 2V7NB 1GC1C 3Q5TA 2W92A 3PG2A 5E5UB 2R0KL 4MCYB 5CEYA 1KLFA 1KRFA 2X4RA 1TCRB 1U42A 1GC1H 4MYWB 3VU2A 1YEJL 3GSRB 4CDGC 3UTTB 2VDLL 3S36L 2IBZX 3CFJB 4ZDHB 4AG4L 5B8CA 4AM0B 3H0TB 4P46C 5GGUB 3LMJH 4AQOA 1DBBH 1P4BL 4KV5F 1XZ0A 3P4OA 1ADQA 1H3PL 4ZO9A 1UJ3B 2IQ9H 2NY2C 3MJ7A 4N0UB 3OQ3B 1CGUA 3F7YA 4M5YH 3QIWA 3WFDH 2D2OA 5T3ZH 9CGTA 5AYUH 35C8H 4RFOL 4Q6IC 3ANIA 3S3SA 4P5KB 3VFMB 3ABZA 3BEVB 1RY7B 1H8OA 2VABB 4MMZC 4OCSH 4V1DD 1OGTA 3OG4B 3OAZK 4B50A 1F13A 2X9WA 3HS0A 5HDBE 3VWKD 3VD9A 1I3UA 3VXPA 3C5ZD 3RU8H 3FO2A 3BH9B 3GMQB 2DQEH 1PX3A 4POUB 5ICXA 2DDQL 2C3GA 3QDJA 4Y4FD 3FJTA 1A3RL 3BZFA 5BVJA 3ARDC 3HB3C 3O9WC 4MNGB 1L6XA 3IDGB 2I9TB 3OF6A 4KJQD 4NZJA 2NY4D 3LDBC 5FUZH 1KTLB 3CNKA 1OTTD 5SX5K 1QLFB 5E00B 1GGIH 4UIKH 3RVUC 4NNPL 4D9QE 3Q6FA 4L8BB 4MAYA 4OF8A 5FDWA 1NAMA 5E4EB 1CD1A 4YK4B 1PKQE 2P7TB 3H9SA 4ZG8A 2XOTA 5D1XB 3NA9L 3E3QE 1V05A 3QJHA 2MFNA 3S5LA 2ATKB 4NGHL 2EEAA 3ZDZE 3IDNB 5E08H 2ARJA 4RWYH 2NX5E 2BJML 3DI2B 4O5LL 3QDGB 1HKLL 3SKOB 5FYLH 3A67H 3R8QA 1NMAH 3SJVD 3BX7C 3UDWC 4Z76A 5C8JA 5C0AD 3F12B 5I6XB 2FECL 5C08D 4YFEA 4DVBB 4KAQH 4XPAH 3WKHA 4WU7B 2MCPH 1AGFB 2E9IA 1Z3GH 3BFOA 2MSPA 2NXZD 1KB5B 4ZQKB 2IWGA 1JRHL 3KNBB 3IKCB 3EYUH 4WO4C 1PVHA 5LGKA 3HLAB 1S8DA 3MV8D 3STLA 1V3LA 4ORZC 4JHAH 3L3JB 4RZCB 3MLXL 3MC0A 3MLZH 4KI5E 1ZHKA 3PHOB 1XGUA 4BQCA 5C6WH 3OX8A 3NPZB 3CFKB 4G6FD 2NY7H 3CVHA 4M6NH 1A7NL 4D0DB 2EC8A 1K4DA 4GUPB 1BQLH 3ARPA 4OT1L 3HZYB 2R2HA 1Q1JL 1CIUA 3BKCL 1FAKT 1HQ4A 4GKNA 2F15A 4XMLL 5F71A 4KVNL 4NSKA 2OZ4A 1AY1H 3VRLE 3MOAL 3VD3A 3SKJH 1JWSA 4HMCA 3SDDB 4HC1H 3JWDL 4O51A 1U8NB 5JW3L 1DE4B 3SGEI 5I1KL 3RAJL 1K6QL 5FYKH 2YUXA 2QQNH 5FB8A 4XMKL 4OZHE 1LO4H 1K8IB 2EDYA 3D87B 1NDMA 5CJOH 1N4XL 3RVWD 1G7QA 3WJJA 3B5TA 4CVXA 1I1AD 3T1WA 4GFTB 5JR1H 2JJBA 3AC0A 3A6CH 3DSNA 1IQDB 1L1YA 4QRPA 5DVKA 2R1XA 3LPGA 4LKCB 5EORL 4ZAKC 5C0EB 4PGEA 4UU9B 5FO8A 5F44A 4MNQD 4KMQA 4RMSA 5IJKC 1TVBA 3HC0A 4ZUVB 3HE7D 2AXHA 5C07D 3PE9A 5JNYB 1XR8A 3QG7H 3MJGX 3HPJB 1RZGB 3WIQA 3KR3L 3FOLA 1I3RB 4J4PA 3AS0A 3RUGB 5DJYB 3VCLB 4NM8H 3VWKB 3MRMA 3O6ML 2ORBH 3C5ZB 4P48A 3T0EC 4ZFOL 2VAAB 3TBTB 4P23D 4FXKB 3JUYA 1WZ1H 5DHYA 2OQJB 4Z5RB 3L3IA 3LKPA 1OAUL 2UVFA 1V7XA 1BFSA 1MAJA 4Y4FB 1FMIA 4L4VA 3VXSE 5EBLB 3NCMA 1DQMH 5IVOA 2IAMD 3IDJA 4OJFL 2BVOB 5TH2B 5J7CC 4LMQI 3E0GA 2NTFA 3HNSL 4OI7A 3O3AB 4MB4A 3UTSB 4I3SH 1YQ2A 1NBYB 3D0VA 3GSNB 4JGUA 2FEEI 3CSYA 4JFDD 1TTFA 1OGAE 4QTHA 4QY8A 4WU5A 5I73B 3Q1SH 4WEUD 4TUKL 5D93C 5M95B 1CE6B 2O5YL 5BS0E 1C1EL 5J6HA 1ORQB 1I1FA 3OKMA 2ZZRA 1L7IH 1KCRH 3QHZL 2XV6B 4LSRL 3SJVB 1JUFB 1TVDA 4BFBD 3BQUC 4NT6A 2ICEA 3BHBB 2GSGB 2YXMA 3UZQA 2JJSA 3QQ4A 5DHVH 1LHZA 5DHXB 2NXZB 3TA3D 3VDAA 5FM5O 5TQ0L 5EB9A 5GGVH 3INUH 5TE4H 1DZBA 1F45A 3TO2B 3VGAB 4YBHA 3OR6A 4O4YH 3FMGH 4XI5C 3EYVA 2GI7A 1QR1A 2N1KA 4KGLA 4ODUA 5DA0B 5EOQH 4OV6F 3QUMB 3TPUB 2DWEA 3U4EB 1MI5B 3O6LL 4J6RH 1NUFA 5FO9A 3QUYC 3UBXA 4F7TB 4PJ7B 4JN2B 4KKBC 3LKOA 3ULUE 3N1FC 1KELL 3V52H 3WXVH 2G5BA 4NBYB 4QRUA 3K4ZA 3DV6A 1M05B 2Q6WB 1YEKL 4K8RD 1AD9B 1QYGH 1KCLA 4XPFH 4BSJA 5ECJE 2KL6A 5EBWB 3HE6C 1KN4H 4A6YL 2XXCB 3L1OH 1J8KA 2C1PB 2YXFA 4MWFB 1A7OH 1B6UA 1C7TA 4H0HB 1JPFA 2P48B 4AIZB 1NMBH 4OFIA 2DBLH 1GCFA 4JPIA 3SQBA 1I1AB 3T2OA 2OTWB 1IFHH 4I77L 3BP7A 3NH7L 5DTFB 1D6VL 1T2QH 2Y07H 1MIEL 3BESR 4NC1E 3IKKA 1R3KB 4BH8A 4S0TD 3RJDA 3EHBD 5IEKA 3ILPA 2CDFA 4P9ML 4MNQB 3OJ2C 4HUNB 2WSKA 3TBYB 4MVBC 1KCUH 3TZVB 5DEGB 3UPRA 2ADIA 2XI9A 2V9TA 3WFCL 2FSEA 3TBVA 1ZLVK 2C3HA 2V9RA 3O41A 1U8PB 1OSPH 4AEIL 1M7XA 3EDKA 2BXYA 1X5AA 4D94A 1D5ZB 2IADA 3RWJA 4LDOB 4R4BB 3VXDA 2BVPB 4KK6C 4OLYL 2IALB 4P23B 4WUKH 2DLFH 2LFGA 3VXMB 2GTZA 1EAPA 2HFFB 4ISVA 4OZIE 5AAWA 3IFPB 1U0QA 5ID0A 4KGJA 2GQHA 3FB7B 1H0DA 5ENWA 3DIFA 1RK1B 4WFGE 5JPMA 3VFTB 2G75A 1FZKB 4L29A 1QA9A 4Z7UE 1MREL 4UINH 4JFDB 5CEZD 3MR9A 1WBXA 1TPXB 2KPNA 2Q8AH 2MNUA 4MLSA 3O4LE 2I9LB 4KTYA 3SE9H 3SKNB 1F6FB 3FTGA 3MZGB 1UCBL 4GAJL 5GJTH 4JLRB 1E4JA 4E5XA 5EC1A 1FV1A 5JMRA 3EOBB 4IBLT 2A6KB 4KHXL 2HJKA 4PTTA 4EUPG 5EZOL 5CCKH 1X5FA 1ZEAL 3BW9A 1MELA 3HNVH 1NC2B 1INQA 4G8IA 1XIWA 5ISZE 3ZHDA 3WDJA 3TA3B 4N1HB 3MJ6A 2P24B 1OTUC 4M5ZL 3V0AC 3ARBA 4G42B 5EC2B 1N5AB 1T20B 4YDIH 1SBSL 4MJID 2VLJE 2W59A 1PFCA 2CMRL 5BV7B 2BVEA 4OSUL 2HKFL 5HD8D 5T5NF 4NCDA 2PXYC 5SX4H 3EDJA 5GGRA 4M1DL 1AI1H 4JN1H 3PXJA 4HUUB 4U1HB 4KY1H 3BKML 4KI1A 5JHDA 2CJUH 4ONGL 3QNYB 3AU1A 3QCVH 3U9UB 5CGMA 5LQBH 5BZDB 3SOBH 4HUXA 2E9WA 4NHUA 5IB1B 1ETZB 4FQXA 3DYMA 3UC0L 3DMMC 4ZUUB 5TE6H 4FTVD 1YJDH 4LVHB 4OLUL 4BFIB 1D9KD 3RGVC 3P30H 5HTSA 2W60B 4FNLH 4ELME 4K7PL 5HYSA 1I8LA 3VWJA 1V5JA 4Y16B 4ZYKB 3LRSB 5CILL 4YHIA 4Y2DC 1GHFH 1RUMH 1VENA 4ODXB 4EN3D 4X99B 1NSNH 4O9HH 5C1MB 4TSBL 4X6BA 4R7DB 1P7QD 4EDXB 1A0QH 5DS8B 4WW2B 5IVZB 2EYTA 2OL3A 3GBNL 2NW3B 4MJ6A 3VD5A 5D7JD 1J0JA 4JPWH 1SVZA 1YPZE 3I6GB 1V7WA 5GY3A 4XWOD 3VXRD 4HZLB 4S1DD 5K9OA 3MODH 3RZCC 4DZ8A 2FO4B 1CD9B 1AQKH 4YIQB 4WUUD 1FBIH 4NPYA 2EO9A 4OD3L 4D3CL 2MPAH 4DK3A 4GW1A 1RZFH 4X6EA 3DVGA 4TOYL 2F6DA 3S4BA 1NGYB 3VMOA 4ZXBD 4ODVL 4B0MM 2AJVL 3V5DB 2AJYL 4IRZL 4ZUWB 5FUCC 4QXUL 2X4NA 2GK0A 4LLUB 5AWNH 4PRBB 5D2LB 2DQTH 1L7TL 4JFHE 3EFFA 4X9HA 1UM4L 1IGTB 5IK3B 5MEND 4ZUSA 1OW0A 2AVGA 4Y5XA 4EZMA 5BW7A 4CDHA 4F37F 4XBEL 1Q0XH 2DM7A 4PJAF 2YD6A 4OAWA 4XMPH 2HFGH 1R5VA 4WEBL 5GS2D 5DMGC 3I75B 3QJFB 5HGHA 1E28A 3WKFA 4XAKE 1CWVA 5B39G 3F7VB 4KC3B 5AZEH 4N9OB 1FFNB 4F9PA 3U9PL 5LVEA 1GRWA 1T21B 2PCPB 1GAHA 1P4BH 4U6TA 2Q86A 2FLBT 1SYVA 1MFEH 4LAJH 4LCUB 3QFJA 4UT7H 2FV1A 7FABH 4LF3B 2H3NA 3O8XB 4PREB 1FYTD 4MJIB 4S1QH 1KJ3H 3QDJE 4PRDB 1LDSA 1MRFH 3FFCE 4KJWD 4GKZA 4K55A 5FAAA 1WC7B 4HJJL 4I5BB 1WWBX 2CIIA 1KSRA 1DQTA 4RA0C 1YEIH 2BOBA 3C6LB 1D3CA 4QTIH 1MCHA 3N9GL 4G8FB 5DUBA 1FBOA 4X8JB 3PDGA 1B9ZA 5DJCB 1VKXB 4FTVB 3CC5A 4KKAC 4GRLB 2RIKA 2F53D 1D9KB 1JTOA 3H9SE 2IQAA 4UT6L 2V5TA 3EOYG 4XNQA 3TNNA 4R0LB 3S88H 1KJ2H 2J88L 5HDQL 4CBPA 1Z9LA 3FB5A 3GMOA 3MRRB 5D1ZD 3QA3A 3IFOB 1QFWM 2ERJC 4JAMA 4IRJA 4PY8J 4NQDD 3FT3B 5BO1L 5IQ7L 1CYGA 3WL9A 3CLEH 1ZHLA 4YJZL 4CNIA 3HZMB 5T33L 3OSKA 1HKLH 4XP9H 5B3NA 5LCVL 1FN4A 5JMOC 2XG4A 1XWTA 5FGSA 5GGQH 5LAXA 5I8CB 1I8IA 2Z92B 3IJHB 1BJ8A 2X4SB 3BD5A 4OGYL 1S7RA 2AEQL 3RP1A 2APFA 3P2CA 2LVCA 3LKQA 4WUUB 5A16B 5EU4B 3RWFA 2VXVL 3L3OA 3P9MA 5DFVD 1Q9LB 4DJMA 2ICES 3GEWB 4G7YH 1BQHG 2ZNWA 3T2PA 4C59B 6FABL 1IEHA 1UA6L 3FB6B 1UVQB 2EDNA 1J86A 2PR4L 4X9BA 1S9VA 2X4TA 5FECA 1MF2H 4WDIB 2BSRA 1MQKL 1AHWA 4NNYB 2FB4L 5GSVB 1B2WL 3SKMB 2LVEA 2VDQL 1Q1JH 2IGFH 2Z31D 2M1KA 4XVTH 4Y4KC 3V7MA 1T0NA 2EH7L 4XMLH 1MCFA 5MENB 1IE5A 3Q5OA 1YY8B 3JWDC 1EDQA 3V5KA 3MOAH 1KB5H 2GY7B 2A6DB 3HRPA 3JWDH 2D7QA 4WU0A 2A1WH 2VR4A 4QRPE 4WFFD 5KW9L 1FNSL 3CU7A 1NCWH 2BY2A 4KK8C 1K6QH 2J3SA 4BZ1L 3DXAD 4XMKH 5I0DA 3U6RB 4PB0L 4JDVA 3GKWH 3DRQA 3D3VE 3RI5F 4X6DB 3SKUD 5HYQB 1Z5LB 4YPJA 4DWHA 5JTWA 4RAUB 5C0DA 4UI2A 1E27A 5IW6B 2CO6B 1EFXD 4NWTH 1UXWB 5DLML 1YMHB 3L7FB 3GIVB 3GMMB 4FA8A 3BZDA 3OKLA 3SO3C 2VIRB 1MH5B 5FHBH 1TVHB 5CJXA 1WT5C 4TULL 2F19H 2Z0BA 1ND0B 3O2WH 4M7KH 4Q9RH 1UB5A 4JQXA 2WBJC 2VZTA 2FD6L 1YEFL 4XC3L 3KYKL 4ETQB 3AROA 4JFXA 1XF4A 1BVKA 1JPSH 3UBXI 3WNMA 3KR3H 3E2HC 5CGYD 1IAKA 1MCOL 2DQDL 3RNQB 3QI9D 4GQPH 2HLFD 5EOTB 4XRCB 1DVFA 2VXTL 2CLVB 1DUYA 4G6AD 2KH2B 3H3PL 2QR0A 2Q87A 2H9GB 4JFFB 3STZA 4HFWB 3BWAA 3WNNA 1F4AA 2F53B 3MUY1 3QZWB 4G9FA 5JUEH 5EU5A 3ZYIA 5IF0A 1OARH 2R15A 4OJFH 4PJAA 5LBSH 5TDOA 2H32B 4JRYD 4KV5E 5CHNB 1IKNA 1KPVA 1XIWC 3MNZA 4PJ5A 3LH2H 4XWGH 3G6AB 4ODHL 1GPOH 4G7VL 1U58B 4PJGB 3ARBC 4FQLH 5CZVL 4NQDB 4P5MA 2X4OA 3RWEA 5LGHL 1HDMA 4TUKH 1N59B 2DQHH 3W81A 3AMKA 1C5CH 1LD9B 5ESQA 4AYPA 5EH1A 5HY9B 4LHJB 5IB2B 3H9YA 5EU7E 1N5YH 4G8GE 5K9KA 3EDFA 1LNUB 3HZVA 1MVFA 1J0KA 2X9XA 2GJJA 1RUAH 5K33A 1K5NB 1GOHA 4U1KB 5DMKA 2DQFB 3U7YL 3PQYA 1T1ZA 3EDEA 3HI6H 4X9GA 3H7BA 1MLCB 5JZ7D 2DIAA 3MUHL 3GSUB 2DRRA 1DL7H 1CT8B 1IGJA 4JGMA 1CU4L 4Y1AE 3C08H 1FFQA 1RZKL 1A4KA 5D8JL 3FQNA 2DLIA 1NFIA 1I8LC 3GMPA 1IAIH 1M7DA 4RA3A 1K72A 1JTPA 1D5XA 3HMXA 2VLKE 4C54A 3MGTA 1KELH 2YKLH 3QBTB 2Y23A 1MFCL 1KSDA 3CFBA 3NGBB 2OI9C 5DFTA 1FPTL 4DTGL 3DURA 2E9JA 1MCPL 1RPQA 2XN9D 5IKCA 2VTFA 1UWXK 2IH3A 3PGCB 3TV3L 4J3SA 3U1SH 2AJ3B 5DUML 4LHQB 3DXAB 1A6AB 3FFDB 4X7CC 3CXHJ 5DI8A 1ZVYA 3N0PB 4PRHA 3X3GL 1H3VA 3QG0A 2ICCA 3QUMH 5E99L 4RFEA 5A2KH 1MQ8A 3M07A 4R96A 1A4JB 4I77H 1J5OL 3QQ9C 1DBKH 1FFRA 2H2PC 1N0XL 3Q5YA 4YFLF 1U8IA 1JMZA 1CLYL 2MOVA 3O2VH 4DZBB 4F37K 3FQWA 4TVPD 2YPLA 3RWHB 3P40A 1A2YB 4Q9QL 1CZ8L 1DR9A 4WI2A 3QQNA 1O7SA 4F7EB 1A7PL 4ALAL 4GKSA 2YK1L 3SDYL 2C3VB 5E94B 3MYZA 1LMKA 2HVKA 4WRLA 4HPYH 3D2UA 1UH4A 3P0VL 1KIPA 3VRJA 1GIGH 4LLDA 3VFGL 1VGEL 2X70B 4OLYH 4ZTOL 4UNUA 2DROA 1A6VH 1L2AA 2OR9H 2IJ0C 1M6OB 3KLAB 3TN0B 1TQBC 2DLEA 4CADA 1G6RH 5HHMB 3WKML 3FT2A 4WVAA 1B0GA 4ZS7H 3GSQA 5I71C 1PYWA 2J8UE 1IM9A 4JRYB 5KAQG 1DEEB 5D1QB 2XFXA 4N0FA 1CFVL 2VXQL 3IS1X 2IFFL 4PY7A 4WGWB 5EWIL 1MJ8L 4YDJB 4AMKH 1I3GH 1F8TH 2EIZB 3WBDA 2DYPD 3KYNA 3WCYA 4N0CD 4RBPK 4JCMA 3K7UA 4F8QA 2AJZB 2UWEF 1I7RA 5F7NC 1GLMA 1CDJA 3WEXA 1FG2A 4QF1A 2GTWB 5T1KD 1AKJD 1BEYH 1U95B 1QSED 1HSAB 4HBCH 4AYOA 4YNYA 4BFEA 1KREA 1F90L 1A6WH 2X09A 3PP3H 1ZEAH 5I1GL 4QYOA 1LEGA 1NCNA 2WANA 4KKNA 2R2BB 3GRWH 2YUWA 2FWOB 3NOIA 2Q1EA 3ACSA 2X5PA 4GLRI 2D03H 2VSCA 4PS4L 2DM3A 2ED9A 2ICWA 3PHSA 3KYAA 4YH6A 4WWID 3TWCH 2VZOA 2D4DA 3JXAA 3SDXF 4MA8L 2H41A 4P2QE 5I8EB 1FVCB 3NCJL 4OSUH 2HKFH 3DX7B 1O5DT 1T1WB 4M1DH 4NO0A 5IEHA 2HG5A 2R29H 5IOPA 1XGTB 3DETD 3VFNB 1X4YA 3T1FB 4X7TB 3MMEA 1CGYA 1HEZA 5TDNB 3BXNA 3TVMC 4JANB 1FSKB 4OFKA 1WIOA 3TIEB 4RAVB 4X80H 3RVTC 3QXDB 1DOGA 4OZFB 5SWQB 1C5BL 1CR9H 2CRMA 1FNFA 3ME0A 5GRXG 1DDHB 3GI8L 4U1GC 1FFOA 3IXAA 4HLZH 1FO2A 5IW1B 1QEWB 5ITBH 1I7TA 4N90E 1NFDF 1VFAA 5F3HB 3G5XA 4BM7A 3MA7A 4NN7B 1ZANL 4R2GD 5T1MA 1Z6JT 4I9WD 2Z35A 1GGYA 2HTKD 1H13A 5L6YH 5ESAB 4LHUA 3EJZD 3VXUA 3U2SA 1CXHA 1BAFL 4IRSA 3OB0K 1TJIL 3HG1A 4MCZB 3BRFA 1PQZB 2BNRE 4MAUL 4X9FA 3CAFA 4IIQB 4PJ9D 4R6UA 5TPWL 5CGTA 4K8RC 4JCLA 3GGWA 3Q6GL 3FL7A 3PF2A 5KOMC 4X0KB 3T2QA 4K8RH 4G6KH 3MUZ1 1J05A 4PV9B 1YNKL 1M1SA 2EDOA 3ULSA 1KGCD 5I1HL 1EVUA 3G6DL 1MAKA 1C5DA 3VFUA 5J11B 2Q8BL 3G6JE 4JG0L 5D72L 3OXSB 5D2NA 3LV3A 1H15B 3RI5K 1T89A 2WWKT 25C8L 3MUGB 2DLHA 4HKZB 4PRIE 2X6MA 5F7EH 5DGRA 4O2FB 3OKKB 5CD3B 4ODTL 1MY7A 5JHLH 1SJHA 1P2CB 4QHKJ 4XP5L 4ODVH 1S7WA 4NZUL 1EHXA 3WUWA 3IU3A 5IB5A 5E8NA 2V17H 5MEOA 3UTQB 4NUJB 3VFRB 5EBMA 2P45B 1FP5A 3PL6D 5KVDH 1WITA 4FG6C 3VDBA 2E7MA 4ACPA 2B4CH 4LCIH 5HGDB 4C56B 1UM5L 4CU6A 2AXFB 3IB4A 2F54E 2CUHA 2DYPB 4P2RE 1MJUH 3W39A 4JQXC 1P53A 3IU4L 5TQ2H 4M8QB 3QFJE 4UIMA 2NY0B 3TIDB 1QSEB 4MSWB 1OAXL 5GRJH 3K81A 3P0GB 5I74B 4HJGA 4P3CL 2YMXH 1CBVL 1QFWL 4G9DB 3RVXD 2ZNXA 4BSWB 3VG9B 4DW2H 3EAKA 1S78D 2I24N 3DX6B 1S7UB 1MY5A 3SBWA 2FYYB 5ALBL 3ECBB 3HZKA 5CEZH 5IG7A 4HK0A 3RL2A 5KSVA 2GAZA 1CLCA 3ARFA 2WAHA 1BIIB 4JFZH 2A73B 4NCC1 1IKNC 1OPGL 2NY1B 5C6PB 3T0DA 1H3WM 2J5LB 3ELAT 3RWCB 4F7PA 2ZSWB 1CG9B 4K3GA 3BN3B 1G1CA 3N1GC 3V4UH 3J7HA 4UT6H 1YMMD 1G7HB 1I1YB 1AXSB 2VYRE 1JIBA 4JDZA 4MX7A 5EZJB 1IL1A 4ONHA 5HD8C 4NN5C 1S9YA 3GSXB 3MRGA 1RU9L 2UWEA 3E6FA 3ROOA 3NZ8B 4HF5H 3SY0A 4NQSA 4X6FA 4JRXD 4YDLB 3MRFB 4OTXL 2GJZA 5FYJE 4LASL 5FGBA 3LIZL 2EDFA 4GSDL 4B41A 1OAZL 2JCCB 3NZHH 1UEMA 4FQPA 5C2BL 5MHSE 4JFQA 3QFDA 4HUVA 3F65A 3GSOB 4I2XA 4KZEL 3RGHA 4U6HB 3SDXA 4OLZH 4OGYH 3D69A 2IAND 1M7IB 1OGAB 4DVRH 2K3TA 4NO2A 4EN3C 2HFEB 4CN6A 4FQHA 4XCYB 4N8CL 4W6WB 3QRYA 5DO2D 1A9BB 1FL5A 4HLZG 5D71L 3L5JA 4UUJA 2DQCL 5T1LA 3AVEA 2FGZA 3FQRB 3QNXA 3QXTA 5CJQL 3ILQD 5D7LB 1UC6A 1OF2A 4UQ2A 2GY5A 5D7JC 1S9WA 4XHQA 4HH9A 3T0VA 4ZNCD 3H2WA 3BJLA 3KPMA 1AR1D 4NP4L 1SVCP 3KPSD 1MRCL 1CFQA 5I19L 5IMKA 5DJDA 1LE9B 2NNAA 4DGVL 2JK5B 1JI2A 2EH7H 3FCTB 5C3TA 1NFDA 3SE8L 3JV6B 5KVFL 4RAHA 1LWRA 1E4XL 1CVSC 3LPWA 1IEAA 3K8LA 4OGAC 5BQ7B 4M8VA 5GSRA 3LZFH 4BZ1H 1EGJL 3QR2A 2JIXA 4ZXBC 5DVNA 3VGEA 1MNUH 4PB0H 3A6OA 4X98B 4H1LA 4OF7A 3X14A 3O45B 4R4FH 4BKLB 2CRYA 3BZ4B 1W72A 4YDVB 1JN6A 2XWJB 5DLMH 4I48A 1HXMB 5FCUH 3KHOA 5B4MC 3V9FA 5EUOB 2E7CA 1IBGH 1DQQB 4NO3B 4WNQB 1TTGA 1UENA 2BRQA 2YRZA 1G9NC 1CCZA 1T5WA 4NRZA 3RNKB 1NL0H 1FAEA 4G9FE 5GS2H 4NNXB 1K8DA 1G9NH 3MNWB 1ONQA 2EICA 4ZFZA 4M9OA 3ZYOA 4G5ZH 4K3JH 4PJHB 3E6HB 4GAYA 3UTPE 3VG0L 4DKEL 4I3RH 2GT9B 3RUGF 4YXLL 5I8KH 4PJ5E 5MI0B 3H3PH 1T80A 1VADB 1IC4H 2EDDA 15C8H 2J8OA 5SWZD 2XRAL 1H3TA 2YRLA 2BY1A 4GMSH 2JELH 1Z0MA 5D6CB 5TF1H 1KNOB 3QEQB 4CMHC 3BT2L 5DQDH 3DVNB 3EO1B 4L3EA 2HRLA 4OCXH 1UQSB 5E8OB 5JORA 4X4XA 1A1NB 5ERWB 4TQEL 4MD4A 3MO1A 3E6UA 2V7NA 3S4AA 3JWOL 3TT3L 4OIBA 4OFDA 4RRPG 3RVVC 4NQCD 3F58H 4JRXB 4MCYA 1CGSL 2VC2H 2ZUWA 5CJBA 3J8F7 3JBG7 1TCRA 5LGHH 3GSRA 3UTTA 3C60B 1HINH 2YS4A 1OCWL 3UYPA 1LF6A 4NZRL 3QRGH 3CFJA 4ZDHA 4JPVL 4AM0A 3H0TA 4TSAH 4MZ3A 4QHUB 3QUZA 4KVCL 2DKSA 5E9DD 1FJ1B 1OP5H 1KV3A 3TM6A 5IM7A 2OLDA 4N0UA 4M7ZC 1WAAA 2IANB 4F80A 3KXFB 4Z7WB 1RZKC 2D8LA 3O4LB 1CU4H 3BOVA 1RZKH 5FYLE 4P5KA 1P9MA 3VFMA 3BEVA 4NKOB 2VABA 3C6SB 2VITB 4MHHG 5IWLC 4P9HC 4X4YB 2FRGP 5IB3B 4YPGB 3DUUB 1IRAY 3BH9A 4D9RE 3L3DB 4X5XB 3GSNL 4P9HH 2IPUG 4TTDD 1GGCL 3GMQA 2MMXA 3KPSB 3DGCR 3MYJB 1MFCH 3MV9D 1NQBA 4PJ7F 5KSBB 2X1OA 4BFGA 4PRHE 4MQXD 1RHHA 1RJZB 4DGIH 1LO0H 1B4RA 2EDJA 1J1PH 4MNGA 1RAMA 1QPXA 3IDGA 3B5GA 5DFVC 2I9TA 1YQVL 3F7QA 4EI5D 4OLXL 4QRQB 4Y89A 3D9AH 3W0WD 1KTLA 1NGQH 3V6OA 1S9KC 1QLFA 1S3KL 4IM8A 2YPLE 3DSFL 4JO4H 4L8BA 5C09D 4X7FC 3QAZB 3OJDB 3IJSB 2P7TA 1ACYL 5D1XA 1NLDH 3FO0H 4YUEH 5E99H 1N64L 2UZIL 2N4IA 3IDNA 4GOSA 3V4PL 2Y4SA 2Z31C 4JVWA 3QDGA 3QG6B 3V7AE 1OAQL 2FBJL 3SKOA 5C0JB 4K23L 5ICZB 3BIAX 5FYKE 4LGRB 4G6ML 3F12A 3T2NH 5HYJE 3ULVD 4KUZL 1CZ8H 3QWRA 2JF4A 4DVBA 5D96B 5IFJB 4WU7A 1NGPL 1AGFA 1A7PH 1KB5A 2VWEC 3MRQB 4ZQKA 4FFZL 3KNBA 3IKCA 3HLAA 4Y8AA 2CKBB 1W8OA 3MLUL 4OFYA 4O58L 4LRNH 3L3JA 4HWUA 4RZCA 3EGSB 3N85L 4JFEE 1KCVH 2XZQH 1P5UA 1NJ9B 3PHOA 3VFGH 3DX8A 4LU5H 3CFKA 4D0DA 5EA0H 3SGJA 3JUZA 4GUPA 4XC1L 5CBEB 7CGTA 2CSPA 3HZYA 3PWPE 4U3CA 2BK8A 4IDJL 3WN5C 3GJFB 2VAJA 4WEMB 3V7AG 5A2IH 1G0XA 1SY6H 2R1WB 5DJ0B 3W9DB 1T4KB 4QHLB 2YA1A 3SDDA 4U2YA 4X4MA 5J4MA 1U8NA 4YDKL 4DK6A 1DE4A 2HLFC 3F62A 2PTUA 4ZD3L 5DJXB 1SJVA 4XNYL 4G6AC 1WZZA 3D39D 4Y19B 3FO1B 1IQWL 4XCEB 3NFPB 4H20H 1CXLA 2FV0A 4XP1L 3RDTD 3V0WH 3ARFC 3ZT7A 2BDNL 1IQDA 5HBBA 4POYA 1F90H 4LKCA 4F3FB 3GNMH 1T7VA 3K8MA 5C0EA 3MNVB 2EEBA 1OD7A 1HYRC 1EA9C 1AE6L 2EZ0D 4ZUVA 4WI3A 3CDFA 1RVFL 1NCCH 4BQBA 5JNYA 5KJRL 1HI6B 2IF7A 4GRWB 4BH7B 1KLUB 3LQZA 3HPJA 1RZGA 1I3RA 3VCLA 3RUGA 5DJYA 5E6IA 5B22A 5J12C 3C5ZA 3O2DH 1U41A 4C83B 2VAAA 5IBUB 3TBTA 3VH8B 1FO0L 4FXKA 1JZ6A 2OQJA 4Z5RA 1P7HL 4Y4FA 5CS7A 2AQ2A 3RTQB 4EXPX 4XXCA 3QIUD 4NKIH 5EBLA 1FYHB 3L9RA 2VKXA 5IHZB 3VXUE 2H45A 4L6XA 2BVOA 1KF9B 5TH2A 3FQUB 3HG1E 2ZUYA 2RI8A 5CAYB 1ZS8B 5GS0L 2VLRE 3W0WB 3NCEB 3QSPA 3O3AA 1TENA 3UTSA 1NBYA 3GSNA 3HAEH 1QFOA 5GISL 2D3VA 3WSQH 1A3LL 1KWFA 4OM1H 1T0MA 4HCRL 4QHMB 5FYJU 1TNMA 5L2KD 1QACA 2YBRB 1CE6A 2KZ1B 3ETBF 1EBAA 1S7VB 3FAWA 3OPZH 5EDXA 4M00A 5D2NE 5BV7L 2XZZA 2WWKO 3SJVA 1AGEB 3BHBA 1MHHB 2GSGA 4WW2F 3I9GL 5IMMB 3PMMA 2BNQD 3NCFB 2V2XB 5J56B 2XY1A 5A43C 1BQSA 3OBAA 5HYFA 5EIQA 3X11B 5A2FA 4LHUG 1TXKA 3EYFB 4M7LT 4XT1C 3TO2A 4NUGH 4ZG1A 4MA1C 2FO1A 4JM2D 2DN7A 5JIPA 2OKXA 4LBEB 1A14H 3RRQA 3HPLB 2PNDA 3QUMA 3B8SA 3TPUA 3FRPA 3U4EA 1MI5A 4J12A 3CUPB 4F7TA 5T1DH 4KPHH 4PJ7A 4JN2A 3ZYJA 1K3ZA 5E2UH 3RWGB 4JJ5B 4TVPH 3PHQB 1M05A 2Q6WA 3CVIH 1AD9A 3IDMB 1ZT7B 3ARYA 4WY7L 4ZPTB 5JA8B 1CD0A 4XB8A 5SX4I 5EBWA 4OF3A 1YEGL 5D2LF 3TF4A 2C1PA 2HT4D 4NWUL 4XCFH 4MWFA 1JPTL 3WUWG 3ZKMD 3EJYD 4L3AA 1JFQH 4AIZA 4JO1H 2B39A 1I1AA 2OTWA 2ADJB 4XHJC 1PZ5B 4PBWD 3P73B 5CKGA 1JGEB 2WNGA 2OJZH 3ZZ1A 1WSST 2GCYB 5DTFA 1N7MH 2FZ3B 2X7LA 5A3IC 3LRGA 4UDTB 3WDIA 2KDGA 4P3CH 1R3KA 4M1GL 1A6ZB 2W1NA 4MNQA 4FZEL 3MOBH 3TBYA 1AXTH 3TZVA 4Z8FH 5JW4M 5DEGA 4BZ2H 1DP0A 3L7EB 4PTUB 1A1OB 1U8KB 2K1MA 3MLSL 1U8PA 4LEXL 2E7HA 2Z8SA 1D5ZA 2LABA 1HILA 3BYTA 4H26B 4R4BA 2DJSA 4P5TC 3B2VH 3RWIB 4P23A 2IALA 3F5WB 2CDEA 2EDRA 3VXMA 4X6CE 4UB0L 4WHCA 4TSCL 2COQA 2HFFA 4U6YB 4K3EL 4GMTH 2NZ9C 3IFPA 2UWEE 3TO4D 4K9EL 5IHUH 3MGAA 1LK3L 3FB7A 3GRWA 1RK1A 3ARED 4OLVL 2P5WD 1BREA 3VFTA 2F74B 5GGVY 3DUSB 1FZKA 5ADOL 2W65B 3QUZC 4YXHL 1F11A 1FLRL 4WVBA 1EH9A 3MFGB 4I2XE 4JFDA 3K74B 1BD2D 3DETC 4FFWD 3B9KB 4HMEA 5L2KB 3EOTL 1EHLL 4JKMA 2I9LA 3SKNA 3KGRA 3QHTC 3SDXE 3V79C 1H3XA 3NABL 4JLRA 2BNUB 5I8OL 5C2BH 2Y72A 3S3PA 5GRYA 3EOBA 2B2XH 2A6KA 2Q20A 3QUXD 5IROA 2P8LB 3JV4B 4IOSD 4GS7B 1J8HD 3PV7A 1NC2A 4PV8B 1I1CA 2AGJL 3MFFB 1IKFH 3DHJA 2BNQB 4LL9A 3TA3A 2XPGB 1VESA 2P24A 3I3EA 4HCRA 3OXRB 1A22B 4R2GC 1BJ1J 4EL8A 4G42A 5EC2A 1N5AA 3C8HA 1T20A 2DQGH 2HTKC 2XICA 3DOSA 3OR7B 4YBLC 2X89A 2AW2A 3EJZC 4JM2B 4N8CH 5FA4B 1OLLA 4F2MB 1U9KA 2AHFA 1TJHH 3ZE1F 2DQCH 4I8DA 4PB9L 1NFDE 4WHDA 3X12B 2MQCA 3HAEG 1UYWH 4DGYH 4HUUA 1A21A 2YD8A 4U1HA 4PP1C 1A1MB 3QNYA 3U9UA 3WIIL 2E7BA 3QCUL 3V95A 5BZDA 1WZLA 5IB1A 1ETZA 2MWCA 2QKIB 3ARVA 4C4KT 4ZUUA 5GJSL 2Y1VA 5B38B 3RQ3A 1R3IH 4DGVH 3MBED 4BFIA 5I1JH 1IGFH 1F3JB 1KKTA 1GYAA 2W60A 3B43A 5I6XC 3ZMRA 3MV01 5M7IA 3QIBD 4Y16A 2R9HC 4ZYKA 3LRSA 3LKNB 3LN5B 4FHBD 1FVDB 4ODXA 3O3DB 1EGJH 4QRRD 3HR6A 3TLRA 4X99A 1N2RB 4EQ3A 5D7KD 3G08B 4R7DA 4WHTB 2MCG1 1FORH 5GHWL 4EDXA 3MLVL 2WINB 4BZYA 5HI4C 4EDWL 5DS8A 5FHAL 4YWGH 3T09A 4WW2A 5IVZA 3PL6C 1DCLA 1EJ6A 4HV8B 2NW3A 4X6DF 4L8SC 3LOWA 2R0WL 2XTJD 3I6GA 4PRPD 3U82B 2VUYA 4HZLA 2UUDK 4QXGH 2Z93B 5F1KC 4HWNA 4PJIE 3CMOH 1SM3H 2FO4A 4PJ8D 1LDPL 1RIUL 1A7BA 4YIQA 2VL5B 2CK0H 5C0BD 5LXGH 1NCDL 2VH5H 1I9IL 1IGIL 1KIRB 3G04B 1NKRA 5FUOL 4YAQB 1NGYA 4L3EE 3GBMH 3HRZA 3M8OL 1FC1A 3RVXC 3OB8A 3V5DA 5H2BB 1JHKL 1MJ7H 4ZUWA 1S78C 4GBXB 2AERT 4IMKC 4MA7L 1J12A 4LLUA 4PRBA 3OZ9H 2WWMD 5D2LA 4RIRB 3UTTE 1IGTA 1RURL 2F5BL 1TZIB 3NA4A 5IK3A 2V2TB 4XVJL 5C86A 5D7SL 1U3HD 1Q38A 2WIIB 3JWOC 4NBXB 5EULV 5E2WH 1HCUA 2P42B 1CICD 3IDXL 4WHYH 5DJZB 3L95B 5I1IH 3B3IB 2DI9A 3PGFH 5JXEA 3I75A 4X4ZA 3QJFA 5F9OL 4GRMB 1WTLA 1T6WA 3OKDB 3C9NB 4PJGF 4N8PA 4P2CG 3F7VA 1IAOA 4NZRH 5E6IC 1RIVL 1FFNA 2J8UB 4KDWA 5C2UB 4HGWB 1LVEA 1GVIA 1T21A 1T04B 1ZKAA 2PCPA 2EH8L 5T3XL 5INCB 4BK4A 4LCUA 3D85D 4XXCC 1KEMH 3C2AL 1O7VA 1RUKH 3O8XA 4LF3A 4PREA 2GSIB 4H0GA 4HGKC 4MJIA 3CFEB 4PRDA 1T03L 2R8SL 2N7AA 2BERA 4KU1A 4LNRB 1WC7A 4I5BA 4RGMC 1JNNL 3SDAB 4MNGE 3C6LA 3V2AR 3LEVL 3IDIB 5T5FH 1LILA 1X7QB 3U4AA 5AZ2L 3WJLA 5FOBB 5MEHA 4G8FA 1GGCH 3V6OE 4PLJC 3U4BL 1Y0LB 5DJCA 4YXKL 4FTVA 5HHXH 1KBGH 1VKXA 3VFOB 4HXAH 4GRLA 1D9KA 3DRTB 1OAKL 3BWUC 4U1SB 4HKXB 4R0LA 5GZOC 1YQVH 4JFPB 4P2QB 1IC5L 1YEDB 3QDGE 2R56L 3MRRA 4AT6B 3RL1B 3O6KH 3ILQC 3IFOA 4QRRB 3WKNA 2NXYC 3DSFH 1ED3B 2FGWL 3SCMC 1ACYH 3FT3A 4OIIH 1AR1C 4PP2B 3UP1A 1BPVA 1WFUA 1J1OH 3HZMA 4LSSL 4OM0L 5EU3B 3BZEB 3OGOE 3MRIA 3K1KC 5JXAH 5I8CA 2Z92A 3GI9L 1MCSA 2X4SA 5ICYB 4CVUA 4EXKA 4PJBB 1KTRL 2D0GA 3KPQB 5A16A 1NGWB 5EU4A 4KKLC 4KWUA 2ZUXA 5C0BB 1Q9LA 1KN2L 3I2CL 3VA6A 1DLHB 3UAJC 1WIPA 1WCBB 3FB6A 1UVQA 3B6SB 3SDCD 2VLLB 3O11B 1FHGA 5DR5L 1MHPH 3JWNC 4EVNB 1X5KA 4WENB 2IG2H 3RENA 1E6JL 4TVSa 4X4ME 1CDBA 4M6OH 4NNYA 5E5MB 5GSVA 1Y6KR 3SKMA 2AK4B 1RMFL 1SEBB 5L0QB 3M45A 3UMTA 1JS4A 3G6JB 2WUCL 1VPOH 1CL7L 2NX5D 3TH3T 1TETL 2FATL 3KJ6L 3KPOB 5MENA 1A5FH 1BWWA 1YY8A 3NVQA 4O00A 5F9JB 4PRIB 4XTRD 2A6DA 1FRGL 3QXWA 2WK2A 4JZNB 3LQAH 4Z0XB 1BFVH 1IAII 4P2OB 2YD4A 1Q72H 4ZD3H 3TZVC 2O5ZH 2BSTB 2Y36L 4XCCL 4XNYH 3U6RA 1FL3B 3TFKD 1VCAA 3FT4B 4XVSL 1IARB 3IAQA 1YC7A 2EIEA 2FEDD 4X6DA 5HYQA 3BKJL 1Z5LA 2NYYD 3Q3GB 2X1PA 1ZLSL 4RAUA 2HT2D 5I1LB 4LP4A 1NC4B 5IW6A 1UXWA 3L7FA 1YMHA 2DMKA 3GIVA 3GMMA 1DQLH 5BXFB 4YHKH 3MQIA 3RUGE 4FQJL 2VIRA 1MH5A 1TVHA 5HHOD 2F54B 4Y4HD 1ND0A 3VDCA 4LPTA 3HMWH 3QPQD 1RVFH 1D5MB 4YGAB 2IH1B 4ETQA 4YE4L 2APVA 2BC4B 3UJJL 1QFUH 2BY0A 2FR4B 4S2SB 5D70L 4NRXB 2A8ZA 3OKNB 3RNQA 1FDLL 5EOTA 4XRCA 1IC7H 3BD3A 4JM4H 4LOUD 4ERSH 2CLVA 4TYUA 1FO0H 1TPXC 1WVZA 4FFYL 3SQOL 4AYRA 2M8XA 3VA2C 3UTSE 2H9GA 4JFFA 5HDOA 3SHSA 3RY6A 2XZCH 4HFWA 1MPAL 3GO1L 3QZWA 3R0MA 3O6FC 1A9EB 4JPKL 1CXKA 2VLMD 4I13B 3L3GB 5LJYH 2FLRT 1ZLWK 2H32A 5CHNA 4OD1L 5CP7B 1FIGL 3SJVE 3G6AA 4P46D 4I0PB 1U58A 4PJGA 2EACA 3QQ3B 1NBQA 2NY2D 4L8DB 3HC4H 4X7DC 2PO6D 3NAAL 4TTDC 2YD5A 4ZODA 5T3ZD 1N59A 3D3IA 2AABL 2E6QA 1OM3H 2NVPA 1LD9A 5F70A 5HY9A 4AENB 1AP2B 5IB2A 5DC4B 1R0AH 5GGTL 1LNUA 5ESVB 1UWGL 2H8PB 3IFNH 4TPRH 5BRZD 1L4IA 2QV2A 2LAAA 1K5NA 4EI5C 3ARZA 2CH8A 2XZAL 4HIEB 3RRSA 4U1KA 2DQFA 5KVGL 4J2XA 3MACL 1MI5E 2XWTA 1LK2B 5ADPH 1MLCA 4PJ7E 1EEZB 4APQB 3GSUA 1G7MB 1HHKB 1CT8A 4TF4A 4I18B 5CP3H 3B9AA 4LVHC 2CKNA 4QGYA 3ARDD 2DOCA 4NHCH 3HB3D 3O9WD 3FQTB 1DN0A 1YN7B 4Y16C 5K9JL 4HMDA 2HJLB 3MXWH 3VJ6B 4G3YL 5KZCD 3RVUD 4I3GA 5BS0D 2DL2A 3ULVH 4FMKA 3OJMB 3K4DA 1RHFA 3CFDB 5IHLB 3HUJB 4UAOC 5CKAA 3HI1B 4LCCB 5I15L 3CH1B 4S1SH 5F6IC 1AFVL 1QG3A 3PGCA 4MXWL 1MRDL 5DRNB 1DQJB 2AJ3A 1UH2A 3GFUA 3DXAA 1A6AA 4OQTH 3FFDA 4Q58C 1GGUA 4MNQE 2UY7A 12E8H 3KHQA 3B9VA 2B0SL 4KI5F 4JJJA 4GAGL 4RISL 4U3XA 3LS4L 4KTRA 4U6XB 1RZ7H 2DI7A 1A4JA 4OB5H 4WO4D 5DD5L 4ODWB 1J0ZA 4HKBB 1U8JB 1G0DA 5DK3A 4DZBA 2OCFD 1X6NA 4M1GH 3RWHA 3ULUD 3RX7A 1A2YA 3V5HB 1DQDL 2VR9A 3GMRB 4GAFB 1JI1A 4F7EA 3L5WB 2ZPKL 2V2WB 5L7XH 1DBAL 5FIEA 2C3VA 5E94A 3OAYH 4WV1B 4C57C 3VRIB 2BVTA 4OZGB 4FQ2H 5FA3B 4LEXH 2FIRT 2QADC 4DEPB 1MIMH 4QHKI 1F4XL 4J3UA 1G84A 5IBLC 2Y6SC 1KJVB 5IVXE 1JHTB 4WWKD 4FP8H 1M6OA 3KLAA 1BVLA 5AEAA 3TN0A 1GA2A 4FUSA 1G6VK 1WBYB 2E9BA 4K9EC 4HJ0C 5JXEC 4JFDE 3BGFC 4K3EH 5KN5A 2ID5A 3EFDL 1KXTB 4H88H 3D0LB 4KDTA 4UOJA 4QEGA 1DEEA 5D1QA 5GZNC 2EXWC 3UPAA 4JEGB 1QLEL 5L88L 4YDJA 3QCTL 4ZAKD 2NY2B 1AQDB 2DQIH 4MD0B 1WQVT 1LEIB 3O8XC 1EHLH 1G9MC 3WXWH 3SGKA 2AJZA 2XA8L 3QIUC 1OL0A 4M43L 2J8HA 1G9MH 2GTWA 3OHXB 4Q6IB 4N9GB 2VXUL 5CD5C 1GAFL 1U95A 1CIDA 1HSAA 4AYQA 5EO0B 4XXDB 2JCCF 1MLBB 3T0WA 3LB6C 2AGJH 2R2BA 2FWOA 1D5IH 3T0ED 2IBZY 3QT3A 3V4VL 4GT7A 3UYRL 1P4IL 4JQVA 4GRLC 3PIQB 5KSAB 2AK1H 3S97C 3ARDB 5DQ9B 2PN5A 3WIRA 2R4SL 5GGTA 4C4KO 5EBGA 3O9WB 1FVCA 5I8EA 4DUXA 3DX7A 2YD7A 1T1WA 3ZO0A 1AIFB 3VFNA 1PJ9A 3T1FA 3UZEA 3LDBB 4X7TA 3BE1H 5TDNA 5DZNA 4JANA 1JYXA 1CN4A 4RAVA 3BRGC 4LVOC 3QXDA 3DBXB 4M62H 4OZFA 4QOKB 2YD1A 3BPNC 4FQ1L 4P4KD 5SWQA 2ZUVA 3BUYB 3WLBB 1CFNB 2GK2A 2R0ZH 5H35B 1F97A 3JTTB 4LGPB 1DDHA 1BP3B 1FNEB 5IW1A 1QEWA 5ISZD 3O0RL 4PGZA 5F3HA 4OV5B 1HYSC 1FNHA 3BQUD 1MFDH 4E41B 4CUCA 5FM4A 3V6FB 1I9RH 5ESAA 4XPHL 2C26A 4I1NB 3HFML 4GG6B 1WU6A 1U6AL 4ZSOB 2H6PB 2D5JA 4MCZA 4M93B 1PQZA 4IIQA 4FZ8L 5IUSA 4L4TB 1CK0H 1A7QH 4XI5D 2EDHA 4X0KA 1IJ9A 4QRTA 4PV9A 2IPTH 1ZWIB 5IBTL 4OF0A 3QUYD 4U7SA 1JPGB 2HT4C 3OXSA 3ZKMC 5TDPB 3EJYC 5EUOF 4JVUA 1H15A 1PG7X 3EW3B 4IHOB 3P9LB 3MUGA 4HKZA 3DI3B 1I9IH 5D2LE 3ARTA 4PJEB 2FX9H 1T5XB 4X5WB 4O2FA 3OKKA 5CD3A 2P47B 4KTDH 3HE6D 3CK0H 1P2CA 5HYJB 5CEZE 1HHJB 3NMEA 4PJHF 4Y88A 5J0BA 4RNRB 5L2JB 1SHMA 4NQEB 3UTQA 2WM0A 4NUJA 2PTTB 4MA7H 1L0QA 2NY6C 5J9PB 4HFUL 2AKRB 5F72S 3IAGC 4NDMB 4RWHA 1BECA 5D7SH 1DBJL 1Y6MR 2XY2A 5HGDA 4C56A 2FEEL 4JFEB 2AXFA 4IEFB 4NM4H 3VFPB 2DAVA 2DYPA 5M7YA 4KZDL 5HHVL 1X5JA 2X1WL 4M8QA 5F9OH 1IZKA 4Z0BH 3WS6C 3TO4C 1JYNA 3PWPB 3TIDA 1I8MB 1HIML 1NLBL 2MTPA 2P5EB 1QSEA 4MJIE 4MSWA 2A9NL 4HIXH 4K7FB 4OCRL 2VR5A 4YHZH 4OLWL 4YC2C 4G9DA 3T0EB 4BSWA 4KK6D 3CPLB 1RZJH 5JW4Q 3C8KB 3DX6A 1S7UA 3C2AH 1XGRB 2ITDB 2FYYA 1S7SA 4YHLL 4FTVE 2Z4QB 3BKYL 4Z7WF 4TTGA 3S96B 2FJHB 4HWEL 1BIIA 2A73A 1JZ2A 3TT1L 1AJ7H 3QUXC 1NCTA 3RWCA 4GXVL 2ZSWA 1ZSDB 3GMLA 2Y06H 4LSUL 1CG9A 5I1CH 1A3QA 4YXKH 2FX7L 5D93B 3QIWD 3B2UC 1KIUA 3L5IA 5BMFH 1G7HA 3P11H 1AXSA 3K8KA 3ARGC 4YQXH 1I3VA 5KSBF 5EZJA 5DHVB 3BQUB 4M3JA 3GSXA 2Q76B 1V7NL 2EKJA 3NZ8A 3VXRE 2C1OB 4K3DL 4AEHH 4EQ2A 2B8OT 3FHQA 1OTUD 4NKQB 4RGNC 1MHCB 3MRFA 3QDJD 2FGWH 4UT9H 3WFBH 5CUSL 2JCCA 4WUUE 3ZE1E 1PLGH 5I18H 4LSSH 2JF1A 4U49A 1AGCB 1I85A 2A9ML 5JOPD 3GSOA 3OF6D 3VI4F 3U0WL 2VLRB 4KMLB 3UYOD 4CGTA 4U6HA 1CLOL 2C9AA 3DWTA 5ALCL 2AV1B 1M7IA 1OGAA 3DGGB 3HI5L 3H9SD 2HFEA 3N1QC 3W7WA 4XCYA 1H54A 3UJTL 2G60H 3DMMD 4UTAL 1JK8B 1A9BA 2D7PA 2E6PA 2YSSB 3FQRA 2HRPL 2VE6B 2OM5A 5MENE 2AEPL 3HE6B 5D7LA 3BYYA 5FKPB 1FH5H 2FBOJ 2J6EL 2XTJC 2JB6B 1GGBL 1F00I 1ROWA 3S36X 3FO9B 1RMFH 2YUVA 4MB5A 1NKOA 1LE9A 3E73A 1CL7H 5DYOB 2JK5A 4GQ9H 3FCTA 2VDOL 1DANU 1TETH 3KJ6H 3JV6A 3KYMB 1JHLL 4X6DE 1II4E 5E2TL 2PYFB 4OLEA 2NPLX 3TNMB 1YEHL 1MFBL 5BQ7A 2NY3D 4LCYB 2QNOA 4F9LC 4H8WL 4L9LB 1MWAL 2QQKL 1YY9C 1U8MB 4RFNC 5GS3A 3VI3F 3QO1A 2BP3A 4X98A 4R9HA 2CO7B 5B39B 2IBGA 3BKJH 3FONB 3O45A 1QHOA 4BKLA 3OAUH 3BZ4A 5EO9B 4YDVA 2CKBL 2XWJA 5DT1L 4JR9H 1HXMA 4PYGA 2E7LC 3MLYL 2JB5H 1DEDA 3P0YL 1YEEL 5D7IE 4HWBH 5EUOA 1R24B 5T3XE 3DVFA 2YD3A 1OAYH 3GK8H 1DQQA 3MGOB 4KQ3L 4NO3A 4W4OA 4WNQA 2X4RB 4NQXB 4TUJB 3TYGH 2XQBL 4JFFE 4XPGH 4YHMH 3BP5B 3MX0A 2AJSL 3RNKA 3RBGA 2F53E 5D70H 2C7UB 4NNXA 1M4KA 3MNWA 4LNVA 4NRYB 1T3FA 2X41A 2BFVL 4PJHA 1E6OH 3E6HA 4GRWF 4QRPD 5L9DL 1N6QL 2BHYA 4AJ0A 2GT9A 2DD8H 1EJOL 4ODSH 3GZKA 1VADA 5C0RH 1MCCA 3VXTB 3SGKC 5FV1L 4HT1H 4PJGE 5DMGD 3GO1H 4NQDE 1JYWA 5F1NB 5D6CA 4YHYB 1KNOA 3ZE2F 3QEQA 4NZDA 3LHPH 4HUWB 5KSUA 3DVNA 3EO1A 5F7MC 1UQSA 1JYVA 5E8OA 1HHHB 4JY6B 1WU4A 3X3FL 4KTEH 1A1NA 5ERWA 4HXBL 3UROR 1X4XA 4UV4L 4X6CB 4JRXA 1KS8A 1U8HB 2EDKA 3KPNB 1PG7L 4K94L 4CVZB 4L4VD 1IZJA 5KVEL 1PG7W 2AABH 3C60A 3WNKA 1ADQL 3QZWG 1J1XL 5FV2A 5L8KB 4U31A 1LO2H 1B4JL 1NAKL 4ONFL 2GUOB 2AJXL 4ODBD 1LF9A 2ADGB 2PXYB 2X10A 3SO5A 3RBSA 3A3VA 5IT2H 4QHUA 3TJHD 3ZTNL 5HVHC 2HJFB 1FJ1A 4Z7UA 1DFBL 4JKPH 3GSWB 5KVGH 3GDBA 1UM6H 1TTUA 3VE0B 1FSKC 2IANA 2DQUL 3ULVF 3KXFA 4Z7WA 3O4LA 3DMMB 1A7RL 4PG2C 1BX2B 2RGSA 2ARJB 1F6AB 1BQHB 5DRWB 43C9B 2QHLA 1EO7A 1WWCA 4Q0XL 1U8LB 4YGVB 1D6EB 4NKOA 3C6SA 3RGVB 1FGNH 2VITA 4AY0A 3TCXA 4X4YA 5IB3A 1JNLH 4IJ3C 4YPGA 3DUUA 3F8UB 4DAGH 5CLWA 3L3DA 4X5XA 2QSCH 4WFFE 5ELIA 5C0NC 3KPSA 4Y2DB 2MHAB 3VGHA 5FOJA 3PGDB 3MYJA 5DC9B 4LIQH 3DXAE 2UVEA 3CSGA 2FCBA 5KSBA 2VDNL 3GHEH 1RJZA 1B0RB 1NAML 1F9DA 4YEFA 1R3LB 4KJPD 5I15H 1J18A 3JV5A 5D4QA 1U3YA 1LO5B 4QRQA 1X5IA 2J6EA 3SDCC 5I1EL 5DD3H 5EG6C 2KZWA 1F58H 5J11C 2YC1B 4W6XB 3OJDA 3IJSA 4L4JA 4RISH 3RZCB 2F58H 3E3QC 4LSTL 5HVGB 4Y8DC 3QG6A 5D9SB 1QSFB 5IB4B 5C0JA 1TJGH 5ICZA 3NTCH 3WO4C 5DA4A 3QT9A 4ZMAT 1GZQB 1DQDH 3ANJA 5IFJA 2XKUA 4DKDC 3MRQA 1MFAL 2G2RB 4N0YH 5A1AA 1ZHNB 4KHTL 5BZWB 4Y4KD 3CFCH 1EFQA 2CKBA 3G5YB 5BVPH 1WZKA 4LAQH 1Y6NR 3ZDXF 1F4XH 5L8JB 3EGSA 4D2NA 2XYCA 4MD5B 5J13C 2R1YB 3CD4A 1NJ9A 4JRYE 4KI5C 2I60L 5IFHL 4KMTL 1HZHL 5E1AB 4KK8D 4ZFFA 1XCTB 2ADFH 2VSDA 2DIJA 4Y4HC 4PJIB 3FHAA 2NY0C 3HA0A 4PRAB 3L6FB 1GZPB 3GJFA 3DECA 1I8KB 3MOQA 2R1WA 5C9JB 3W9DA 1T4KA 5H94B 4QHLA 3VD7A 3S7GA 1BVZA 1PBYA 4ZUTB 3AM8A 4XPTL 4KRMB 3VD4A 3R0NA 4JO3L 5AG9A 1QLEH 3VG9C 1Z9SA 3AY4A 3REWB 4RMWA 5DJXA 4LOUC 1ORSB 3T8XB 4Y19A 3FO1A 3T0AA 3S98A 1Z9OA 3THML 3H9ZA 4XCEA 1QVOA 3NFPA 1E4WH 5HHQB 3CJJA 4JKKA 4Z7VB 3IDYC 2NY1C 4R26L 4F3FA 3CX5K 3ON6A 3MNVA 3CSYB 4C55A 4NJ9H 5KTEH 1F4WH 1NFKA 5GRUL 2NQCA 3A6BH 4JRWA 1RUPL 2OR7A 2PO6C 1HI6A 3K2UL 1KLUA 2IEPA 1KJ2B 4LFHD 4JDTH 3OKMB 5F6HJ 2NY5L 4JM2F 2APBA 2XN9E 3T77B 5JDSB 4C83A 3VH8A 1XIWD 1PSKL 5DZLA 3ZSTA 2CRZA 5DWUL 4ZFGH 2ZCHH 4L0GA 3RTQA 5ETUB 5B3JF 2BX5A 2ERJB 3MRHB 3ARBD 5DQJB 5DK2B 4FQ1H 5IHZA 2WYNA 1MCLA 1I85C 3FQUA 3FFCA 3CXDL 1ZS8A 3O81A 3W0WA 3WFHB 4BUHA 4HIHB 1F4YH 3NCCB 1RI8A 5JHDD 2L4OA 2DTSA 1QBAA 2Y9RT 1M71B 4QHMA 1KENL 4XPHH 2YBRA 4FQXD 3MRLB 1FE8L 4MB3A 4OKDA 1S7VA 3KPPB 5E2JA 2E27L 3GSVB 2C4FU 1XWQA 3GJFK 4PUBL 2DJUA 1AGEA 2VDRL 5DUPL 2MQ0A 3MTRA 4I4WB 1MHHA 3NIFF 4P57B 2DWDB 5IMMA 3BPOB 1DN2A 1TMCB 2V2XA 3KAAA 4Z77B 3MCLH 3X11A 1U92B 3EYFA 1MEXL 4N0RA 4Y4KB 5I75C 1X4ZA 5EZIH 1UH3A 4MDJB 4LBEA 1QKZL 2A6IB 3HC3L 3HPLA 1TZGL 3KJ4C 4AEEA 3MBXL 2ZKHL 4FFVC 3MLRH 4C56E 4DOEA 3ULUC 1WGOA 1KPUB 4PJDB 3EBAA 4DN4H 1UXSB 1X5XA 3RWGA 4JJ5A 3ULUH 3MREB 3PHQA 5IVNA 4CJ0A 2AJUH 4L5FH 3IDMA 3RIAF 1ZT7A 4QCIB 4M7JL 4ZPTA 4J7RA 3QQ9D 1QSEE 1INDH 2H2PD 2EDTA 1KYOK 1G7IB 3SO3B 4KRPC 3T65B 2O61B 1B88A 3QEHB 3MRDB 5CJ8A 3RA7L 3OKOB 4WWKC 4WVCA 2WBJB 4Y5YB 2VDMH 3G5ZB 3HNTL 2ADJA 4Z95H 3ZKXC 4LQFH 3P73A 1NLBH 1JGEA 3DIFB 1KT2B 5HSFA 1BGXH 2M26A 5JOFB 3E2HB 2FZ3A 3O4OB 5C7XH 4ZFOB 4UDTA 4J3WA 2FIKB 4NC1C 1A6ZA 1S7TA 4NJAH 4F7MB 5MI0C 2J8UF 4FMFA 1I7UB 3KG5A 4K7PX 5HI5C 1UG9A 1JZ4A 1BMGA 3L7EA 2ZCLH 4PTUA 1A1OA 1U8KA 1QNZH 3SE3A 4XP4H 4YHLH 3D3VA 5L8LB 1A6UL 3RWDB 2IC2A 3MJ9L 2HN7B 1B90A 1LO3L 3RWIA 4V1DB 3F5WA 4HPOL 1XIWB 3DO7B 3IAPA 3M17B 4OGXL 3BPLC 4QWWD 6CGTA 1S9XB 5AAMA 4EUPH 4U6YA 2AI0L 4WTZA 4I9WE 2B1HL 3ARBB 1PGRB 2R0LH 3C60C 4JB9L 3TEUA 4F57H 4MQSB 4UNVA 3MXVL 1LQSR 3U0TB 2JCCE 2F74A 5E2VH 5F21B 1U91A 3DUSA 2W65A 4YBQC 2O93L 1FO3A 3WIHH 4M6ML 4CE7A 2D7TH 5E8DH 2NY4B 3B9KA 5ILTL 2OK0L 5L2KA 3NACL 2XQYK 1OY3B 2XKNB 2J2ZA 2BNUA 1ZLUH 4P4KC 2QEJA 3G9AB 2P8LA 3JV4A 1TQCB 1QBMH 2ZUUA 4PV8A 3AAZB 3QWOA 3MFFA 1JGLH 4F58H 3QPFA 5GGSB 2XPGA 4YHIB 5D7LE 1CE1L 5C0AB 3OXRA 2IBBA 4UV7L 5C08B 5I30L 3WUZA 3TVMD 2PW1A 4IRJD 3OR7A 1DLFL 2APWA 3RVTD 5JLZB 1UJTA 4JM2A 5FA4A 4PJBF 5GIRB 5F1OB 1F2XK 1BFTA 1RFDL 4A6YB 1K2DB 2LE9A 5C6TH 4G8GA 4JREB 3MV8B 5CZXC 2O5XH 1L9NA 2ENYA 4LSQL 1A1MA 5LWYL 4JO2L 2OR8A 1MJJB 4D8PB 2PYED 3MA9L 4Q2ZB 5J1AB 1SJXA 1EX0A 1VHPA 2W9EL 3EO9L 3QAZC 3LVEA 1DBMH 2QKIA 4G6FB 4XNXL 5B38A 4IOFD 4Y1AA 5HJ3B 4FQIL 4O2EB 1F3JA 4LMQE 3MCKB 3G6JF 1FZMB 1BM3H 4R97C 1XF5B 1XW2A 4HQQH 5CINL 4H8WC 4J8RB 4R8WH 1MFBH 1IT9H 4NKMB 3LKNA 3IF1A 3LN5A 5D96C 1MWAH 1NUNB 2QQKH 4M7LH 2OL3L 2GITB 1FVDA 3O3DA 2X2YA 2VLKA 3GIZL 1N2RA 5EUOE 3VW5A 1BBDL 2GK0B 1JGVL 1ZTXH 3G08A 4WHTA 4X7SL 5CA3A 4LARH 5IGXL 2WINA 1IM3B 5SWSD 1VEOA 4FRWA 5DVLA 4HV8A 3QDEA 8CGTA 1IGCH 4K71B 1KOAA 4LEOB 3MLYH 1WK0A 4PJHE 1Q9KB 3L3HB 3JVGA 1G6RB 2W9DH 1TQBB 1FGVL 2Z93A 4YHNB 3WE6B 1TF4A 2P0VA 2Y5EA 4HS8L 3SE4C 2XQBH 2VMFA 1JGUL 2VL5A 3HE7B 1MCWM 4Y5VC 1NXCA 1YMME 5C07B 1KIRA 3ARRA 1HQRB 3D25B 3G04A 3WD5L 5JW4N 3TJEL 3OGCB 3MLWH 5IQ9B 3AM8C 3QEQE 4JZJB 4FG6D 2R39A 4YAQA 2I5YH 3C8DA 3BVNB 3AY4C 4V2BA 1I7ZB 1SQ2N 1ZAGA 1EJOH 2OTPA 1QZ1A 5E4IA 5H2BA 3BIKB 5IR1B 1H9VA 4GBXA 4XP6L 4JRXE 3PWUB 1GOFA 2Z8RA 3T4YB 4RIRA 3MJ9A 1TZIA 2IAMB 4KQ4H 4QKXB 2V2TA 1V7ML 3T08A 3MRBA 4UBDC 2ZBLA 1QBLL 2WIIA 1KC5H 5FKAB 2Q7YB 4HXBH 5DJZA 4RDQG 2E6JA 5B8CC 3L95A 5IVXB 3EQAA 4K94C 3EYSL 4GJTB 2BRRL 3B3IA 4X8XA 1PG7H 4K94H 4CL7A 4GRMA 2IANE 5CIPB 5KVEH 3OKDA 3KXFE 4Z7WE 1ADQH 3C9NA 1DJSA 2H26B 1MAMH 1ERNA 2EKSB 1R3JB 2HKHL 1B4JH 2QSTA 3QIWC 1IGMH 3TNNB 4ONFH 4N68A 2J8UA 1WU5A 1RJYB 5E8EB 1Q94B 1VACB 4HGWA 5MEQB 1JZ3A 3F6LA 1T04A 3OKEB 1TDQA 1YYML 4PJ5D 2CQTA 5INCA 1OD9A 1R5IB 2A2QT 3TVMB 2DQUH 3UX9B 3V8CA 1XCQB 1CF8L 2GSIA 5F96L 3KPSE 1L9MA 3UJIH 3CFEA 5HHPB 1ZHBB 4U1IB 4LNRA 5HGBB 5KSBE 1P84K 5ACMA 4U1GB 5JIKA 4YLQT 3LS5L 4JHWL 1WEJL 3SDAA 5JDJA 4UDUB 3IDIA 5DMIL 1X7QA 4R90H 2PYEB 1KYOJ 5FOBA 4N8VB 5DK0B 5HVWA 3PQYD 3BISA 1BFOB 1Y0LA 3QEUB 3BJ91 5JIIA 1KCSH 3VFOA 2QHRL 4OCWL 3REVB 2YPKB 4Z7OF 1KLGB 1KJMB 4MAYC 1H5BB 4M03A 3DRTA 3HKFA 1V8HA 4U1SA 1NAMH 4HKXA 1IA7A 1F3RB 3VI4E 4P2QA 3BDBA 3FN0L 1YEDA 1Q0YH 5AUMB 3HUJF 3RY4A 4OBSA 4AT6A 3RL1A 1WFTA 5I1EH 4XZUB 4QRRA 1ED3A 3MLTB 1EV2E 2UY6A 3I6LD 2MKLC 4O02L 4PP2A 3EYOB 2MKWA 4JFYB 5FYJL 5SWSB 3RIAK 1V5DA 3L5XH 4RMVA 5EU3A 1XR9B 3BZEA 4LSPL 1IEBB 4U6VL 4S1RL 2NY3C 1DANT 4UTBL 3WLWD 1G7LB 4PJBA 4JQIH 3MRKB 1B3JA 5DD0H 1YUHB 3KPQA 3HTLX 2GEEA 1NGWA 4D9LL 5SWZE 1XF3B 4HW6A 1EO8H 4WCYH 3QPXL 3CVHH 4LPCA 5C0DB 5E56A 1DLHA 1NH6A 2BNRA 3CZFB 1WCBA 3ARQA 3B6SA 3VFVB 1UGNA 2VLLA 4OZGF 3O11A 4WGVB 3WFEL 2V7HB 4OGAD 4EVNA 2DTML 3U7WH 5DJ2B 2OZ4H 3VI3E 4NYLB 4KMTH 5E5MA 2B1AH 2AK4A 4NQCE 1SEBA 3WHE1 3G6JA 1OP3H 4GG8B 1SEQL 4MMXC 4Y19E 2QQLH 3KPOA 4HWBA 3S35H 1JF1B 2R69H 4PRIA 3WJJC 3GM0A 1Z0NA 4MGXA 2HFTA 4JZNA 4PJCB 4Z0XA 4I0KA 4KROC 4P2OA 5B4MD 5IFAL 2BSTA 1FL3A 2L0DA 3FT4A 3SE3C 5KS9B 4RGOL 3VFWB 3R1GL 5IF0B 2R0KH 4LSVL 5JPNB 5I1LA 4BQ8A 1NC4A 1YEJH 2H1PL 1IM9D 4GRWE 4MZ2A 3H42L 4DKFL 1J7VR 2VDLH 3CU1A 5BXFA 1FNAA 3MNZB 3STBA 3ZYZA 1YNTB 3GHBL 3QEGL 4J4PC 1RULL 3S36H 2HTLD 4AG4H 2F54A 3PWJB 4Z4LA 4P2RA 1GC1L 1RUPH 1OT2A 1BF2A 5GS1B 1AO7D 1H3PH 1D5MA 3GB7B 2IH1A 3ZE2E 2BC4A 3RIFF 3K2UH 2FR4A 4S2SA 2WV3A 4NRXA 3OKNA 3RPKA 4ZNEA 1KCKA 1NBZB 5M94B 1IA6A 4RFOH 3LMJL 4TRPL 2GW5A 4NN5B 4U0RC 2NLJB 4U1MB 3W0WE 2IQ9L 3PQYB 3TJHC 2EABA 1QQDB 2FJFB 4M5YL 3RVVD 1FNLA 5AYUL 4YX2L 3DROB 35C8L 4MLIA 2HLAB 5C92A 3K1DA 1OT1A 1A9EA 1ZLVH 2DDQH 1A4KB 4OCSL 1P1ZB 1A3RH 3L3GA 4MNHB 3BP6B 3H6JA 5LG1A 4X9IA 4NO0D 5CP7A 3RU8L 2DKUA 4TNWF 3MZTA 2R2CA 1D5XB 4I0PA 2Z8WC 3ULVE 1TZHB 3MGTB 4F33B 2DQEL 3QQ3A 4F15C 2FJGB 4L8DA 2JJSC 5GQBA 1WWWX 3U30C 1FE8H 1MSPA 4EN3B 4NNPH 4AENA 1AP2A 4RMRA 2FL5A 2NTSP 1TIUA 4KK5C 3CCHB 1P7QB 3NA9H 5EU7C 4GG6F 3DTXB 1CS6A 4NGHH 4PUBH 1X9DA 2H8PA 5ESVA 5FUZL 2BJMH 4KJPC 5A40E 4O5LH 1T83A 5D7JB 4HIEA 1QPPA 1GGIL 4UIKL 2EE6A 1P4LB 3O3UN 1LK2A 2EDEA 1EEZA 4APQA 3VXRB 4I18A 1G7MA 1HHKA 4LHUD 4P4RA 3VXUD 1ACZA 4YR6B 5E08L 3HMXL 4HKJB 3T33A 1RSFA 1ZMYA 1JRHH 3NCYP 1QKZH 5FYLL 3A67L 3S5LG 1NMAL 3FQTA 2X42A 1YN7A 2HJLA 3VJ6A 4KAQL 3ARSA 3QXUA 4PJEF 1BBJB 2MCPL 1NGXA 3MLXH 1T7XA 4ZXBB 3EYUL 3C09C 3D39E 2ILLA 1A7NH 3CFDA 1C7SA 4W6YB 4PYHA 5I66B 3HUJA 5F9WC 4LLWB 4X5LA 3GBLA 4OT1H 5C3LD 4JHAL 2P8PB 1FBWA 3HI1A 1KIPB 4LCCA 4U1JB 3BKCH 4OD2A 1KXQE 4KVNH 1A6TB 1DQJA 5DRNA 1KTDB 2NY7L 4M6NL 5FXCH 1C16B 1BQLL 4IDLA 5FDYA 5JW3H 5I1KH 3RAJH 4U6XA 3K80A 1QTYT 2A0LD 1IM9B 1AY1L 3NPSB 3ZDXE 1U93A 1N4XH 4HKBA 4XB7A 1U8JA 4HC1L 3S37X 2CIKB 5F9AC 4ZOEA 3V5HA 3GMRA 5FYKL 5HGGS 2QQNL 3EUUA 4A2MA 1AO7B 2ATPA 3L5WA 2V2WA 5EORH 5CJOL 4S11A 2OXHA 4Z7QF 4WV1A 3MV7D 4G43A 5TJWK 5JR1L 5FA3A 3UZVB 3A6CL 1FYTB 2CLZB 2K9UA 3N50A 3P3YA 1LO3H 1KJVA 1JHTA 1ZA3A 4TUOA 1QSVA 3O6MH 1WBYA 1LP9B 4ORGB 5D7IB 1ZVSB 4RMTA 2P1YA 5L2KE 2AQ3A 3QG7L 2HA1A 4H5SB 4EKXA 1OAUH 3D0LA 3RSYA 2YHGA 4NM8L 2BVUA 3BEWB 1MFNA 5C0CD 3ARFD 5IMLB 1CFTB 3RPIB 2RAMA 3CZJA 1WZ1L 3IFLL 4PGBB 4WJ5B 1AQDA 5D1ZB 4M7ZB 4MD0A 2OK0H 3HNSH 1LEIA 3QULB 2BNQE 4LPUA 2D0HA 3OHXA 4Q6IA 4N9GA 3VGGA 5IMOB 1ZT4A 2F8OA 1KTKE 2ZG3A 1RZIB 5EO0A 1EEQA 4XXDA 2O5YH 5GRZA 1R5WA 5K9QI 1C1EH 1MLBA 1RZ8B 4I3SL 1YN6B 3BGAA 3NFNB 3JV0A 2DRQA 3QHZH 2Z35B 4LSRH 5B3JE 5JO5A 1U3JA 3Q1SL 3U2SB 2EDQA 3PIQA 5KSAA 5TQ0H 3ARDA 4Q88A 1OQXA 4FQXC 4PJXB 5DQ9A 3O9WA 1L7IL 1KCRL 1RFDH 4B7LA 2EAEA 1AIFA 2LQRA 3OG6B 3ZDYF 2OYPA 1JWUB 1WF5A 5GGVL 3INUL 3VWJC 1I1RA 3TBWB 5TE4L 3O6LH 3DBXA 4XNXH 5C0FB 3T0XA 2C4FT 4QOKA 5F7FA 4O4YL 1S7QB 2APTA 3BUYA 3WLBA 3FMGL 1CFNA 4LCWD 4ZH5A 3H8NA 5H35A 3JTTA 2DQJL 2Z31B 4NOFA 4G6JL 2ED8A 2NCMA 1FNEA 1AGDB 5CINH 5EOQL 1BLNB 2VRAA 1YEKH 3NIFE 5I76B 4Q9CA 4J6RL 4FOMA 2VZUA 2B5IC 2JJWA 1BZ9B 4OV5A 4Q97A 4E41A 3V6FA 3V52L 4A6YH 3GIZH 2GYSA 3UBXG 1JGVH 4GG6A 4ZSOA 3Q48A 1QYGL 2H6PA 1SMOA 5F7UA 4XPFL 4L4TA 4OKVB 4UOW1 4B53A 1RJLB 3NH7H 1EFXB 1NCAL 3L1OL 2BMKB 1D6VH 3AB0C 1H14A 1A7OL 1ZWIA 1MIEH 1JPGA 2W0FB 5L0QC 2JIXD 3WO3B 1NMBL 2DBLL 3MV7B 5TDPA 3TBSB 4P9MH 1BOGB 3M1BB 3WN5B 4IHOA 3P9LA 1T1XB 1UB6B 3VGDA 5CLTA 3WFCH 3ZSSA 4HC1A 4PJEA 2P5WE 4X5WA 1Z9MA 3KLSA 1WTGT 3I84A 1UKSA 2NW2B 5FK9B 4AEIH 3QI9B 4P2OC 1PY4A 5FO7A 1OW0C 1IAIM 5HI3C 4Y5XC 5HYJA 1HHJA 2XXMB 5BW7C 1KCUL 4RNRA 1IAMA 5L2JA 4NQEA 1I9JL 2PTTA 3P4MB 3RIFK 5J9PA 1OSPL 2AKRA 2LTQC 5F8RC 1E4KA 4XHJD 4NDMA 4HG4K 5C0CB 3P4NB 3F7PC 4PRNB 5A3ID 1MOEA 4JFEA 2EE9A 1HH9B 4V2CB 3VFPA 5E24E 1X44A 4F9PC 1F3DJ 1ZOXA 1SYSB 4XH2B 4MQ7B 4I0CC 2A74B 2HT3C 1HCFX 4QWWC 1EAJA 1MREH 4YO0B 3JTSB 4X6CF 3PWPA 1I8MA 1CL7I 4NQTA 2EIDA 2P5EA 3NN8B 2X4QB 2HKHH 2ZP0T 4K7FA 5KANI 1UCBH 2CXKA 2XTLA 1FL6B 4GAJH 5EPMB 4TNWK 3T0EA 4P5TD 3CPLA 2GIYA 1D7FA 4KHXH 5EZOH 5F7DB 2Q8AL 3C8KA 1XGRA 3G5VB 2NZ9D 3WIHA 5GJTL 4M5ZH 3UTTD 2Z4QA 3S96A 2VISB 2FJHA 5CCKL 1SBSH 4KH2A 3HAEB 1JZ5A 3HNVL 2VL4A 2ZOKB 4LFHG 5CIPH 2CMRH 1BQUA 3FAXA 3QUZD 3V0VB 4BYHA 3LEXB 1ZSDA 2CR3A 3G9VA 1W0VB 2YD2A 4PGJA 4QRRE 3BKMH 1JP5A 4ONGH 4YDIL 2VZ1A 4LCWB 2ZUQC 4IRJC 3ET9F 3UC0H 1AI1L 1VGKB 1ZT1B 2D7MA 3LAFA 3FN0H 4JN1L 4PG9B 3S37L 4OLUH 5DHVA 2XN9B 2CJUL 3WMSA 3QCVL 3WYRA 4K7PH 3PWVB 4JY5L 3SOBL 2C1OA 3BGMB 4APQC 1I75A 4L3CB 3X13B 1MHCA 5IMKB 5TE6L 4PJBE 1KFGA 3L5HA 1YJDL 5CILH 4NO5B 2DICA 3EOAB 1CGXA 4MA1B 2EE3A 3P30L 3T4AB 5C0BE 4IOFC 1VB9A 1AGCA 1KXVC 1VDGA 4TSBH 2BHZA 2WW8A 5AD0B 2VLRA 4HD9A 3GBNH 1GHFL 1RUML 4PP1D 4S1RH 5HYSG 1NSNL 2AV1A 2ZJSL 1YYLL 4O9HL 2YZ8A 3ALPA 3DGGA 4EI6B 4Q74A 5D1XD 1AHWC 2AK4E 4HDIB 1JK8A 1A0QL 4LCCC 5D6DA 2QSVA 2YSSA 3HR5B 2VE6A 4JPWL 4D3CH 4OD3H 3U46B 4ZO7A 5FKPA 3NIDF 1LE5B 1ZGLB 1X5ZA 2JB6A 2R9HD 1T7ZA 3QWRD 4TOYH 1G7PB 4QRSB 3DX9B 3FO9A 3P2TA 1BOYA 1AQKL 2BVQB 1UKTA 1FBIL 2AJVH 5DYOA 2G9HB 4PIRF 2AJYH 3KYMA 4IRZH 4YHPB 4BK5A 1RZFL 4QXUH 4ZFZB 4PJIF 2QQQA 4OFYD 5HI4D 4UMGA 4HLJA 2D31B 2PYFA 3WKIA 2ZUTA 4U1NB 1L7TH 4LCYA 4HIJB 4L9LA 4DQOL 4GXUM 1UM4H 2BVYA 4JVPA 5JW5B 1UWEL 2DM2A 5GRWA 1W72L 1U8MA 5CJXC 4XBEH 2YEZB 5AWNL 3O3EB 5B39A 3FONA 4WEBH 4J1UB 5D5MB 1GH7A 2Z8VC 5EO9A 3VW3L 2AXGB 1JL8A 5T1KB 5J57B 2QTEA 3KLHC 1AKJB 3BSZL 4P5TB 1Q0XL 2X4PB 3R06B 1UWXH 3SDDD 5GW7A 3EO0B 4ZNEE 1CQKA 4PFEA 1UZ6F 4K2UL 4Z7VF 1R24A 2ESVD 2HFGL 1XH3B 4U7MA 1BJMA 3U9PH 3MGOA 1DVFC 4DN3L 4E9LA 3P77B 4AK1A 4NQXA 2GKIA 4TUJA 3DHMA 2EADA 3BP5A 4XPBL 1T1YB 5GPRA 2C7UA 5AZEL 4PGCB 4NRYA 5F89B 1IC1A 2NMSA 2AS5M 4KRNA 3IGAB 3QUZB 4TRPH 4HJJH 5IM7B 1MFEL 2CUMA 2YA2A 1F2QA 4UT7L 3ZE0E 7FABL 2OSLB 3VXTA 2WP3T 4S1QL 4YX2H 1KJ3L 3N9GH 3KS0H 5F1NA 1MRFL 3VXNB 3FZUC 2BCKB 5DRZB 4HUWA 1P7KB 2DLGA 2I07B 1YEIL 5E6ID 4MA3B 1HHHA 4JY6A 4NFDA 4QTIL 5DJ6A 4LIQE 2DF3A 3EYQD 2J88H 5HDQH 4MJ2A 4X6CA 1U8HA 4R2GB 3KPNA 4CVZA 4YBLB 5KSAC 4J5TA 1RHHB 2VOTA 4G80A 3BH8B 3S88L 1KJ2L 2GUOA 5BO1H 5IQ7H 2ADGA 2PXYA 2X9YA 3KS0J 2JJTA 4LVNC 4PJ9B 2D0FA 1L0YA 5T33H 2HJFA 1U2HA 3UTSD 3GSWA 4HK3N 3VE0A 5LCVH 3ZKSD 4Z7OE 3TC9A 3KPLB 4PLJD 4IOIB 3DMMA 4RBPH 5F6HI 1BX2A 3CLEL 3HMXH 4MS8C 1F6AA 1BQHA 2AEQH 5DRWA 43C9A 1U8LA 4XGZB 1D6EA 4YGVA 3RGVA 4XP9L 5HYEA 3HUJE 2VXVH 4HG4J 5GZOD 3K2MC 4QO1A 5GGQL 5E95B 2Y7QB 3KVQA 3AXLB 6FABH 1UA6H 5EUKB 2PR4H 4UILL 4Y2DA 2MHAA 3PGDA 3PWNB 2NXYD 3WLWC 4XUVA 3SCMD 4M93C 1MQKH 4EJ1C 1B0RA 4PJDF 2FB4H 4G7YL 1B2WH 3U0PB 4NIKB 2VDQH 4GW5B 1R3LA 2ITCB 3PL6B 5T5NG 4L8SB 2W9LA 3T04D 1LO5A 4P3DB 3H9HB 2B4FA 3DX8B 1MF2L 1QRND 2EC9U 5KAQF 1MI5D 1C12A 5HHOE 2YC1A 2VERN 1ODAA 5TFSL 3RZCA 2VNCA 2IGFL 3BI9X 5KW9H 1FVEA 3MRJB 4XVTL 1FNSH 3BMWA 1CDUA 1CDGA 4KKLD 3ESVF 5D9SA 2Y5TB 4OZGE 1KB5L 5I9QC 1QSFA 5IB4A 3UAJD 2DL9A 2MJWA 5E70A 2A1WL 2ESVB 1GZQA 1NCWL 1H3UA 4OZ4B 2P8MB 4M1CC 1UACL 2G2RA 1I4FB 5I16B 3GKWL 1ZHNA 4TN9A 3H3BC 2SEBB 4KKCC 4TULH 3ES6B 5BZWA 1FZJB 4NFCA 3A0OA 1E4KC 3OB0H 5DMJB 1CXEA 2FD6H 3G5YA 1YEFH 4NWTL 4XC3H 3KYKH 2VLME 3QNZB 1ULVA 1NGZB 4MD5A 2R1YA 1BIHA 4X7EC 5J89A 5FHBL 4DODA 1S7XB 1LEKB 1MCOH 2DQDH 3EJJX 2F19L 4BJLA 4Q9RL 3O2WL 4M7KL 4OF5A 5E1AA 3TZVD 2HTLC 1XCTA 4ZOAA 2VXTH 1MCJA 4PJIA 5T3ZE 4PRAA 3L6FA 1GZPA 1JPSL 1ZA6B 3LQZB 1I8KA 1AGMA 2ARJQ 5C9JA 5H94A 5E6IB 1YMMB 4ZUTA 5HXMA 1LGVA 3WKGA 2VQ1A 5BRZE 4NZTL 3IFLH 3REWA 3VXMD 4XNZB 1ORSA 2YN3A 3LN4B 1HSBB 3T8XA 1RD6A 2W0PA 4LLAA 2EDWA 2DM4A 2IMNA 3BN9D 4JG1L 4ODHH 5JUEL 3L9RB 1AC0A 5JQHC 4G7VH 1OARL 5CZVH 5HHQA 2GZ6A 4HS6B 5LBSL 5FF6B 4RGMB 5FM5M 4Z7VA 3TF7C 2YOCA 4XWGL 3LH2L 3MRPB 5IESL 1PAMA 4PBXA 2D4FA 1OB1B 1GPOL 1Q9OB 4FQLL 1MCRA 1HK6A 3I6KB 5GGUA 1T0MB 4E0RB 1EZVY 4POZC 2DQHL