2VN7A

Glycoside hydrolase family 15 glucoamylase from hypocrea jecorina
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
599
structure length
599
Chain Sequence
SVDDFISTETPIALNNLLCNVGPDGCRAFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDRFTETYDAGLQRRIEQYITAQVTLQGLSNPSGSLADGSGLGEPKFELTLKPFTGNWGRPQRDGPALRAIALIGYSKWLINNNYQSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEEVNGSSFFTVANQHRALVEGATLAATLGQSGSAYSSVAPQVLCFLQRFWVSSGGYVDSNINTNEGRTGKDVNSVLTSIHTFDPNLGCDAGTFQPCSDKALSNLKVVVDSFRSIYGVNKGIPAGAAVAIGRYAEDVYYNGNPWYLATFAAAEQLYDAIYVWKKTGSITVTATSLAFFQELVPGVTAGTYSSSSSTFTNIINAVSTYADGFLSEAAKYVPADGSLAEQFDRNSGTPLSALHLTWSYASFLTATARRAGIVPPSWANSSASTIPSTCSGASVVGSYSRPTATSFPPSQTPKPGVPSGTPYTPLPCATPTSVAVTFHELVSTQFGQTVKVAGNAAALGNWSTSAAVALDAVNYADNHPLWIGTVNLEAGDVVEYKYINVGQDGSVTWESDPNHTYTVPAVACVTQVVKEDTWQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-Dimensional Structure of an Intact Glycoside Hydrolase Family 15 Glucoamylase from Hypocrea Jecorina.
pubmed doi rcsb
molecule keywords GLUCOAMYLASE
molecule tags Hydrolase
total genus 209
structure length 599
sequence length 599
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2008-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2vn7A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vn7A02
4JQVA 5I1DA 5IVOA 1UM4L 1J7VR 3VDCA 3U7YL 1IAKB 5CBEB 1MCOH 1QHPA 1T3FA 5HHQA 3BX7C 2AABL 1MNUH 3QUXB 4YGAB 1TQCB 4KPHL 2R2CA 1P4LA 1B4JH 2KPNA 5GHWL 2W9DL 4HLJA 3CCHB 3BIBX 1MFCH 3CMOH 3MNZB 4O02L 5I1AB 1J1PL 3LEVL 3LOWA 3O3BA 4HMDA 2Q76A 4LAQH 4Y5XB 5I76B 2Y7QA 5F72S 2GJJA 5C0CB 3QCVL 2HJLA 1PKOA 4U2ZA 5TDPA 1CICA 2XI9A 5J1TC 3F7YA 1CS6A 1ZAGA 2BERA 4FNLH 1QSFD 4CAGA 2ICCA 4OM1L 3RVVC 3PQYB 3MOAH 2X4PA 3FFDB 4OGYL 4ZFOA 1OAXL 1J0KA 1A9EA 1TPXC 1Z3GL 4M5ZH 3RVVD 1A22B 2FJHB 3SJVD 3UJIL 1Z5LB 2FH8A 1JL8A 1Y0LA 4X7DC 1V7MH 4LSVH 4WHYH 1S9VB 1KSCA 3L6FB 3KYKH 3I84A 5AD0B 3VXUE 2WIMA 4HEME 3TBSA 3CH8A 3FAXA 4FFZL 3WMSA 2CUMA 1E0OB 2I5YL 4ELME 1D5ZB 3HC3H 1N7MH 1G9NC 4DN4L 2FR4A 1YMHA 4LCCC 5BMFH 4GQ9H 3C5ZC 1MHHB 2W91A 5JXAL 2UYLB 1LD9B 4IIQA 4HCRA 4L8SB 2MFNA 4XNUL 4XVSL 3DROB 3RL2B 3THMH 3EO1B 1T6WA 3KXFD 1YEDB 2OYPA 1WWBX 3KJ4B 2R2BB 15C8L 1Q72L 1QQDB 4PJDB 4JFFE 4L3AA 3D39D 1BBDL 1DQTA 4LSRH 3QT3A 4KV5F 2ZUWA 3S4AA 4JE4B 3GUTA 1ZT4A 3V0WL 4JQIL 1JFQL 1NGZB 3F7QA 5JHDA 4N5EC 1DE4A 5J13C 4MJ6A 1W0YT 1Z0NA 4KKCC 2H45A 1H3UA 1OVZA 5HYJE 4N5ED 4Z78B 1FE8L 4PG2A 1T04A 4PLJC 3KJ6H 5KAQF 5HYSB 3DRTA 2ARJQ 1SJEB 2AXFB 4OCYL 4KKCD 3CVHL 1WIOA 4GRLB 5DHYB 3VXPA 5I8OH 2EABA 3FO9A 1F42A 1AGCA 5HHPB 2NY1B 3B9VA 1HQRB 5DD3H 1PGRB 3ARVA 2ADIB 4RFOH 4NWUH 4PLJD 4Z76B 4JDTH 1JYNA 1F5WA 3U6RA 4Z4JA 2XWBB 1FO0B 5EWIH 2DQGH 2CQTA 1JN6A 2ZG1A 4WWID 4ETYA 1CTOA 1TCRB 1OP3H 4ONFH 2FCBA 2Y06L 4JLRB 1RU9L 2AEPH 2AW2A 2IPTL 4XP1L 5IFAH 3JTTA 3ETBF 3ISWA 3WHE1 1U8IA 1SMOA 4MJ2A 4R7DB 2IAMB 1A4JA 1PFCA 4DKDC 4FG6C 4RBPH 2HFTA 2GSIA 3W2DH 4ZFOL 5EO0B 2BRQA 5DJDB 1KN2L 4HUMB 2XA3A 5K59E 2DJSA 4OZIA 1YUHA 1JPFB 4FG6D 1TQCC 3QNXA 3ECBB 3HZMA 4QHUA 1N0LA 5F7YC 4IMKC 3X13A 1AE6L 5IM7A 4PJEF 4Y5XC 4ORZC 3ULSA 4AT6B 4GMTH 4X5LA 4YFLI 1I4FA 4QRSA 2DLTA 5BS0E 3KYNA 4PBXA 2QQKL 5F7KC 5C0IA 2X1QA 2X1WL 1P9MC 3GIZH 4P48A 3I3BA 4PRHA 4PY7B 3MRNA 1FG2B 3VXDA 3N0PB 1K4CA 5C0FA 1JWUB 4JREC 4YHKH 2EIDA 4QRRA 4QGYA 5FYJD 3QXAA 2D9CA 2NY2D 1MIML 5DVLA 4XWOC 4L6XA 4Y19E 4DZBA 2IGFL 1XR9A 2XKNA 5C09D 3HKFA 5J1SC 1LDPL 3MCKA 4YQXL 5CUSH 1T0MA 4PG9B 4BKLA 1RIVL 4FFYH 1NEZB 5SWQB 4X80L 5ILTH 1MLBB 3AS2A 1NCAH 3TH3T 1T03L 1OB1A 1ZXQA 1B9ZA 2IADB 2Y36H 4PD4J 2UWEE 1T7VA 5TPWL 2MCPL 4OZHA 2CKBA 1VFUA 1MCIA 5EU6E 4L8SC 5SWZA 2QQLL 3QFJD 2YN5A 1JZ3A 4O2CA 5DQJA 3FRUA 2JCCA 1GYAA 1L7IL 4JFQA 2KQNA 5HI4C 4KTDH 3ZE0E 2FECI 4PV9A 4QXUL 1AKJB 3CFBB 4P23A 4Y4HA 5B4MD 5C08D 5DJ8B 4FZ8L 3TV3L 2DQFB 1HWGB 1F00I 4UNTA 4NZUH 4F80A 3OX8B 4GBXB 5HI4D 4HWUA 4PJ5A 2GY7B 3V6OA 4IDJH 2K7QA 5I17A 5CZVL 2YR3A 4ZS6D 1H3PH 1WEJH 1F8TL 3OG4B 3KPTA 1TNNA 2AXGA 2J4WH 1MPAH 3MRKA 2YPVL 1I1FB 2Z8WC 4S1RL 3FO0H 4PJGF 5ICYA 3E3QC 3O8XD 4GRLC 3QEQD 1DN0B 4AYPA 5CSZB 5JOFA 1BIIB 2QTEA 4TOYL 4F37F 2NY1C 4EI5B 3B83A 5F1SA 4BSWB 2PR4L 5B39A 1CFNB 4YDVB 3MRLB 1PKQB 3T0EC 5GIRB 3STLA 4M9OA 3H9SD 1KLFA 2PTTA 1BQLL 3S4DA 3O3EA 4PRBB 4P9HL 3B4NA 4Z0BH 4XXDA 3I85A 3P30L 2BP3A 1T6VN 2P5WB 2RJMA 4C4KT 1UKTA 1VFAB 2W65B 2B2XL 4KUZL 3G6JE 2NZIA 5AWNL 3O3UN 4CADB 3AY4A 3QDJE 3X17A 5DEFA 1NQBA 2IAMC 4U33A 4UDUB 5JPMA 3BWAA 5EUOB 4PUBL 1L0YA 3OKKB 3DRQB 4C56A 1KRFA 5H94A 3TO4B 4M1GH 3DARA 2FB4H 3HAEH 3T0VA 4UV4L 2IPUK 4Z7OF 1ZT7B 1FL6A 4LSUL 5GS2D 5IK3B 5KN5A 2GHWB 1G84A 1YMME 5E00A 4I8DA 3ACTA 4N90E 4XHQA 2H26B 3IXTA 3QUYA 4UIMA 2R4RH 2H32H 4XB7A 3DSFH 1A7PL 2YMXL 2F5BL 1YJDC 4ORGA 2Z4QA 5I1HH 1MRFH 4UILL 4JFHE 3VXRD 2NYYD 5ISZD 5ETUA 4APQC 4LIQL 1HH6A 2XN9B 4IRZL 1RURL 3FN0L 1JK8A 4P5TB 4U1JB 4XI5C 4PGCB 4X6CF 4PJFA 5B3NA 2K9UA 1IC1A 5HXMA 4JVWA 1XIWB 1CFTA 1HSBB 5JW4M 5DRWA 3A6BL 1JPSH 1ZA6B 1BJ8A 2EKSA 4ONHB 2WINA 4XBPA 3JBG7 3C2SA 2E7LA 2VWEE 4D9RD 1INEH 1GGBL 3O2DH 3EAKA 4JKMA 1FNEA 5DMYA 5I8KH 3GNML 2IBBA 1DBBL 3ARUA 4R0LA 5E8EA 1MH5A 5GZNC 5D2NE 4PJ8C 3INUH 2AJXL 1H8SA 2HTKD 3TGXA 3N1PC 1PX4A 3CFDA 4NNXA 2ARJA 1ITCA 5GZND 1MFAH 4XMPL 2DYPD 3I3DA 1IRAY 1OGTB 4XVJH 4G7VL 5KSUA 1WBYA 3KNBA 4MB3A 4Q0XH 4XNQB 1F45A 2ENYA 3D87B 4XBEH 5EUKA 1UB6A 3VFPA 3MUJA 4TYUA 1R5VB 1HHHA 1MCWW 1TZGH 4BSVA 1LO3L 1R3LB 3RX7A 3SKOA 4M7ZC 3KR3H 2ZUQC 2SEBA 4UIKL 5ANMA 2QNOA 3OTTA 2B5IC 4JPWL 3BP7B 1CZ8H 1ADQA 3WSQH 4TUJA 4ZMAT 1ONQA 1KB9K 2YXMA 2VLRD 5IOPA 4XCCL 3IJYA 3LD8B 3N85L 2ZZRA 2BSSA 5IF0A 4U2YA 4M4RA 2YZ8A 1T1ZB 3C6LC 3RX5A 3O2WL 4XP9H 2N1KA 4DGYH 1K6QH 4X6BB 1F6AA 4GBXC 1LWRA 2R0KH 3LPFA 5CIPH 1CBVH 4ZUUB 4HMEA 2N4IA 5J6GB 4KJPC 4KJWC 3AFJA 2Y23A 1WFOA 3C6LD 4GG6B 3RUGA 2IQAA 5FECA 4CNIB 4RNRB 3PV6B 1FNGA 1P7KB 5F7EL 1H9VA 4JRYB 4AEEA 3FT4A 3RTQC 4GLRH 4UUJB 3LRSB 4HUUB 2QSTA 4ODSH 1YECL 4WWKB 2M26A 3FQNA 3EKCA 3AM8A 1CGVA 1HXYA 1JUFB 3RTQD 1U8HA 4WO4D 1QSEA 2HVKA 2FL5A 3LEYH 4RAVB 4ODXA 2VXQH 5JIKA 4PJ5E 1YPZA 3V6OE 5SWSB 3B8YA 4K55A 1DBML 1KB5H 1ROWA 2R0WH 4NQXA 5FV1L 5TFSH 5B21A 1KELL 4PLKC 3RP1A 3VFWB 4V1DB 1E6OH 3TO4C 3E73A 1EFXB 4YDIH 4OFVA 3SKJL 3S96B 1OD7A 1S7TA 2P5EA 4PLKD 4JM2A 1H3TA 3LKNA 5C9KA 3ARDD 2HWZH 3NACL 1XGPA 4X4XA 3MLYH 2BVTA 4F7MB 1LP9E 5E8NA 2XZQL 3IDUA 1NAMH 3GSOA 4RQQA 4DAGH 4DK6A 1LO5A 2ADFH 1U3JA 2EYRB 1BQSA 2XZCH 2NW3A 2P8PA 5C0JB 3IF1A 1O5DT 3ZHDA 4P46A 5I0DA 3O9WD 4WTXA 4TTGA 1ZVSB 2IG2H 3K80A 1FPTH 5EBMB 1QBML 5IB5A 4OLXL 5AZEH 3FFCE 1KTLA 1U8KB 3WUXA 1H5BB 4P2OA 3VWJA 4ONGH 1XF4B 2ICWJ 3BYYA 1ADQL 3WCYA 5F9JB 3VD3A 1JRHL 4NRZB 3MR9B 5D1XA 1C1EL 4MD0A 1V3JA 1KJMA 5F3BB 3I6KB 1T5XA 1BAFL 1X5HA 3HUJF 4TXTA 1OAUH 2JK5B 4TULL 4G8FB 1LK3L 1JNNH 3OXRB 1SJVA 3FB8A 4JRXA 1A14H 4NM8H 3BPOC 5GGUB 4GXVH 1HEZB 3FO1B 3DVGB 1OD9A 4H8WL 43C9A 4F15C 3IKCB 3CX5J 3RVUD 1P4IH 3NPZB 1JZ6A 4PJFE 3LS5L 3Q5TA 1XGYL 4D9QE 1Q9WB 4FQJH 1I85C 1FN4A 4L4VE 2FX8H 4OCSH 5BV7H 3GBNH 4FP8H 5CZXD 3RIAK 4JKPL 2AK4A 2W0KA 3OAUL 3Q3GA 1S9XA 1B0RB 25C8L 1F3DH 3JXAA 1OCWL 3LKOA 2NY6C 3GMPA 5L0QB 4LSQH 2GJ6E 5C0AE 2Q3AA 4WUUE 2E27L 2BOCB 4F9PC 4NZDA 3WV0A 5K59F 3QG6A 1K8DB 4Y88A 4N0RA 4LLMB 1A6AB 1VSCA 2NY6D 5AG9A 2NY7H 4ODHH 3MMEA 4YHPA 1IZKA 4WHTA 2DKUA 3GKWH 5GRUH 3TT1H 4MLSA 3WJLC 4LEOA 4YPGB 3BQUD 2YKLH 3UYOD 3LZFL 1HHKB 2KL6A 2AAVA 2NNAA 1D5BB 1KSDA 5GJSL 4FQHB 1TIUA 3NIGE 3IXAA 5D6DC 3MACL 2IH3B 3DUUB 2RGKA 1V7XA 4D9LL 1KCSH 4U1KA 3W7XA 2R2HA 3OR6A 3O6FB 2HRPH 3EYQC 5E4EB 3IFNH 2ZNWA 4KK6D 2LU4A 4IOSD 1E4WH 4WTWA 1QR4A 5CHNA 1D5IL 2L7UA 2BK8A 1C12B 2BHYA 4Y16C 2OSLA 5EBGA 3MRCA 3ILPA 4KRPB 1AD0B 5DK0A 4U7KA 5CEYA 4NO3A 1KTRL 1KXQE 4YWGL 1MF2H 2Z35B 4NQED 2E9JA 4M43H 4NWTL 2KUTA 2UZIH 4ODTL 5EA0H 1NSNL 1PEZA 1P6FA 4Y16D 5I1GL 1NANH 2OJZL 1CTNA 1D5MA 2IAND 3VFMB 5J1AB 4MCZB 5H2BA 3EGSB 2PXYC 1YEGH 2EDDA 3MXWH 2UWEF 4MD4B 1KTDB 5IHZA 2B0SL 3QDHA 4FZEL 1IGML 4G80A 1FHGA 4OT1L 3D3VE 3VFSB 1FL5A 5GRVL 2PXYD 5EB9A 2FIKA 3G5XA 3PL6D 4DZ8B 4J2XA 1A7QH 3G6AA 1KC5H 4HKJB 4XB8A 1MFEH 2YSSB 2ZUTA 2VL5A 2VLJB 4X9BA 2J2ZA 4UU9B 1CG9B 3QHFH 4FQ2H 4O51A 2X70B 3U0TA 4E0RA 1GOGA 4U1NA 4YBLB 1H5BC 5IW6B 3RY5A 3TVMA 2VTFA 4U1MA 5J57B 3U9UA 4D0CB 5J6HB 2FEEI 2EH8H 1ACYL 3VW3H 4R97C 4F2MA 1WU6A 1S5IL 3GJEA 3O4OC 4POZC 2WBJC 4L29B 5K9QG 3W0WE 3KPLB 3R1GH 4WI4A 2CDGA 4DKFH 1DDHB 2R4SH 3QZWB 1LO0L 4S2SA 1ZHKB 5LWYH 1RULH 4W4OA 3TNMB 4WEBL 1DVFD 4LCYB 4PGDA 1QYGH 1A1MB 5E99L 4UQ2B 4FN0A 2WBJD 1HHIB 3DXAE 3FQTA 3K2MC 5TGBA 3MRGA 1MCCA 4J6RH 1PLGL 1HYSD 4F7CA 1S7SA 4KDTC 4PRAA 3SDXE 5K9KB 3CIQA 4K3HA 1NLDH 1T21B 3HG1B 2ZP0T 4R4NC 3AXLB 4PR5A 4YHZH 4DVRL 4YHYC 3TYFA 3BGFB 3P4NB 3ZKXB 1S78C 1X3DA 3L1OL 4NSKA 3VH8G 4MMZC 1T5WB 2BNRA 2CSPA 4U1IB 1A1NB 1QBAA 3PIQB 3LV3A 1L9MA 1MI5D 3WFDL 5CJ5A 1GZQA 4MQ7A 1IAMA 1JPGB 5DT1L 5KZCB 4G6FB 1ZGLB 1S78D 4C59B 2AHGA 4X6EB 5F1IB 3P0VL 4HHAA 5AUMB 1TETL 4LHUD 4HC1H 2EDBA 2GKIA 5TDNB 3MGAA 2VDLH 2I24N 2ZSWA 1CGUA 1NCBL 4PGZA 1A7RH 3OR7B 3DX6B 3VXSE 1PW3A 2I07B 4GH7B 3NCFB 5JA9A 4LARH 4G5ZL 2PYED 4N0CD 1CDIA 5LBSH 2RHEA 4UT9L 3TBYB 2BFVL 1KJ2B 3UTSD 5KVGL 4IOFC 1X6LA 4TNVF 5CJOH 4P5KA 2J88L 3UTQA 2CLVA 4MAUH 5CILL 1A1OB 1SBSL 2Z93B 3HE7A 1IQDA 4LHUG 4M48H 4KI1A 5DUBB 1EA9C 5FUCC 3RWFB 1U8NB 2W0PA 3LIZH 2YC1B 4IOFD 1OPGH 3IDJB 1BFVH 1MJ7H 3EIFA 3O6FC 3C60B 4CMHB 3FN3A 5DJ0A 5CCKH 1SBBA 5HVFB 4NN7B 3M1BB 1J8KA 4LDOB 1P53A 4WVAA 1QLEH 5F89A 4XAKE 4KRPC 4PTTB 4QTHB 3ZKSD 5JW4Q 2LVEA 1S8DA 4P4KA 5C6TL 4MCYA 4S1SL 1MQKH 1QLFA 1SEBA 3GSNA 1DBAH 3GHEH 3X11A 5H37H 3ULVF 3W7UA 4OZ4B 1CDGA 1N4XL 5I19H 2K3TA 3RA7L 2A1WH 3U4EA 2UUDH 5E4IA 2HAZA 5K9JH 5D2LF 5DJYB 3A6OA 3E6FA 3MJ7A 4PJCA 1EERB 1JGLL 3K3QA 4UAOC 5C0BB 1UWXK 4EVNA 2VERN 3FQWB 2VH5L 1IC7L 4NBYB 3WUWG 3BN3B 3QWOB 2GQHA 4OLZH 1OAKH 3V0VB 4HKXB 5IW1A 4JFED 2HYMA 4P9ML 1ND0A 2X44D 4YBLC 4I0PA 1AGDA 4TSCL 2VLKB 3KPRA 1OSPL 3X3GH 1BFSA 1KBGL 2Q1EA 4CMMB 4H0GA 3HPJB 5CLTA 5FGBA 4X4YB 3EOAB 4H5SA 4LQFL 4NNYA 4BH8B 2FZ3A 3WIHA 3I9GL 2ZG2A 1PG7L 3W7WA 5JHLL 3BN9C 1FDLL 1I8MB 1NBZB 7FABL 4MGXA 3VMOA 5T3ZL 2JTDA 3QFYA 5KW9H 2JF4A 2EH7L 4MXWL 2G9HA 4K3DH 5CZLA 4KZDH 1RJLA 1NAKH 1DFBH 3BN9D 1E28A 5B38A 3RZCA 1U8QA 1G0DA 5GRWA 4GRWE 3SE3C 3ZKXC 3RNKA 1RVFH 1VHPA 1R24A 4M1DL 1S7RB 4LRNH 4NO0A 4MJIB 4PRDA 5T3XE 4OB5H 4GW4B 4HFUH 4TSAL 3BPNB 4HWBA 1YYLH 1E27B 3QNYA 4JHZA 4Y7MA 3LVEA 1UGNA 4QRPB 4WUKL 1BD2D 5DYOB 2FV0A 1PQZA 3PHOA 4AK1A 2HJFA 2OP4H 2Y25A 1RUAH 5DD6A 5B3JF 4UTBL 3CVIL 4BZ2L 4DWHA 1H0DA 1K2DA 3D48R 1NGWA 3QXDA 4FFWC 4NZRL 3OZ9H 2CQSA 1EZVY 2Z8RA 5EU3B 3GSNL 3MRRB 3MZTA 2YPLE 1EVUA 5GRVK 1RZFL 3DI2B 1JWMA 2V2XB 3U2SA 5D1ZB 1SYVB 1NUGA 1VGKA 2HMIC 1NGQL 3U0WL 4MHHG 2D31A 2BHUA 3L5WB 1BQHB 2GI7A 4MA7L 5EO1B 1N5YL 2ZJSL 3C60C 1QSFA 3O4LA 5C0DB 1FFOB 2QV2A 5C71A 2HMID 5F21B 3JWDC 4NN7C 1FBOA 5HGAA 4URTB 4AEHH 5D7KE 3DOSA 5IHUL 2GTZB 4PS4L 3MLTB 4MWFB 3BH9B 2ITCB 5CP7A 4GG8B 3PWPA 2CKNA 4ODWB 1P7QB 2J8UA 5K9OA 2W60B 4FXGB 5FDWA 1WBZA 4AIZB 4RWYL 4HBCH 1RK1B 1MWAB 4PRID 2X4QA 4XCNA 1HILA 3AVEA 4R7NB 1JF1A 1IEHA 2VAAB 5FYKL 1HKLL 1G7MB 2FGZA 4NNPL 2NXYB 1A3LL 4U3XA 3WIHL 3O2VL 3PHQA 3QDGB 5D71L 4HX1A 3TBWB 4ENEC 2A9NH 1HSAA 3QO0B 4Y1AD 1CFQB 5FIEA 4Z7VF 4WU0A 3FZUC 3MLSL 1GPOL 3WLBB 1Q9OA 2AEQL 3T04D 3CX2A 1IKFL 1IARB 4LCCA 1UZ6E 4OLEA 4M5YH 1NC5A 4R9HA 2X4UB 5J3HC 3C5ZA 4ELKB 2Q86A 1V05A 4J8RA 1DLFH 5E9DA 2VUYA 2AJZB 2FJGA 3GRWH 3OKMB 2IEPA 2VZ3A 4NQSA 1KIRA 4YIQA 1MAML 4Y4KC 6FABH 4YAQB 4L4TA 5DRXA 5DS8B 3NN8B 4PJAA 3ESVF 4HWBL 4OV5B 3QUMA 4I5BA 4PB9H 4Y4FA 3VFNB 4NBZB 4Y4KD 3CU1A 3BKCH 5C07D 1FFNA 4X6FB 1UM5H 3ZKMC 1IGYB 4L8DA 1I8IA 1MCPL 5GISH 3FCTB 4ZOCA 2E3VA 2VKWA 2R1XA 2CXGA 5CEZD 4CW1A 3GMOA 3NIFE 2OK0L 2JELL 5D9SA 4RA0C 2P7TB 4UNVA 3O3DA 1C8PA 4X7TA 3B2VH 3ZKMD 1GC1L 1IILE 1BFOB 2HLAB 4P2YA 5DMIL 2A74B 4OCNC 4YHOL 4XBGA 4ALAL 3B8SA 4Y5YC 5A16A 5C6PB 3IFOA 1INDL 1FIEA 4OLYH 5DJCA 3BPNC 4TUKH 5F1OB 2WANA 3WE6B 2E9BA 3QQ9C 2D7PA 3SCMB 3UTZB 4YDJB 3V0AC 3UO1H 3UPRB 4LCWD 3GGWB 2OL3H 3OAYH 4PRNB 4H1LA 5C0GB 2P0VA 1FFPA 1BEYH 5FYLE 1FSKC 1YEJH 2PETA 1PSKH 3QQ9D 1OHQA 1KLUA 2PUQT 2VDMH 3MPCA 5EC2B 3HMXH 5FO9A 3KDMA 1XF3B 3GHBL 1Z9LA 1WU4A 5SV3A 5DC0A 1NBQA 3DBXB 3UDWC 1GAIA 4OFPA 1QRKA 1IEBB 5D1ZC 5KVFL 4U1SA 2HT4D 4UBDC 2VN4A 3QUXA 1G7QB 4QTIH 1G7JB 4P99A 4I1NB 5J0BA 1N2RB 4WI3A 4WVBA 1TTFA 3L5XH 3UTTB 1DUYB 3FHAA 4UBDD 4Y5XA 1M71B 1GA2A 5I76A 1QPPA 3HR6A 3GI8H 2AKRB 1UACH 4AM0A 3MQIA 5MENE 1OSZB 1G9NL 2XY1A 5IFHH 1P9MA 1FVCB 4K94H 3BKML 4XP4L 2IF7A 3PQYA 1C5DB 5F9OL 4K23L 3FFDA 1CEMA 1DQDH 1M6OB 4HXAL 5DWUH 4D0BA 1BVLB 3K4ZA 1P2CB 1ZLUK 5FKAB 1Z5LA 3OKYA 5C0RL 3HMWH 5E1AB 5KTEH 4JGMA 3RI5F 5BO1H 3GSWB 2BY1A 4AYQA 2X4TB 5I1KL 5ALCL 3L6FA 5TE4H 5FM5M 5AD0A 5T1KB 4W68A 1R0AL 4GRWH 4PJ7B 1F3DJ 3TNNA 1D5ZA 3A3VA 3G6DL 1J8HD 5C7XL 1ERNA 3BE1H 3FL7A 3S4SB 4ZH5A 3MOQA 5IV2B 3WL9B 1CQKA 2UYLA 3GZKA 4JG0H 1EEUA 4L8SA 5T3XH 3DROA 3DTXB 4K8RD 1OP5K 3RL2A 3SJVE 2PYFA 3EO1A 4K8RL 1YEDA 3RL1A 1I1RA 2R2BA 4J3OC 1QQDA 1P7HL 3QIWD 5C0ND 2F54B 2VDQH 1JGUL 1DANT 2D8LA 5FUOH 4WCYL 3VDBA 4GRMA 2ZZUT 1HH9B 2AJUL 1GGCH 3IETA 1U6AL 1E4XL 1Q0XH 3C8KB 4WGWB 5F1NA 4FXLA 2DRUA 3EO9H 3PP3H 5KS9A 2DMBA 1NGPL 3CFIC 4P2QB 3IDMB 3IDXH 4Z78A 1F3JB 4IRSC 3KXFE 3TA3C 3K74B 1OQXA 5HYSA 3AROA 2AXFA 3MBEB 3N9GL 1F3RB 3JV5A 1IT9L 3WEXB 4GRLA 5DHYA 3D39E 3QUKB 5HHPA 4HKBB 3SDDD 5HYFA 4Z77B 2ADIA 1WFTA 4IRSD 3DJ9A 4Z76A 4C55A 3TA3D 2VDRL 4LSTL 4I4WA 4OAWB 3T0EA 2XWBA 1FO0A 4N1HB 4NP4L 4GS7C 5F9AC 4DFHA 4RWHA 3ZE1F 3VW5A 1PD6A 2B8OT 2BVPA 3W39B 5L8KB 5C0CD 1TCRA 4AG4H 3QNZB 1N8ZB 4JLRA 5FUZL 3TWCH 4M8VA 1HCFX 5BJTB 1IAIM 1MEXL 4R7DA 5F9WB 2IAMA 1UENA 2ESVA 5FGCB 1WQVT 2W0FA 1RAMA 2BSRB 4FQXC 4TSBH 4ZD3L 1I3RB 4XC1L 2EZ0C 3T77B 4XPHH 5DJDA 3K8LA 3LEXB 5DDHB 1SJXA 3RSYA 1MJJB 4NM4H 5F88B 4XVUD 3NIDF 2A6JA 3MJ9H 4E41B 3IAQA 1PVHA 2H6PA 4X7CC 3PGCB 1YEEH 4XPGL 5E6IC 2ZUYA 4KHTH 5H35B 4AT6A 3BRDA 4JANA 4X9HA 4GLRI 4QXTB 4APQA 3TT3H 1PBYA 5CWSB 5ID0B 1FG2A 2W38A 5E6ID 2G75B 4UT6H 3QWRD 1Q9LB 1JWUA 1N64L 1KGCD 3TBTB 4C4KO 4A2LA 4LP4A 4YBHA 1OGAB 4DN3L 3MV01 5IVXA 3AREB 4Q74A 2UY6A 4PJ8A 3CAFA 4JY5H 4NQCB 2DQHL 1KNOB 3MGOB 4YHML 3RGVD 2E9IA 4JO3L 2WWKT 1N0XH 2FWOB 3E6HB 3MV8D 4W6XB 2AJSL 4PG9A 1QG3A 3UTPE 1NEZA 2NTFA 5SWQA 1I3VA 4XHJC 1N3NA 1MLBA 3G5VA 2FJFB 2M8XA 5E08H 1CF8L 2IADA 3E2HC 2C4FU 4N0FB 5C3LD 4BZ1H 3MRQB 3BISA 4YUEH 1C5CH 2VLRA 5FYJE 2VXTH 2E6QA 2QR0B 3TZVB 5TQ2H 3I6LD 1A6ZB 5EOCJ 2OXGA 3GBMH 2J6EH 5FA4A 1IAOB 2BCKB 3MLUH 4MA8L 4YXKL 5C09E 1AKJA 3QI9D 3CFBA 3T0DA 1FO0L 4MA3A 4U1HB 5HI5D 4K9EH 1KPVB 3NGBC 3CDGB 5FYLH 3QT2A 1J87A 3OX8A 4GBXA 4XCFH 4NT6B 2C4FT 3CLFL 1NCUA 2OTWB 4QHKJ 1TDQA 1M7IB 3CLEL 5E8OB 1CVSC 4GKZB 1HHJB 3BWUC 5FB8A 2WSKA 4OD3L 5ITBL 3QFJE 4TVPD 3IFLH 3DSNA 4XX1G 1I1FA 3U7AA 3P11H 3MBEC 4G7YL 3CXDL 1UZ8B 3KGRA 1A3RH 1DN0A 3RTQA 5CSZA 1BIIA 1BZQK 4LASL 2I26N 5A2IH 1M7XA 5IEHA 5F97E 4QNPE 5C08E 3L5HA 4HG4K 3BO8B 2F58H 1CFNA 3HAEB 4YDVA 3MRLA 3TFKC 1PKQA 4G9FA 2EYSB 5GIRA 1H13A 5GS0C 2E8ZA 3VXUB 1NCCH 4PRBA 5D7JC 1YJDL 2K1MA 4YHNB 3RWEB 2N7AA 4TRPH 1UM4H 1C08B 4ELMB 3U7YH 2P5WA 4ZNCD 2H32B 1AFVL 1AY1H 4JRWA 1QA9B 2AABH 4XZUA 1NDMB 1YQVL 4BFBD 5GS0D 4CADA 1QSZA 5HI3C 3QBTB 5F9WC 3G5YB 4UDUA 3QEQE 4YHLL 5EUOA 1NGYB 2W9DH 4CN6A 1K85A 1FAIH 1EH9A 2DIBA 3OKKA 3DRQA 3LKPA 3UTOA 3TO4A 3LEVH 2PTVA 2C7UB 4LKCA 3BVNA 1XZ0B 4X9FA 2WUBH 3LY6A 4RDQF 4DK3A 4JFFB 3S37L 5IK3A 3H9SE 1D9KD 4LLYA 2XKUA 1RUPL 2DL9A 3HI6H 2H26A 3I50H 1RUML 3CFCL 4JJHA 4OGYH 4PBVC 1FAKT 2H9GB 5J12B 4OQTA 5KSVB 3S5LG 3LDBB 5D70H 2XN9A 4NN5B 1TNMA 4Y2DD 5I66B 1JZ7A 4U1JA 5HYJB 2VE6B 3KLHD 2HFEA 1NLBL 4LVEA 3VRLE 4XVTH 1EO8L 1T2QH 2EXYC 5GJTH 1ZA6A 4ONHA 3D0LB 2Y72A 5A2KH 3EYOB 3A0OA 3V4VH 2I5YH 5FM5O 4Z7NF 5FF6A 2CQVA 4E9LA 4EQ2A 4DN4H 5HYQB 2QKIB 5GGRY 4HUKB 2P8LB 3NIFF 2R0ZH 4W81A 3ON6A 4K07A 3VXRE 5L2KD 5ISZE 5IR1B 2LU3A 1E6JL 4XNUH 4XVSH 4P2RD 2RBLA 4I77L 15C8H 2P24A 5D72L 4ZPTB 1HI6B 4Z7WE 1OGTA 1NANI 3ZKNC 4D9RE 4I18C 4PJBF 3CPLB 4JQIH 1R5VA 1ORSA 3EUUA 1X5LA 4OFDA 4KQ4L 1DQLL 3N1FC 3TZVC 1I85A 4HJGA 3U0PB 5IJKC 1CE6B 1X5JA 2XKSA 4WHDA 4G8IB 1N26A 1OT2A 3RVWD 3RWDB 4OJFL 2FO4B 3LH2L 4PJHF 1ZOXA 1I9IL 4JZOB 4X6BA 2IPKA 1T66D 3CVHH 3JTSB 2GY5A 1X7QA 2D2OA 5EOQL 3O6LH 4HK3N 1EJOL 1QFWM 5DD1H 4ZUUA 4F9PA 2V2WB 5J6GA 1UEYA 2ATKB 4I9WD 4GG6A 4CNIA 4RNRA 4MD5A 5BQ7A 2QLVB 3PV6A 3VG9B 3NCJH 5I1JL 3GDBA 3IGAB 3OJDB 1HE7A 4NKIL 4JRYA 3EJYD 3U83A 1JNLL 2EDRA 4LSSL 3V7AG 3WJLA 2JJTC 5I1DB 2VLRE 4UUJA 5FO8B 3GSXB 2Y06H 4HUUA 4YDKL 2DM4A 4MB4A 4XP1H 4WWKA 5F44A 5HHQB 5J11B 2PN5A 4QF1B 4Y19B 4X8XA 3I3EA 5I2IA 5D6DA 1Q8MA 2BDNL 2WP3T 1JUFA 3MRBB 5IMOB 4WFGD 5J4MA 2M2DA 4NZJA 2VZSA 2A77L 3LMJL 4OQTL 4OCXH 5HHOD 3O3BB 3ZTNH 2FUZA 4P5TD 1UWEH 4NQEA 2UWEB 2HJLB 2OR8A 1XIWD 5SWSA 3WXVH 4ZFGH 4P59H 1NAMB 3QEHB 4JM4L 4WI6A 1CICB 1BECA 2DQUH 4Y16A 4LPUA 5EU6B 1IC4L 4V1DA 3ULUD 1AE6H 3H9YA 3ULUL 5HGBB 3JWNC 2O5XH 5INCB 5FAAA 1A9EB 1MCKA 3S96A 4M3JA 3ZTJG 3JWOL 2XZZA 4R90L 4IS6B 4CGTA 2PXYA 4HIJA 1QRNE 2FX9L 1Y0LB 4WI5A 2XNAA 4CDGC 5F7DB 4W6YB 3MZGB 2P46B 5J12C 1JS4A 3G9AB 3E8UH 3ZT5A 3VI3F 1ZT1B 3LDBC 3MLRL 5T1MA 3HI5L 4KVCH 3NCMA 1LF6A 4LLQB 4M62L 5FYJH 4WW2B 5C0JA 4LRIA 1ZVSA 3MSPA 5EBMA 1EIBA 1U8KA 4M7LT 1F90L 3M07A 3N1GC 1VPOL 1H5BA 2VC2L 5JW5B 4P0DA 2Q8BL 2VZOA 4IIQB 5SX5K 3P9LA 1XF4A 4JDVA 4LPYA 5BZWA 1C16B 1UYWL 1XR8B 4JPKH 5FHBH 5IBUB 1IQWL 2DBLL 2R2EB 3MR9A 3ACSA 5DXWA 2V5YA 2ZCLL 3S3SA 3W11C 5L2JA 1RZ7L 3L3KA 5F3BA 5DUPL 3SOBL 3IS0X 4PJIE 4HIHB 1QBLL 2JK5A 3UC0L 4Q9QH 3LN9A 3SDAD 1L7IH 3G6JB 1SEQH 2EXWC 4NCDA 1PZ5B 5L8LB 3DMMC 3OXSB 4MJ6B 1HEZA 3QDJB 2C1OA 2VITB 3DVGA 3FO1A 1KLGB 1EEZA 1S5HA 3IKCA 2EIBA 4GSDL 4KDTA 2XFGA 3WIIH 4NGHH 4R2GD 1T04B 1VADB 2EXWD 1Q9WA 4OM0H 5DMJB 2RR3A 2DQCL 3FO9B 1AGCB 2AGJL 4WJ5A 4XNXH 3BMVA 4ZS7H 1CFSB 1F8TH 1YMMB 1S7UB 4NQDD 1EMTL 3G04B 4OFYA 5F6IC 5E8DH 1IGCL 3C5SB 2DQIL 1B0RA 2Z8SA 3MRDB 5F8RC 3BXNA 2R29L 1FBWA 3PWUA 4X8JB 2FSEB 3EZJB 1GGYA 3QDMD 3NA9L 3QXVA 2BOCA 3O6KH 5DSCA 2PR4H 1G7HB 4HV8B 4LLMA 1A6AA 1EJ6A 4YLQT 3P40A 2Q7YB 4JFOB 2ZUUA 3VG9C 1JBJA 1BQLH 2DQTH 1U8IB 3T4AA 2FECL 2JIXB 1WWCA 1YEHL 2VOTA 4DEPB 1DEDA 3MRPB 2GSIB 5F1KC 4M03A 5DHVH 4YPGA 4BYHA 5F7UA 1HHKA 5D2NB 5J11C 1YN6B 3UJTL 4QYOB 5I30H 4OZIB 1IGTB 2IH3A 4O9HH 2EC8A 3HZMB 4QHUB 5IT2L 2XWTB 4XT1C 3PV7A 1IM9B 5FA3B 5IKCA 3O6FA 5IM7B 1VDGA 1MAKA 3N50A 4UV4H 5LAXB 4GAYB 3BPCA 2EO1A 4P3CL 4KKBD 1I4FB 4QRSB 2I60H 2A9ML 1C12A 3O6MH 3OV6A 3KPMB 1AD0A 3MRNB 5KG9B 5FXCH 4ZOEA 4GAFB 1A7PH 2BNQD 3FQRB 2CDEA 2BVOA 5KVDL 1NBVH 2Z35A 1TVBB 2WQ8A 1GJIA 3STZA 5JORB 1V3LA 1RURH 3DECA 4R96B 5J1AA 2CO7B 1CU4H 2A83B 4MCZA 3EGSA 3QXAB 3NH7L 2EICA 2CK0H 1KTDA 3A6BH 2UZXB 4FTVD 2MKLC 35C8L 1P84J 1OM3H 1OAYL 1O7VA 4FQQB 2NY0B 3VFSA 1MFBL 5FHAL 3MCKB 1T0MB 5J06A 4FQ1H 3V6BR 4WW2C 4XH2B 2BOBB 5DA0B 1Q1JL 2YSSA 2DI9A 3LB6D 5J8OA 1A7NL 2VLJA 1WIPA 4UU9A 3BKYL 1CG9A 4KJQC 2X70A 1UEMA 1TVDA 4OZGE 4U4BA 1RI8A 1KCLA 2CKBB 5IW6A 2IQ9L 5IWLC 5D96B 2IANE 3MOBH 3SDCD 3SPVB 4H25B 5DEZA 4D0CA 4FQPA 5J6HA 1TJHH 2YS4A 5HHNB 3QG7H 4FXKB 1LEKA 2CD0A 2NY5C 3KLAB 3JV6A 4L29A 5BV7C 4X9GA 3KPLA 4AMKH 1IFHL 5KOMC 2C3VB 3SKMB 4UIKH 1DDHA 3QZWA 1ZHKA 3CSYB 2VLMD 4JPWH 4K3EL 2DTML 1C5BL 4LCYA 1YEKL 4HH8A 1A1MA 4PJ5B 4UQ2A 2BXYA 2HKHL 5I17B 1HHIA 4GAJH 4JFPB 4XCCH 4JO4H 5BCAA 1KT2A 3EBAA 1T21A 3IU4L 2P47B 3AXLA 4GW1B 3QIBB 1A6UL 3P4NA 2EE2A 4NRXB 1T5WA 5IMMB 1WAAA 1OY3B 4U1IA 1A1NA 2R23B 3PIQA 1MCJA 1DUZB 5ICZB 1JPGA 2PO6D 1LP9B 1ZGLA 4G6KL 4HGWB 4X6EA 5F1IA 5AUMA 4XWGH 4NFBA 1KFAL 1Z0MA 3W82A 4LCIL 4IRJC 1UVQB 3F12B 1YECH 4GFTB 5TDNA 5M95B 3D9AH 3FFCB 2NZ9C 1NCWH 2DD8L 3OR7A 3DX6A 1T7ZA 5JUEL 2I07A 4XGZB 2F53D 3RIFK 1FNSH 4N1CA 5DD0H 4DEPC 4IRJD 4XAWL 2E7BA 3RIAF 1D6VH 1KJ2A 3BEWB 2NZ9D 1FNFA 2PKDA 5D2NC 4NCC2 5ACZB 1MI5E 5B22A 1A1OA 2Z93A 2XTLA 5DUBA 2OS7A 4MXVE 5HPOA 1LF9A 5JO5B 3RWFA 5KN5B 3VRLF 2YC1A 1X44A 4J4PD 1NC2D 4JO2H 3IDJA 3S35H 2XICA 4OIBA 2DLGA 4K7PL 3C60A 3ELAT 4JQXC 5E2TH 1CXKA 3SE4C 2NY4B 3GB7B 2XA8L 2BY3A 1U3HC 3M1BA 1F4XL 3TYGL 1YN7B 2PYEE 3P9WB 2XZAL 4MNGE 4PTTA 4QTHA 4PJFB 3ULVD 5L9DH 1KREA 3UTSE 4OUUB 2VB5A 2GFBA 2WINB 3GSUB 1U3HD 4L4VB 4NUJB 4MYWB 1I9EA 2NLJB 4OZHF 3D18B 3NAAL 4Z7WF 2ZKHH 4R0LB 1FH5H 3EW3B 1QBMH 4NFDA 2APXA 2C3HA 1G6IA 5DJYA 2DWEA 2JCCF 4GT7A 3X3FL 3OGOE 4LPTA 1WJ3A 4GJTB 2NY0C 3ZDZF 2GJ6B 3UCRA 3CFDB 5MP6H 4NNXB 1K3ZA 4WUUB 2AJVL 3S88H 2ARJB 3FQWA 2NR6C 2QBWA 1ZA3B 4HD9A 2OZ4L 3KG5A 3QWOA 3TESA 3VGEA 4OSUL 1I1AD 2ED9A 4HKXA 3V0VA 3RBSA 4J7RA 5D7SL 5DMGC 5KSUB 3O11A 4X4ZA 3U36B 3HG1D 4AYFA 2F6DA 3GI9H 2DQEH 1UB6B 3D6GA 2VLKA 4Y8DC 1BAFH 4Q9RL 4BSJA 3SKOB 4LKXB 2SEBB 4ZTPL 4BQ6A 1CLZL 1VFBB 1AJ7H 3HPJA 4I3SH 5DURB 4X4YA 3B2UD 3HNSL 4Y4KA 5I1IL 1ZLVK 1T1XB 2BSSB 1F4WL 1UA6H 1J1OH 1WFUA 1I8MA 1F6AB 1NBZA 4JFEE 3SKUD 1VEPA 2FHFA 2H1PL 1AR1C 1KCUL 4CDHA 1WLHA 4TQEL 4XCYB 5JQHC 5BVPL 4G43A 2VZTA 25C8H 2DM2A 3ARFB 4HLZG 4F3FA 3EOBA 1KJ2L 2YD2A 2KKQA 4KGLA 2E27H 1IJ9A 3CDFA 2EEAA 3QPFA 1GHFL 3T1WA 4Y5YA 1IEAB 4MJIA 1OTUC 1U2HA 3S35X 2BNUB 3FQNB 3BDXA 3ZDYE 4GW4A 3BD4A 1HXYB 2FX7H 3D3VB 4GXUN 5I6XC 4QRPA 4HAFA 2YN3A 5C6WH 4Z5RB 4ESKA 3JWDL 4ZFZB 4QOKD 1J10A 5A3ID 5SX4H 1UG9A 3QEGL 4UV7H 4NQXB 1J0YA 3TN0C 4AEIH 2H2SC 3VD7A 1AD9A 1H8OA 2CJUH 3MRRA 3QCTL 1MFDL 2GAZB 5HHVL 2V2XA 3J8F7 2FD6L 5D1ZA 5CS7A 3TN0D 1SYVA 3QISA 3LKNB 2H2SD 2P42B 3W0WB 4HXBH 3ZE2F 1BD2E 1RMFL 3EDFA 3L5WA 4X4XB 2J12B 3NFSL 3VDAA 2Z31C 4YWGH 1JWSA 3MRJB 3WNPA 5EO1A 4ODTH 4QRQB 4M6ML 5D8JL 5C0DA 1FFOA 2NY4C 3GSOB 5I1GH 2HFGL 2OJZH 4D0DA 1TJIL 3DXAB 5HHMD 2X7LB 2EE6A 2NW3B 2Z31D 3SDXB 1SY6L 3MLTA 4MWFA 3BH9A 1CFVH 2ITCA 2X05A 4GG8A 4ODWA 1P7QA 2W60A 4FXGA 3RWCB 2FHBA 4AIZA 4P2OB 1LGVA 3IAPA 1RK1A 1DBJH 1E4KA 2JJSC 3BP6A 4KAQH 3BIKA 3DLQR 4L8BB 3WKHA 4ZO7A 3QHZL 4R7NA 3WJJA 1KCVH 2DRSA 3MBXH 2VAAA 5KJRL 4YO0B 1G7MA 3ES6A 3ZSTA 1M05B 1AXTL 5E2WH 2R8SH 4M7JH 3QXQA 2VLLA 1U8OB 5D1XB 3P0GB 3QDGA 1CQYA 3WFHB 1BHGA 2HVJB 1T5XB 3I2CL 4OLWL 4WGVB 3ARBD 4HS8L 4ZNEA 3VWKB 1ACYH 4WVCA 3ESUF 3CFJB 1NFDE 2O5YL 2Z8VC 2MWCA 43C9B 3P77B 4Z95L 3RDTD 4BFEA 2X4UA 3SE8L 4F57L 4OD1L 4PRIE 1FYTA 1YA5A 4L9DA 4JFZL 4L8CB 3RUGF 2AJZA 1FN4B 3OKMA 2G60L 3QUZC 2NQCA 4MNQD 2AP2A 4F33B 1PLGH 1ZLSL 1FCGA 2Z91B 4YAQA 4GMSH 5DS8A 4HPYH 3NN8A 1N59B 4RMTA 4Y1AE 3Q3GB 4C57C 3GSVB 5HVWA 2F8OA 1GXEA 3QUZD 2QQQA 3VFNA 3BSZL 1GSMA 5K93A 5AZ2L 3GMPB 4Y5VC 4RX4D 5D7LD 4X6FA 1IGYA 3EFDH 3FCTA 3QO1A 3UYRH 5DT1H 3C6SB 2P7TA 4YHPB 3RVTC 3TC9A 1LO4L 3P0VH 1EZVX 3TA3A 1W72H 4JN1H 1BFOA 1DBKL 2R69H 4XNMB 4MXQD 4DOHE 5FOBB 5KSAC 3C08L 5CGYD 4MSWB 4CBPA 4PPTA 3L5JA 1WGOA 5GGTH 3RVTD 3G08B 4OF3A 3S97C 2CDFB 4RRPG 3AGVA 5ACLA 1DJSA 4JM2F 4RGND 3WE6A 5C07E 4ZG8A 4UT9H 2FGWH 4EUPG 3SCMA 3UTZA 5KVGH 2R2HB 4YDJA 3V9FA 4N0YH 1GAFH 2DICA 3KYMA 3UPRA 4RISH 5LGHH 5CEZE 1RIHH 3GGWA 5C0GA 5CHNB 5DGRA 2C3XA 5LQBL 1ZHBA 3L3GB 5EC2A 3MRCB 1F58L 4HH9B 2GH4A 1BQHG 4NO3B 3P9MB 4JZJC 3SQOL 1NDGB 4FQXA 4PRPD 3DBXA 1MWAL 3WXWL 3OMZA 1MRDH 3KLSA 1U95B 1IEBA 5DD5H 3ALPA 5I1EL 1D5MB 3V52L 2BJMH 5JMOC 5H2BB 1G7QA 4KJYA 3L3OA 1G7JA 4MB5A 1JI1A 1N2RA 5C6TH 3W9EB 1BBJB 1NL0H 3UTTA 4LCWE 1AXSB 1DUYA 5IQ9A 1BVKB 1WIUA 5ITFA 1M71A 2AKRA 4WTZA 3RA7H 1RJZB 2KQMA 3G6AB 1O7SA 4X83A 1BPVA 3W5NA 2NTSP 2GSGB 2EDFA 4GRWB 3U0TB 4LAJH 1C5DA 1KIUA 2YD6A 3A6CL 1M6OA 2ENSA 1JTTA 1A4KB 3TVMB 2VH5H 4XP5H 4LHJB 4U1MB 3NZ8B 3H2WA 1FZJA 1BVLA 1ZWIB 3GM0A 4FUSA 1P2CA 1SJHB 3HR5B 5ADOH 1V7VA 5FKAA 1FG9C 5E1AA 1RJYB 4L5FH 4PY8J 4YC2B 5DJZB 4DKEH 5T1KA 3QIUC 1I7TB 1FL3A 2HT3C 2BSTB 4PJ7A 5TF0A 3ZL4L 1FYHB 1MIEH 2YD1A 5DQDL 4OLUH 4OZFG 3S4SA 4F7CB 1S7SB 3SDYH 1FFRA 4DQOH 1PY4A 3QB7C 4RMSA 3WL9A 2AI0L 4RGMB 3UBXG 5MEPB 3KPNA 1IVLA 1HCUA 2D0HA 7FABH 4M6OL 3VXSD 3BRFA 2BHZA 1NMBH 3F58H 3HRPA 4NSKB 4ZUSB 5CD3B 1KXVC 2BNRB 2PCPA 4MDIA 2F54A 5DLMH 2NXZD 4U6HA 1M7DB 1MCOL 4PJGA 3H9ZA 5L6YH 1MNUL 1NUFA 1HH9A 3D2UB 4JFDD 1J8HE 2RI9A 1B4JL 2H8PB 3RVXD 2J5LB 3HE6C 3C8KA 3CMOL 4LAQL 4ZNEE 4MXVF 3E6UA 2ZSWB 4BFIB 4OV6F 4P2QA 4OCMC 3IDMA 5EBLB 5BRZD 1GVIA 4HJJH 3OAZH 5JQ6H 1F3JA 2I27N 3ARGC 3GIVA 3QPQC 1QFPA 4FQIH 3MBEA 4RFEB 2WWKO 3WEXA 2X10A 3QUKA 5J7CC 1HWHB 2X1PA 1Q9KB 1WTLA 3MRMA 2E6JA 4Z77A 1FRGL 3TP4A 1N6UA 2CLVB 4OTXL 3PGFH 3ARGD 2P43B 4QT5A 3CVIH 3QPQD 4JHAH 3HE7B 4L0GA 1IQDB 3I02B 4M5ZL 4OAWA 4YXHL 1CDCA 3MRFA 3GK8L 2OCFD 3B5HA 4KRLB 2CRYA 5D7JA 2DQJH 2CR6A 4LLUA 3VA2C 4LSVL 4DKAA 4L3CB 3TO2B 4UINH 5DJ0B 3KYKL 1N8ZA 3QR2A 5ENWB 1FP3A 2IBZY 3EDEA 4H0HB 5BJTA 3VD5A 5DFVD 4JKKA 1ZMYA 2W9EH 4HW6A 4MA7H 1N7ML 3U46B 5JXEC 1N5YH 2D4DA 5HDOA 2LVCA 1QLFB 1SEBB 4GQ9L 3T77A 4AQOA 4KROB 4U31A 3U30B 2RFXB 3WFEH 3LEXA 5DDHA 2EDWA 1MJJA 1IMHC 3EYVA 5F88A 5JDJA 3U4EB 1NC4D 3THML 3HZKA 4ZXBC 5E7BA 5HPMB 5C0CE 1U8PB 3E6FB 3RWJB 4LSRL 1FAEA 2DKMA 5H35A 3EYSH 2ZPKH 4QXTA 4LMQE 4M61B 1FNLA 4ZXBD 4NNPH 2FBJH 5E8PA 4EN3D 1PZUB 2YPKB 1ND0B 1AO7D 2G75A 3QFZA 1XCQA 4M93B 2X42A 3EO0B 1Q9LA 3Q2CA 1TCMA 4PJEE 5FM8A 3HNVH 4YK4B 2ED7A 1CXHA 3V4UL 3IS1X 5L2KA 2AS5M 2Z0BA 1T0NA 3KJ6L 2RAMA 1TXKA 1OGAA 2VISB 3RNQB 3BOVA 3AREA 2XG4A 4H5SB 4NQCA 3RRSA 1R3JB 4YC2C 4PV8B 5DD3L 3MGOA 4RFOL 4K71B 1F9DA 2FWOA 3E6HA 3DUSA 2Q8AH 2JF1A 5ALBH 5CZKA 1KEMH 2D7TH 1QSVA 2DQGL 5EWIL 2FJFA 2EO9A 3S8WA 8CGTA 1WWAX 1YNTB 2G9HB 2A2QT 4HJ0C 4N0FA 3ZDYF 4ONFL 3KYAA 3MRQA 4I18A 5F7HA 2AEPL 4JB9H 5B38B 5IFAL 1KGCE 2D3VA 1YY8A 4PJDE 5CD2A 2QSQA 3TZVA 1IAIH 4O5LL 3ZSSA 1IAOA 2BCKA 1R24B 3MODH 3NABH 3GJFH 1D3CA 5F7MC 5CEZH 1CGSL 4U1HA 5TDOA 3MV8E 2DM3A 2FIRT 2YXFA 3W9DB 3CDGA 3MLPA 1GC1H 3MA7B 3QNYB 2NMSA 4Y8AA 4KTRA 4NT6A 5DMIH 1HZHH 2OTWA 3ZYZA 5MENB 4YHOH 1G9MH 5IG7A 2J5LC 1M7IA 1LHZA 5E8OA 4CL7A 1INDH 3OB0H 4GKZA 4GMTL 1Z9MA 3X14A 1W0WA 3I6LE 1H0DB 5DVKA 3GIZL 3QXDB 4X5XB 1UZ8A 4XX1E 4HPOL 2NX5D 2JJTA 3D3IA 4X6DF 5IW3A 1HQ4B 3RZWA 2X89D 4E41D 1JWMB 3BO8A 2OBGA 3HAEA 2OQJA 4YHKL 3A67H 1VGKB 3HB3C 2QADD 5IVZA 3VXUA 1ZS8B 3GMLB 3OQ3B 4YHNA 3RWEA 5GZOC 1H3XA 2JKXA 3SBWC 1C08A 4ELMA 1CL7L 1QSFB 3FRPG 3O4LB 4PJCF 2H32A 3HB3D 4TVPE 4ZOBA 1QA9A 1NDMA 1U41A 4FFYL 4XTRD 4ODVH 3G5YA 2OKXA 4NJAH 5ILTL 3W7TA 1NGYA 2KH2B 4HDIB 3SE9H 3ZYJA 1CCZA 2Y36L 3SJVB 1MLCB 2C7UA 3ET9F 3U30C 1WBZB 1XZ0A 4HEPG 4JFFA 2X4QB 1NKOA 2VDNH 1NFDF 2X4OB 3O2DA 4MDJA 2GJZB 2GUOB 4XP4H 2X1OA 5HVGB 3HS0B 3KPSD 1GGIH 5KSVA 3P2CA 3ZZ1A 1KIPB 4Z7OE 2PNDA 3B6SB 4GAGH 3T65A 5I66A 4NZUL 5HYJA 1P69B 1Q9OB 1UT9A 1KJVB 3KYOB 4TTDD 3QQ4B 1WU5A 5ALCH 3KXFB 2WP3O 1PY9A 1H3PL 3SN6N 3CFEB 4G8GD 1WEJL 4M93C 2VRAA 4PJXF 5GGSY 3T4YB 3D39B 4YK4C 5F7FA 1R0AH 3EYOA 3LCYA 2AK1H 4WHCA 4F7TB 1XCTA 1DQQA 5C7XH 5HYQA 2QKIA 5EZIH 1KIRB 2IH1B 2YOCA 2YIKA 3SGJA 3WKIA 1BGXH 2P8LA 2JLLA 4X6CE 5IR1A 1EEYA 3ZT6A 3MUZ1 3QUMB 4K8RH 4K9EC 2O5ZH 4ZPTA 2QHRH 1BF2A 1HI6A 4S1QH 4PJ9C 3DMMA 3HLAB 4Z0BL 1NBYA 2XG5A 5CIPA 3CPLA 4CW1B 3GMOB 5A1AA 3ZMRA 5D9SB 2RB8A 4MAYC 4MVBC 3O3DB 3NOIA 4XXCC 3B9KD 3MV9D 4PJ9D 4LVHC 2LTQB 1CE6A 4G8IA 4M1GL 3T8XB 2FB4L 4OI7A 1A6TA 4MAYD 5L2KE 4MVBD 4NQTA 5HJ3B 3RWDA 2FO4A 2DKSA 4P2RE 2F9BT 5DJCB 3NFPB 5GGVL 4JZOA 2IBGA 1BF8A 3R8BB 1BZ7B 3FB7A 3ROOB 5BS0A 2R4RL 3DSFL 5CSGA 1OTSD 2V2WA 2ATKA 5I1HL 1MRFL 5D1QC 5DHXB 3P2TA 5J89A 4FMKA 1T89C 1QO3B 2F74B 1ZKAA 3OJDA 4QWWD 1KLUB 5FO9B 2ZCKL 4P2CG 3UJJH 1KB5A 4X99B 1II4E 5FO8A 3GSXA 3QDEA 5D1QD 4U6YA 5M94B 2NW2A 5FUZH 3V7AE 2J8UF 1NCDH 1KN4H 4U1SB 4QF1A 2Y4SA 4Y19A 3Q0HA 3HC4H 1MEXH 3MRBA 5IMOA 1LQSR 3NTCL 1B0GB 1YYMH 3INUL 2DIJA 4XC1H 4I9WE 2BNQA 2YUVA 1GLMA 4PGJA 4AM0B 2UWEA 3QFDB 5DTFA 5KSBE 5D5ME 4Q2ZB 1NAMA 3DX8B 3QEHA 1MJUL 4P49A 1JCKA 4ZFFB 1Y6KR 2AV7B 1QFOA 2ICES 4AYOA 3MYJA 5EU6A 4YR6A 4XVJL 4W70A 2F8VA 3VXMD 5MEOB 2NY2B 4DW2H 3NCYS 4IJ3C 5HGBA 4XBEL 4F37K 2YA1A 2OTUA 3IJSA 4FTVA 5INCA 5IROC 4JREB 3MNVB 1TZGL 5DZLA 4WFGE 1T2JA 1WUNT 3KR3L 4D0BB 5C09B 4IS6A 1A9BB 2QSCH 3LHPH 3VXQB 1WZZA 2WLYA 5IESL 1OP3K 1CZ8L 1QNZL 4ZSOA 3BZ4B 4HS3B 2MMXA 5F7DA 5HHOE 1ED3B 3FONA 3KPPB 1KXTB 2Y5TB 4W6WB 4FOMA 1YY9D 1P4BH 1XAUA 1N64H 1ZT1A 4PJAF 4RBPK 5T1DH 4LLQA 4NBXB 4XP9L 1K6QL 3BUTA 4WW2A 4DN3H 3TNNB 3ULUE 5T33H 1XF5A 3QFJB 1MQ8A 5AYUH 2DQHH 4GXUM 5LVEA 4YHMH 3VXNA 4P3DA 5F7WC 5HTSA 1EDQA 3NA4A 4JO3H 5JW5A 3D85D 3IT8D 1QFWH 5IWLA 2VN7A 5EIQA 2AJSH 4HUWA 3V6ZA 4P4RB 1Y6NR 1C16A 2PYFB 5C08B 5GRYA 5CD5C 2FRGP 3RL1B 1XR8A 2IPUG 1JMZA 3GMRA 2GT9B 4NZTH 4ETQA 1KJ3L 2R2EA 3EJJX 1CK0H 1TMCB 1I9RL 1T1WB 3ABZA 5FCUH 1I9JH 5JLZB 4GRMB 5CD5D 4HIHA 5ESAA 3G6JA 3IETB 4FFVD 1PZ5A 3OXSA 3QDJA 2VITA 1KLGA 3O8XB 2Q7NA 3QEQB 5F1NB 5JZ7D 2X9WA 3GT5A 2VXQL 5KS9B 2CUHA 4S0SD 1KWFA 1A7BA 1JGDB 2VUOA 1OF2A 1VADA 5SX5H 5TFSL 2LU7A 3CLFH 2LTQC 1CD0A 1HYRC 3HUJE 2E9WA 3RAJH 3H9SB 1E6OL 3CLEH 1K8IA 2DWDB 1CFSA 1ZLWK 2EE3A 4PLOB 1YMMA 1D7FA 1S7UA 4OD3H 3G04A 5DHVB 4PP1D 5E6YA 3C5SA 4TVPH 4I4WB 4RA3A 3T0EB 5C86A 3BGAA 4G7YH 3OF6D 1KS8A 2YWZA 2HWZL 3MRDA 5DC4B 4HIEB 4X8JA 2BVPB 2FSEA 3HC0B 3M17B 2LABA 2DJUA 1G7HA 4HV8A 1CICD 1NAML 3FQUB 3WIFA 1EUTA 2VXVL 3BT2L 4DAGL 2Q7YA 4JFOA 4FABH 2ADFL 2AERT 2OI9C 2XZCL 3H3PL 1CI5A 1BREA 2ESVB 4O4YH 2IG2L 2JIXA 4XPAH 1FPTL 5EIVA 3MRPA 3C9NB 2W0FB 4BM7A 5DR5H 1I7RB 3FO2B 4NQDE 5D2NA 1TVHA 4G3YL 1YN6A 4QYOA 5GS0H 3RBGA 4ONGL 1X9QA 1IGTA 2R56H 4UB0H 4YHLH 3ROLB 3TCXA 2A6JB 3VXRB 1UADC 3DYPA 5ISZB 2XWTA 3HFMH 3GSQA 2H6PB 3WO4C 3QDME 2AXJA 1IM9A 5FA3A 4BH7B 5LAXA 5D7IE 4GAYA 3OGCA 4JQXA 4Z7WB 4JANB 4APQB 4CVWA 1WCQA 1RUPH 1JNNL 3UTPD 3KPMA 5KG9A 1RUMH 3CFCH 3FQRA 4TN9A 1DZBA 2NY2C 3K2UH 1N6QH 1BIHA 4HCRL 1F6LL 1A21A 4YE4H 1TVBA 1P4IL 5LXGH 5EFIB 3T33A 5JORA 2P8MB 4R96A 2B1HH 2A83A 4FQJL 5DJAB 2JJBA 3BH8B 4QHLB 5SX4I 5IVXB 2FX8L 4OCSL 1LNUB 2DYPB 3PABA 4PJ8B 4JCMA 4QY8B 3GBNL 1RSFA 4FP8L 1ZEAL 4PJDF 5JHDD 4FQQA 2MJWA 2HT2C 4QHNB 1A47A 2QSVA 4XH2A 3QCUL 4LLWA 2NTFB 3DURB 2BOBA 4X7SL 1N3NB 3D69B 3G5VB 2BNQE 1R5WA 4LSQL 3QH3B 1W8NA 2MCG1 3HZYB 1WISA 1VACB 4YZFE 1U8LA 2HT2D 2ZOLB 3S36H 4CN1A 1E6JH 5MERB 4M00A 3F6IA 3DVIA 2NY7L 2VLRB 3K4DA 3B5GA 1GZPB 2DMCA 3CSPA 2ZUQB 4M7ZB 5B4MC 4NPYB 2A73B 3SPVA 4H25A 2RI8A 3PGDB 2MKWA 2B5IB 5HHNA 3GKWL 4FTVE 3WFBH 5BOZG 5DJXB 2BXZA 3OKDB 4FXKA 3KLAA 4OD2A 5FA4B 4EXKA 5BOPA 4BUHA 1S9KC 1KG0B 2YD8A 4MA3B 4U6XB 4ZS6C 4KQ4H 2C3VA 3SKMA 2APVA 1XT5A 1FLRH 1MVFA 4ZSOE 3C6LB 3CSYA 3R06B 3ZYOA 3O81A 4HWEH 1KCSL 2DQDH 3GEWB 4X4ME 2M1KA 4HF5H 2CLRB 2HRPL 3O8XC 4JFPA 4OJFH 2ED8A 5K9QI 5ELIA 3LH2H 3QA3A 4NKOB 5FB8B 3W5MA 4HC1A 2AJ3A 1E4WL 4GW1A 1DLHB 3QIBA 3VGDA 4HBQA 1JHLH 4NRXA 4RCAA 2Y1VA 1EJOH 4KI5F 3RTQB 5IMMA 3D0VA 4WO4B 2R23A 5IEHB 2CR3A 2UZIL 3IDNA 2VABA 5EA0L 1CE1H 1UCTA 5IJVA 1DUZA 1CVRA 3RU8H 5ICZA 2VLME 4G9FB 4B7LA 3HCVB 1SVCP 1LP9A 5C1MB 1YEGL 4HGWA 3MXWL 4OF5A 4HWZB 4U0QB 4KMTH 2ERJB 4UDTB 3N06B 4GOSA 1G7LB 1OL0A 3W81A 2VR4A 1UVQA 3F12A 3PXHA 3IVKB 3FFCA 4PRHD 4XZUB 2CXKA 3MUGA 1I75A 4EQ3A 1VEMA 4XGZA 4NUGH 1KC5L 1MFEL 4PYGA 3QHTC 5HVHC 3ZTJH 2YD5A 3LKPB 3QHFL 4FQ2L 3BEWA 4QRRD 2OM5A 3V4PL 2V5SA 4QHMA 4LKCB 5ACZA 3BVNB 1J1XH 4O58H 1UH2A 5JA8B 4JM4H 5CJXC 3VFGH 1RIUL 3HPLB 5JO5A 4LLYB 1QKZH 2NYYC 3RENA 4N8CH 4PJIB 1MHCB 2JB5H 3ULUH 2Z31A 3VW3L 3O9WB 1JV5B 1IZJA 3WIWA 3K11A 1AP2B 3R1GL 5KVMC 3GB7A 3OPZH 4DGVL 2R4SL 4OCRL 3S36X 2F53E 5JOEA 2QQNL 3CGTA 1YN7A 4JPVL 3Q1SL 2HFEB 2AJYH 4Q9BA 1RZKH 4OUUA 2CKBL 4J6RL 5SWZD 3GSUA 4L4VA 4NUJA 3MLRH 3KS0J 1NLDL 2NLJA 2HTKC 3D18A 1MRCH 3DUHA 5FF6B 4YHZL 3FMGL 1QEWB 1KIQB 4P23D 5E2VL 4Y4HD 1V7NL 3QRYA 4PTUB 2OX5A 2VXUH 2GJ6A 3P73B 4DOEA 5C0AA 4WUUA 4N0UA 3T0BA 1KEGH 2V9RA 3HRZA 1UYWH 1ZA3A 2P24B 2HKFH 3Q5YA 3ULVE 4U1GB 2P49B 4CJ1A 3BPOB 3V7MA 2ZCLH 3MV7D 4MNHB 4HC1L 3U36A 1F2QA 3CSGA 2VDLL 1RZ7H 4F15B 5D2LE 3SOBH 1ORSB 4N8PA 3N1MC 3UC0H 4LKXA 3HZVB 1IC5L 5EOCL 4HJGB 4LARL 2WIIB 5DF0A 3GLYA 1VFBA 3PWVB 3QUZA 1R3IH 7CGTA 1CT8B 4GSDH 4JCLA 4WEMB 2VQUA 5CJOL 1T1XA 1JVKA 3KHQA 3PG2A 4MAUL 4YXLL 4M48L 1E4JA 3WNKA 3AS3A 2DQCH 2IPKB 2NY6B 3LIZL 5HGDA 3V95A 2EDJA 1X7QB 1IL1B 2DTSA 2DF3A 3S6CA 1BFVL 3HG1E 4TNWK 1DN2A 5TH2A 4RGOH 1EMTH 4XCYA 1IGCH 5CCKL 1NCNA 3BQUB 5B39G 3WLWD 5BQ7B 4MD5B 3ARFA 4C56D 4AIOA 3EJZD 1QLEL 1RK0A 5EUOF 4WO4C 3C2AH 3VFTA 5KSAA 1MQKL 3BZFA 1XGQB 5KSBF 5D5MF 1IEAA 3WIRA 1S3KH 2BNUA 1QBBA 3CD4A 1NMAH 3QUYD 1U8JB 4OKVA 5I19L 5I2IB 2XV6B 2A1WL 3WKML 3D3VA 5I71B 5K9JL 2ERJC 1QRND 3LQZB 1ZSDB 4Z5RA 1X5FA 4OGZA 4JVUA 1S7QB 4ZFZA 1MUJB 4NQEB 5EORL 5FYKU 4OZGB 3P4LA 1JGVH 3B5TA 4Y16B 3JV4B 2IANB 3ARDC 1ACZA 1X5ZA 1WITA 1WTGT 2GAZA 1JTOA 3ARZA 1KSRA 5SV4A 2D0GA 3ULUF 4PREB 1X4ZA 3W0WA 2PXYB 5B3JE 4HIJB 1QTYT 3PL6B 5CEXA 1PYWB 5KVDH 3MRJA 3O9WC 2XNAB 4F58H 4F8TA 4LOUC 4QRQA 4QOKE 5KANG 3ALWA 4I48B 3DXAA 3QRGH 5T1MB 3RIFF 4JN2B 4LLVA 2X7LA 1T7WA 2VQ1B 3F7PC 4MHHI 1LK2B 3SDXA 3V5DA 1UH4A 5IP4A 4LOUD 5KW9L 35C8H 1EHAA 1OAYH 1JYWA 4NFCA 4JO1L 4KZDL 4AYRA 4U6VH 1J11A 1MFBH 3VU2A 4LGPB 1NAKL 2PW1B 1DFBL 3RWCA 1K4DA 1UXSA 4YGVB 3P9LB 4JDVB 5BZWB 4L8BA 4JG1L 3VH8B 1W0VB 3BKYH 4YO0A 2C26A 3GRWA 3O3AA 1M05A 1DVFB 1ZK9A 5GGSA 4R97B 1U8OA 1RVFL 2IQ9H 5L2JB 3K1KC 3O4OB 3WFHA 2WBJB 5HHME 4OIAA 12E8H 3L3KB 3RWIA 2CIIB 2HVJA 3NCCB 4OB5L 3QIUA 4EBQH 4HFUL 3RVUC 5IBTH 3T09A 3MLVL 1YYLL 3ANKA 3VWKA 4U1GC 4Z7UE 3QULA 1ULVA 5EU7E 3CFJA 5CLWA 3VXSA 2IALB 1FORL 2C1OB 1QFUH 1UCBL 1EEZB 1S5HB 2X2YA 4LSPL 3P77A 2OP4L 3Q5OA 5JTWA 1RUQH 2A6DB 5CZXC 4GG6F 4L8CA 1H15B 1Y6MR 1RUKH 2CPCA 4ZUVB 1MI5B 1GH7A 4YHYB 4H26B 2NY5H 4ERSH 3BESR 3OZ9L 4Z7VE 3VFOB 3E1F1 5C2UB 4JFDA 4WJ5B 4F33A 2ATPB 3AS1A 2Z91A 1W72B 5HDQL 1A2YB 1N59A 3WUZA 2IMNA 1ES0B 3GSVA 1VB9A 1QSED 4JR9L 1A6UH 5BRZA 3TEUA 2GITB 3F62A 3CUPB 3BXNB 3PWUB 1I3UA 3B9AA 4N0UE 5DSCB 5E2UH 2PYEB 3HE6A 4MNGB 1RV6X 3BQUC 3UTSB 1WZ1H 1I1YB 3C6SA 3AFLA 4JHBA 2OL3A 3T4AB 3ARGA 3OBAA 4WU7B 1KFAH 4MNQE 5D7IF 4CVXB 2MNUA 4XNMA 1MVUA 2P5ED 5FOBA 3F7VB 3HMXA 2X09A 1FJ1B 4JM2D 2XRAH 4MSWA 4I3GA 3DGGB 2H3NB 4WFFD 4R4BB 3UZVB 1JZ2A 4HBCL 3G08A 2C3WA 4KK6C 5JUEH 1VGEH 2CDFA 1QFHA 3TJEH 4L1HA 5I71C 5D7LE 4XAWH 3U9PH 4K2UH 4MX7B 5DZNA 5IKCB 2D7OA 5DA4A 2GTWA 4HSQA 3BPCB 4AH2B 4P46D 2LAAA 5CA3A 4R8WH 1IAII 2A9NL 3MJ6A 2WAHA 2WWMD 5I1CH 2CIKB 3WUWB 3MA9H 2LAGB 3V2AR 2Q6WB 3OB8A 1UJ3B 1HOCA 3L3GA 4HH9A 3LN5A 3P9MA 2CDEB 3H0TB 3PP4H 1KFGA 3QQ3A 4P2OD 3VWJD 2BVOB 5JXEA 4K7PH 1NDGA 1YEIH 5K33A 1U95A 2CMRL 4UT7L 3STZB 2D7NA 1DLFL 3TYGH 5IMLB 1YNLH 4RGNE 2XZAH 3K8KA 3PL6C 4YZFF 2EDYA 3W9EA 4ZXBA 3ULVH 4OF8A 3ARRA 1BBJA 5LCVH 6FABL 1AXSA 1BVKA 2AVGA 1N5AB 4UAOB 4JRXD 1BWMA 5HYIA 1F6FB 1RJZA 4S0TD 4PB9L 3HNTH 5EPMB 3MLWH 4RFNB 5MI0C 1FLTX 2ID5A 1UM5L 4H88H 2GSGA 4PRPE 4M02A 2YK1L 5GISL 4ZYKA 3IDYC 2MQ0A 3KHOA 1A4KA 2AJVH 4MS8D 4M8QB 2G5RA 1A6WL 1LE9B 2OZ4H 3NZ8A 4LGSB 5EU5B 1ZWIA 1TJGL 2UZYB 3B2VL 1SJHA 3HR5A 5D7SH 2AK4D 1VCAA 1DVFC 1HINH 1LEKB 2XACC 1RJYA 3JV6B 5F3HB 1CN4A 3QT9A 5DJZA 4IEFB 5CBAB 1HYSC 2DRQA 1I7TA 1WICA 3HA0A 4OLYL 4C54A 2BSTA 3H7BA 3U79A 5GRJH 4KZEH 5FGRA 1GGUA 3UO1L 4OGXH 1F02I 3HI1B 4HLZH 3QXUA 1L1YA 5EZOL 1F4WH 5TQ0L 1KACB 1KT2B 3GKZA 2UUDK 1BEYL 2YPLA 1YEJL 2P44B 5MEPA 5HY9B 5E03A 1C7TA 5DEGB 5AAMA 1TFHA 3C87A 3HMXL 5CD3A 4ZUSA 5TE7H 1UM6H 4TQEH 4HKZA 1BD2B 3ZDXF 3CDCA 1M7DA 2P48B 5I16B 4GKSB 1BZ9B 1G7PB 3MLXL 2X41A 3ZYIA 2P45B 3D2UA 2OJEB 1QVOA 2WQRA 2H8PA 1GHFH 1ORQB 4N0CC 4BFIA 3GI8L 1UACL 4K7PX 1J0JA 5EBLA 1XF2A 2X89A 5B8CB 3DO3A 1WK0A 2EDEA 1B90A 2EE9A 5IFHL 1IBGH 5LG1A 3BP5A 4RFEA 4K94L 3KVQA 2DLEA 3CK0L 4F8QA 4DTGH 1Q9KA 2VDOH 4KKLD 4Z8FH 1AI1H 5DWUL 2EDNA 5ERWB 3QEGH 4J12A 1EGJH 3I02A 4L3ED 4JFDE 1K72A 4CE7A 1TITA 4JHWH 3MJ9A 3SBWA 3PWJB 2ICEB 3IAGC 6CGTA 4L3CA 1T0PB 3TO2A 2FD6H 4Z7QF 1A64A 5TE4L 1MHPL 1NFDB 5JIPA 1LEGA 5BRZE 5ENWA 3VXOB 5HGGS 1UJ3C 1EAJA 3MREB 4PRIB 2I9LB 1K3IA 2Z92B 3U46A 1DEEB 4QXWA 3BE1L 4M6MH 3BYTA 2GFBB 3ZE1E 2Y6SC 2RFXA 4WI8A 1A5FH 1I8LC 2HG5B 4DGIH 1CLYH 3DETD 4W4OC 4HT1H 4XC3H 4JG0L 4D3CH 3S4CA 2F15A 4J3UA 5T3XL 3L95B 5IQ7H 1SY6H 2B4FA 1RFDH 4Y1AB 5IVNA 1GIGL 3LKSB 3BKJL 5HPMA 5I15H 1U8PA 2DWEB 2Y6SD 1EHLH 3RWJA 3CXHK 4YNYA 1MFNA 2FATH 1T4KB 5C0EB 5FUOL 4NC0B 3QHZH 4M61A 4RFNC 1S7WB 4EOWL 1GGCL 1AXTH 1FGNL 2XQBH 1KPUB 3NIDE 3RPKA 2YPKA 3O11B 2VR9A 3S4BA 4LMQI 1Q0XL 3F65A 3EO0A 4NO5B 4OLWH 2Q3ZA 4DOHB 3BGMB 5I9QC 4M7LH 3IDXL 5CGTA 1U2CA 4YX2H 1OLZA 2BNRD 5IB2B 2O5YH 2VISA 4NJ9H 3RNQA 4K3JH 3T0AA 5A2JH 1T80A 2ZG3A 4Z95H 5DUML 1UB5A 4Y4KB 1R3JA 3SE8H 5C07B 4F57H 1WAAF 4PV8A 5E1HB 4JFZH 4Y2OA 1QR1B 2J6EA 2RCSH 2XY2A 3O0RH 3SKNB 4XMLH 3GJFB 2G60H 5T3ZD 2FDBP 2Q20A 2ORBL 1AO7E 4XPFH 4YBQC 3DV4B 1YNTA 4PJ9A 5EULV 2MPAH 4AG4L 2ITDB 1J5OH 4XRCB 3BDYH 4G43B 4MAYA 3NPSB 3UEZA 3O41B 2XTJD 3MFFB 4YBQD 3FOMB 4XXCA 4F3FB 3EOBB 4AQ1B 5C2BH 2BRRH 4QRUB 3HE7D 4TSBL 4Y5YB 4XPHL 4LF3B 2B4CH 4EUPH 4UOJA 1KV3A 1J0ZA 4LCWB 3P4OB 4NM4L 4HGKC 3W9DA 5JW3L 3MA7A 2G5BA 3MJ9L 1QFWI 3T1FB 4P4KC 4HS6B 4LSDA 5DVNA 1QOKA 3C08H 5MENA 3ARYA 1AQKH 5DRZA 4O2FB 1YEEL 3WFCH 1OWRM 1F11B 4KHTL 3LSOB 1MREH 2IBZX 1NXCA 1JZ4A 5B8CC 4P4KD 1FGVH 1FSKB 1T89A 3TT3L 3NZHH 3DNKA 4ZUTA 4O00A 1XEDA 1OTTD 4X5XA 5I18H 5A2LH 4B50A 3DYMA 1AD9B 2V7NA 2CLZB 3MROB 2GEEA 1HQ4A 5J9PB 4YDLB 1S7VB 1DQJB 5LQBH 4J5TA 1OAQH 1F58H 4ACPA 4AEFA 4CVZB 1ZS8A 3GMLA 3D1MC 1JWSB 1OWWA 1MWAH 3SEPA 3WXWH 4JY5L 4JGUA 1BQUA 1A6VH 1LE5B 1MHEB 1CDJA 5FGCE 5BZDA 4D0DB 1N0XL 1BM3H 2MOVA 2ZOKB 5JDSA 4QO1A 2B1AL 3IRPX 4UOW0 4I0PD 4XP6L 5FGBC 4HDIA 2NX5E 3VGGA 3HTLX 1I7ZA 3KPRD 5KBNC 5E08L 3SJVA 1CD9B 1AGFB 3RPIA 4E41E 1MLCA 2G2RB 5CJQH 2R0LH 3S7GA 1JPTL 1C5CL 1INQB 5IROA 3BP6B 2AQ1A 2ZCHL 2R1YB 4Z7UF 2VXTL 2X6MA 3BIKB 4EDWH 5TQ2L 5F93C 5FYKD 2X4OA 3FQXA 3OHXB 2APWA 2GJZA 2GUOA 3ES6B 1TF4A 3GBML 1AGBB 4HQQH 3OAYK 3R0NA 2VLLB 2J6EL 3HS0A 5L88L 1D5XB 1CIUA 3MLUL 1J8HB 3H8NA 1RZGB 4KQ3H 1TQBC 1KIPA 1RZJH 3B6SA 3G9VA 4OZFH 5GGRB 5FYLL 4BELD 1ZHNB 4XCFL 2N7BA 1ITBB 1KJVA 3KYOA 3RZCD 3QQ4A 2A6IB 3KXFA 3CFEA 5T1LD 2DLFL 4Z0XB 3QIWB 3T4YA 1FYTB 3D39A 4P5MB 4WFHD 3IFLL 3IYLW 4XPTL 3PXJA 3P11L 3ZL4H 4F7TA 4NO0D 1A3RL 1TENA 2IH1A 3KPSE 2BMKB 4U6TA 4TUOB 2HA1A 2J7LA 3GMNB 1FQ9C 1EXUB 5B38G 4UTAH 1NCCL 3T3MF 2IFGA 1GC1C 4Z7NE 1XH3B 2WLZA 3NFNB 5E5MB 5E7FA 3HLAA 3CVHA 4TRPL 4G8GE 5F9DC 3QO1B 1G6RH 1G9MC 1AY1L 4ISVA 3NPSC 3SDDB 4IRSB 1EAPB 3TA3B 3FOLB 1FAIL 3VRIB 3OF6A 3UPCA 1XGTA 3T8XA 2ADJA 3VG0L 5HJ3A 1QZ1A 2WUBL 3VFRB 1G0YR 4AL8H 3NFPA 1JMXA 4PJBE 1SM3H 1BZ7A 2XQYK 1WZMA 3HI6L 4GS7B 5FOJA 3O4LD 3ROOA 3PJSB 4KC3B 3I50L 3L7EB 3TCLB 3KYMB 4CU6A 2GIYA 1FRGH 4NN6C 4OTXH 3DIFB 5IEKB 3AS0A 5GGQH 4YXHH 5D70L 1QO3A 2F74A 1P84K 3GK8H 1ZHBB 3MV9E 3PWPD 2HT4C 4PJHE 4PJEB 1FZMA 4PGBB 1A0QH 3T3PF 4XNZC 5D6CB 4LPWA 4UQ3A 4X99A 4XVTL 1T2QL 5GJTL 2KDGA 4G6MH 4FQXB 4YDLC 2A0LC 3V4VL 3S34H 4KJYB 3L3OB 1VFMA 5GSVA 3L7FB 2VXSL 5FM4A 5MEQB 1D6EB 1B0GA 4IMKA 2A0LD 2IFFH 3PP3K 5IFJB 2YUXA 4Y0GA 2R0ZL 3VFUB 5IQ9B 2ZNXA 1HCVA 1KCRH 5ITFB 2ARWA 5E6IB 4HUVA 4G9DB 1KENL 3QFDA 4Q2ZA 2B7DT 3DX8A 4MLIA 3OSKA 4ZFFA 2OR9L 2AV7A 3C5ZD 1IGIH 2D03H 4QXGH 5EIIB 4WY7L 5MEOA 4ZDHB 2HFFB 5E9DD 1NJ9B 1HDMB 2NY3C 1UQSB 4JDZB 4Y4FC 3GM8A 3MNVA 1CR9L 1KULA 1OOAA 1FZJB 5C09A 3RGVB 1A9BA 4L4TD 3VXQA 3MV8B 1HIMH 4OF6A 2NY3D 2DIAA 2B39A 3BZ4A 4HS3A 1ZHLB 1ED3A 4LPVA 3KPPA 3QUML 4Y4FD 2Y5TA 3EYUH 5IB3B 3MLZH 1WBXA 1YC8A 3V4UH 1FL3B 3VFVB 1DANU 2YZ1A 3ZT7A 3IDGB 3QFJA 4K8RC 3VXME 1RZIB 5IGXH 3O6LL 2V5RA 1OW0C 1Q94A 4B5EA 3E2HB 5DD1L 1DL7H 1UC6A 3QIWC 1XF1A 1J05A 5C0NC 3LAFA 3H42H 3KPNB 3NCJL 3QI9B 4P4RA 3VI3E 3Q6GH 5C08A 1CD8A 3LQAH 1L2AA 2GT9A 1A7OH 5DQ9A 2PCPB 4MDIB 5EDXA 1T1WA 4U6HB 4ZAKC 2C3GA 2VDPH 3VGBA 1DOGA 2E6PA 5JLZA 4PJGB 1JHKH 3SQBA 4A6YH 4KFZC 3HN3A 3NGBB 1UWGH 3U4BH 4O5LH 4ZAKD 3RHWK 4HULB 2FNBA 2Z9TA 4OCXL 2YD3A 3L3IB 4YFEA 4WFED 1I3GH 4MJ5B 5E5RB 1ZANL 3O8XA 3QEQA 1CGSH 3ZTNL 3U1SH 1UWEL 3R8QA 3EYFA 3QUXC 3SDDC 1VESA 1JGDA 3WXVL 4ZFGL 1URLA 4P59L 5EC1A 3GIVB 2DQUL 2ZWLT 5GS1B 5HD8C 1FO2A 1BMGA 3H9SA 2JG0A 2BVYA 4S1DC 2DWDA 3MRMB 3QUXD 3SGDH 2O5XL 4DUXA 1Q0YH 5DHVA 5F71A 5ADPH 4H1LG 4QT5B 3K8MA 5HD8D 1S7XA 3MRFB 3TF7C 2YBRB 1XGRB 4HIEA 4S1DD 1HNGA 5D7JB 4HPOH 3HC0A 1MJ8H 2JB6B 4LLUB 3M17A 3S5LB 2WK2A 3E8UL 3MCLH 3S3PA 1PJ9A 1C7SA 3FQUA 3UROR 4F7EB 4KVCL 3WHXA 2MSPA 3PQYD 2AV1B 5FYJL 3OKNA 1W8OA 2VDKH 1G7IB 4XVUC 1D9KB 3C9NA 1I7RA 1TTGA 1CL7H 1OAZH 1YEFH 1U3ZA 3FO2A 1ZLWH 3LS4H 4JFXB 1ZTXL 2DDQH 4I3RH 3EYVB 4X6CB 4XWOD 5CJXA 3ROLA 2MQCA 3VXRA 5ISZA 2HH0L 2CO6B 3HZKB 2DLHA 3F6LA 4JPKL 4WRLA 5FHBL 4BH7A 4Y2DB 2VZUA 5L7XH 5FGSA 3OJMB 3K7UA 4KTEH 4LGRB 4Z7WA 2VMFA 4U05A 3KJ4C 4Q9QL 1FP5A 5E8PB 1SEQL 3I6GB 5BVJB 4PJ7F 5F7NC 1FC1A 2F19H 3U7WH 2D7MA 4XNYH 4WDIA 1XCQB 4PBWD 4RZCA 4NRYA 5EFIA 3WIIL 2CRZA 2F5AL 2P8MA 4NGHL 5T5FH 4PFEA 3RGVC 5L2KB 1T0NB 4OM0L 5DJAA 2R1WA 1HXMB 1H3GA 4P2RB 5C70A 3VJ6B 3BH8A 4QHLA 3QWTA 1LNUA 2DYPA 5HHXL 4XNXL 2AEWA 4ZS7L 1U36A 4QY8A 1XFPA 5EU4B 4RSVA 3WFZA 2Y9RT 3MV7A 5E8DL 3V8OA 4QHNA 5CINH 1Z9SA 3DUSB 3DURA 4QGTA 3D69A 5F96H 3SGKC 3QH3A 4JEGB 3HZYA 1JI2A 1VACA 3VCLB 3O6KL 2ZOLA 1F4YL 5ESVB 4I18B 5D93B 5HGHB 2J3SA 5MERA 4H20H 4GRLD 1YY8B 3QI9C 1GZPA 2DQTL 5HI5C 4NPYA 2A73A 3ME0A 3PGDA 2NY1D 2DRRA 5DJXA 1REIA 3OKDA 5JHDE 3T0ED 1UXWB 5TF1L 5J56B 3DO7B 1KG0A 4LLDA 5TE6H 4U6XA 5TDOB 5I30L 2X4RB 3MUY1 3C6LA 3R06A 4O9HL 4KI5C 4HK3J 5HYSG 3P3YA 3ARXA 4LEXH 3DV6B 2UV3A 2CLRA 5KSBB 5D5MB 5IG7B 4XMKL 4XPBL 4JAMB 4OLVL 4NKOA 2IAMD 3DX9B 2ESVD 2WNGA 4KI5D 2WUCH 3SHSA 2GCYB 4OFIA 5GGVH 4R4FL 3GO1H 3X14B 2I60L 1W0WB 3IJHB 1DLHA 2FBOJ 3O6ML 5GS1C 4KVNH 5CP3H 2AHFA 2VSDA 3SY0A 1G6VK 1CXEA 2W07A 1MCQA 4EZMA 1NBVL 4WO4A 4NDMB 5JR1H 1QRNA 3EQAA 3TM6A 4B0MM 1FZKA 2OQJB 2OXHA 3T2NL 4D2NA 5HHOB 4FQLL 1XW2A 4KKAC 3HCVA 1CU4L 3VI4E 1CLOL 5IVZB 2ZCKH 1AYXA 4HWZA 5BW7C 2CK0L 3PE9A 4UDTA 1G7LA 1VEOA 3FB6B 1G9GA 5DFWH 1OM3L 4APQD 4Q97A 3UX9B 4X9IA 4KKAD 3IVKA 4C58B 4XI5D 2QEJA 4FQ1L 3NTCH