2VN7A

Glycoside hydrolase family 15 glucoamylase from hypocrea jecorina
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
599
structure length
599
Chain Sequence
b'SVDDFISTETPIALNNLLCNVGPDGCRAFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDRFTETYDAGLQRRIEQYITAQVTLQGLSNPSGSLADGSGLGEPKFELTLKPFTGNWGRPQRDGPALRAIALIGYSKWLINNNYQSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEEVNGSSFFTVANQHRALVEGATLAATLGQSGSAYSSVAPQVLCFLQRFWVSSGGYVDSNINTNEGRTGKDVNSVLTSIHTFDPNLGCDAGTFQPCSDKALSNLKVVVDSFRSIYGVNKGIPAGAAVAIGRYAEDVYYNGNPWYLATFAAAEQLYDAIYVWKKTGSITVTATSLAFFQELVPGVTAGTYSSSSSTFTNIINAVSTYADGFLSEAAKYVPADGSLAEQFDRNSGTPLSALHLTWSYASFLTATARRAGIVPPSWANSSASTIPSTCSGASVVGSYSRPTATSFPPSQTPKPGVPSGTPYTPLPCATPTSVAVTFHELVSTQFGQTVKVAGNAAALGNWSTSAAVALDAVNYADNHPLWIGTVNLEAGDVVEYKYINVGQDGSVTWESDPNHTYTVPAVACVTQVVKEDTWQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCOAMYLASE
publication title Three-Dimensional Structure of an Intact Glycoside Hydrolase Family 15 Glucoamylase from Hypocrea Jecorina.
pubmed doi rcsb
molecule tags Hydrolase
total genus 209
structure length 599
sequence length 599
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2008-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2vn7A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vn7A02
3MV7A 1B9ZA 4BSWA 1BEYL 3VGEA 5C6WH 4ERSL 3RNQB 4XGZA 3T0EA 1E4XI 4ZSOB 4O2EA 5FM4A 4WW2A 5HGDA 3UTZB 1TCRA 5I30L 4AH2A 3P0YH 3IGAA 1U6AH 4JPWH 3HR6A 5CJOL 4PS4L 3P73A 3PJSA 1GYAA 1FVCB 3HG1B 1FYTD 2DQGH 4ZTPH 1LO4L 3HLAB 4ZXBD 3L3IA 4PV9B 4LQ1A 4UINL 3L3KA 4PJDA 3RQ3A 3KAAA 4ZS7L 2ITDA 1KSCA 1FZMA 5F7HA 3OV6A 3IF1B 4NQCD 3OGOE 3ULVE 4C83B 4PP1C 1INDL 3DO3A 3O0RH 4TNWF 2CMRL 2F53B 4TSCL 4UILH 1RY7B 1ZAGA 3VCLB 4HS8L 2HFEB 1IC7H 3QZWA 2EXYC 1BF8A 2PXYC 4F3FA 1E4KA 2A1WH 2AXFB 2VLRD 1S7QB 1J18A 2A6DA 1M6OB 5TF0A 5SX4I 3CSYB 1FG2A 4P46D 4PPTA 1MHCA 1JI1A 4HUKB 1NLBH 3QDEA 4OSUL 2WBJD 4U1MB 5C0IA 2EE9A 2AEQL 4XPTL 1FPTL 3GGWB 4GW5A 1VESA 5LWYL 3DRTA 1T7ZA 2ZUXA 1HDMA 3WE6A 3NA9H 3FO9B 1AGFA 1SJVA 1GGIL 3CIQA 4PYGA 3S6CA 3VFUB 1U2HA 2HJKB 1V7ML 2BK8A 4U1GB 1BECA 1S7VA 4MXQC 4XNUL 4BFGA 3MA7A 4E41A 4IIQB 3GSNL 4J3VA 1T66D 3ZYOA 4APQD 2V5TA 3W5MA 4F8TA 2DKMA 1YPZF 5HPMB 2GK0B 2GY7B 2KDGA 2FL5B 3QCUH 4X7TA 4OB5L 3FQRA 1HNGA 5JXAL 4JKMA 3TYGL 2BERA 5BO1H 5MEPA 4O51B 2HT4C 4CVZA 4KHTH 4G9DA 2GSIA 4DUVA 4FQCL 4HJ0C 1DLHA 3B2VH 2NY7L 1JHLL 1C7TA 4U1IB 2A74A 1S5IL 1H12A 1FGVH 1XGYL 4NOFA 4ONGH 3RY6C 2QEJA 3WS3A 1KIRA 4PRNA 5DEZA 2MCG1 3LKNB 1F4YL 2ICWI 5L2JA 2VUYA 2M26A 1A1NA 2QL1A 5D1ZC 5ILTH 1QFWI 3QFDB 3MO1A 3U4BL 4GUPB 3QXFA 3LIZH 2A6KA 4OV5A 1BD2D 2YR3A 2NLJB 5M95B 5IVXE 1YMME 4L4TB 5BVPL 1UENA 5MENB 2DLTA 3ARBC 3BJLA 3E8UL 3DYMA 4LSQL 1WZLA 3CFIC 5E9DB 2J8UB 4J3WA 4K94C 1I8IA 4Y2DA 3PUCA 3BPCB 3CZFB 4AT6A 3RNKB 3QCVL 4JGMA 3T65A 3C5ZB 1KJ2H 2ZP0T 5HD8C 1I3UA 2DI7A 1XGRA 4P9HC 5GHWL 2Z35A 4N9GA 1N2RA 3EYSH 4D0CA 4J3XA 3QPXH 2XIDA 3RRQA 1TFHA 5CP7B 4D3CH 1HE7A 4PTTA 5DLML 3PF2A 3CVHH 4K3JH 3R1GL 4QHMB 5T1MB 3ZKMC 2CXKA 4CRPA 1Y18A 3E6HA 1KTDA 5DHVB 5GGQH 2AI0H 5J6GB 4NO0A 3GUTA 4F33B 2YUZA 2IAMD 4LSTL 5C3LD 2B4CL 1EVUA 4UUJB 3ZYJA 1E6JL 3TBYB 2B0SH 4LARH 1P4BL 5HYJB 2XA3A 5FYJD 4Q9QH 1DQDH 4DFIA 1GXEA 1H3XA 4NM4L 3V4UL 1DDHB 1CICB 2LFGA 2ADIB 5JPNA 3NGBC 4XBGB 3WFHB 2XRAH 1AP2B 1T6VN 3BPLC 5C08A 2V9RA 4H8WL 4J8RB 4P4KA 4JFYA 4MJIA 1V3JA 3VXMA 4MB5A 5ACZB 3BKJH 1ITCA 1AE6H 3QZWG 4OLXH 4ZAKB 2UZIH 3RPIA 4TUOA 4HF5L 2DJSA 3D87B 4X6BA 3RKDC 4KDTA 1BQHB 3ULVD 1L0YA 2WZPD 3FFDB 3MRQA 4FZEH 5IVZB 3P9MA 2VQUA 1XZ0B 4HV8A 2PTTA 1I85A 2W60A 4HK0B 5GGTL 2EECA 3M1BB 4FMKA 3X12A 1NBVH 3LDBC 3QDAA 3FB8A 4OZFG 2X9YA 5DUPH 3DV6A 2DQEH 3S4SB 3VXQA 1FSKC 4GS7B 1FVDA 4WW1A 2WUCL 2P7TB 1Y0LB 2YC1A 1OM3L 4JJJA 4XCEA 1WAAF 4M1DL 3VW3H 4OIAA 1Y6KR 1S9KC 3RAJH 4HWBH 5K59F 5I76B 1IL1B 3EFFB 3WNNA 3GI8L 4U7MA 3HE7B 1DFBH 5AZEH 1U8QB 5FM5O 3IJYA 4HCRA 4LSPH 4RFOH 3PWLB 2IFFL 2CDGB 4I4WB 1GGYA 5DA4A 4X80L 3QUKB 4EBQL 2ADGB 1MCOL 4KMLB 4QRPB 3SDDB 4F7EB 5BXFA 4XAWH 2NY2B 2J88H 1P9MA 2Z92B 3JTSB 1R5IA 3GJFK 1BVLB 3R0NA 1QO3B 3DURA 3S5LA 2VR5A 5LVEA 5FUZH 1MFAH 2JKXA 2NX5B 1I1YB 1UB5A 1HH9B 1T89C 5GJSH 4HS6B 3CDFA 2BVOB 1Q9LA 3S36X 3TC9A 4N9OB 3UJIH 2R2BB 4NPYB 3QRFM 1S9WA 3OKOA 1K8DA 4M6AA 3B9KC 3SDXE 4XPHL 2ZOLA 1J8KA 4ZUSB 4XPFH 4JRYB 5GRVL 4G3YL 1DEEB 5DRWA 5JHDE 3WKHA 5DRXA 3CLEL 5CEZL 4H26B 5DHXB 5E0QA 5JA8B 4WHYH 3MJ7B 4JDVA 2DF3A 3N85L 2CO6B 3QEQB 4S11A 1H0DA 1QQDA 4MXVF 1CDGA 2CUMA 4MVBD 4OCNC 4QT5A 4Y19A 3H9YA 2BC4A 4GRWE 4UT7L 3WJLA 5I16B 2VDRH 1A3QA 1FL6A 4HIHB 4NZUL 1XGPA 4OGYH 1KJVA 4R6UA 1JPTH 3QIWD 3RX8A 3OQ3B 3TYFA 4LKXA 5HHPA 4MCYB 5IB3B 5INDB 3MLXH 4UDUA 1V5JA 4KMQA 3V0WL 1MHPL 3ZDZE 1YMMD 3HMXH 1RFDH 3B5HA 1GOFA 4JLRA 4NNXA 5ECJE 4C57C 5TDOA 3KJ4C 2XV6B 3V4VL 2EYTA 1ND0A 3IDMB 5LJYH 2QV2A 2I07A 1QUNA 3DRQB 2AJ3A 4AEHH 3BDYH 4Z7WF 2X70A 4O2FA 5C3TA 2X40A 4L5FH 4P5KA 2YPLD 4UU9B 5IF0B 5IBTH 2OMBA 2W0FB 5HHOB 1I9EA 4XNQA 3N1GC 4WRLA 1BZ7B 3HUJB 5GJTL 3ZSTA 4DZ8A 4KK9D 5I1DB 2FLBT 4J7RA 5IW3A 2W9DL 3VXRA 4QTIH 1CU4L 2XXCB 1FIGH 4LU5H 1K5NB 4YE4L 1VPOH 1QEWB 4XPAL 4FXKB 4HXAL 5DFTA 4DN4H 4OUOA 3PQYE 3VMPA 1ITBB 3VXTB 4TOYL 3LN4B 5DHYB 4V1DA 1A5FH 4JO4H 3WFDL 2DYPA 4NQED 5E8EB 3QI9A 4WWKA 1T1YA 1IS9A 4PJFA 1DQML 4XP1L 1MIMH 4ZNEE 5ABDE 4RAVB 1IM9A 1R3LA 3RZWA 5AAMA 5JW5A 3TO4C 3MV8B 4NN7B 3X3FH 5KVDH 1PJ9A 1OB1A 4JFDA 4BZ2L 4MD5B 1FP5A 5EZIH 5AEAA 4RIRB 4MQ7B 4UT9H 3F12B 8CGTA 1UXSB 1YN6A 2E7CA 4FQLL 3GHBL 4LASH 4HH9A 2GZ6A 2KKQA 1EJ6A 1W0YT 2MOVA 2HRLA 1GZPA 4A6YH 4YHLL 4I2XA 4K3GA 4XVUC 2VWEE 3QBTB 4PJBF 3MRGB 3T77B 1GGCL 1YECH 2DQJH 1KB5A 2Q3ZA 4U3XA 1IT9L 4G8IA 3MCG1 4LBEA 4RFEB 3G6JA 5E6YA 3VH8A 2PXYA 2V17H 3RVVD 4NP4L 1HYSD 3LKPB 3MRJA 1BZ9B 3A6OA 4RBPK 2A6IB 4F7PB 3LN9A 5IESL 4LCCC 2FX7L 4HG4J 1OLZA 1AC6A 1DBBH 2VDKH 2WV3A 4YC2B 5J1TC 1LD9A 4Z0XB 4F58L 1SYSB 5FKAB 5D7LB 1RSFA 5FHAH 4ODSL 2EZ0D 4C58B 5DQDL 3S88L 1HCFX 1KJMB 3QIUA 3MMEA 1JFQL 2D7TH 4M6NH 1ADQA 3U2SB 4OD1L 4X7SH 1A6UL 3LEYL 3GJFH 4F2MB 1DP0A 3O6LL 3G6DH 2GCYB 4XAKE 4AEIH 3RGVC 1BFVL 3OKDA 2ADJA 3BPOB 4XH2B 2BVPA 5HSFA 3N1PC 1J0HA 1JPFA 2JB5L 3BXNA 3ZTJG 4ZDHB 4PRDB 4XCYA 1N5YH 2NCMA 4YHKH 3DWTA 2V2XB 2UWEA 3IU3A 4Z7NF 5H35B 5D2LF 1NFKA 2J5LB 1UJ3C 5E2TL 1QNZL 2X4NB 3STLB 5C70A 2XFXB 3T1WA 4FFVD 3WDJA 3PDOA 3NIGE 3RY6A 5IK3A 4E5XA 4X6DA 5EPMB 4HULB 3FFCB 3C60C 4WFGE 3C8DA 3BN9D 3GSXA 4JVUA 5DR5L 4NCDA 1BEYH 3D6GA 4G8EA 1LO2L 5D1ZA 1S7XB 1NEZB 4BK4A 3P40A 4Y4KD 4Z7OF 5H94B 3FTGB 3QDJB 1CQYA 4JAMB 2C3VB 4IMLB 3KPRB 2ZCHL 3VD4A 5JUEL 3QPQC 4G43A 1DSFH 5CJOH 3WJJC 4AK1A 5KZCD 3DUHA 3ARBA 4U0QB 4D0BA 1UM6L 4D8PA 1XGUB 2ATKB 4LVNC 3VMNA 4UINH 5FYKE 4K3HA 3DGGB 4NQDA 1H3WM 4ZS7H 4DOHE 2WWMD 3K46A 1WTGT 4XWGL 3BI9X 1PDKA 4P2QA 1B6UA 1J12A 3ARXA 1XGTB 5MEQB 2CMRH 3GBNL 1O7VA 2CH8A 1FYHB 1UVQB 2CGRH 2DKSA 1TPXC 5CD3B 4HKXB 4PGEA 3VD7A 4DAGL 2RJMA 1KB9J 2B2XH 4ONFH 4L4JA 3O4OC 5KN5B 3HI1B 1MWAB 2Y7QB 4NUJB 1S9XA 1J87A 4K23L 4OSUH 5EC1A 1QSED 4NN5B 2AEQH 4H1LG 4XPTH 3ANKA 5DJDB 3PQYD 4Z7QE 4KVNL 4W4NA 4LGSB 3F62A 5LWYH 4KMTH 3W7WA 4QOKA 5IOPB 2OK0L 2HH0H 3MJ8A 1TTUA 2AXGB 3J8F7 2FBAA 4QXWA 1QPPA 5E24E 4LHJB 1X4XA 3TF7C 4L3EB 1GGIH 2YN3A 4UV7H 1YPZA 4KRNA 5ICXA 1ED3B 4XNUH 1VFAB 1H3VA 1ORSB 3GSNH 5TJWK 3AM8C 3HNTL 1CGUA 3AS0A 3WKIA 4XT1C 1X7QA 5E1HB 4MLSA 1HH6A 2PCPB 3MZTA 2SEBA 2Q6WB 3MCLH 2QADD 3B2UD 3SBWC 2P24B 4ALAL 3QULA 3NPZB 1EMTL 3SO5A 4LEOB 5ICZB 5F8QC 3TYGH 5IP4A 1JUFA 3QDME 5TE7H 4RZCA 4PREA 1TETL 4EDWL 4PB0L 2NY7H 2YD3A 1S5IH 1XGYH 2Z91B 1N0LA 1T1XA 3WUXA 2VXVL 3G5XB 4LF3A 4UQ3A 3HAEB 3DX8A 2ZOKB 5IB2B 5IEHB 1KYOJ 3NBNA 4JJHA 3D3VD 4RBPH 5INCB 4K8RH 4RGOL 3VWJC 3PXHA 1YEGL 4HDIB 4Y5VB 5DMYA 3U4BH 4KTDL 4YPJA 3L1OL 1LMKA 3VE0A 1IGMH 4Q6IB 4HBCL 1JYXA 3T4YB 2IQAA 4JFEA 3GMNB 4JFOA 3LEVL 1BLNA 2QR0A 5DJXB 3E8UH 1RUPL 4LSQH 3O3DA 5I1IH 2FWOB 5T1KB 4G9FD 2F6DA 5SWZE 1JRHI 3LHPL 4I0KA 3HKFA 4X6CE 3DX9B 1SYVB 3N50A 4ODXA 5F1NB 4IRSB 4X6EA 4FXGB 5F6IC 1JS4A 4PRPB 1YYML 5ACLA 5M7QA 3B9KA 3DTXB 1U41A 3X13A 1FCGA 4RA0C 2QSQA 3HE6B 1RK1A 3R1GH 4YUEL 4NO3A 3FQNA 4PJ8C 4N0CD 4YXHL 4RAUB 3VD5A 1BIIB 2C3HA 2H3NA 1SVZA 5J12C 1FVEA 2P5WA 3EJYD 4FQJL 3L95B 1E6JH 2R8SH 3MV01 1P4BH 5SWSA 4WFGD 1GAFH 2XZCL 4JY5L 4NM4H 3V4UH 5HVGB 4ODHH 5IQ9A 5KANG 3UYRL 3VW5A 5AUMB 3SJVD 4U1SA 4KXZI 2FV1A 4GBXD 3QPFA 1MCHA 2OX5A 1Z3GH 1ZHBA 1JMZA 3O3BA 3V6FA 35C8L 1I7ZB 1TIUA 5C07A 4Q9CA 4P23B 5H2BA 2WBKA 4HF5H 1KLUA 5A2KH 2O61B 5I75B 3D48R 4NDMA 3GO1H 3WKML 1F2XK 4AIZA 2MSPA 3ARDB 5EBWA 1AGMA 4OZGB 5C09A 1IGTB 4ZO9A 3V6OE 4MZ3A 1C16B 5HHQA 4JQVC 1ZVYA 1IAOA 5GGTH 1KCRL 3J7HA 1WAAA 1QA9A 1RD6A 1A4JB 5EIIA 4HZLB 4TVSa 3HZMA 3UBXA 4Y4FC 2Y5EA 3S34L 5K9JL 5J13C 4MGXA 1NH6A 3NTCL 3FB7A 3VFTB 3IDYC 4XBPA 1MEXL 3VG0L 3SE8L 1MFCL 1T2QL 5C0GB 4M1DH 5T1LA 2YD1A 4LIQE 5CP3A 5FF6B 3C5SB 1DANT 2CK2A 2CLZA 4TSAL 5DQ9B 4OT1L 4I3RL 4W68A 3VXOB 5B39A 4L6XA 4KROB 1KEMH 1CYGA 2A9ML 2YWZA 2FGWH 5E5MA 1X5FA 1ROWA 4JGUA 2IFFH 3UTSB 2HKHL 1T0MA 3BHBA 3E3QE 1MCDA 3DYPA 2QTEA 1A9BB 4ODVL 4ETQA 3TO4A 1EX0A 1MCOH 4PJDE 3X14A 1YEDB 2E9WA 5D93C 1S7RB 5HGHA 1KT2B 2XN9E 4D9RE 5C6PB 3G04A 1KWFA 4WVAA 3KXFE 3CFDA 3HMWH 5DURB 5C2BH 1H5BC 2AW2A 1XF3A 3LKOA 4XPHH 5HJ3A 2OSLA 1ZT1B 5J11B 1YA5A 3BPNC 4G3YH 5CEZH 3CLEH 5ADOH 1F00I 2V2WB 5CEYA 4NT6A 5DD1L 5DJ2A 1TVHA 2EIZB 1Z9OA 1HK6A 4N68A 1Q0YL 3NABL 5JZ7D 2ZSWB 3WN5A 4X7DC 5I6XB 5T3ZL 3PL6A 1MFNA 4XHJC 4LCCA 1L0XA 4M6ML 3UMTA 2MQ3A 2I26N 2LABA 3SDAD 5I9QB 1XR8A 2R0ZL 5C0EB 1RZKC 5ALBL 4WDIA 1NPUA 3QSKB 2VH5L 1NEUA 2F54B 4DVRH 3IKCA 4Z7WA 1P7KB 4XP6H 5H8DA 3U0PA 3DMMD 5BV7B 2N4IA 1DANU 2NY1D 3MOAL 4KQ4L 1B2WL 4U6HB 2X4OA 3V4VH 4YBQD 5IW6A 2QKIB 4PTUA 1WBZB 3RWFA 2IH1A 1T5WA 1RZIB 2MKLC 1EAPB 1BJMA 3BE1L 3I02A 5C8JA 1GC1L 2A6JB 5CGYD 3RGVA 3B9VA 4WI2A 5C7XL 1ONQA 1NGYA 5GJTH 1Z5LB 1KCLA 4MNQA 3DROA 5HGAB 3HRPA 3MV9E 1JZ5A 1CU4H 3BQUD 3BSZL 3WCYA 3EBAA 3HFML 5EWIL 2VLJE 4YE4H 1UJ3A 1WLHA 4XPAH 3OPZL 1L7IH 3QEUA 4MA1C 2BFVL 2V9TA 2P1YA 1BIHA 1T2XA 3ROOA 1AO7A 5F1OB 4TOYH 4HS3A 1A7PL 4E9LA 5IMOB 3C60A 5L7XL 3L5IA 2BOBA 4RNRA 1V8HA 3WFDH 1KELL 2AAVA 4KKLC 1AKJA 1J7VR 4CAGA 5KSVA 1DQMH 5EU4B 4CADB 4HUUA 3E2HC 1RJZB 1U8PA 5HDLA 3W0WA 1NC5A 4NKQB 4LCWB 4P2RA 3OR7A 1D5ZA 1H3PL 3IDJA 1GIGL 5EIQA 3WJJA 2NQCA 5FKPB 5TH2B 1QP1A 4PJBA 5F6HJ 4MNHA 2IANB 1SEBB 2EEDA 3F6LA 3BUYB 1DQLL 1NDMA 1QHOA 2APVA 4TF4A 4XWOC 1SMAA 3D25A 4YHLH 4KK5D 1J88A 2O5XH 5C0RL 3O6FD 4KPHH 3BO8A 2BNUB 1IT9H 3QIBB 4Y1AA 2DQIL 5HHMB 4UT6H 5GPRA 4GKNA 2V5MA 5IFJB 1MRDL 2B20A 2X1OA 1HHHA 2VZ3A 4NP4H 3WEXA 3S36L 1NSNL 1ZT4A 2JF1A 4RFNC 4MB4A 3GEWB 3T0ED 1BREA 5IESH 2FX7H 4UIMA 4R26L 1DL2A 4JHWL 2BVTA 1KJ2A 1CZ8H 2OQJA 3SGDH 4CMMB 3NZ8A 5C08E 5JMRA 4GAGL 3HZYA 4OLEA 4M48L 4TRPL 5HXMA 4XI5C 3S88H 3KPLA 4KI5F 4MJIE 4MA3B 1SBSH 2VLKB 1PKOA 5JOFB 1JFQH 3CVHA 2WIIB 1NFDF 1OTUC 4OD1H 4OZIB 1WZ1H 5D5MF 3T3PF 5DJZB 1U8NA 3O6LH 2X4QA 3BFOA 2DQFB 2JCCB 3AM8A 2XZZA 4I0CC 2XN9D 5HYIA 4XC3L 3ALWA 1OF2B 3ZKXC 2WSKA 5D2LA 1JZ3A 3SBWA 1DBJL 4HJGA 5HI5D 2JB5H 5KSBE 3MRPB 1W8NA 2RIKA 1FYTB 3HCVA 5GZOC 3BP6A 4ZXBB 1G9NL 2WK2A 4UOJA 3UTQA 4MDIA 3W7XA 4I77L 2FEEL 2ZWLT 2YZ1A 4PD4K 2F8VA 5GW7A 2IGFL 5E2TH 3LZFL 4KKCC 1XCTB 2DRSA 2YBRB 4DN3L 2NY3C 2VSDA 4KJWD 3QSPA 1KACB 3MBXL 1F58L 2O5YH 3KR3H 5DDHA 3LQZB 1B4RA 3KYOA 5DR5H 3PP4H 4JRWA 3IDXL 4EJ1C 1IQWL 3HC0B 3VWJA 5HYEA 4PRIA 4UIKL 4PJGF 2VLRB 2NY0C 1CDCA 2WINB 2ZCHH 4P46B 1L9MA 3QUYC 5JUEH 2WBJB 2V6HA 5EIVA 2PO6A 2ARJB 5EBMB 4E41D 1ORQA 1OWRM 1UM6H 1PGRB 1WZMA 4QCIA 1GPOL 1OY3B 4U6XB 1KPUA 2DIBA 3WHE1 2OR9L 5EUKA 3ISWA 3ARVA 1AC0A 4OFKA 3Q6GL 4K8RC 4OBRA 3IJHA 3QHZH 1U8IA 3ORJA 4YFEA 3VFWA 3V79C 3GBNH 4I1NB 3MYZA 4HWBA 2FECI 1PYWA 5F89B 4C56E 1N4XH 2EDFA 5EFIA 3KPPB 1LEIA 2F8XC 2IPTL 3MV9D 3RVTD 1ZGLA 5CBEA 4PJ7E 1HSAA 2H32H 2XT1B 1FGNL 1QVOA 4PJ8A 4K23H 2BDNL 3CVIH 3VFVB 1DTUA 4KI5C 5IMLB 4KVNH 1ZOXA 4ZPTA 3P2CA 4FFWD 2C1PB 3WL9A 2MPAH 1TENA 5ALCL 5I66B 4JG1H 2FUZA 3MLTB 1KN4L 3U7AA 32C2B 2DJ4A 4POZC 2VISB 1H9VA 5JO5A 5A3IC 5DYOB 3RY5A 3EYOA 2AJZB 2WWKT 4MD0B 4OF7A 4Y2DD 4HIJB 1HEZB 5EORH 5DD3H 5EUOB 1HXMB 1ZVSA 3HNTH 2HVJA 4PJIE 1OT2A 3ARQA 4N0FA 2FIRT 4MSWB 4RMVA 5AYQA 3IS0X 4U1KA 1JHKH 1BD2B 4BUGA 3AS2A 4JANA 3TH3T 3QQ3B 4PRBA 1EMTH 2D2OA 1JP5A 4N0UE 5C0JA 4AMKL 1WBXA 5FOBA 1YEFH 4GRMA 5LGJB 2VKWA 4EI6A 3MNVA 4FXLA 4EDWH 2Z4QA 1HNFA 4PB0H 4YEEA 4JQVA 4X99B 3QUXC 5F1IB 4XXCC 2VXVH 4WCYL 3FRUA 1DE4A 3BZFA 3HMXA 4Y4FA 1B0RB 1S78D 3MGOA 1WJ3A 4OQTL 1QTYT 5I73B 2X89A 3DX6A 1XIWD 4GW4A 1ZWIB 2AK4E 2DQDL 1RZ8B 3L1OH 3NFPA 4BM7A 3L6FB 5LGHL 2FJHB 1INQA 4R4FH 2GUOA 4P4RA 1FN4A 2I27N 3LEVH 3BGMB 3H7BA 5C08D 5JR1L 1CI5A 1RUPH 1JZ2A 4OCXL 5JDJA 2ILLA 3JVGC 5KS9E 3ZL4L 4MJID 3W9EA 3O9WB 5J8OA 1NFIA 3LHPH 3QUZC 3VFSB 4F37F 3ELAT 2YS4A 5F9JB 3OF6A 2AQ2A 2ENYA 5IB1A 4HC1L 4ZQKB 1FFOB 3SDCC 4XUVA 2MHAB 5ESAB 5DK2B 4PUBL 2HWZL 3KGRA 1M4KA 1YYMH 1P84K 1IC5H 3MRMA 4R4ND 2AHGA 3WIRA 4Z8FH 4X4YA 4UV4H 4ZYKB 3V5HB 5T5FL 3LPWA 5EOTA 1E4WL 1V05A 1MVUB 2PW2B 3A6CH 2EIEA 3FOMB 2Q86B 4Y8AA 4XMLH 4OM1L 2LU3A 4NSKB 4PJ9C 1TLKA 5BJTA 4FQJH 4ZO6A 2CLRA 3CFCH 2FATH 4KGJA 2F58L 4QNPF 3PWPE 4TSBH 3SE9L 5AAWA 1FFPA 2AXHA 3LS4L 2XZCH 1FJ1A 1JTTA 4X7EC 4HQQL 4RSVA 1WFUA 5FAAA 1I1RA 1NGXA 4PJEE 4N5ED 4LKCA 4U1NB 1CGTA 5C9JA 4CMHB 4A6YA 3WHXA 4XCFH 2J2ZA 4KRPC 2HLFD 4HEME 3V0AC 2BCKA 1UWGL 2KZ1B 4PYHA 1OSZA 4OFYD 5CHNB 1FNGA 5L2KA 4DODA 5I8CA 2DTMH 4U31A 5F44A 4AYPA 3BAEH 3G5YA 2XWJB 3WKMH 4NN6B 5EH1A 2OZ4H 4QHUA 4LPVA 3NCBB 1VKXA 4Y16C 4EI5C 4LEXL 4DGVL 3FQUA 2BRRL 1KCRH 3B5TA 5CKGA 3LVEA 1ZK9A 2H26A 3GSVB 1MRFL 4R4BA 5EN2B 5K9JH 1DQJB 2UYLA 5HVHB 5DUBA 4Y19D 4IS6B 5E8OA 4WU0A 4KKBD 3NTCH 4XPGL 3MQIA 2EABA 2W1NA 1QFHA 3SE8H 4DZBA 4E0RB 1T2QH 1FFQA 4HWZA 3GJFA 3UC0L 4OT1H 3IXAA 4WHYG 1VADA 2VZSA 4YZFF 1OP5K 2HMIC 2J7LA 1QFUL 5JNYA 4MAYC 5DHVH 3UXFA 1F4WL 1OW0C 2HKHH 2PKDA 1HHKB 3ULUL 2NXZC 4D9QE 1X5ZA 1NMCC 5GIRB 1NUFA 4LLUB 1WCBB 4UTAH 5ID0A 1CFTB 2G9HB 1INEH 3N1MC 5CCKL 2ICEB 1CE1L 1OLLA 2C3GA 5GGRB 5H37H 2GFBA 5IVXB 1YMMB 4BSVB 1WWCA 4ORZC 1NJ9B 3CUPB 3C8KA 4JPKL 4X8JB 1BJ8A 1FV1B 4BKLB 1AHWB 1A47A 2FSEA 4YH6A 1GRWA 2QQNH 2X1PA 5E2UL 2HT3D 3GMMA 3BT2L 3ECBB 3QUMB 2YPLB 1AD0B 15C8L 2JELL 2XPGB 1Q72H 1R24B 3BIKB 1Q0YH 3NABH 4KZEL 2N56A 5J6HB 4X4MA 4V1DD 1J8HE 2GITA 3O81A 2DYPD 5KJRL 4ZUTB 2AK4D 4M6MH 5BRZE 2RI8A 1KF9B 2IWGA 5D7IB 1PZUB 1HI6A 5EBLA 2JF4A 3MBEB 3VXSA 5SX4H 4LLYA 1KLGA 4JFFE 4X5WA 2ERJB 4LMQE 4D94A 4KQ4H 1U42A 4KFZC 5D71L 4NQEB 2YD9A 3ZT5A 4FZ8L 3RIFK 3TFKC 5IR1A 3BGAA 2CIKB 2X7LB 2IMNA 2X4TB 3BE1H 4P3CL 1GC1H 2X4RB 5GS0L 2HFTA 1XWTA 4PP1D 4R97B 4L8BA 3KVQA 2NW3A 2EXYD 4S1SL 2PXYD 4WEBH 3HPLA 4AYOA 5DJ0B 3DXAA 3O6KH 1CFVL 5IHLB 4XVTL 5J0BA 1PZ5A 4LSVL 5EWIH 3TPUB 1A7QL 4P2OC 1OGTA 1OGAE 3PHQB 1D6EB 4PG2C 3GSNA 3BESR 4YR6B 4ELMA 3WNOA 1A7PH 3UBXI 5L7XH 3P4NB 3DVGA 2KH2B 3PWPD 3S4BA 1KELH 5D7JD 5EO0A 1TNNA 1MHHB 4OCRL 2FJGB 2C1OB 3OX8B 1A7RH 5IQ7L 1G9ML 4K7PY 4WVRA 5ANMB 1WFTA 1E27B 4JY4B 2HAZA 1MI5A 1BFSA 4NWUH 4LQFL 5JW3L 4U0RB 4MXQD 1GIGH 3MSPA 5IM7A 1YYLL 3D9AL 3I6GA 4JFPA 3OXSB 4ODWB 1HOCB 4FN0A 4HX1B 2R1YA 2UZYB 4X98A 2P8LA 1DQLH 2NY5L 2YN5A 1XW2A 4X5XB 1A4KA 5I1CL 3RDTC 5A16A 3FO2A 5I8EB 3EYFA 2HT4D 3U46A 5C0RH 1RUQL 2B8OT 5BV7L 4Z76B 4Z7VF 4WNQB 4HJ0D 4EN3C 1KSRA 1FRGL 4UDTA 3AB0C 4ZUVB 1CDBA 1MRDH 2FEDD 3MYJA 3RWJA 4DEPC 4I48B 3T3MF 1HILA 1NSNH 4MX7B 5J57B 5DJ6A 5GRWA 3WKGA 5D1ZD 2C7UB 3FZUC 3BGFB 4L8DA 1LP9F 2X4SB 2OR7A 1OP5H 3QO0A 4OFIA 1NFDA 4GRLC 5D6CA 1CLZL 2VAJA 1JPSL 4QY8B 2HJFB 4M48H 4XBEL 4U6TA 4EUPB 4L1DA 2H1PH 3QWTA 1FBWA 4GRWB 3S96A 3VRLF 4NQDD 1L6XA 1I3RB 4GO6B 2YMXH 4Y4KB 2BJMH 3SKJL 3OKKB 4BQ9A 5HD8D 3SHSA 2IMMA 1ES0A 4OZHB 5J1AB 4R9HA 1DBJH 5KZCB 1VDGA 5GSVB 1WAAE 3WYRA 5EZOL 3MNZB 4YHNA 5FDWA 4M4RA 4I77H 4PV8B 2AK1L 3D39A 4QRSA 1NEZG 4KC3B 3TCLA 4YHYB 5BVJB 3ZKMD 1TVBA 4GMTL 5I1HL 4G8GE 4DN3H 5E7BA 1QKZL 3DVNA 3QUXA 4PJGA 4PY8J 3QDGE 1D5XA 2NY4C 3SKOA 3RU8L 1RQ5A 3SQOL 1RUAL 4OFPA 2H2PC 2NY6C 3LRHA 3MXVH 4OZ4A 4QOKD 5DEGA 3X11B 3IVKB 1IQWH 3QHFH 5E8NB 2X4PA 2CK0H 4UIKH 5BRZD 4WI4A 3P0GB 3GIVA 1N64L 4LAQH 1QSEB 1JK8B 5JLZA 4HWNA 3PQYB 3MACH 4JFFD 5GGTA 5F9WC 4KJQD 4KH2A 3JVGA 4C4KT 1OTTC 1G7MB 4M93C 4N8CH 4TUKL 2OR9H 3OHXA 1P4LA 2YXMA 1EV2E 3QUZA 4MXVE 3BP4B 5LAXB 2J8UF 1KIQB 3RKDD 3ZHDA 4JDZA 2HVKB 2QQQA 5FA4B 4RGNE 3SDCA 4ISVA 5EOCL 1ZS8B 4TQEL 4V2BA 3KPSE 1NCTA 4KUCF 4PGZA 3MRRB 1ZANL 4YNYB 3BVNA 3VWKB 3IAPA 2IPTH 2QADB 2NXYC 2Q8BH 1WWBX 1GLMA 1YY8A 4LSRH 1FGNH 3EDDA 1SMOA 5KSAC 1M7IA 4Y0GA 5DVKA 1O0VA 1ZKAA 4ESKA 4ZSOE 2VLME 1CXIA 1BAFH 3BP5A 2VDPH 3OKLA 1CGVA 1I1CA 3H3PL 5IMKA 3JWOL 4JFED 5ALCH 4OF8A 4ELKB 1QFOA 4GMSL 2Y72A 1FNEB 3OAUH 4WVBA 1K6QL 4JEGB 3D3VB 1RUKL 2G5BB 3KPMB 5GS2D 4CNIB 1CGSH 1AXSB 2DRRA 4JZNA 5HPOA 4JHZA 4HIXL 4KGLA 2CDEA 1T0NB 2XWTB 1J05A 4NBYB 5F7DA 4UTBL 2DOCA 3PV6A 3KWWB 4AMKH 1TQBB 1TZGL 1MRCH 1J1PL 4RISL 2R2EA 4U33A 1YUHB 2N1KA 4EI5A 4OQ1A 2Y36L 3EO0B 2VR4A 4FMFA 4Q2BA 1DQQA 3C9NA 3UAJD 1SM3L 4YDKH 2D4DA 2P5WD 2J6EL 2QHLA 3SOBH 4OQTH 1SJXA 3BEVA 5SWSD 3A3VA 1FZJB 4JRXA 5T5NF 2HN7B 3G5VA 3G6AB 1YEEH 2DQDH 5DEFA 1FFNB 3LOWA 2DQHL 3BP7A 3CCHB 4OGXH 1G7LB 3W0WE 4NKMB 3IETA 3MXWH 4PGBA 3ARGC 4KDWA 4HBQA 3V5KA 3REWB 3EYQC 4TYUA 1XGQA 4XNXL 5JPMB 3WV0A 5CBAB 1MWAH 2J1KA 1ZLSL 1X5AA 1N8ZB 4MAYA 2VN7A 3WD5L 3EO9L 1YEIL 3ZL4H 1R3KA 4KJYB 5IVNA 5C07D 3U6RB 4NO5B 4ZUWB 2NTSP 5K9QG 3C09B 3SJVB 2GJ6A 1CGXA 2ITCA 5CZVL 2RFXB 4HC1H 3NIFF 3MJ6A 2JTDA 5D7SL 3QNZB 4Q0XH 5C09D 3ZMRA 4HGWA 2HWZH 3THML 3LQMA 1R3JB 2BSSB 3GM8A 2EYSB 4YDJA 2VAAB 5E2WL 2JE8A 3RVXC 5T5FH 5CAYB 1E4WH 1JVKA 4FQXC 2BVUA 5I1AA 4K7PX 1F6AA 2GT9A 2EYRA 4DOHB 1WIPA 4JO1L 3QDGD 3TBSB 1IEAA 2ZPKL 5CEXB 1T04A 2E6JA 3MCKA 3WC3A 3BKML 3I85A 1AQKL 3OG6B 3QHTC 3LS4H 1CICC 2FZ3A 3MREA 3LSOA 4K9EC 4LLVA 4HQQH 4AG4L 5JOEA 3MUGB 1SHMA 4OLYL 2BX5A 1N7ML 4L9LC 2YOCA 1B4JL 1K4DB 3HAEH 1BZQK 3OXRB 3TBTB 3TO4D 4OGAC 2VITB 4BZ1L 1UKSA 3D0VB 5JXEA 5GSRA 4ZAKC 2YZ8A 1M05B 1TZHB 3T04D 1UEMA 3GMRA 2VLLA 4M61B 2VJXA 1S7TA 1JIBA 4B7IA 3MRCB 5F7FA 3HN3A 3KLHC 4D0DA 4Z7UA 4OTXL 4CVXB 4JHAH 5HYSA 1KTKE 4DVBA 3Q2CA 5JDSB 4XVUD 2BNRE 4O9HH 4LCUB 1EBPA 4DGVH 1VA9A 3HZVA 1TJIL 2EXWD 2GTWA 5FYJL 1V3MA 5FYLH 4MDJA 3ESVF 3O8XC 4N8VA 4GS7C 1CLCA 1MRFH 1NLDL 4JZJB 1J5OH 1IAKA 5DWUH 5EBGA 4HUXA 1IGCL 1CXHA 1F13A 5KW9L 3DBXB 4LGRB 3FONB 4XPGH 4R96A 4P2OA 2WNGA 5CILL 4PRIE 2BY2A 3UC0H 4KUZL 4PG2A 3RWIB 1XF5A 1GC1C 2R56L 4HIIA 5BQ7B 4LDEB 43CAA 2R1WB 5HY9B 3IDIB 4LPTA 1DL7L 4B7LA 3SDDC 1BBJA 3ULUH 4XRCA 2V2TA 4HUVB 4U1HB 3ULVL 2AVGA 3CFEA 1Q9KA 4PR5A 4MJ6B 1KENL 4GFTB 4DGYL 4RWYL 1KBGH 2FD6L 4JFQB 2PYEA 1I1AC 3SDAB 4PGCB 4AZ8A 1CQKA 4ODUA 4ZS6C 3OBAA 5IEKB 1XH3A 1CE1H 3C5JB 5T3ZE 2GY5A 1M1SA 3RGVD 1V5CA 4TPRL 3RDTA 5BMFL 3DMMB 4MNQD 5K9OB 3LV3A 2IF7A 4JPKH 2NY1B 3SGJC 5F7KC 1K2DA 2W92A 5IW1A 2B7DT 4EN3A 3D1MC 4M7KL 4LHUG 4X6CB 4QHKJ 4QRRA 1AO7D 4KZEH 3B3IA 4YIQA 1EBAA 5HI4C 3C60D 1KCUL 4HJJH 3F7RA 2N7AA 2UVFA 5FGSA 1G7IB 3BZ4B 5I19L 3ZKND 4FOMA 4EVNA 3PABB 3MRNB 5DS8A 4WWID 4R8WL 2IADB 7FABL 3BQUB 5EO9A 3HNSH 3W0WD 1KJ3L 1NMBL 5JW4M 3EOTL 3CDCA 4XCNA 2W65B 2DWEA 4GRLA 5K9KB 4P2RD 1OWWA 1NC2D 2YKLL 3QPQD 3TN0A 3IDGA 4S2SB 2VXTH 1IILE 3RIFF 1GCFA 2VL4A 1YMHA 1F8TL 5I18L 3S37X 2NX5E 3RWCB 1A3LL 1I9JH 4QRTB 3LKSA 3WIFA 3E1F1 1QSZA 5DD0L 4AENB 2H32A 1LHZA 1AGCA 1UM4L 3EZJB 1JNLL 3U1SL 4P3CH 5GS0H 2Z8WC 2BNQA 4YGVA 3MLUL 3VFMA 5T1DL 4Y1AD 3GMOB 4XZUA 4KVCL 4F57H 1PQZA 5CWSB 4U1JB 5EU3B 5FUCC 4PJXB 1NGZB 1CFVH 4LSVH 5IB4A 3PWVB 3QXDB 3BX7C 1F3JA 2MCPL 4JVPA 4G6AC 1PY4A 1R5WA 3RVWD 3O6FB 1JPST 4CKVX 3RNQA 2CD0A 3DSFL 1UT9A 1YQVH 5DMGC 3GMQB 3RZCC 4OCRH 1UKQA 2CRMA 1G9MH 3QUML 1G9EA 2CUIA 1X5LA 5DVMA 4PP2B 3BWAA 1B90A 4Y5XC 4BSWB 2NPLX 4XGZB 2AEIT 3HLAA 2H6PA 3PMMA 3D9AH 1PKQE 4WW2B 3U4AA 2H9GA 1G87A 4TVPH 4Z7VA 3TVMC 1FZKA 2NY5H 1IE5A 3IF1A 3KLAB 4N8VG 5I1CH 2Y5TA 4C83A 3LCYA 1WIUA 1RPQA 3ON6A 4LAJH 2F53A 1OSPH 2MQCA 3VCLA 3NACH 1KLFA 2BNRD 3L3KB 4PJDB 1N5AB 1MCPH 1FCEA 3MUHL 1CFSB 2AXFA 2XN9B 1S7QA 1JRHH 3LKQA 1M6OA 1WWAX 2DBLH 3KXFB 1LP9A 3CSYA 3BISA 1OAKL 1C5CL 4U1MA 4HKJB 3QZWB 4H0HB 4P3DB 3VWJD 1IGIL 1YNKH 3GRWH 4PRID 4YC2C 1TJHL 4F3FB 3G9AB 2W9LA 3FO9A 5F3HA 3QQ4B 1DVFB 3IRPX 5KVMC 1BX2A 1M7DB 1FG2B 1ACYH 2R4RH 1MHCB 4XP5L 4WI3A 1JPSH 1T1WA 2EKJA 3KDMB 4NYLB 3VFUA 1DLFH 4GW5B 4N1EA 3VA2C 4IOFC 4WIQA 1FL5B 3BRGC 5E5RB 1A1OB 3W7SA 2G75B 3WE6B 5FHBH 5F7UA 4OZFB 3IT8D 1ZTXL 5DT1H 5LQBL 2A0LC 5K93A 1WT5A 1GHFL 2GK0A 3BPOC 3EFDL 2FL5A 1H8SA 2W07A 3TZVD 3R4DA 4UOW1 1P1ZB 4FQIL 3MA7B 4O51A 4E41B 3ZT6A 4KXZH 3U4EB 5C0NC 4J23A 3QWOB 3TO2A 5EZOH 1T1ZB 1EZVY 3MRBB 2J5LC 3NVQA 3VI4F 3WDIA 1CD9B 5FEBA 2AK1H 4X7TB 1KPVB 4PY7B 4PJ8D 5I1HH 1QOKA 5KTEL 3S9DB 4CVZB 5EZJA 1HYRC 3WUZA 1HCUA 2GSIB 2EDBA 1RUAH 3QFDA 2X09A 3UYPA 4GUPA 5TF1H 2BXZA 1JF5A 4ZO8A 1VEPA 5I71C 4LP4A 3MV9B 1C12A 2XNAA 1A21A 1KIRB 3VXNA 1N64H 3ARGA 2OZ4A 4L4TA 5MENA 1A1NB 4YK4B 3VXUA 1FNFA 5KVEL 3MO1B 5DGQA 2ZZRA 3V6BR 2J8UA 5ESVB 2CRZA 1OARL 1B88A 3BPCA 4D2NA 3CZFA 4OV5B 5E2VH 1MCCA 1PEWA 5B8CC 3W81A 5AWNL 1A6TB 1BBDL 4K55A 4NQXB 1L2AA 2X4UA 1SJEB 3S35H 5CP7A 5EOCH 4HLZH 4TQEH 5I74B 5IROC 1MIEH 1HWGB 1YY9C 4KRLB 4OJFH 3KPQB 2AQ3A 1X6LA 1FQ9C 2M1KA 4HFWB 1FZOB 4AEEA 4NC2B 4FQXA 4Y4FD 5DHVA 1N2RB 1AGBA 4N1CA 4D0CB 4NN5C 3IB4A 2BSRB 3FRPA 4F33A 4S0TD 3FL7A 3I3BA 1BOGB 5I2IB 4UUJA 3TBYA 5HYJA 4YWGH 3ULSB 4XCCH 3GJEB 2GSGB 3R8QA 1T20B 3HA0A 1Y18B 3E6HB 3UJTL 1KTDB 3ULUF 1CICA 5ID1B 2ADIA 2ED7A 3N9GL 4XBGA 3WFHA 1FO0H 4NC0B 4L9LA 1KGCE 4P5TB 1XIWB 3EO1A 4J8RA 4GXVH 1Z9MA 1G7HB 3MUY1 5ACZA 2JB6A 5E4EB 1F11A 4MJ4A 1T21B 4ZAKA 5IKCB 1NXCA 1LEKA 1BFTA 4PBXA 3FN9A 3BW9B 2R1XA 3AXLB 4OCSL 5FDYA 5C08B 3L3OA 1I7UB 4ZOEA 5DJCA 1BQHA 2EIBA 5L9DL 1TZGH 4JFYB 4MJIB 5DZNA 1FO2A 4RISH 5IVZA 1XZ0A 4HK0A 4X6FB 3T2NH 1UZ6F 4TUOB 3E6FB 3M1BA 5C0AE 2QSCL 2W91A 4X6BB 2FCBA 4M3JA 1O7SA 3S4SA 4OZGF 2P8PA 4OAWB 3O8XA 5HHXL 2J6EH 3LRGA 1KUMA 2Q8AL 1Z0NA 1KCKA 2P7TA 1Y0LA 2PF6A 1MH5B 4NBZB 1KCVL 2JJSC 4HV8B 5KSBB 1GSMA 3X12B 2Z8RA 4XHJD 5I76A 2P5EE 1DJSA 5JQ6L 3IFLL 1IL1A 3DV6B 4XVSL 3VXQB 1GAIA 2OI9B 2RB8A 1KEGL 4WW1B 2YC1B 1TTFA 4XNXH 3O2VL 2CDGA 4I4WA 1HCVA 5GY3A 3QUKA 4XP4L 3BZEA 1OTSC 3EO9H 2ADGA 4AL8L 1HQ4B 2FDBP 3SDDA 4F7EA 2Z92A 3JTSA 1BVLA 1U3YA 1ZLVK 2APXA 5FFLA 1F3DJ 5GS1C 1I1YA 1HH9A 1I1AA 5CZVH 3HTLX 3S8WA 1QFPA 4NPYA 5D7SH 4P99A 4P5MA 5E70A 5TQ0L 2A83B 1EFXA 2VZVA 1ZLUK 3THMH 5DJYA 1R5IB 4JRYA 2VRAA 5E2WH 1DEEA 3BWUC 1T5XA 2G60H 4H26A 4M62H 3H6JA 3VFGL 5HBBA 3LD8B 3D5OF 3MJ7A 3SGJA 1Q9LB 3QEQA 4FHBD 3ULUC 5KSUB 4L8SB 1MY5A 2VL5A 3ARUA 2EEAA 3OKOB 4FTVA 1K8DB 4IJ3B 2OM5A 4NGHH 1WK0A 1R5VA 3I75A 2E9JA 2ICWA 3ZTNL 2ZOLB 3PDDA 2ZPKH 4WHTA 1CDJA 5I16A 4L9DA 4HHAB 3BKMH 3D18A 1AQKH 5F3BB 2WLZA 1PG7W 4ZOBA 5D5ME 4C56B 5I1LB 3JWDL 1AFVL 3T3PE 4KKLD 4AG4H 1EO8L 2LTQC 1HINH 2VZTA 1N7MH 3CPLB 4PJ7B 1B4JH 2DLFH 4CVWA 2DI9A 1EVTC 2YPVL 3H0TA 3STZB 1FL6B 1IAIL 4BZ1H 1LEGA 5BS0E 1QBLL 2IBZX 4P23C 4GKZA 1KJVB 1LNUB 3IDMA 4W6XB 3TM6A 3TYFB 5I75C 3MROB 4MJ5A 1RJLA 2VC2L 2Y06H 4UU9A 5IF0A 1CLYH 3W2DL 3ARFC 2W0FA 3GHEH 3UROR 5HHOA 3U82B 1NGQH 2DB8A 5FO9A 4NNXB 4XWOD 3ZDXF 1OAQL 3HUJA 3K8LA 5TDOB 3O4LE 3Q48A 3HI6H 5MHSD 5KANI 4FRWA 4NCC1 2AJ3B 4HFUL 4HWUA 3S4DA 4PJIB 1I3GH 2HA1A 4ZTOL 3WKFA 1K5NA 1QEWA 4CN1A 4DZ8B 4NNPL 2Y23A 3VXTA 3U30C 4XTRC 3T1FA 5GS0C 1X5YA 5EU6E 5FYKL 1NCWL 3RZCA 3VXSD 1RZGB 3MV8A 4Y5XA 3ULVH 2DYPB 1WICA 3WNLA 3O41A 2D31A 1KENH 1T1YB 2AK4B 4DGYH 1OTUD 1S5HB 4RWYH 2EC8A 4MWFB 4RIRA 2C4FU 1U58B 4NJAL 1D9KC 1R3LB 3F12A 1SEQH 3IXTB 5JW5B 4H1LB 4F8QA 3RHWK 4JO2H 3AUVA 3TVMA 4PFEA 1SQ2N 5J11C 3VGBA 1U8OA 5D9SB 5BMFH 3MRGA 1LVEA 2I9LB 5KS9B 5B38A 1G9MC 1W2KT 3C6LC 1YN6B 3DXAD 2R4SL 1QFWM 2JJTC 2GKIA 4KKCD 5E94A 2X1WL 1GZPB 5C0AD 3BKCH 4HT1L 3LKPA 2NY3D 3MOBH 3SDYL 5I6XC 3QB7C 2XZQL 2A6IA 4YAQB 5E08H 2WQ8A 1RJYB 1ZXQA 3H3KA 4LBEB 4OF0A 3DO7B 43C9A 2NY5C 3VH8B 1JL8A 4R8WH 7FABH 3QXAA 4Z0XA 1SYSA 2P5ED 3NFSH 5FKAA 4LPXA 3MRJB 5D7LA 2NY0D 5EZLA 2DQCH 5IBUG 1NMBH 1MI5D 3EOTH 4FQ2L 3M17A 2PTUA 3TV3L 2GAZB 3QUYD 3QXWA 1ZMYA 2Z8SA 1IA6A 5JQHC 1TNMA 2BY3A 3KJ6L 1F90L 1HIMH 3V4PH 1F8TH 1A3LH 2F8OA 3PWPB 2FH8A 5D7JB 4F2MA 2VXUL 1RAMA 1ZLVH 4KQ3H 3SEPA 4WUUA 1JGEA 3X3GL 1KULA 4Q2ZB 2E5EA 3RUGE 1JNLH 4K8RD 4V2CB 4XH2A 3U1SH 5AYUH 2EE2A 3MMEB 1ZLUH 4ZDHA 4PRDA 1YJDL 4G5ZL 3DI3B 4Q74A 1NBZB 3MLUH 2JCCF 4ZPVB 4CJ0A 1N26A 2ADJB 2BVEA 4IOSD 1UM5L 1D5IL 2X4NA 3ZKQD 2XFXA 1JPFB 3BXNB 4K2UL 1V7WA 1RZFH 2MCPH 3SPVB 4HUMB 4ZG8A 4GLRH 3FO1A 1JWUB 5C0BE 3FFCA 2YIKA 5A2JH 2CKBB 2UWEB 3IU3B 4XNMB 4JJ5B 1S7XA 3DSFH 4IRJD 4J4PC 4AIXA 1LK3L 4GT7A 3TBVB 3FTGA 3QDJA 2OCFD 1MQKH 4IMLA 3KPRA 3PDOB 4M7JL 3WSQL 4DJMA 4POZD 1GGUA 1EUTA 4G8EB 1N6QL 1XGUA 3R8BB 2ATKA 4YBLC 3WKNA 1JZ6A 5BS0D 2ZKHL 1CFQA 1I8KA 2EH8H 3DGGA 4FQPA 5CSGA 4J1UB 5IHBA 2E7LC 5IBLC 6CGTA 1SBBA 3E6UA 4OQTA 4M8QB 5F72S 1NGWA 5B8CA 4YXKL 1EEYB 4D8PB 5C6TH 3AROA 3O4LD 3QIBC 2IPKB 3MLYL 3VRJA 5CD3A 3F7PC 3D39D 4HKXA 3CX5K 3QUXD 4CU8A 4LFHG 2Y6SC 5KN5A 3HI1A 1G6RB 1MWAA 2Y7QA 4NUJA 3WDHA 1C5CH 1NCCL 3ALXA 1G6IA 5DJDA 2HKFL 4DKFL 3KPTA 1A6ZA 4M43H 4PGEB 1IGIH 3NIDE 1TJHH 1FNLA 5DVOA 1FL3A 3WFEH 5EA0H 4ZFOA 4HC1A 4BYHA 2I5YH 4L3EA 2AQ1A 4NRXB 5EC1B 2N7BA 5KG9B 5EU6D 5ADPH 3T0BA 3FAXA 1UXWB 2ICES 4OV6F 4X9IA 1HHIB 1IQDA 1ED3A 1VFAA 4QOKB 4F80A 2IPUG 1ORSA 1AY1L 1J8HB 3MJ8B 2KPNA 5LQBH 2O93L 1KN2L 5B38G 5BRZB 4MQSB 2Q6WA 3QUZD 1GHFH 3U7YL 1J0ZA 2P24A 4LEOA 5LKNA 2XTJC 3BPLB 4FQIH 4ZXBC 3SDCD 1T83C 2BVQA 2XTLA 4G6JH 3VGGA 4WFFD 1J9CT 1FC1A 4JFFB 3QG6A 5DSCA 3S37L 2SEBB 3IU4L 1AGDB 1LO3H 2V7HB 3JTTB 4LIQL 1L4IA 2Z91A 3QULB 2L7JA 4YZFE 2XZAL 3G5XA 5DZOA 3HAEA 1V5DA 1C08B 5IB2A 4DOEA 2PTVA 4P2CG 4KKNA 3GFUA 2BMKA 5IEHA 3NOIA 4PJ9D 4QF1A 2J12B 4PREB 1UACH 3F7YA 3LB6C 4HDIA 1V7VA 3IFPB 4Y5VA 5E8PA 3U36A 3LRSB 3DJ9A 1F3RB 3C8HA 1L0QA 2JJSA 4RQQB 4KZDL 4Q6IA 2DKUA 2P8MA 4NJ9L 3T4YA 4J3OC 3LDBB 1CDYA 3EAKA 5GGUB 4QLRA 2A73B 3K3QA 1SY6L 3OKMB 3FCTB 1Q9OB 4ZFFB 5DJXA 3FJTA 3EOAA 4LDOB 2YD2A 4KRPD 2R29L 1OGAB 2APBA 4KHXL 5CLTA 2FWOA 3C6SB 2HFGL 3L5WB 5T1KA 3V0VB 1OARH 2IQAB 4DQOL 3FO0H 5GRUL 3TT3L 2YXFA 3MZGB 3NPSC 3IJSA 1BLNB 1CK0L 5CSZA 2QR0B 3DX9A 1JNJA 4QXGH 4P4KC 5AWNH 3O3DB 4K3DL 5F1NA 1VFBB 2R69H 5E5UB 4FXGA 1TJGL 4M02A 4Y16D 4EI5D 4JM2F 3TA3B 4K3EL 4GRWH 3NCMA 3DTXA 4NQCE 3HE6A 2AV1B 3GSUB 1GZQA 2KL6A 4BH8A 3CFJB 4RAUA 3DX7A 2VDML 4HAFA 3VG9B 3LMJH 2EDQA 4OM0L 1A2YB 5EC2A 5C0BD 5I0ZA 3X13B 2LAAA 4X9HA 5D8JH 1RK1B 3FT3B 4OF3A 4NO3B 3FQNB 4LHUD 1CDIA 1MCRA 4HPOH 4NUGL 3UJTH 3KPOB 1J1OL 2H3NB 5AUMA 3ULVF 1FVEB 4G80A 4M7LL 3JV5A 4ODBD 4PLJD 4JPVL 4MAYD 2ZJSL 4WTWA 5SWSB 2NXZD 3E73A 4PGDB 3I84A 5CLWA 1I7ZA 5I1EL 1H15A 1KNOB 3H42L 4P23A 2GJ6D 4OKDA 4U1SB 2CXGA 2Y4SA 5E03A 2O61A 3QFZA 4OCSH 5HHNA 1U8JA 3ARFA 3ARDA 3C08H 4OZGA 1IGTA 1EA9C 2JIXB 4M9OA 2MKWA 5C07B 5TE6L 3IAQA 3KJ4B 3QCTL 4Y4HC 2NVPA 3KS0J 1HKLL 5J9PB 4NDMB 5I73C 3VRIB 1IKFH 4NIKB 5HHXH 3UP1A 2Q8AH 4OFVA 3BEWB 1KCVH 4UZGA 5C0GA 5FF6A 3TIDB 3C5SA 3CH1B 3HZMB 3VXPA 5JQ6H 1AXIB 3IFLH 3VXOA 3WHE0 2PETA 3T4AA 5ERWA 3WJLC 4B0MM 2EDHA 3JBG7 1KEGH 1JE6A 1KTLB 3P0VL 4G8GB 3ARTA 3UTSA 3O2VH 3MLWL 3QDGB 1IA7A 2AGJH 3O9WC 1I1FA 3AAZB 4XP4H 1NCUA 4AL8H 2CLZB 1BD2E 3O6ML 3RP1A 3Q6FB 4JM2C 5DUML 5BZWB 2Z07A 3M45A 4R90L 1IGJA 3TFKD 3L3HA 3PHOB 3SE4C 1D9KA 4NKDA 4Y5YB 3VA6A 3FB6B 4U6YB 3X14B 1AQDB 4K7FB 4YDVB 3MRHA 1NANI 3G04B 3TJEH 2ZCLL 3CFDB 3C6LA 4KTPA 5IVXF 5DGRA 1RIHH 2EIZA 1CG9B 4LVHB 3ULVC 1N3NA 2JJTA 1BJ1J 3BD5A 1Z2KA 2ZSWA 3ZTNH 7CGTA 2DD8L 1FAIL 4G7VL 4OCWL 3I50L 3VRLE 1BGXH 3FOLB 3JWDH 3K1DA 4LRIC 2W9EL 1TVHB 5C0EA 1MAMH 3W39B 3RWHB 1U8LA 2F54A 5FYJE 5L88L 1P7KA 1VEOA 4BQCA 3QI9C 4H5SA 4WWKC 3OGCB 2ICCA 2YPVH 1IAIH 4LLMB 4YX2H 3ZE2E 4LCCB 1RVFL 3GMPB 3RTQD 2PYED 4U6HA 3T09A 5ICYA 1XR8B 4X6DF 4WDIB 2QKIA 1WBZA 1EAPA 1PD6A 3U0PB 1OAQH 1Z5LA 1LE9B 3GRWA 5B3JE 5ETUB 3RRSA 2E3VA 4ETYA 1MJ7H 5DMJB 5HGAA 4PTUB 3UTTA 4EN3D 1T5WB 5D72L 5D96C 4HCRL 4O2CA 3EHBC 3RGVB 3KPNA 5AZ2L 3K2MC 1ONQB 2JJUA 3MC0A 4J12A 5HYQB 5IFAL 1KCSL 4NNPH 4MNQB 3A67L 3DROB 4HKBB 2DDQL 5D6DA 5CGMA 2B1AH 2I60L 3FZUD 2XQBL 3EDKA 5F7YC 2R0KH 3DSNA 4K07A 5EU4A 4J4PA 4CADA 5FYKH 3U9UA 1RJZA 3T2OA 1I75A 1NCWH 4GG8A 4GRLD 1ZEAH 3QEUB 3H9ZA 5FYKU 3ROOB 3MNWB 5JIPA 3REVB 4LCWA 1U92A 3C60B 4W6YB 4RNRB 4MNGA 1JNHB 4R0LC 1MY7A 5EU5B 4EOWH 5FKPA 1WV7T 2OP4H 4GKSA 5TH2A 3RHWF 3EOBB 3RPKA 5KSVB 4WHDA 4HUUB 1C1EL 1YEHH 4I3GA 2IANA 3W0WB 3QIUC 3BUYA 1QLFB 1I8MB 1PY9A 5HDOA 2E7LA 4P2RB 1NC2B 4LNVA 3NAAL 3PIQB 4H0IA 1AHWC 1WCQA 3WBDA 4PJBB 5IGXL 2BNUA 4LVNB 4MNHB 3QIBA 2R4SH 3RIAF 2NR6C 5IFJA 5AD0B 5DRZB 2PYFB 1A6AB 3ARWA 3D25B 4MXWL 3U0TB 2IEPA 2XICA 3IFNH 2RAMA 2QQKL 2NY4D 4FQHB 2XZQH 3KYMA 3BO8B 1JBJA 1Q1JL 2VXSH 1YC8A 2NY6D 1QRNE 1EIBA 1TPXB 1VGKA 1BVKA 3FT4A 4CMMA 1KS8A 3MBEC 4K7PH 3RL2B 3O4OB 4FQ2H 3TV3H 4DUXA 3SDXF 5FO8A 2FX8L 2VQ1A 4MA3A 2VLKA 4UIMB 5JOFA 2XYCA 1NCBL 3BIAX 1MCBA 4YHPB 2E27H 3G08B 4OZIA 3GNML 2VXUH 5DJZA 4ORGA 1OTTD 4GW1B 5B3NA 3F58L 1X5GA 2DQFA 2JCCA 4JFZH 3X3GH 2EDYA 4GSDL 4WO4D 1R0AL 3H7LA 1FORL 1LDPH 1OF2A 4AY0A 3KPLB 4GRWF 2QSTA 1XEDA 4DTGH 2F53D 1MLBA 1QRKA 4G5ZH 2R2CA 4ZXBA 1T83A 5LBSL 2CQSA 2YPLE 2X41A 3OG4B 2X4QB 5FA3A 1W8OA 5JHLL 3AC0A 3ZDZF 5D2LB 4JFXB 1UM5H 1FO0A 3H9SA 2NXYD 3OZ9L 4UMGA 2VDOL 4HJGB 3ILQC 4M5YH 2NTFB 5KSAD 1S7SA 1WGOA 3BP6B 1KRFA 4NFDA 3BYTA 3LQZA 3TH4T 3UTQB 1GGBL 2BNRB 5D7IE 3HC0A 3RVVC 1LK3H 1EGJH 2VLRA 3JV6B 3LQAL 2HTKC 3PDGA 1IKNC 3WSQH 4M7JH 4WFHE 3NIFE 4OI7A 2WBJA 3U79A 4NQEE 4PJ5A 4Z77A 1UA6L 4U05A 3MRIB 1N6QH 3VWJB 4PRIB 1ZHKA 5TDPB 4M5ZL 3QH3B 2ZKHH 3AS1A 2EH7L 2VUOA 1MJUH 4NNYB 5CZXC 3QNYB 3HC4L 4U7KA 2J6EA 1WC7B 3CSGA 5L6YL 3QG7L 2FEEI 5HI3C 3WO4C 4YXKH 4YFLF 2MWCA 5C9KA 1RZJH 3GB7B 4GH7B 4YO0B 3MLYH 4FP8L 1AR2A 3UCRA 5EUKB 3ET9F 3IFOB 3PGDB 2HP4A 3IJHB 4FQ1L 2WWKO 3QAZB 3TZVB 1NCCH 3HS0A 3V8CA 3VFVA 1RIUL 2PNDA 2HKFH 2D9CA 4F7CB 3QJFB 3F7VB 4CL7A 4EQ2A 5EFIB 1ZGLB 1MVFA 5IHZA 3RI5K 5ANME 5CBEB 4DK3A 32C2A 3ARGD 5FM8A 3GK8H 4L4TD 5MEND 3VXUD 1MAKA 3LEXA 3EYQD 4O4YL 4PJHF 3EGSA 4JB9L 5DYOA 2XA8L 2AJZA 2C3XA 4MD0A 3CZJA 3B8YA 2CKBL 4ZUUB 3CXHJ 4OCYL 3VFPA 4KUCD 4Q6YA 4H88L 2DQTH 3U7YH 5IHUL 1PLGL 3QQ3A 1WQVT 4RX4D 1QLEH 3EYOB 4MS8C 1J0KA 3CK0L 1K9TA 1ZVSB 5LGJA 3SY0B 3PWUA 1H13A 2CRYA 3S37H 4U1KB 3RVXD 3IS1X 1CD8A 4LIQH 1CTNA 2D03L 4J6RL 4FQXD 4Y4HA 3BYYA 4PRBB 2VDNH 2XZAH 2JK5B 4XNZB 4XXDB 5D7KD 1B0RA 1KFAL 3QO1A 5FOBB 2AABH 1UQSA 4EI6B 1OVZA 2Q3AA 2Z4QB 2X05A 1QRND 4KZDH 4CU7A 2FJHA 4XC1L 5ITFA 5CKAA 3CFKA 1TCMA 3FRUB 1DE4B 4N0YL 2YRZA 4Y4FB 2J4WL 1IEHA 1SY6H 2DLGA 3GMLB 1HHJB 5J13B 1G6RL 4FNLL 3EYVB 3QRGL 2R29H 3IDYB 4KHXH 3QR2A 4OGAD 2HFGH 1RMFL 3SCMB 3O9WA 5DRNA 1QHPA 4ZAKD 2DROA 1XMWA 4OZHE 2GUOB 4P4RB 1IFHL 4XMKH 5GRUH 4O02L 3TT3H 4JM2A 2P44B 3OAYK 4Q97A 5F9JA 3H7BB 1CK0H 1E28B 4HK3J 3FQXB 3NIGF 1CR9L 2XFGA 1FFOA 1VGEH 2Z8VC 4OF6A 4GAYB 2MHAA 3KLHD 5DK2A 1JGDB 3IKKA 3SE4A 3TT1L 2EEBA 1EHLL 4K3EH 1UH4A 3VWKC 1NFIB 3V5HA 3SE3A 1UCBH 1U9KA 4OZFH 1PKQB 2X9WA 1ZHNA 3FQWA 4TULL 4S1RH 5D93B 1MVUA 1LQSR 2PW2A 1JN6A 5IB1B 1T7YA 3O8XD 3FOMA 1GA2A 2VDMH 1MPAL 1MCSA 4IDJH 4NSKA 1H5BB 5MEHA 5CINL 1GOHA 2VWEC 2A2QT 3NN8B 4OM0H 2GHWB 4X4YB 1JGUL 1P2CB 4PLKC 1PG7H 1VFOA 3BPNB 1A6VL 5C0FB 1MJ8L 1QSEE 2MNUA 4NFBA 5C0CE 4PJAE 4LRIA 2D5JA 2PR4H 4RWHA 4Z95L 3O3AA 4X9FA 2CLRB 4JPVH 1H3GA 2ZJSH 4WFHD 3SDDD 5IT2H 1FFPB 2ZSVB 5HVFB 5L0QC 4IMKC 1I7TB 2JJVA 3B9AA 1N0XL 1FJ1B 4WUUE 5CHNA 4KRMB 5I1EH 3H42H 4S1QL 3BH8B 4GQ9H 4LKCB 1I1AD 4ZS6D 5C9JB 1RU9H 2VABB 4HIEB 5GGVL 1EFXD 2FO4B 2XWJA 1TQBC 1LK2B 3DHJA 1XR9B 4TXTA 3Q0HA 3JWDC 4JRYD 1OSZB 4QXTB 1FNGB 5TE6H 1BM3H 2HFFB 2B5IB 3QCTH 3QEQD 1HKLH 2H8PA 3QJHA 3VFNB 5DTFA 3G5YB 1GVIA 4FTVD 4NWTH 1DQJA 5DFWH 2DM2A 3OB0K 3TJHC 5HI4D 4UAOB 3N06B 3FQUB 4E0RA 4I18B 4QYOB 2MMXA 2H26B 4RDQF 3WN5C 2GI7A 2GJJA 2UYLB 3D3VE 4X7CC 5DUBB 1QBMH 3PL6C 3QFJE 6FABL 3P0VH 5FIEA 1U3HB 2GJZA 5TFSH 4F7MB 5I8KL 1U36A 1U8KB 1UB6B 5GIRA 1T03L 5GRJL 5ISZE 3INUL 1WCBA 5CIPH 3L3DB 3ZYZA 3S5LG 4R0LA 3ZDYF 3KYKH 4R90H 4M7ZB 2X1XR 3E2HB 1NAMH 3PNWA 5GGRA 2BP3A 1YMMA 4G9FE 5IVXA 4CJ1A 1OAZL 2MFNA 5BCAA 3RSYA 1NJ9A 2EKSB 1XCQA 5ID0B 4X8JA 4BKLA 1F02I 5F21B 1JGVL 1AHWA 2ZUWA 2ZCLH 1RURL 1FNSL 2ZBLA 3W82A 5CD5C 4GG6E 1UCTA 3ECBA 4ODTH 4G6FD 1AD0A 5FXCH 4CU6A 1T7VA 2GFBB 2XPGA 1AGEB 3UO1L 1R24A 3BIKA 1X5JA 4YDIL 5A40E 5FB8B 1CL7L 4G6AD 4PG9A 3GSQB 2DD8H 2NNAB 3QWQB 1FAIH 3HNVH 3VGFA 4G7VH 3PGFL 4ZUTA 3HZKA 3I50H 1PSKL 5DMIL 4LFHD 4X6CF 2W9EH 3WXVL 5DMGD 3RZCD 3Q1SL 4O02H 3MBEA 1ZA3B 3MV8D 3RJDA 2XXMB 3K80A 2GITB 4ERSH 4CVUA 4LLWB 2IQ9L 2BZDA 1RV6X 4WUKL 3D85D 3SJVE 2F74B 3QXQA 3VI4E 3MGTB 5I30H 2YD8A 4AJ0A 3OAYH 2O26U 2CIKA 2FJFB 2X7LA 5EBLB 4PS4H 3TVMD 5FOJA 1IZJA 3VJ6B 3FAWA 1LO4H 4X5WB 2EO9A 3P9WB 3T08A 2FBJL 3ZLQC 4AQ1B 5LG1A 5KVGL 5CS7A 2RBLA 1S9VB 5DC4B 1YC7A 5DJ0A 1INDH 5KBNC 1NAKL 4O58L 1Q8MA 2HT2C 3ZKXB 4L8BB 1WU4A 3FQTA 4TSCH 2OLDA 5E99L 4HS8H 3QWRA 4MD4B 3M07A 1KCSH 4WV1B 4RGMC 4YR6A 2DDQH 2X2YA 2NW3B 4XX1G 4WU5B 2I60H 3P4NA 2EADA 1X5IA 4BFIA 2FYYB 1PZ5B 1A7OL 4UBDC 5C0AB 1K85A 2NY3B 3KYNA 1FPTH 5C0CD 1EEZA 5ENWB 4JY4A 1IKNA 1BQSA 4P59L 3D69B 1F6LL 4IOFD 3L9RA 4DW2L 1WEJL 3HPJB 4JREC 4ODWA 1T0PB 1HOCA 2A0LD 4HX1A 4WUUD 4RRPA 4JPIB 1C1EH 2P5EB 5CJXC 5DJAB 5EOQL 2NY0B 4U49A 4MMZC 1V7MH 2XWBA 4HUWB 4X5XA 5JMOC 3V2AR 3LN5B 3QUYB 5CUSL 3KYAA 2DQGL 5IJKC 5I8EA 3NAAH 5IM7B 3MLSL 3Q5OA 3I6KA 5C0ND 1U91B 3I6GB 4PRHA 5IGXH 4Z76A 1TQCB 1M7XA 2C26A 2R1YB 2IC2A 2P8LB 1N59A 4OB5H 4ZUVA 5JXAH 3VH8G 2Q7YA 1JWMA 5TPWL 5JW4N 4I48A 1FBOA 3O0RL 3FO2B 4MXWH 1B6DA 1KXQE 3U46B 3OB0H 4FQCH 5GRVK 3ILPB 3MLVL 3SDXA 1JHLH 2AV7B 4UDTB 2WANA 5JHDA 2DL9A 1AR1C 3B9DA 1F4YH 1MCEA 2BHYA 1W0VB 1NLBL 1RZJC 3PG2A 4QY8A 2HJFA 1IBGL 2YHGA 3P77B 5DJ6B 3QFJD 2FX8H 4EQ3A 4JG0L 1NCBH 4X83A 4IM8A 4IRJB 4WJ5B 5ISZD 3GNMH 3QO0B 1G7JA 4P0DA 4EIZC 2PO6C 4FS0A 3F58H 5D5MB 5D6CB 5FCSH 3OKKA 5BVPH 2YK1L 1FORH 2OTUB 3L3JB 2YEZB 2D8LA 3H9HB 1L7TL 3ES6A 1QR1A 5GSVA 1MAJA 3V52L 3MNZA 3QCVH 5BS0B 1RUML 3VD9A 4PLNC 4LLDB 1FE8L 3QCUL 5GHWH 5BVJA 4BK5A 1HSBB 1ES0B 5ELIA 4PBVC 3OZ9H 1IVLA 1MHEA 3OAZK 4H1LH 4R7DB 4KK5C 4KHTL 2HTLD 3FB5B 4C4KO 1LO5B 5E6IC 5DLMH 3SO3C 3V6OC 5E7FA 4YHNB 3IVKA 3X11A 3B2VL 3O4LB 1GGBH 4B53A 4QRSB 3D39B 5E8NA 4ONGL 3MLPA 3V95A 1XWQA 4L3ED 3LQAH 2ZUTA 3SKNB 1AIFB 2XACC 4LSTH 4E42B 2B4CH 3MRKA 4NQSB 3H3BC 5ILTL 1JK8A 3CX2A 5D2NE 4CW1A 3PQYA 1IAMA 2X4PB 4WI5A 1QR4A 2X9XA 2OMNA 5CMAA 4M5ZH 1IM3B 3GIVB 4LNRB 1LF9A 3PWNB 4PJCE 3HC4H 4ZNEA 2VDLL 5CJQL 2JG0A 5EU6B 1A22B 2DIAA 4H8WH 3E3QC 2HVKA 5FA4A 4PJXE 2G2RB 4HXBL 4FP8H 4NRZB 5IWLC 4YNYA 3RY4A 3VWKA 4I5BB 3QUZB 3TIEA 4BFBD 5DVNA 5C0DB 3GSOB 3EYSL 3MFFB 3QPXL 2VE6B 3SDCB 3RI5F 4ISVB 4D3CL 4MQTB 4U6VL 4OGZA 5EDXA 4PJHA 1DVFC 2B39A 3VFOA 4O00A 1U95B 2OS7A 1YY8B 4ELKA 3FN3A 1KXVC 5HDBF 2D4FA 3W9DB 2AI0L 3DARA 3MV7E 3QRYA 3T0EE 2WUCH 1FNEA 5DMKA 1OM3H 1KB9K 4O4YH 4PJ9B 2G5BA 3ZDXE 3KPMA 5FYLD 1V7NL 1DQDL 4CNIA 2OL3B 1AXSA 2CKBH 5CJ5A 3GI8H 4OCYH 4IMKA 2ZNWA 2WP3O 4H88H 3LS5L 5IHUH 1AH1A 1T0NA 3QP3A 4X80H 4LCIL 3VGDA 4EBQH 1H8NA 2XWTA 3CK0H 3KWWA 3O3EA 2FR4A 5DVLA 3ZE1E 3UTTE 3BKJL 1AE6L 1YUHA 4OLXL 3MJ9L 3CDYA 1OD7A 2EDNA 2D03H 5C92A 4W81A 1BMGA 3ULUD 5ITBL 5HGBB 1KFAH 3RUGB 1T7WA 2XY1A 1FZJA 4Y16B 5E00A 2HN7A 4LPUA 2QJDA 2FX9L 3G6AA 1FFNA 1FNAA 3N85H 1NBVL 1S3KL 2KBGA 4NC1E 1DQQB 4NKMA 5IG7A 2DQEL 4YK4C 5JOPD 3P4MB 3REWA 2KQNA 4UT7H 4YHML 3ZSSA 3ZYIA 5KSBF 5JPMA 3BEVB 4W6WB 5CBAA 1G6RH 4FNLH 2IFGA 1BQLL 1KYOK 1N8ZA 3QRGH 5C0BB 3VW3L 4NZUH 4HWBL 3BP7B 4KJYA 4KV5F 2E9BA 2LAGB 4NO5A 4ZUWA 2UV3A 4LHUB 3V0WH 1MHPH 4ONHB 4LSPL 3V5KB 4E41E 1XGQB 1CR9H 3G9VA 1SVCP 4BH7A 1E6OL 4OLZL 4X0KB 3ARFD 2Y25A 4MAYB 2AEPL 4OD2A 2Z0BA 3MLZL 1R3KB 5I74C 3S3PA 1VERA 1EHLH 2XQYG 4XAWL 2VZOA 2NXZB 4LPCA 1R3JA 2F19L 2EYSA 2VAAA 1MFAL 4TULH 2GJ6B 2WIMA 2HG5B 4KWUA 3UJIL 2ZUQB 3U9PL 4G42A 2PN5A 3OAZH 5CINH 3DUUA 3BJ91 3TBSA 4YDJB 1JGUH 2W9DH 2GTZA 2NYYD 3R06A 4QRUA 4L1HA 1A6VH 3W5NA 2Q87A 1F6AB 3GT5A 1MJ8H 4IOIB 3MUGA 1S78C 4HXAH 5GS0D 3FT2B 1WZKA 2AFAA 2JJWA 4P5TC 1G7QB 1IEAB 1K4DA 3OXRA 3TBTA 2VZUA 1T04B 3D2UA 4JZOA 3WUWA 4UOW0 2VDRL 4JVWA 1A14L 4OGYL 1N0XH 3MREB 1TZHA 3LSOB 4XP1H 2M8XA 4S1QH 4PJ7F 3MLXL 4Z4JA 1D9KD 1NDGA 4ELMF 1G84A 1G9JA 5GGVH 2XTJE 5C1MB 5I0DA 4CVXA 1ERNA 4BZ2H 1HHGA 2D7MA 2C3WA 5GSRB 3NCFB 2ATPB 2LVEA 3AS3A 5JDSA 1Q94B 4LCUA 5IB5A 1ETZB 3GMRB 1UADC 3I6LE 3BDYL 5CA3A 4FQLH 3GHBH 3C6LD 3K7UA 3UBXG 4MAUL 5IBTL 3ARZA 2OTWB 3B9EA 5F7LB 1IC1A 3DBXA 1X4YA 1GGCH 5E1AA 5MI0C 2GTWB 1SJHB 2XY2A 3QDMA 4PJIF 5GS2H 1MCIA 1KG0A 4TVPD 3RWIA 1X6NA 5B39G 4L8CA 4F9LC 4N8VB 1VPOL 2F54D 4HUXB 5GGRY 3T2QA 6FABH 3MV7D 5HY9A 3IDIA 2FIKA 3WIQA 4R96B 1MFDL 1P4IL 1CFBA 2J8HA 5I8KH 2QNOA 1A5FL 4HUVA 5T33L 1D7FA 3JSSA 2DMBA 1T03H 4MJ6A 3INUH 4F58H 1UH3A 4HIIB 1W0WB 4ODSH 4PGCA 5IEKA 2YSSA 3C5JA 5DQDH 1DUZB 3VXME 3K4ZA 5CJXA 1QZ1A 2RCSL 1PVHA 5KVDL 3X3FL 5GZNC 3RFZC 4HH8A 1A6UH 3LEYH 1U0QA 5IJKA 3RTQB 3UTTD 5F9AC 1EGJA 1JGVH 1UYWL 1RURH 1FNSH 4XMPL 1BFVH 5SWZA 1K3ZA 4LASL 4L8SC 3ROLB 3RX7A 1GGTA 1EEQA 5T3XE 2EDWA 4X6CA 5KOVC 3UO1H 2VNCA 1RZKL 2B4FA 1J11A 4YDIH 3Q5TA 5KS9F 1T3FB 1XAUA 1WBYB 1UZ8B 1C5DB 2VXQL 3PWJB 1JHTA 3PGFH 3BZ4A 1PSKH 4ACPA 1QNZH 3PABA 4P49A 4J4PD 2V17L 4EN3B 1Z6JT 4NQCB 3BQUA 3WIWA 4KKBC 4OF5A 3DV4B 5JORA 2W65A 1BOYA 3B3IB 3Q1SH 4YIQB 1IEBA 2EDKA 2XOTA 3DECA 2F15A 5DI8A 3CXDL 4S2SA 1LO2H 4QRQB 2OBGA 1DBBL 3DOSA 1JWSB 3RWCA 5DFVD 4QRTA 2IAND 4RMQA 4EDXB 4XCNB 2HLAB 3A6BL 1FMIA 1YMHB 1EERB 1IARB 3LKSB 4CDGC 3WIFB 2FBJH 3VXDA 3QIBD 4QKXB 5KVGH 4PJEF 4XWGH 5EU3A 4U1JA 1A3RL 1TZIB 1UFUA 2ARWA 4JM4L 4WI8A 5B4MC 4O58H 2Y6SD 3QXDA 5E99H 3OKEB 3QXVA 1N5YL 3N1QC 3VFMB 4APQB 3WUWG 5E6IA 4DAGH 3V6OA 2FHBA 5M7YA 4LK4A 1PQZB 2ZUSA 4Y19E 3QA3B 3GMQA 4JE4B 1F3JB 2M2DA 4PP2A 2NY4B 4KK6C 4BJLA 4BFEA 4F7TB 2QSVA 5IV2B 2OK0H 4MHHI 4DCQB 2NY6B 2BOCB 4DW2H 1WEJH 1CXFA 2QQLL 1YN7B 2VO5A 4OCMC 2Z31C 2W59A 4W70A 5EOQH 1MCWM 3BWAB 4X9GA 1DSFL 3KLAA 1OAYL 5CUSH 2VERN 4QHLB 2ZG1A 4RDQG 1G1CA 2XTJD 1I4FA 2H6PB 3MLSH 1LILA 2H2SC 3MJGX 3LQAC 2H9GB 2DICA 5F9WB 1N5AA 2VDQL 2B4CC 4Z7VB 1CE6B 3I6LD 4ALAH 1CFSA 4GLRI 1FZKB 4M93B 4NHUB 4U2YA 3H9SD 1G6VK 2XN9A 5TPWH 4WO4B 4L4VA 3V6ZB 1SY6A 2Y5TB 3L5JA 4N5UA 3KXFA 5IWLA 4AYQA 1CN4A 2ZUVA 3P4OB 3NFNB 5M94B 3VXRE 1TETH 1XF2A 2CGRL 4HKJA 3MLVH 3LB6D 3RA7L 4P3DA 5F70A 2B2XL 4NO0D 4H8WC 4ONFL 3LKQB 3QQ4A 1DVFA 4LSUL 1LP9B 5CFHA 1M7DA 2OTPA 2NXYB 4V1DE 4EIGB 3ZHKA 4XX1E 3KDMA 3O11A 4NYLA 1IBGH 5KSAB 4PJ5D 4RGOH 1YEGH 4OKVA 4PJFE 1X44A 4KTDH 1VSCA 4KMTL 4JG0H 1OL0A 1T4KA 1FL5A 5D7JC 4C54A 1A1OA 3QEHB 2G75A 2HH0L 4HBCH 4OZFA 3QQ9D 1ZT7A 5F3HB 1NGPL 5I17B 1BX2B 1K8IB 4CUCA 4UV7L 1T1WB 2R0LL 4JFDE 2IAMB 2YK1H 4P4KD 4FQQA 3VXMD 1P1ZA 1A7BA 3IDNB 5B22A 1L7TH 3RWDB 3U4EA 1U8HA 1JNNL 3V52H 4G8FA 3QWOA 3SGEH 1T1ZA 1CT8A 1BHGA 1RUMH 3MRBA 1QPXA 2W0KA 3C2AL 3MCLL 4I2XE 5E56A 1FE8H 3QQNA 1KPVA 4PY7A 5F8RC 1ZGLM 3T2PA 5T3XD 3EJZC 3N0PB 4PLOB 5TE7L 2DAVA 1DEDA 4QGTA 3G6JE 3TO2B 3V5DA 3WFCL 4H20L 3GZKA 4YUEH 2DM7A 4YXHH 2FEDC 2YUXA 1JPGB 3CC5B 3MV9A 4NZTL 1P7QA 3DUSA 5EZJB 2VLJA 5F71A 2DMCA 5ACMA 4K8RL 4J3SA 4JY5H 3K1KC 1IGML 5ESVA 4LHQB 3K81A 1C12B 3UYRH 2XNAB 2P46B 3VXNB 2EO1A 3ARGB 2VDLH 4NQVB 1YZZA 5CJQH 3MRLA 3VXUB 1A6TA 5F7NC 5I1IL 4NQXA 1CEMA 1SJEA 4NKIL 4I0PC 35C8H 3GKZA 4MMXC 4UNUA 2EE3A 1CFNA 1Z9SA 3MFGB 1CDUA 1QSFA 4HXBH 3KPQA 4Y4HD 5L8JB 4HFWA 1FZOA 4HZAA 3I3DA 3AREC 2UWEE 5MERB 2X4UB 2BSRA 4XVJL 1BOGA 5I2IA 5CIPA 3G5ZB 4U6VH 5IJVB 3ULSA 1CXEA 4Z7UF 4BA8A 3GJEA 2GSGA 3EDEA 3S34H 1T20A 4N8PA 4TTGA 4X6DE 4M1GL 4FQXB 5HHVL 1NANH 1AGBB 1KIPB 5ID1A 4DUWA 1NAMA 5CJ8A 3OJDB 3LKRA 1F6FB 1MEXH 1K4CA 3VG0H 1MFCH 2R8SL 1ZSDB 4P5TA 1XIWA 1GAFL 1V7NH 3JWNC 4TSAH 3FN0L 3O9WD 4I3RH 5CGTA 1G7HA 3PE9A 5DXWA 3T33A 1QRNB 2A9MH 1URLA 4JM2D 4ODHL 1T21A 4NO2B 5IKCA 3BW9A 3LS5H 3AXLA 2A77L 4L9LB 4EL8A 4LCIH 4ODVH 3TNNA 1I7UA 1Z3GL 3EO1B 5FGCB 4NQDE 4CDHA 1QLRA 4KJQC 4NRYA 2F9BT 4YPGA 4LLQA 2JB6B 1F11B 4P2QE 1MUJB 3QIWB 1A02N 1D5MA 1F5WA 1LEKB 4X6FA 3E6FA 3MJ9H 5J3HC 3CH8A 2R1XB 3EUUA 1UGNA 3GO1L 3L3OB 5DJCB 3DVIA 4OAWA 3O2DL 5ITBH 4LOUC 1MH5A 3VXRD 4Q9BA 5GGSB 1YEKL 4YHZL 5KSBA 3Q3GB 5D1QC 2FX9H 1TXKA 1VFUA 2RHEA 5DD1H 1S3KH 5E95B 1MELA 2XKNB 4LVEA 1X5XA 4OUUB 3MPCA 3RJQB 1F4XL 2P8PB 3O8XB 4F9LA 1N6UA 4QOKE 4YHMH 2Q76A 2PW1B 5T3ZH 3NA4A 3QI9D 1BQLH 1S7UB 4WWKD 5J06A 1HQRB 4WU7B 3ZE0F 1HQ4A 1PX4A 5BOZG 1YPZE 2R0ZH 1IM9D 5ALBH 1KEML 1PW3A 3R0MA 5AG8A 4KKAC 2FGWL 2VH5H 3L5HA 1VACA 5JXEC 3K11A 2QBWA 1LE5B 4JFDD 1E6OH 4OLZH 3OTTA 2AEPH 2A83A 3MLZH 4PRHE 3WLBA 3BZEB 3MOAH 3TA3C 4YFLI 1B2WH 3C2SA 4URTB 2L0DA 2F19H 5D1XC 3OR6B 4OFYA 2OL3L 3GDBA 1YQ2A 4NQTA 2HJLA 4TUJA 5IBUB 4YGAB 4LRNL 1I1AB 3HMWL 2G5RA 3O45B 3VG9C 5C2BL 3U9PH 4UQ2B 5TGBB 2XKSA 5KSUA 5C7XH 3F7QA 4L8SA 4P5MB 2O5ZL 1EFXB 3EHBD 5F93C 4EZMA 5DJYB 4HHAA 1T5XB 1OAUL 5ADOL 3U83A 2IALA 3BSZH 5F3BA 2YD5A 4C56A 5I1LA 3HFMH 3UAJC 3OPZH 2VL5B 4FTVB 3EYUL 2BFVH 3CPLA 3L7EB 1R5VB 4KDVA 4PJ7A 3I75B 2ICWB 5DK0A 4WHTB 4JR9L 4JFEE 1RZ7L 4L29A 4Q58C 3STZA 3D18B 2AKRB 1A14H 1AYXA 3ALPA 3SQBA 1IMHC 1LNUA 3HRZB 1B0GB 5F7MC 3MROA 4DVRL 5IUSA 5EO1B 3QIUD 4XP6L 3T8XB 4R3SA 5FK9B 3H0TB 1H3PH 3F8UB 1LEGB 4R2GC 1KOAA 4IHOA 3WIHL 4GKZB 3WNMA 3RVUC 3QFYA 4MJ5B 2R15A 2Q1EA 1RJLB 4PJIA 4MAUH 1MJJA 2NR6D 3JUYA 4NKOB 5FO9B 1PAMA 4N0UA 2R0WL 5FO7A 4P9ML 2DQIH 3QT2A 1NBYB 4AM0B 2P5WE 5BZDA 3B6SA 3NZHL 2ZCKL 3SKUD 4G6FB 3S36H 1IAII 1L7IL 5SWSE 3MBED 1RZGA 1CGYA 1MFDH 1P4IH 2V7NB 4LCYB 5T33H 4R26H 4JHWH 3S4AA 1CVSC 2I25N 2AK4A 3T1FB 1S5HA 2FNBA 4MWFA 3WNPA 2OKXA