2VNSA

Crystal structure of the membrane proximal oxidoreductase domain of human steap3, the dominant ferric reductase of the erythroid transferrin cycle
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
180
structure length
180
Chain Sequence
b'PKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLOREDUCTASE STEAP3
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structure of the Membrane Proximal Oxidoreductase Domain of Human Steap3, the Dominant Ferrireductase of the Erythroid Transferrin Cycle
pubmed doi rcsb
total genus 60
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 1.16.1.2: Diferric-transferrin reductase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vnsA00
1AHHA 4CMHA 1K89A 4A0SA 3GMDA 1LX6A 2X6TA 4OHUA 5FFFA 1ZMTA 2GPTA 4I08A 5F1OA 1YBVA 1VJ0A 1H2BA 2QZ9A 1HE4A 4KDEA 3VTZA 4R3WA 3OJLA 3WICA 1Z45A 3WX0A 1X14A 4J7CA 2Y67A 4LRSB 1RM3A 5BR7A 5THKA 4NHEA 3P2YA 4W7IA 1ID1A 4A73A 3GFBA 4ESOA 2EERA 1U8FO 1CYDA 1WAMA 2JHGA 4CLEA 4OM8A 3GDOA 1MLDA 2FP4A 3JQCA 1EVIA 1R66A 1M66A 2X23A 4ZQBA 4UULA 1J49A 3IQDB 5THQA 3DOCA 1DBVO 1HDOA 4TKMA 4KZPA 4E21A 1SBYA 3GEMA 2HK8A 4OAQA 1Y8RB 4CMIB 1YQGA 2I65A 3S2IA 5KVVA 3JCZA 4YWJA 1UJMA 4IQGA 1VJTA 2VUUA 3ZWPA 3OQ1A 4FFMA 3PTZA 4ROSA 3VPHA 4E5KA 1KEVA 3M2PA 2BFOA 4BKUA 4MKZA 3G1TA 1T25A 1SAYA 5EIOA 2BD0A 2NWQA 3PP8A 1PL6A 2Y1FA 2IRWA 1LRJA 4QXMA 4ND1A 4Y9DA 3KYDB 2YHIB 1Y8QA 4FB5A 5A1TA 4II3A 4A10A 1O9BA 2ZCVA 4BNWA 4W9NC 3QV1A 3GVXA 4BV8A 1GUZA 4R01A 4CL3A 4TZTA 3W8DA 5CDGA 1ZSNA 4BNYA 1MUUA 1F06A 2BGKA 3RUFA 2A35A 3BMNB 4BGVA 1JAYA 1ZEMA 4XDYA 5CEEA 1PZEA 2H6EA 4YJHA 1J0XO 4XKJA 4CM4A 5DBFA 4YXFA 3WXBA 1T2CA 2CD9A 2GZ3A 1H9BA 2JCVA 3I9JA 3NUGA 1XKQA 3RI3A 1HDXA 3RFVA 3FNEA 3JQ7A 2ZB4A 4BMVA 1NM5A 2B4QA 3GGPA 4GLLA 1YRLA 1I3NA 5ER9A 1IB6A 4INAA 4YCAA 1DAOA 1UZNA 1GAEO 4DYDA 4D46A 1DPGA 3GY0A 5T5QA 3WOHA 4PIVA 4A2CA 1IY8A 4ALKA 7MDHA 3TFOA 3KVOA 1PJQA 2GR9A 3AOEA 3GDFA 3H9GA 4N54A 2NVBA 5EESA 4A7PA 3MCVA 3U4IA 2HMUA 4ZICA 1OMOA 3EZYA 3GH3A 2XAAA 4PG4A 1HT0A 3AUUA 1HL3A 2PWZA 5DNAA 1WWKA 1HZZA 1I2ZA 3GFGA 3D3EA 1MXFA 1R4MB 4B3HA 4BL5A 3WGIA 4IS3A 4P4LA 1JDJA 2PH5A 2ZYDA 4YT4A 4J90A 2AG5A 5JAMA 4E5PA 1LSSA 1PX0A 1RM4A 4WLNA 3NYWA 4GLOA 1O5IA 4D45A 4NIMA 1Y5RA 1U5CA 4TZKA 4CM8A 1KVTA 4CMEA 3L6EA 3N74A 5BSGA 5JW6A 4BB6A 3JYOA 5CDTA 3NT5A 1E1LA 5T67A 2EGHA 3RWBA 5C3MA 4NBTA 1Z82A 3JQGB 2EP7A 4TWRA 2R6JA 3UN1A 2I6TA 1LEHA 1GYQA 5U9CA 4CM8B 2EKQA 2CVOA 4NNJA 2AQ8A 3ZV5A 2H5LA 3ZH2A 4DQUA 4EJMA 1ZK0A 1UXKA 1YJ8A 3LC1O 1Y7TA 3ZU5A 1ARZA 4GBJA 3Q2KA 4CUJA 3NDIA 4JBGA 2E6UX 1YOVB 1CEQA 2Y1CA 4F45A 4ZHSA 2VTDA 1F0YA 1T1SA 2X22A 4J9UE 4LW8A 1Y5MA 1U3TA 2GASA 3SEFA 1BGVA 3RJ5A 3NTRA 2WYUA 1NVTA 4RVGA 1HWYA 1N1GA 4AJ4A 4EBFA 4TRMA 3KOUA 4RDHA 5ES3A 1QV6A 3GAFA 1HTBA 2CUKA 2PZKA 3EAGA 4IQ0A 3DXFA 1U28A 5G4KB 1E7WA 4CMAA 5EQFA 4BKRA 4D0RA 3D3WB 4YT8A 3WNVA 4WCDA 1CETA 1YQDA 3QVTA 3RBXA 2YY7A 4CLOA 4XYGA 5IFLA 2EKLA 4ND5A 1NPYA 1QLJA 2V7PA 4IY1A 3JD4A 4N7RA 1PL7A 1N9GB 1G6KA 3QWFA 4NR0A 4EEZA 3ZU3A 5CDYA 1UDBA 4J6FA 2VWHA 2Q4BA 2W90A 3HADA 4Y6RA 3WGTA 6ADHA 3AI2A 2JKVA 2ZCUA 4CQLB 4HV4A 3KV3O 2FHSA 2D8AA 4MIYA 1T4DA 5L4SA 1NVGA 1I8TA 1VSVA 1Q1NA 1CF2O 2HRBA 2XXJA 3OETA 3T7CA 4WEQA 4BO1A 5JYDA 2IEBA 3UKOA 1SOVA 3I4CA 1EVJA 3GDGA 4MVJA 3I4FA 1XHLA 3OQ6A 4CM4B 1H93A 4P8RA 3ZNOA 1MFZA 3ETDA 3I83A 3HDJA 4GVXA 5BSHA 5CEFA 3BMNA 1ZCJA 3K73O 3UH1A 4XYEA 1YH3A 3I9KA 4DBZA 3VVCA 3PIIA 1T26A 1T1RA 1JWBB 3IJPA 1V9LA 2W2KA 4L73A 4WLUA 3K92A 4D44A 5IDYA 4XGIA 1E7SA 1C1DA 3V1TC 4Z9XA 1B26A 5DN9A 2AQIA 4YQYA 3JV7A 3LT0A 3GEDA 3JD1A 2BHLA 1M76A 3P7MA 3CIFA 2FOIA 1H5QA 1A4UA 3AM4A 4FD3A 3A14A 4ID9A 3ZV3A 2ZTUA 3SJ7A 4EJ6A 3GHYA 3MJEA 2GF2A 1CWUA 3ETGA 2FRDA 3FPCA 5AOVA 5COBA 3L6DA 1PJ3A 1PJLA 4R69A 4RQTA 3D3WA 1K2WA 4J4HA 4X54A 3WS7A 2P5YA 1ZBQA 3GF4A 4KWHA 4GH5A 2Q49A 2NVWA 1YDEA 3KLMX 2G82A 1BW9A 3E48A 3ZWBA 1NP3A 3GVHA 1E5QA 2GNAA 2V6BA 4OXKA 2YQ4A 3G17A 1MX3A 3K6JA 5KJEA 1E1NA 4JN6B 1E6EA 1E77A 1Q7GA 2R2GA 1HDRA 2E4AA 4ZU3A 4W6ZA 3N58A 4QTZA 3U62A 1BW9B 1JW9B 2OMEA 4P22A 1P31A 1P9LA 3CMCO 1O0SA 3KETA 3GA0A 4DQXA 2FR1A 4BS9A 1B16A 4NBRA 4DA9A 4XJTA 4L9RA 1LRKA 4EITA 4KTTE 3OEYA 5H81A 3DBLB 1NASA 2EGGA 2UV8A 5TGDA 1I30A 1LLUA 3ZWAA 2AE1A 2EP5A 3Q3CA 3QLJA 3JQAB 4FS3A 2JJYA 3RASA 2C0CA 4GI2A 5FI5A 1N92A 5IAAA 4GL4A 1YQXA 1E7YA 1E1MA 1L1FA 1VL0A 3WGZA 5GY7A 2IZZA 5L3ZA 2EW8A 4WK6A 3G49A 4OOFA 1TEHA 4EJ0A 5JMWA 4BGIA 5HBRA 1FMCA 1S6YA 2DKNA 2AEFA 4RCVA 5CDSA 2GZ1A 2NLOA 4NJMA 4QUKA 1R4MA 1DLJA 1XA0A 1GYPA 4JX8A 4Q3CA 1R16A 2FSSA 3OJ0A 4WLFA 4IMRA 1I3MA 4CM9D 4IZHA 2OBYA 5G2OA 5DCUA 1D8AA 3GQVA 2Q50A 4NH4A 2X0RA 2DM6A 1GPJA 2X9NA 4L74A 3WB9A 3DO5A 2O2YA 1V3TA 1DXYA 2VHXA 4HNHA 4PGFA 2OHXA 1BHSA 1F8GA 3COSA 1SMKA 3RC1A 1UDAA 3W4IA 3K2BA 4YAGA 3I9NA 3CMMA 1AXEA 5JAZA 2C29D 1XQ6A 2AEJA 1SCUA 3PFFA 4BO9A 4F6LA 2VWPA 2D59A 3ZNNA 2PKQP 2UYYA 3LT4A 3MJCA 3WMWA 1KYQA 3QP9A 1UP7A 1K5HA 2CDCA 2VNAA 2Y1EA 8ADHA 4WLVA 3ZZNA 3V8BA 4ALLA 3NRCA 3L9XA 3RU7A 1ADFA 5IDQA 3BZUA 2PR2A 4IGFA 5JLAA 4CPDA 3F5SA 1DDOA 4KDFA 3M1AA 5HM8A 2PD4A 5JFOA 2X0NA 4MVJE 4IBOA 1DIAA 1KVQA 1MC4A 3E5MA 1Q0HA 5TNXA 1ZZEA 2CDBA 4RV9A 4CM1A 5KCZA 1V6AA 3E6AA 4OQYA 3RFTA 3VAZA 3BIOA 4PRLA 1K0UA 1WZEA 4FJ2A 3JYNA 1E3WA 4D79A 2A92A 4ZQEA 1EVYA 1U5AA 3KYDA 1P1IA 3U4HA 1EUDA 3ZWWA 3UGKA 1OAAA 2Q2VA 4GPD1 2HAEA 4TVOA 3UXYA 1VJ1A 5K6AA 3TOXA 3GAZA 3ST7A 4M54A 1EBUA 1UXHA 1X1TA 2Q2QA 2QRKA 2Q1SA 3ADPA 5JDCA 1PZFA 4ZQHA 1BXZA 1R6DA 3AY3A 1CQJA 4XEHA 1U1IA 4OSPA 2ZTLA 4B4WA 4KMSA 3NKLA 3IMFA 4WUVA 1M6WA 5A9SA 2OFPA 2PY6A 4IXTA 4CMCA 2CSUA 2GRAA 1ZNQO 1MP0A 3RUEA 1LU9A 1N1EA 1ONOA 1P1RA 2PH3A 3E5RA 3HUDA 1T2EA 2OORA 3JQAA 1IHXA 4J43A 4NJOA 5F1PA 1EMDA 3ZV6A 2PKRA 3PEFA 4U6QA 4DMMA 3MOGA 4RL6A 2O7QA 4RPHA 2FSVA 2XPCA 3PWKA 3FR7A 4FQ8A 3L0DA 4ALNA 3PXXA 2H1SA 3GEGA 4YA6A 4R1UA 4BQRA 4CR7A 4IDGA 4RO0A 5JCJD 1KEPA 2VHZA 3DEYX 4K28A 2A4KA 3VZQA 5F3RA 1E7RA 4DXHA 1I01A 3X2EA 3C7CB 1HETA 1KOLA 3TN7A 2VZ9A 2D5AA 4G2NA 4K1LA 1V8BA 3DHNA 4JROA 5IG2A 4H7PA 1YBMA 2BKAA 3AI3A 1H6BA 3P19A 2IZ1A 3ZN2A 3IL2A 1MB4A 1EEHA 3WQRA 2V6FA 5AQ1A 4BGEA 2CNBA 2EHDA 1OBFO 4XR4A 2PZMA 5B4UA 3UFXA 3KYCA 1RYEA 1T4BA 3Q9UA 4IZIA 1ISFA 2OOSA 4TRNA 3ANMA 5DOZA 1O95A 2RHCA 1HE5A 3DL2A 4NJMB 2C5EA 1QSGA 4ITUA 4CUKA 2PA3A 2CY0A 2OO5A 5EPOA 4DPMA 4HADA 5IZ4A 3JQBC 1GDHA 5DP2A 3JQBA 5A5EA 1MG5A 5CP8A 1GUFA 1YONA 4E2XA 3K5PA 3UHAA 3S2EA 3S1LA 1O6ZA 1QYDA 4CMKA 4D43A 3WGHA 4AJ2A 1KY4A 2FR8A 1H6AA 1GZ4A 4LMPA 4DIBA 1RKXA 3DC2A 3NJ4A 3IOYA 4I9UA 1O89A 4O6VA 2G0TA 3M6IA 4Q3DA 5B1YA 3UF0A 1BVUA 3AM3A 4FOOA 5ITVA 4YR9A 5IN4A 4E3ZA 4Q39A 4L4XA 2WEKA 2DBZA 1IE3A 2VUSA 2GZ2A 1ZO8A 5TF4A 5CAEA 4J9VA 2NACA 4ZGWA 5I7FA 2GD1O 3KSUA 3I9MA 3PRJA 1WZIA 4BMNA 4GMFA 4KWIA 5CPFA 4ND4A 4MIOA 1DC3A 1NAIA 4ZRNA 4LCEA 3BMQA 3RVDA 1LSOA 4M8SA 5H82A 3IS3A 4R1NA 2FMUA 3OIDA 4BNTA 3LZ6A 3BA1A 1PJCA 3WLFA 4B7XA 2J3JA 1E3JA 1PR9A 1N2SA 3FTPA 4S3MA 4FPXA 3TOZA 2I67A 3VKUA 1YJQA 3QJ5A 1BMDA 1KEUA 3QSGA 1LRLA 4CLOB 2HUNA 4XYMA 4NG5A 5L51A 5L9AA 2Y1OA 5L45A 2VHYA 3WYEA 1EQUA 3SBOA 3H7AA 4JCOA 3DMTC 3I52A 1I10A 3ICPA 1U7HA 3GVCA 5ENDA 5GZ3A 3HFGA 2HMSA 3BTSA 1NVMB 4OSOA 1Q0LA 2JL1A 4PFJA 2I3AA 3E8XA 3ONEA 3K96A 1HYHA 3R3JA 4DMLA 2Q1WA 3LSYA 2J6IA 2RH4A 2HCTA 2YHIA 3OMLA 1YOVA 2DUUA 4H3VA 4BO0A 4W82A 3WFJA 3V2HA 3EY4A 3FD8A 1M6HA 2EJWA 3D64A 2IE0A 4CV0A 4B8ZA 2B36A 5KNLA 4GKBA 3MJSA 5L7TA 2NTJA 3SX2A 4B3JA 4Z0PA 2NU6A 4XX0A 1ZXLA 3OICA 4YRDA 3OEWA 3JD2A 3FR8A 3ETEA 3PJDA 2AHRA 3DZJA 1C0KA 5ADHA 4P4GA 4HFNA 3GHHA 4XR9A 2AW5A 4FFRA 3W6UA 1P74A 2WE8A 4OL9A 1P3DA 1OC4A 4JGBA 4CR6A 2LDBA 1AUPA 4MVJM 1BRMA 2VYVD 5A3VA 3D7LA 1ISGA 2B4TO 4RVHA 5HWSA 4L75A 2AA3A 3F5QA 1A27A 1VC2A 4MO2A 5ER6A 5F1KA 2PZJA 1DFGA 1PR3A 3KM0A 1P1KA 3LF1A 4KOAA 2C59A 1XU9A 3W8FA 3BTUA 2DBRA 3CZRA 5JCJA 3WG9A 4BNUA 4CQMB 2HQ1A 2X4GA 1DRWA 3PK0A 1ZSVA 3KTDA 3RSHA 1UP4A 3L77A 1R0SA 4IINA 2CFCA 2VYVA 1ADGA 1BWSA 2OXIA 1HDZA 4K6CA 3PGJA 1NX6A 5KJCA 1GPDG 4DL9A 1LC0A 2GUGA 3B1JA 3UOGA 2VRCA 2D5CA 2GLXA 1I32A 1R12A 3HFSA 2LDXA 2D2IA 4L4RA 4E30A 3VZSA 3VH3A 1QMGA 1BXGA 2TMGA 3EGOA 1Z7EA 2XF8A 1BDMA 1I3KA 5JMPA 1M2WA 3KSZO 3K9QO 4K9DA 4R5HA 3PLRA 3KEOA 2JAHA 4BKQA 4B3IA 4UUPA 1HRDA 1U7TA 2EWMA 4Q3EA 4DRYA 5FI3A 1I2BA 3OBBA 1DEHA 2Y93A 2X9GA 1MG0A 1VL6A 1MC5A 2ZB8A 1E92A 4FJ1A 4IS2A 3NAQA 4E2WA 1PGOA 5T6BA 2PLAA 4YJGA 1YL6A 5IDWA 3A06A 4EW6A 4RLSA 3KUXA 1PS0A 3VOSA 3RUDA 2EKPA 2WMDA 1K6IA 5LDHA 3CPSA 3U0BA 5JXWA 1DFHA 3GK3A 3HG7A 4RF5A 1V3UA 1GV0A 2YQ5A 2I99A 2ZJ1A 3C7AA 4BO5A 1MV8A 3RUIA 2DTEA 4XA8A 1PGNA 3NTQA 4RJTA 4DWVA 2Z95A 3JQ9C 3D1LA 3L07A 1JN0A 3HDYA 3NEPX 1GD1O 2DTXA 4HFMA 3UICA 5DOVA 1WDMA 4F46A 1BXKA 2J3IA 1LUAA 5JY1A 1QV7A 2B4RO 4UUNA 1LQTA 2GN4A 4QT0A 2I76A 4NPCA 1C1XA 2HLPA 5JSFA 4WLOA 1NXQA 2BELA 3QWIA 5AXBA 1LQUA 4E5MA 4FW8A 3VH2A 1OI7A 2WM3A 2C54A 1SEVA 1ULSA 3MJ4A 4FCCA 5B37A 2AQHA 5L53A 5HS6A 3F4BA 5G4KA 3IC5A 2QRLA 5KKAA 3ORFA 1P0CA 2HU2A 2D4AA 3DDNA 3JSAA 1ZMOA 2JHFA 3OM9A 5DBIA 3GG9A 3EVNA 2DLDA 3M2TA 4AJHA 5KVCA 5JO9A 3NDRA 4HXYA 5AXAA 2WD8A 3MOIA 4DC1A 1LC3A 1E5LA 3TJRA 4GQAA 2HJSA 4MVJI 3GPDG 1VI2A 3WR5A 2PZLA 3PQEA 2H9IA 4J49A 4ALMA 3MTJA 1ZK3A 1ISMA 1LNQA 1AGNA 1MFPA 1I0ZA 4H15A 1GEEA 2YW9A 1E3LA 1PJ4A 3AFNA 3JTMA 5C5IA 5L95A 1T2AA 3CXRA 4HFRA 3FHLA 2OL4A 1T2FA 1MXHA 3A9WA 4ND2A 2Y66A 1JVSA 4R3NA 2BGMA 4Z6KA 3OJFA 5EERA 4CLRB 2Z1NA 3ZWNA 1HXHA 4EGFA 1KETA 5T8KC 5JDCC 4UVIA 2VTEA 4QO8A 3H2SA 1DO8A 4YACA 2A9FA 1UXGA 4TVBA 1ORRA 3W1VA 4IIVA 2PD3A 4U0KA 1KERA 3NT2A 3W4JA 4XCVA 1FJHA 1LSUA 4NFYA 1WP4A 4NK4A 2OP1A 4R54A 3DBHB 5TSDA 4BNFA 2YDXA 4I5EA 4I8XA 2YV1A 3F46A 4GVLA 4FN4A 3PFWO 2F1KA 4Q3AA 1B15A 4M87A 4N18A 3DZKA 4MP6A 3OSUA 3H65A 1TT5B 1VM6A 5KVSA 4TMFA 1DC5A 2GDZA 4J1QA 3TZKA 3GZNA 4XRGA 1SB8A 2O3UA 3JQFA 3O8QB 1Q2XA 4B4OA 2C7VA 4YPOA 2VWQA 3BMQB 1UUFA 3LC2O 4FBGA 1EDZA 2JD0A 3KRTA 3GZNB 3WNQA 4LVCA 3K31A 4AJOA 4AG3A 5I7EA 1LDBA 1H0KA 3ADOA 1PS8A 1ULUA 4HBGA 2IZ0A 4PLHA 3DTYA 1Q7BA 3PYMA 4GX0A 4EUEA 4CLDA 3ABIA 5ILGA 2P4HX 1DRVA 3FRJA 4BV9A 1ZEJA 4RDIA 3S55A 1C0IA 3DR3A 1GADO 1B2LA 1PWZA 2Y0EA 2DTDA 4TRJA 1A5ZA 5LCXA 3UVEA 1P1FA 1JWAB 5I8WA 1PU2A 2ET6A 3GLQA 3L9WA 4UUOA 4YAJA 3FSRA 2DFVA 3AOEC 3BMOB 2XOXA 1R4NA 1Z73A 3DBRB 2BFMA 4DYVA 2J5RA 4ONEA 4DTIA 1PQPA 3ULKA 2J3HA 3G79A 4QEDA 1SZJG 2YUTA 4CJXA 4U7WA 5JY6A 4A26A 3AFMA 3JD0A 4Z0HO 3F6YA 1GU7A 2WTBA 1LDMA 1OFGA 3AJRA 4RGBA 2DQ4A 3QIVA 4DBVO 2FPIA 3HDHA 3V2GA 3O38A 4IJKA 3PZBA 4IDBA 1HDCA 2JD2A 1GYRA 3GRKA 3UCXA 4DC0A 4I5GA 1KEWA 4II2A 4I5DA 5H83A 2DPGA 3JQ6A 2FY8A 1QR6A 5BNFA 4URFA 3DQPA 1X1EA 3C8MA 3TDKA 3PHJA 1PJBA 1ZK2A 1NTOA 2X8LA 3ICCA 3ZWOA 4BO8A 4PG5A 2B0JA 4BNLA 3HB4X 1ZW1A 1G0NA 2Q99A 5DF1A 3SC4A 5A05A 1TVEA 2BH9A 2X86A 2Q45A 3PZRA 3OF2A 2HJRA 3RD5A 2R00C 1HE3A 3NV9A 4FGSA 4MP8A 3STHA 1L7DA 4DVJA 2WD7A 4RPKA 1YXMA 3V2UA 4PLZA 4DPKA 1OC2A 1V35A 2P9GA 1B8UA 3L4BC 5T64A 2UAGA 3VZRA 5LDGA 1GCOA 2GO1A 1JLLA 3CSDA 4MJLA 1U8XX 3H4VA 3GUYA 5B4VA 2B83A 4XWYA 1Q7CA 4IM7A 4BO7A 3DONA 4BO2A 3WFIA 1HYGA 4D3SA 3ANNA 3GMSA 1DOHA 1PQUA 3WIDA 4DUPA 2E49A 1EFKA 1NR1A 2D0IA 4PLFA 2PKQO 5A9SB 2O23A 1DB3A 3D4OA 4J7UA 1NQ5A 4QFCA 1FXSA 1UR5A 4G65A 4HX5A 1ZH8A 1UAGA 4XIJA 4GWKA 1U3VA 1A7KA 4FR5A 2VZ8A 4QO7A 5JDIC 3SLKA 4BNMA 2G5CA 3PHHA 3ZHYA 4A5OA 1PL8A 4E31A 3WLEA 2Y99A 5DZSA 4BHTA 3JYPA 5FYDA 3BMCA 4D7AA 3P5SA 1YL5A 1A72A 4PZDA 1VSUA 4WPGA 3RC7A 3ZHBA 4DREA 1AE1A 2B5WA 2GCGA 4AJLA 1C0LA 1B7GO 1E3WB 4E0BA 3GUCA 2GYYA 1RM0A 1B0AA 2X1HA 4KP7A 4BNGA 4NBWA 3U4DA 3E9QA 1N5DA 2GERA 3PWZA 3WWZA 4BKOA 3NGXA 2JCXA 3RAJA 3RUHA 5AVOA 1B3RA 3EUWA 3ONFA 4JIGA 3BHJA 4CV2A 2PTGA 4AVYA 1IYZA 1ENYA 1UP6A 3JQ8B 4C7JA 4EZBA 1KY5A 1O94A 1PQWA 1EQ2A 4HUJA 5CHEA 5TC4A 4AFNA 2EW2A 2RH8A 1ZJZA 2F00A 2TMDA 4KUGA 3QVSA 4MVJP 4EEXA 3ASUA 4LSMA 4E33A 4WNIA 1RWBA 1UZMA 4IIUA 3VTFA 3ZWYA 2Q46A 1HEUA 5A9RA 4M1QA 4NBUA 2VZ0A 2EXXA 4LMRA 4PLGA 4PVCA 4XGNA 4UAGA 1N7GA 3GNQA 3BHMA 2UDPA 2G76A 5JCXA 5JAIA 4CR8A 3DFUA 3DFZA 4ZA2A 4C7KA 3QWBA 1E7MA 2O3TA 1HSZA 3WGOA 5JO0A 3C3XA 3T7EA 1CQIA 2H63A 3V5NA 3LT2A 5IN5A 1C14A 2VOEA 2OBNA 2E82A 5JDIA 1LTHR 1CJCA 2C5AA 3KEQA 2GSDA 4KQWA 3QWAA 4JXKA 3BTOA 3DBHA 4AJJA 1PJSA 1YB1A 3CUKA 1XIVA 3LU1A 1XGKA 2JFGA 3SLGA 3EC7A 1H94A 3C7DB 3WQQA 3BMOA 1C3VA 3HZZA 4I9NA 4QX6A 5JBIA 2QW8A 3WGGA 4RVUA 4FGWA 2ZK7A 1Y9AA 4WCFB 3CTMA 4S1VA 2VCYA 4R68A 4CMEC 3A28A 3FPLA 5A02A 4OIMA 5A9TA 3BMCB 4LN1A 1M75A 5I8ZA 1DRUA 3V1YA 1XR3A 4LVUA 4EUFA 2O3JA 4LRTB 4PLYA 3ZNPA 3WBFA 4XGKA 1GQ2A 1NQOA 1U3UA 1NHGA 1LJ8A 2DBQA 4UVHA 2NVUA 1ZK1A 4O5OA 5A3JA 3VPXA 2HKIA 2QYTA 4N5MA 3KB6A 5ITWA 3AUAA 2B37A 3ITDA 1E7QA 3O9ZA 4MVJH 4BO3A 5L40A 3MJVA 1V0JA 2EV9A 3D4PA 4ALJA 1J5PA 3ZW8A 3JYQA 2YV3A 5G0TA 5FWNA 1LLQA 3VDQA 3QRWA 3G0OA 1LDEA 2R00A 4E13A 2Y0DA 2HSDA 3CKYA 3PQFA 2C2XA 4CL8A 3K30A 2GN8A 4NU5A 1QYVA 2YFHA 1I3LA 2NVUB 1QLHA 2IXAA 3C1AA 4PZCA 3PJGA 4LSWA 1UXIA 4WJZA 3R3SA 3DBVO 3WBBA 3HWRA 3F9IA 4ILKA 4U6SA 2W4QA 1XSEA 3PYLA 5LC1A 4OO3A 4ALIA 5K6AC 1XCBA 4LK3A 4J16A 3ZWCA 3U09A 4JQCA 2WDZA 3NJ8A 4CM5A 3ZHZA 2Q1UA 4KTVE 3ZWVA 4BB5A 3WYCA 3L4SO 4XYLA 5ICSA 1JKIA 4D41A 1F17A 1NQAO 2W2KB 3HJAA 4WKGA 4AJNA 5TX7A 4B4UA 1HLDA 1GCUA 1RM5A 4YQZA 3DAPA 3EK2A 4JK3A 4PZEA 3AK4A 5FEUA 5IF3A 4M86A 4C4OA 2B5VA 1E6UA 3VPSA 1TI7A 2Y0CA 3C1TA 5G0SA 2EJVA 4PLWA 1EDOA 4HP8A 1EE2A 2NU7A 5G0UA 3AY6A 5GMOA 2Q3EA 5L4NA 3DOJA 4WCFA 2W2LA 3S8MA 1HDYA 3FI9A 3MWDB 3GG2A 4OQZA 1IPEA 3TZHA 3HHPA 1PJ2A 4J0FA 1IZ0A 4AJIA 2RCYA 4XDZA 3H9EO 3FNGA 5T57A 4NFHA 5BT9A 4J4TA 7ADHA 4Q3BA 2NTNA 2ZATA 1TA4A 4B7UA 4FFNA 4XIYA 5A4DA 3DHYA 4OKNA 1XU7A 4AL4A 3I1JA 1ADBA 4YJDA 3HB5X 3Q1LA 5EMHA 3K8ZA 4BNXA 5TT0A 1D4FA 1JAXA 1B8PA 1PZHA 2RAFA 1LSJA 2I9PA 3VH4A 2C82A 3C1OA 4IMPA 3TNLA 5JE8A 1PZGA 4WGGA 2X9VA 1EE9A 3QHAA 5DDIP 5KJ6A 2JD1A 2O4UX 3ENKA 3PWSA 3RU9A 2O50A 4IGEA 3KYCB 3RUCA 1P1HA 4YT2A 1B14A 1G0OA 1PGQA 3F4LA 3OA0A 4J2HA 3D4NA 3LLVA 1EUCA 3QA9A 9LDTA 3E9MA 3PHGA 4GSKA 4NFSA 3F3SA 1VLLA 2SCUA 4DQVA 4CUZA 3CE6A 2Y1GA 1HSOA 1VL8A 3E03A 1SEPA 3QVWA 4E2YA 2E48A 1JU9A 4Y6PA 4CQMD 4DLAA 5T8KA 3IAHA 4J91A 2G17A 1XYGA 4YAKA 2BLLA 5B4TA 1WNTA 4BKPA 4BUCA 4E2ZA 2ZB3A 3M1LA 4RF3A 1E3SA 1CIVA 2VHWA 1WMAA 4FSHA 1HZJA 4OXNA 5IDXA 2ZKLA 4MIEA 4QFDA 5A03A 3WJAA 2FPPA 4MKRA 2AEMA 1FDUA 1PWXA 5I9MA 1TLTA 2GGSA 4M89A 2AE2A 1KIFA 1H6CA 2AXQA 3FBGA 3FTNA 5JYEA 5K0ZA 2X5OA 1U4SA 3BTVA 4GGPA 4LGVA 3MZ0A 4BVAA 3RC2A 4E5YA 4DGSA 5CFZA 3OFSA 2POQX 1GQQA 3TSCA 1YL7A 4TSKA 3WSVA 2PV7A 2GN6A 4PLCA 5HA5A 4FOSA 1JQBA 2X58A 3QQPA 1WPQA 2CF6A 2P91A 4JP3A 1B3BA 3DMYA 4JJIA 5TIIA 3OP4A 1UXJA 5IXSA 1DJQA 1DLIA 1YVEI 1S7CA 1EBFA 1M67A 1I33A 3FBTA 3NT4A 5A06A 3C24A 2JAPA 1U2GA 2VT2A 4N5LA 1OOEA 1IULA 1HLPA 5IJZA 4RZHA 4UVDA 1P33A 5CDUA 3OQBA 3UCEA 3A1NA 3MJTA 3RJ9A 4BO6A 4E5NA 5U1PA 3D5TA 5BSFA 3ZCXA 2EF1A 2YFQA 3H9JA 4IPTA 1KC1A 1A4IA 2Y68A 3GZ4A 1XQ1A 1EVZA 4YRAA 5FF9A 1WMBA 2FN7A 3DZBA 1A7AA 4YJHB 4GKVA 3DTTA 1E6WA 3I3OA 4CLHA 5L4LA 2PNFA 4J4BA 3IJRA 3T4EA 1ENOA 3ROPA 1H6DA 8LDHA 4I9HA 3KZVA 4B79A 1C1DB 2X7HA 4WCFC 5COAA 3WJ7A 2PGDA 2Q1TA 1HF3A 1R4NB 3DBRA 1ENPA 2Z5LA 3QE3A 3N7UA 4BIIA 4PG6A 4J0EA 2VNSA 4PG8A 3H5NA 2O3RA 2BFAA 3IKTA 4O59O 5EQDA 1X13A 4OGWA 2PGLA 1WXDA 2O4CA 4QSMA 1BTOA 2NSDA 4BNJA 3OECA 1YWGO 3H2ZA 3JQDA 2NADA 4Y6SA 4YBZA 1O8CA 2DU8A 2FPGA 3U9LA 3W4KA 1A9ZA 1X7GA 4RVDA 1P77A 5MGBA 3R6DA 4YYZA 3GPIA 1QYWA 1IUKA 5TRTA 2EIHA 3TRIA 4KUEA 1EK5A 1RPNA 1W73A 3GN2A 1NWHA 3MEQA 4YTEA 2BMAA 3VC7A 2X0IA 4CQLA 3FWZA 3OIGA 5EINA 4AJPA 4EDFA 4I1IA 3GNTA 5BQFA 2FR0A 3E18A 3ZU4A 3R0IA 4MVJF 4E4YA 5DCWA 1IHYA 2RIRA 2PK3A 3OJEA 5TT1A 2QQ5A 4FC7A 3H8VA 1I24A 2VUTA 3FWNA 4RQUA 5DT9A 1Q0QA 1GFSA 1DHTA 4Q3NA 2YYYA 3GOHA 3HDQA 4AICA 2C07A 4J1SA 1A71A 1TB4A 2BI7A 1LLCA 5GZ1A 4YAIA 1VE9A 3JQ8A 3PYXA 1E1KA 3ONDA 3UW3A 3ROMA 3DOOA 3RBZA 1SO8A 4MKXA 1MA0A 4K26A 3CINA 4PVDA 1LDGA 4R51A 4ZRMA 2Q4EA 1AHIA 5K9ZA 1BDBA 3HE3A 4UEJA 2ZJ0A 3RFXA 4LISA 4XRRA 3G1UA 1YKFA 5F5NA 2ZYAA 2OZPA 4XQGA 4FIZA 2P9EA 3VVBA 3BHIA 1UDCA 5U4QA 3UCFA 3ON5A 3FNHA 4GX2A 4LCJA 3DAGA 3GNSA 2C20A 3E1KA 4YVFA 4BNIA 1DJNA 4DPLA 1XEAA 5TLSA 4AJ1A 3PDJA 1SNYA 4FFPA 5L7YA 1WDLA 1Y9EA 2PD6A 1GUYA 1KVUA 2IYPA 3VHRA 1JKJA 1ZFNA 5TS3A 1QXSA 2WSBA 3U4CA 3ZI0A 3O03A 1SPXA 3PDUA 4XZ3A 2C2YA 4R5MA 1DFIA 3RROA 5BNIA 2W2LD 1I36A 9LDBA 4BNNA 4E32A 2C7GA 2V6MA 3TZQA 5BNTA 4XD2A 1PEDA 3ENNA 4HKTA 4HWKA 3PPIA 1P0FA 1XG5A 1X7HA 3TZ6A 1X7DA 2AMFA 4PCVA 4GMGA 1ISHA 5C37A 5CG2A 4M49A 2WWRA 2DBVO 1QYXA 5CPBA 4OJNA 3WWYA 1NYTA 1Z7BA 2IYOA 3PHLA 4CV1A 1Z6ZA 1CERA 1YB5A 3PVZA 3WYBA 4H16A 2FZEA 2IEDA 1WVGA 1EFLA 4BNZA 3DZFA 5KKCA 3IUPA 5L7WA 4WECA 1FK8A 1X0XA 2I3GA 1KVRA 4YJFA 3TWOA 1SOWA 2HO5A 3IIEA 1F12A 4W9NA 1BSVA 4IDFA 2NQTA 4MINA 4PG7A 3GT0A 1NAHA 3O4RA 5DCYA 4B4VA 4D42A 3PLNA 4W7HA 4Y67A 2BFPA 3Q6IA 3TL2A 3L6OO 5I7VA 2W8ZA 4WEOA 3F47A 1FDSA 4XQEA 1ZSYA 2QRJA 4GX1A 3ZGYA 2ZQYA 1LBEA 2V6GA 4CM9A 4J3FA 3VKVA 2HDHA 1I5RA 1D7OA 5GZ6A 1XELA 1ZUD1 2IODA 1XDWA 4I5FA 1C1XB 2Z1MA 4OYRA 3RCBA 1R37A 2D3TA 2NUAA 1ZVMA 3RQSA 1D1SA 1R0KA 2HK7A 4P4NA 4WLEA 4L8VA 3HN2A 3G3EA 3EMKA 3ROKA 1DIGA 4FJ0A 1BVRA 3ZNQA 1QG6A 2AQKA 4ZQGA 4EI2A 3LQFA 3DZGA 1P1JA 4RZIA 1VRWA 2CZCA 3D5QA 3ANLA 2ZTVA 3FN4A 2JFHA 2PFGA 3I6QA 1Y8QB 3S2GA 3SJUA 1ZJYA 2VYNA 5KVQA 1HE2A 3GVPA 4RORA 2ZB7A 1FDWA 3FNFA 5JS6A 3BYZA 2IXBA 2V65A 4B8WA 1PGJA 2X5JO 3VPGA 3AWDA 3D0OA 4NK5A 4L76A 3O26A 4R1TA 5EJ2A 4NQZA 1J4AA 4YJGB 4CMGA 3JQ9A 4XQCA 4NU6A 3EVTA 4Z3KA 1YB4A 2P9CA 4QQRA 2WYWA 4R4JA 4XQ9A 2NQ8A 3ZW9A 5ICMA 4FFOA 4CMJA 3ITKA 3E9NA 3QVOA 5JC1A 5F21A 3ZU2A 1QRRA 4JNKA 4J1NA 2DC1A 4WOKA 4D3DA 2HMWA 4RVFA 2YV2A 2VHVA 4R41A 1QP8A 3H5RA 3L4BA 4NI5A 4AJEA 3V1UA 1IL0A 1L7EA 3TQHA 3NGLA 4EYEA 3KBOA 3C85A 2P4QA 1XWFA 3EZLA 3INGA 4OXYA 4UEKA 1V3VA 1ISJA 4OKIA 2YHUA 1QYCA 4CQMA 4RPJA 4FDAA 1J6UA 3QVXA 3X2FA 5BSEA 4R9SA 3SC6A 5ENVA 1KC3A 4BO4A 2DT5A 4FC6A 2J3KA 3F1LA 5J23A 2ZIZA 3JQAD 3I9OA 3ZWMA 3QWHA 1D1TA 1KS9A 2VRBA 5A5FA 5IXYA 2CDAA 2VN8A 2BGLA 2PGJA 4YRBA 4Y98A 1TT7A 3VPFA 2QG4A 4UUMA 4HFJA 4WASA 5JNLA 1Z75A 5C7LO 3RIHA 4FFLA 4IDDA 3BAZA 4Q9NA 4U5QA 4MVJG 3JQ7B 4NZ9A 1LDYA 1LA2A 3EHEA 3UUWA 4J1TA 4XB2A 2GN9A 2RBEA 2J8ZA 2EEZA 3KLPX 3BXXA 4RLHA 1DC4A 3JYLA 5DBGA 3GC6A 3I6IA 1EUZA 3WTCA 4JJGA 3VDRA 3Q9NA 5CEJA 1DIHA 1IOLA 1U3WA 4PLTA 1C0PA 4JLWA 1YS4A 1FF9A 1UH5A 1WLYA 3PQDA 4JBHA 3TZCA 5I9LA 3LYLA 4E12A 4RF2A 4KUHA 4PLVA 3FF4A 1DHRA 3ASVA 3DZIA 3ZDFA 2CF5A 4G81A 4L0QA 1A9YA 1RJWA 3OIFA 1ONNA 3Q2IA 1DIRA 4A03A 3EDMA 1ADCA 1EZ4A 1U9JA 1ZIDA 5C7IO 3WIEA 1GL3A 6LDHA 1Y6JA 4GGOA 5DP1A 3B6ZA 2OUIA 4U0JA 2X5KO 3DHEA 1ZKMA 2NV6A 2DFDA 2P2SA 4CM7A 2CVZA 1P44A 4GWGA 4EUHA 1GZ3A 2JFFA 3DWFA 3AU8A 3K2EA 1AN9A 3P2OA 1IZ9A 1NBOA 4RF4A 3JQFC 1Y8RA 4CMIA 4ZD6A 1GV1A 3CZMA 3W8EA 2BI8A 2I5PO 1WW8A 4DIFA 3H9UA 2BRUA 1W6UA 2HMVA 4IQ8A 4P38A 3PGXA 4CM3A 1N9GA 3I9LA 4R16A 4OH1A 4PLPA 4NDNE 1T2DA 3AOGA 3A4VA 1KVSA 3IP1A 4W4TA 3U3XA 3W6ZA 3WGQA 3EW7A 2XXBA 4BNKA 3AI1A 3QW2A 1F14A 3KSDO 1P45A 2VYND 1CDOA 3Q0EA 4CODB 1KBZA 3OJOA 2WJPA 1IPFA 3CEAA 1GY8A 3E82A 3DB2A 3GVIA 2UVDA 3GGOA 2VT3A 3AY7A 3MWEB 4UREA 4XYBA 4GSLA 4D3FA 1GTMA 3GRPA 4K6FA 1NNUA 1MGOA 1K6JA 1PSDA 1W0CA 3LF2A 1YO6A 1U2DA 1OZAA 4BQPA 3TPCA 4IJUA 4YEDA 4GAEA 3WDSA 4M55A 3RC9A 3KHUA 4TQGA 2HK9A 2O48X 1NPTO 2HRZA 3F1KA 3GGGA 1NFQA 3AU9A 3JQEA 3HN7A 3WQSB 5KJ1A 2Y1DA 3DZHA 1K6XA 3OA2A 3RKUA 4UEOA 1PS9A 2VWGA 4R9RA 3H6KA 1JTVA 1E3EA 1Y81A 1UAYA 3O8QA 3I23A 4PN3A 1LDNA 1D3AA 2QYSA 3ZV4A 3IDSA 4QECA 1K3TA 3WSWA 1T24A 2FZWA 2NU9A 4Z0TA 2UUPA 1TT5A 4IXWA 1FDTA 1N8KA 1DIBA 4HNGA 4ZQFA 2QIOA 3DBLA 3B20A 2VQ3A 1N7HA 3FCOA 4OMUA 2HMTA 2WE7A 1TXGA 4BMSA 3CH6A 2CVQA 4D0SA 2P5UA 1HKUA 4F3YA 4IUYA 2CMDA 4UVGA 1EK6A 4MPDA 1JVBA 3IKVA 4BGUA 2O2SA 3PHIA 2ILTA 4TROA 5F5LA 1RYDA 2UUOA 4Z9YA 5TJHA 3OH8A 4Z3DA 3NTOA 5EL0A 5AYVA 3TL3A 5HS4A 5IZCA 3H5AA 2VRCD 3S2FA 4ND3A 5HRUA 1F8FA 5I9NA 3LLSA 3LT1A 4BNHA 2ZTMA 4YDRA 4DLBA 3INRA 1DAPA 3LVFO 2NM0A 1H2HA 2O3QA 5JPIA 1UZLA 3U5TA 2ZQZA 3IP3A 1Z74A 4MDHA 4NMHA 3EYWA 3R1IA 5KJFA 3RKRA 4CLRA 3KO8A 4A27A 3PIDA 1GQYA 1LXCA 1YE3A 3DAFA 1ZXBA 2JCYA 5DULA 5G0WA 5ILOA 4MP3A 3TF5A 4W99A 4XB1A 2NNLD 4IDCA 4DLLA 3UAGA 3ROQA 4BNVA 2Q2WA 4IJVA 4ZVVA 2O3SA 3GN1A 4PRKA 1NR7A 3IUSA 1NPDA 1JA9A 2EG9A 2J5KA 5A04A 1DSSG 2BF7A 2B35A 2OP0A 3SVTA 4J2OA 4WE3A 3KYBA 1YGYA 2I66A 4MVJD 4GX5A 3HSKA 4OOEA 5KIAA 4NBVA 2QHXA 1I2CA 3H3JA 2QX7A 4O63O 1GR0A 2DUWA 3H9QA 4L4SA 1FDVA 4HY3A 1HYEA 3T4XA 5MDHA 4O0LA 1VKOA 4E6PA 2A94A 4RPGA 3OHSX 2W98A 4WOJA 1ISIA 4N5NA 3ZWXA 1Y1PA 5KOIA 2QZZA 1PTJA 4CV3A 2X0JA 3HNPA 2VOJA 1LLDA 2WD7B 4ZJUA 4WNCA 4CMBA 5I7SA 2OGUA 1E0DA 3VH1A 3B1FA 3WGYA 2RHRA 2J5QA 1ML3A 1NFRA 2G1UA 4Z9FA 4B7CA 2NTVA 3H3FA 1R15A 3SXPA 1R0LA 1W4ZA 1PIWA 3DMTA 1NWCA 1SB9A 3HQ4O 4J7XA 3QY9A 4MOWA 5COQA 3RBVA 1B8VA 2D1YA 4XJSA 4AJKA 5HTOA 3AW9A 3ZHXA 2YDYA 3NDJA 3B70A 2IDZA 1AXGA 3INTA 2ZYGA 1SC6A 1PGPA 5JC8A 2NU8A 1U4OA 1XLTA 1JKFA 1NFFA 1NHWA 1X15A 5CG1A 1DC6A 3JD3A 5TQVA 3KXDA 3WTBA 2Y05A 1VPDA 4RPLA 4IDEA 3NX4A 4IJWA 4YJFB 1VKNA 3TFQA 3LDHA 1PJTA 3LC7O 4DIOA 5AXDA 3PJEA 4TKLA 4CM6A 5C7OO 5G0VA 3WMXA 1ENZA 2DAPA 4UVEA 4O1MA 3VZPA 4RVSA 2DVMA 2DPHA 4F6CA 1NQTA 5B12A 2E37A 1G1AA 1ONPA 4JBIA 5IZCC 5AXCA 2YZ7A 4JP2A 4G5HA 3LK7A 1QKIA 4TRRA 2AG8A 4KQXA 1GEGA 1E3IA 3MTGA 3I5MA 5G4LA 2P68A 1YDWA 5TJ9A 5KTKA 1CRWG 1QORA 2FWMX 5EN4A 2O7SA 1W8DA 3U49A 5KWEA 1LI4A 3PI7A 1GZ6A 3B1KA 3AUSA 4R1SA 4YT5A 4IDAA 1H9AA 1WDKA 3Q11A 4JJFA 4YAEA 5JAQA 4YB8A 2YJZA 1BXGB 3RUAA 4ZN6A 3AM5A 1ZK4A 1HDGO 3PJFA 1BG6A 1X0VA 1YBAA 4CLXA 3JQGA 4BOYA 3GR6A 4U8GA 2B69A 3AUTA 2WYVA 4Y8VA
chains in the Genus database with same CATH superfamily
4BZPA 3JVIA 4XVRA 3DDUA 3K9GA 1K89A 2XE7A 2IPXA 2LCIA 1NBAA 3FJ1A 1LX6A 5ALQA 2WQ7A 4IOKA 2QTMA 3AONB 4NMMA 3AX6A 3K0AA 2EFDB 4JKIA 2C4TA 4PFQA 4QUDA 1ZMTA 2HHAA 4Y0NA 1BJKA 3AF1A 2A0XA 3GGCA 5CRIA 3S1AA 4B6QA 3LBYA 1L7VC 1YBVA 4RMHA 1VJ0A 1H2BA 4KDEA 4BBPA 1TEVA 3HP1A 3QFRA 1XDDA 3P4XA 3AVPA 1MIOA 3QLVA 4LRSB 2Y67A 1U6KA 3ZHRA 5THKA 3P2YA 2HSWA 1ID1A 4S1TA 4LJYA 4FDVA 4U9IS 4A73A 3GFBA 3MILA 1U8FO 1SXPA 1FEZA 3NOXA 1E62A 5FPQA 4GS5A 5FWDA 5A7HA 1WR8A 5GV8A 1X3SA 2DQKA 1IH8A 4TYYA 5AI8A 2OHGA 4C4YA 3GFPA 4GXNA 3QU5A 4JJ4A 3SJZA 5C1PA 3CB2A 5THQA 2DQZA 4FHEA 3MD0A 3ZOKA 3GRAA 3F90A 4IW3B 3G88A 4KSYA 4ZVKA 4IZOA 2HK8A 2B30A 4YDHB 1YQGA 3S2IA 1CY0A 2HU8A 2GAIA 3K72B 2FFBA 1N6NA 3KVVA 2X3FA 4IQGA 1ZIOA 2R7KA 4MQ4A 3EE6A 4W5WA 4W1SA 5IMBA 3OQ1A 4FFMA 4QWWA 4UHFA 3L46A 4A8JC 3TOVA 1E69A 1U0FA 2FEOA 2PZ8A 2O59A 3PCXA 3AP3A 2BFOA 2WZDA 5DYGA 1I3CA 4MKZA 3BILA 2QZPA 3HCOA 3UK2A 1T25A 1A77A 2ZIFA 2JVJA 3PP8A 4X84A 2IUEA 3AHFA 4LE2A 2HWXA 2Y1FA 5K01A 2IRWA 1LRJA 1DTWB 1U9IC 3L1JA 4TXNA 4DQDA 1VJDA 2C8KA 3A26A 3KYDB 4QL3A 4CCSA 1KNXA 4JELA 1BVHA 5KMGA 5K3AA 3LUPA 2VHUA 2ZCVA 5IBQA 3W06A 2O8EB 2GCEA 3AKZA 3G8DA 3IOCA 1U81A 1GUZA 2I8LA 2Q1XA 2WFAA 3O7MA 3IMEA 4Q1EA 4R01A 3HA3A 5CDGA 4KLCA 3X1KA 4BNYA 4AW9A 1F06A 5DT9A 5K0EA 3BL6A 4B2PA 6ABPA 4JXXA 1JR6A 2BFNA 4HPXB 1TM2A 4YP7A 2ENWA 3V1KA 1JAYA 2COUA 4L3VA 1JF8A 5LJLA 3QX9A 4NP6A 2KYRA 5KX5B 1CX9B 2F8MA 4FFWA 4MW2A 1N4DA 4DLYA 1Q6ZA 3WAGA 4E09A 4XKJA 4CM4A 1XLTC 3ZQJA 2OCLA 5FPTA 3GX1A 1T2CA 2CD9A 2GZ3A 4M0MA 3RIMA 1XZDA 4EPWA 3I9JA 3JQRA 1UKVY 4HPWA 3H2JA 3KQYA 3OO1A 2I7CA 4Q4JB 3U44B 3M4YA 4LOJA 1EGHA 2PLNA 1VP3A 1NM5A 3KSMA 2VDOB 2B4QA 1YA4A 3GGPA 3X1YA 3ZXIA 2PQ2A 1ZH2A 2XA9A 3MS2A 4GLLA 1KYXA 4X6XA 4DV3B 1IB6A 1TVCA 4ESEA 5AD1A 4E08A 4YCAA 4DYDA 4GL2A 1GAEO 2JI4A 4FQ5A 5FLKA 1QAMA 3UMCA 1OW3B 4BLQA 4D46A 3GY0A 5HF5A 3GB9A 2OAQ1 4PIVA 3RT9A 4A2CA 4UFPA 4ZV4A 7MDHA 3TFOA 2GR9A 4U7JA 1J99A 3RYIA 1CNMA 4L78A 2XH8A 1Y4ZA 5EUCA 2XAAA 4K0KB 3KOZA 5GADl 4NCHA 4C14A 2RGBA 2PWZA 3R7AA 2BDUA 4DAEA 3Q3IA 4P2BA 4DSOA 2QOEA 3TKYA 1NL3A 2YFKA 1PR1A 5CVDA 1I2ZA 3D3EA 6YASA 2PWYA 1GPBA 3CPHA 2ZJ2A 4HNAB 3D6TB 4INPA 1JDJA 2PH5A 2YNMA 4KQHA 4YT4A 1DAGA 1X7ZA 1QG2A 3K1JA 4PO8A 3VU0A 1GZUA 2ZJOA 4GLOA 4JHXA 1XJWA 2ETXA 1QIEA 4NIMA 1H4TA 1Z6AA 4D45A 2P0EA 2JASA 1U63A 3JWPA 3N74A 5BOVA 5JSZA 1O5TA 2O2EA 4N12A 5CDTA 2NNWB 3MUEA 1FDRA 4L8FA 5EIHA 1PN3A 4YRFA 1IN6A 2IPAB 2IU4A 2AZMA 2HNKA 1Y1QA 3RWBA 1HNZB 1F51E 4QLOA 1JLHA 1L7PA 2I6TA 4EM6A 4HNUA 5LQKA 3QUQA 2CKMA 5I5EA 3UM9A 2I0FA 4M83A 3THSA 1Z5UA 2EKQA 5HIAA 4YJ3B 2I7TA 1KXZA 3GU3A 2QK4A 2AQ8A 2Y8EA 3ZV5A 1VE6A 1Q57A 5LA6A 2A3NA 2W2NA 2WTNA 4IP0A 3OZAA 1VLMA 3ZH2A 3HJBA 1HQDA 4QBFA 2VQEB 4LNUB 1FDIA 1JDSA 2VJPA 4HMOA 5AW9A 1QO9A 1Y7TA 2M32A 5B6PA 4CIBA 2QTVA 1E1CA 4BVJA 3J81k 5LNK1 2XCUA 1ARZA 4CUJA 5E1OA 1JG3A 4GF5A 4TLLB 1KE1A 4EFKA 3LKBA 2NAPA 4ZV7A 3CRW1 3FDJA 2A14A 1CEQA 2VTDA 1T1SA 4LW8A 4RK7A 2BGUA 3RVQA 1M2EA 1XI2A 4LF9B 3G5AA 2L19A 2XMBA 3CCFA 3MWEA 3E3LA 5CVUA 1B74A 1E6KA 3RYIB 1V2GA 5FXMA 1VYVA 2OHFA 3W5VA 2WYUA 4HT3B 1Z5ZA 2FXVA 5LQUA 1GARA 1WXHA 1IM5A 4IGKA 3BSFA 1EP9A 1Z4MA 4RA6A 1IJEA 1H05A 1T35A 3CN9A 3KOUA 2R62A 4RDHA 3EQZA 3FCYA 3PS9A 5ES3A 4B6OA 1FUIA 2CUKA 2PZKA 3EAGA 4CU2A 2QRVB 4WY5A 2O8DA 1OYOA 4V03A 5EQFA 3U3JA 2NO5A 1PZMA 4Q4JA 1OIVA 3RLFA 3V8PA 3ED5A 1M10A 3N76A 4YT8A 3SHWA 3VSBA 3IKJA 3KU4A 3F6BX 3QVTA 4YUVA 2PEYA 4K8RB 2FWBA 2XZOA 2ZUUA 4IY1A 1KPIA 1Q1AA 4N7RA 4UDYX 4ZAFA 5JHGB 2FFHA 4URXR 2BBTA 1G6KA 3A3YA 4NR0A 1BH2A 5CDYA 1UDBA 2ZOSA 4J6FA 2W90A 5CLIA 4BVGA 2Z5GA 4P5PA 4D4KA 3WK6A 2BCEA 2CK3D 4ZU6X 2OFOA 5L4SA 3WWCA 2C78A 1MB9A 1VSVA 3C3BA 2XEDA 3W5UA 821PA 3HVUA 3W2HA 1T9KA 2HRBA 2O2CA 3QOFA 4PR0A 1OUMA 1K6MA 2P5SA 4WEQA 4BO1A 5JYDA 1FVOA 1L4UA 1VRCA 5EJ9A 3I4FA 1XHLA 5KVVA 1G21A 4I3GA 1PX2A 3WVNA 1H93A 4KZKA 1K0FA 1U7UA 2JH9A 4FWIB 3QPBA 4P3XA 3HDJA 4FLMA 2G6TA 5CEFA 1ZCJA 1U1CA 2PGOA 1HZZC 3K73O 2CVHA 3BCRA 3LDUA 4N0QA 1FZQA 4F72A 5GTDA 3PX7A 4FOTA 1V37A 3K0HA 1T26A 1T1RA 4XI9A 1V6CA 2CSXA 4MA5A 1QF6A 2PSSA 3PWTA 5K3DA 2APJA 2VH2A 2W2KA 2V4ZA 3UAXA 4D44A 5FOVA 1E7SA 4ITVA 1M0WA 3BXEA 2O8BB 4DDTA 3ZW7A 2ZUEA 3PFIA 4Q34A 2AQIA 1E9RA 4R2MA 4ZPJA 3SDZA 3BULA 4YMSA 3EXEA 3MS7A 1EG2A 1Z17A 2V74B 3AIMA 1A4UA 1MV5A 4DR4B 1XLVA 4FD3A 4FEEA 3WLSA 4OJTA 1M1NB 5FA5A 1EHIA 1JLMA 5IVIA 3RT7A 2GF2A 2QVXX 3ELYA 3SJ7A 3NHYA 2FRDA 4ARUA 2AKYA 2BR4A 3FKJA 2RE8A 3E22A 1X80A 3NVMB 4M38A 5JQGB 3H2BA 4HWSA 4OYLA 5LYYA 3D3WA 4EL0A 1YAHA 2XMDA 5H0IA 5MGNA 3GJSA 4LXYA 1OPXA 2ZU0C 1Z9BA 1VHDA 3GF4A 5EE1A 3V8NA 2Q49A 2EZUA 3KLMX 1SD2A 1YDEA 4RETA 3KG2A 2H5IA 1PQYA 5CM9C 3EDQA 4NJEB 4P83A 4BYGA 4D99A 5FUYA 1N2HA 2ZS8A 4OXKA 2V1UA 2YQ4A 3G17A 3K6JA 3PNBA 3BGSA 1VDMA 1E1NA 3VXKA 1Q7GA 1HDRA 1MU0A 2RK6A 3LKZA 4YRCA 1O03A 3ER8A 3SGLA 1AK1A 4D4JA 1FFYA 1ACJA 2WIGA 4Q4DA 1BW9B 3PKJA 1MJGM 2OMEA 2B7CA 3E2IA 4P22A 1XQVA 1O0SA 3LW7A 5FTKA 1Y98A 3DMPA 3QBJA 5JYEA 3GA0A 4DQXA 4ZVRA 2QZJA 1N2EA 4S35A 1ISPA 4MQEA 5E0OA 5J5CA 3ZE1B 5A2QA 3W77A 1UDWA 1UODA 2CXQA 2P2GA 4NBRA 2JLVA 3AVQA 2XKAA 4L9RA 1LRKA 4QQNA 4XJTA 4RHFA 5AOBA 3SWWA 5H81A 4KAAA 1RRPA 3SE7A 1GTSA 4LZAA 3ZWAA 1QIMA 3Q5EA 2G71A 2OYSA 3JQAB 4QTTB 4ZAWA 2J9YB 3OPYA 4E11A 4NULA 2OT3B 1E99A 1YQXA 2ZPTX 3NR2A 3EARA 4QDTA 3WGZA 1E1MA 5CVCA 3OTOB 2C61A 2IZZA 2GVNA 2QM3A 1CIPA 3OKPA 4WK6A 2B78A 4PQYA 2VPPA 4PNEA 4BEWA 4UMFA 2BM0A 2HSEA 3N0WA 5LZ2A 4FONA 3WWOA 4QLBA 2Q5JA 2XQJA 5JMWA 4IIHA 4MTCA 2B98A 4KSBA 5ALOA 5HBRA 3TCNA 1S6YA 3H2KA 5AM2A 4KQJA 4RCVA 4RTJA 4W5OA 1FSGA 5IVKA 2GZ1A 4QUKA 3VNBA 1RVV1 3K0BA 1QHHB 4JDUA 3UAOA 3QF4B 5AVQA 1R16A 1W5BA 5J2TB 3R24A 2PU7A 4WLFA 2IW1A 1I3MA 2QVLA 6AT1A 5L3SB 5G2OA 1EVLA 2O0JA 2JFOA 3D3NA 1V41E 4CF7A 2Q50A 2BGIA 4MULA 3V4PB 2FE4A 1JIIA 3CO5A 2X0RA 4NH4A 2DM6A 3WK4A 1GPJA 2X9NA 3WB9A 1V16B 1V5EA 1FFHA 3WLMA 1SURA 2VHTA 2ZULA 3O2SB 5BWCA 2VJKA 1B42A 1C7IA 4HNHA 1UJ6A 1L7NA 1YS9A 3KB2A 5LNK6 1L2TA 4NRDA 4WBNF 3TLXA 2FDXA 3T1NA 4B3XA 4DSNA 2QAGA 4GRAA 1MJ5A 1CLEA 2QAGC 4DADA 3CMMA 5HQJA 2QLBA 3I34X 4AJ9A 5JAZA 2AEJA 2GWRA 2JGNA 4BO9A 2XSZD 1ZUNB 2D59A 1OXBB 1OVMA 4HMQA 5EOVA 4UTPA 3D7RA 1LVUA 3HACA 4FIDA 5EJ4A 1M1ZA 5IWCA 3FMVA 3TUJC 4GEKA 3JATB 3M4JA 2VNAA 2Y1EA 3HJNA 1NM5C 5LBIA 1R3DA 1WMFA 2F59A 2XYGA 3DOUA 3IUYA 3NRCA 5BYBA 1Y34E 3QXGA 1TMOA 3PCRB 1JP7A 1E4VA 3B52X 3EFOA 3CKKA 2PE5A 1ICIA 1XWIA 4KDFA 1YBHA 2K7ZA 3S28A 4IBOA 4GECA 4Y1FA 3RC3A 1DIAA 1IY2A 1G4UR 2CLKB 1L5QA 2HQRA 1Q0HA 1TKAA 3TK1A 4CM1A 2FPGB 1WB4A 3FVQA 2WJIA 3T3DA 3WAKA 4ATNA 1PK7A 4FJ2A 3R4VA 4D3XA 1AMNA 4KQ6A 1HORA 3B82A 4C78A 5AW1A 4OHVA 1UC4B 2NXWA 2P4EA 3HP7A 1JLKA 1H2YA 3ZWWA 1GQSA 1J97A 3Q8WA 3FNIA 2HRQA 5DHUA 1IN4A 4MH0R 2VBFA 5A4KA 5A3RA 2DWOA 5K6AA 4PY2A 3ST7A 1EBUA 5EP1A 1DT5A 1L7XA 5KAPA 8GPBA 1USGA 3ADPA 1CR1A 1BXZA 1QFZA 1DTEA 2D13A 3AY3A 3D4BA 1CUVA 4D98A 4G4SO 1C9JA 3UJDA 1U1IA 3W05A 1XNQB 2LRHA 4JQOA 1KGDA 4HQRA 4KODA 3GXOA 1AURA 1T8RA 5KQGA 1X2BA 2OCAA 1VBKA 4I1PA 3AB3A 1M6WA 3K15A 4PCAA 2PY6A 3EEBA 3VV3A 1Y3BE 2ODPA 1KI4A 1ZNQO 3KPWA 3DPSA 3RUEA 3U3MA 4HQKA 1N1EA 2PH3A 4ISCA 3E5RA 3JQAA 4NJOA 2OORA 3F7TA 4PPYA 2RHJA 2OXFA 4WERA 3GLRA 1EMDA 4M3NA 3A7DA 3BJEA 4A6PA 3ZDCA 4HAYA 2O7QA 3FR7A 2C9OA 4DLZA 2KJQA 1ZHOA 4EGJA 1BU5A 2W6QA 1T9DA 3GEGA 4FKZA 4R1UA 4BQRA 4BQOA 2C5FA 4DT1A 1KEPA 2VHZA 3DEYX 1G3RA 4K28A 2OHHA 3EGXA 5EA2A 1P75A 2Q9BA 4NEQA 2BEVB 1XMVA 4RIFA 4GXRA 3C7CB 4Y6QA 1KOLA 4B1FA 4C0HA 4DW8A 4E5UA 2DXIA 4OLAA 1FBTA 4G2NA 5ERXA 2HV8A 4OA5A 4H7PA 4X3OA 4W5NA 4B6FA 2BKAA 3AI3A 3H8SA 3W34A 3IL2A 1DWPA 1Q17A 3DXXA 3JX9A 1AB5A 2X1LA 2HIGA 5B3KA 3ESXA 4Q21A 3CZ4A 5BN3A 4HEHA 4KN9S 4BGEA 1DAEA 2EHDA 4WH0A 4QDKA 4DM3A 5B4UA 4A8PA 1W19A 3KKMA 1RYEA 2AUTA 2YYSA 3OPMA 3NHZA 3Q9UA 3R0VA 4G4JA 1WXGA 3IERA 4Q48A 5DOZA 2ZBVA 3R9KA 1Q0ZA 1USWA 4BWVA 1RWXA 4F93B 4WOCA 2C5EA 4WWHA 2QTHA 1CUIA 2AF3C 2CY0A 2R6FA 2F9LA 2FJ0A 2OO5A 4JVOA 3NDBB 4X1YB 2H9AA 2XDYA 4DPMA 1YHYA 4TSFD 4MZDA 2PX4A 1TPYA 3JQBA 5DP2A 3LHIA 4O2BA 2LZ0A 2FMFA 3G9QA 5CP8A 5CYOA 4OXRA 3G0HA 5INTA 1SU6A 1SQSA 2H0QA 3H2IA 5AIBA 1KYIA 3THWB 3ZR4B 2C3OA 3PGLA 4G5RA 1QYDA 2DHEA 3D4IA 3H5IA 3I2GA 4CMKA 3CJQA 4JB8A 4YCLA 5FPHA 3QBVA 2BMWA 4C21A 1GZ4A 4LMPA 1RKXA 4Y0AA 1KKMA 4LJ6A 4GM4A 4EO4A 3HYSA 3IOYA 4S1NA 5DFAA 4CCYA 2CJYA 3U3RA 1ZWLA 4POAA 1P91A 4OK6A 3GLFE 1JHXA 3OG9A 3TYXA 1E2MA 3V3TA 5B1YA 5CFOA 2WQZA 3UPDA 3LXXA 4BJ6A 2XUZA 2H2WA 3AM3A 4U2GA 3VPCA 4TYPA 1A9SA 4CN9A 5ITVA 4HH3C 1PNVA 4I99A 3TEJA 4IXMA 4E3ZA 2A0YA 1DEOA 1A9QA 1R0WA 4G86A 4L4XA 4TV9B 2DBZA 3G2JA 3AFGA 3P9QA 4H6WA 1QVAA 4YRSA 3OU6A 4IH9A 1P4JA 3KSUA 3WK8A 2BP7B 1WZIA 1Z5WA 2WJAA 5F1YA 1YGPA 3ZUPA 4BMNA 5ADVA 3MIZA 3HCNA 3AW8A 3FZYA 3LWDA 3G7UA 3M5PA 4N7JA 4V0OA 3V4FA 4GMFA 2QXUA 1EU1A 1IJBA 1KFBB 4LCEA 4AY6A 4TTPA 3BHNA 3BMQA 1PNRA 1L5GB 2QUKA 2YRWA 4DLTA 1C7QA 4PYKA 4R1NA 4CKBB 1RYNA 1TTQB 4B2IA 3VTKA 3TEMA 2ERXA 3II6X 3WKDA 1JQDA 1R8JA 3BA1A 1PJCA 1W29A 3AETA 5SY9A 3WLFA 4A0QA 1NMZA 1RU3A 5E4JA 1BS9A 5IARA 4C20A 3SCZA 3KFVA 3TOZA 4OI4A 1Z26A 2BVNA 3QJ5A 4OJQA 4RACA 1XZLA 3K2IA 3WIVA 2HUNA 1M9NA 1S8OA 1OV6A 3KR0A 2VDPB 3NONA 2VHCA 5L51A 2QTBA 3KZOA 1NUSA 1WHTB 4K9QA 4YROA 1AZSC 3USCS 1EQUA 2I2CA 3NRBA 4H27A 2VDQB 3H7AA 3KTAB 3DMTC 3I52A 4JCOA 4RABA 5AKHA 2VAVA 3NM5A 4TS4A 1U7HA 1KDOA 1GXSB 1PVVA 3ZD8A 3ZY4A 4EW2A 1Y3FE 1UXOA 1T5IA 1GOTA 1KRHA 4ZTBA 2HMSA 3BTSA 4KGVA 1ABBA 1NVMB 3EXAA 1Q0LA 1XN4A 2W6OA 1JG2A 5DRTA 1G8YA 4ER3A 2Q6VA 1L5SA 2J9GA 3AEZA 3K96A 3VU1A 3FPSA 1HEYA 3B6IA 3OMLA 1ZMBA 1WL8A 2B34A 2B8JA 3OIYA 4JXJA 1BNCA 2RAPA 1P5FA 3WFJA 1G98A 3V2HA 2IQ5A 1KMHB 3PEYA 1KYVA 2BTQB 1DC7A 1M6HA 2XX3A 2ZUBA 4G89A 1PO7A 1GL9B 1B1AA 5HUHA 2CFRA 4LY6A 5CD9A 1CV2A 3VR6H 2ZG6A 1RJEA 1GT91 4LC1A 1YHZA 1QGDA 3IA2A 1NUPA 3AQ4A 3ZTTA 5KNLA 4H1UA 1F1JA 2NTJA 4WZBA 4MB6A 2UVPA 2VXYA 4PZLA 1EM8A 3F6RA 3SEAA 4X41A 3OICA 4JB3A 3ZLVA 3FR8A 1LVGA 4TTJA 2NXJA 1TZCA 1WEKA 2PPVA 2PLRA 2BRUC 2FEPA 5D2CA 3DNFA 3RYFB 2X5XA 4HFNA 2B4AA 2VRNA 5M34A 4G0WA 2R4TA 3IHWA 3RRJA 4N4AA 4WXEA 1ZR2A 3JALA 3PU6A 3LECA 3AESA 3MTBA 3PSHA 3Q98A 5G3YA 1OC4A 5IH3A 4GDFA 4JGBA 1QV9A 3OZTA 1XAGA 1Y3CE 4FCWA 1JHOA 1LJLA 3PDIB 4I36A 2VYVD 4X8OA 2QUZA 2XXAA 1CJMA 2EKBA 2C3UA 4FZRA 4BWFB 4EG4A 3L0ZA 5FJIA 3S3TA 3OQNA 4UBJA 5F1KA 4MO2A 4DDMA 2JIZD 1T8SA 2VPWA 3KM0A 2PT9A 3OOWA 4UD2A 1GZHB 1JFSA 1FIUA 1J0DA 4O29A 3I1IA 3R9WA 2WHPA 4ER0A 4BNUA 2ZIUB 4CQMB 1L8AA 2A5YB 1FW8A 1TJ4A 2IOFK 2IW3A 3O9VA 4ZYZA 2RHOA 3PK0A 4LG1A 2NUPA 2WWIA 2Z9DA 3LH5A 1EFCA 4MEJA 1V7ZA 3TD9A 3VAAA 2VYVA 3I32A 2X6QA 3U7FB 1HDZA 2WB4A 2RH9B 1EHCA 4B0OA 4HDNB 1NX6A 5JNSA 1JHDA 1DU4A 4LXXA 2NU9B 1LC0A 4RX1A 3KJFA 3B1JA 3UOGA 1TMGE 5SYAA 3S7TA 3RVPA 5F9FA 1GPYA 1OZGA 1ZNXA 2GYUA 1PQ4A 4L4RA 1JIJA 2F64A 3OLQA 4GZ6A 1MO5A 3V97A 2WF6A 1QMGA 3U44A 2P6RA 1TJ3A 1ZD5A 3GWGA 1QR2A 3N2KB 1NV8A 3OPQA 2XF8A 2HYIC 3CLRC 5JMPA 2O7NA 1G42A 3Q3JB 2QD4A 3GJ6A 2JEYA 5ICGA 3LVRE 2PGNA 2G28A 3HS3A 3L5KA 3PLRA 4E70A 4X7BA 5A71A 3G8CA 3ZCUA 1Z7YA 2P2LA 3M83A 1FRZA 1HRDA 1CS0B 3PD7A 4XGQA 2W2QA 5FI3A 2HMAA 4WKCA 4FOPA 2OPHA 3DFMA 3GLGE 3K0KA 1DO0A 4R81A 1RC1A 1ORHA 1ZISA 1SXJD 3OBIA 4PTYA 2X9GA 2JRCA 1GKKA 5GGXA 4FJ1A 4ZJYA 4QUJA 4O4HA 1NBHA 1FX1A 4JEIA 4ZOLA 4E2WA 1JJIA 1A8IA 3EGVA 3K1YA 1EVQA 1RLTA 1QK4A 4UHHA 3A06A 4EW6A 1GNPA 3KUXA 3IV6A 2RJNA 3BE5A 3LQQA 3NP7A 3UJBA 4C0KA 2EKPA 4GXTA 2QRHA 3CPSA 4BE9A 4HH1A 3S2SA 2WDPA 1U0NA 2NN3C 3KT8A 1H69A 1Z37A 3GK3A 1H5NA 2GRUA 3HG7A 2AF4C 4X8MA 1E2GA 1CUWA 1EWRA 1GV0A 2JFZA 2WSSA 2YCBA 3P32A 4M7PA 2CLIB 4MS1A 2ZJ1A 5EP4A 3RVJA 3TW4A 3F5DA 4BO5A 3PUZA 5EJ6A 3E5HA 2RK4A 1BX0A 1ZM7A 5BUCA 1DIOB 4OY3A 2UXBB 4KE6A 2BC9A 1UDXA 3O1JC 3SIXA 1KAQA 3O8DA 1NJ5A 4GE0A 4MWCA 2SBTA 5I5GA 4Q4CA 2KBFA 4HRYA 3UHOA 3EW9A 4JMLA 4QBHA 4D4HA 3I9FA 4EFLA 1ADYA 2J3IA 3PQCA 4BCCA 3GA7A 1A82A 1T9GS 2B4RO 4UUNA 2FJUA 5C4IA 2ZBUA 1LQTA 1UOQA 2ZUDA 5KBYA 2HLDD 1C1XA 5JSFA 1TM5E 4BJHB 4OBXA 2A7XA 2JH3A 2BELA 4P0TA 4NOLA 4L27A 3MOSA 3EDOA 4AN4A 4AZ0A 4AWAA 1TMYA 4FW8A 2Q5IA 4DHWA 2HA4A 2A9RA 5KTOA 2Z57A 2J45A 3HUFA 2K5UA 1ZCFA 3IMGA 3M6WA 3MJ4A 2AQHA 5HS6A 2BAGA 5G4KA 2YOGA 2QRLA 3THOA 3GFVA 2D4AA 3BN3A 4L15A 2ZRKA 3RVNA 2GD2A 3N7TA 3IIMA 4E07A 2I71A 1X8KA 4LMAA 4DILA 3BAFA 5LJIA 1AKVA 3T12A 3SQNA 1CUSA 1FUYB 4EKIA 4PFSA 1EQAA 2HMYB 1W87A 2IGBA 2X8AA 1XAJA 4N3GA 3S5JA 2GK7A 1BJTA 2FQQA 4DC1A 1LC3A 5HSGA 4ZC8A 3P9RA 4EKDA 4DDWA 1XRPA 4H0NA 1PRYA 2ASEA 4LFAB 3GPDG 5GJBA 3HR8A 4H1VA 4G0MA 1MX9A 1EWVA 2P8SA 3JU3A 1AUOA 4M1WA 1VJ5A 4TL7A 2HXYA 1AK9A 4ALMA 3VYVA 3KQKA 3AL2A 1ZK3A 3EY9A 3MTJA 3ZOZA 2HQOA 2RHMA 3UJCA 5EMNA 1PJ4A 2AR7A 3JZAA 1D6SA 3AFNA 2O0MA 3OC6A 2IZ5A 2W6JA 3JTMA 3KLOA 4FWTA 4G4IA 1Z28A 2FPLA 5HIKA 1AGYA 5HIJA 1C2TA 3LHFA 1FQWA 3BDVA 4N82A 2ONYA 2PV0A 3HLKA 2XGOA 4FGLA 4D2IA 1LQ2A 3PX3A 3BL8A 4UDOA 2FZ4A 4CLRB 4EMTA 2Z1NA 5JNUA 3DG9A 1MAWA 1I13A 1UKCA 3ZLJA 1C3LA 3ME5A 3N0TA 4YRGA 4G3XA 1Z6PA 2IYUA 1TK3A 1TL7C 2JATA 3DUFA 2G88A 2RGCA 3BB4A 1G291 1ZUHA 2A9FA 3HZHA 1UXGA 2VXOA 3KOOA 5BSRA 1KEKA 4EZIA 3JQQA 3SC2A 3W1VA 3FKSA 2CHQA 2PD3A 4TPKA 2MSWA 1NXOA 3S70A 4ZYLA 2RGNC 1JR3A 3NT2A 1KZ6A 1OIWA 2TMYA 3HA7A 1D5WA 1EPUA 3I45A 3P0RA 1WF3A 1LSUA 3R4CA 3NUZA 4P7JA 4XCVA 5ED0A 3CEJA 4BO3A 4NF2A 4NK4A 2F90A 1AQUA 1QRDA 4R54A 1YHNA 2WTAA 1EGQA 4KNVA 4GPAA 3PUXA 1L7AA 2W42A 4I5EA 5E8JA 1TKBA 2IYVA 3AP2A 3I30X 4MITA 1SC1A 1CUHA 1B15A 3D2AA 3VR2D 1Q84A 2VBCA 2D00A 2ISSD 3GLHB 3QXCA 4RD3A 1OXSC 3DZKA 1CB7A 1F2TB 3H65A 1TYCA 2EJCA 2IZOA 3I12A 2PUJA 4AMBA 4AS2A 5KPDA 4A6EA 4ZCLA 4TMFA 5B3AA 2I6QA 2GDZA 3OE4A 4ZAZA 4XE5A 2DP4E 1Q1GA 2R7NA 3C3DA 4FR2A 1SB8A 1BIFA 1KK2A 3JQFA 3O8QB 4YPFA 3DOEA 2IH2A 3P45A 4KH1A 4B4OA 1QVRA 4QAQA 3H11B 3WLOA 1YDMA 4ARCA 4L8GA 5GP1A 3HEMA 3EA4A 1DCKA 3I5UA 1JH9A 3BMQB 1UUFA 3X1DA 2JD0A 4FFBB 4KXQA 4P7KA 3WNQA 2AMYA 4DLUA 5B64A 3IXLA 1YR7A 4DG9A 2QM8A 4O25A 1H0KA 1PFUA 1PS8A 1ULUA 4LY0A 4B2YA 4HH0A 3L4KA 1T1EA 1YCDA 3DTYA 1Q7BA 3W3AA 5JASA 3QQ5A 1D03A 1ND6A 1LV7A 1VJGA 4KWEA 3ASYA 1T3SA 4CDNA 4EUEA 4JC0A 3PC8C 4Y2QA 2JEZA 5DW3A 1TIBA 2JA1A 3FRJA 3GP3A 3R6GA 2GF9A 1FP7A 2R2AA 1GGHA 2XGMA 1L3IA 4NQRA 4PS1A 5ALPA 4K3UA 2IH4A 4R7TA 3DR3A 1GADO 4K9LA 4DV6B 3A0UA 5CLGA 5LCXA 1P1FA 1JWAB 4GT1A 3L9WA 4YAJA 4KU4A 1UDRA 3FSRA 3DBRB 1Z73A 4OHKA 1V4NA 2BFMA 2CN1A 4HYEA 4RAQA 2WSMA 1YB2A 4QEDA 4CJXA 4JV5B 3FGPA 3JD0A 4HLUA 1NI5A 3M5WA 4UNNA 5E4YA 4AG6A 2ODAA 4K9PA 1L5YA 5F9MA 4RGBA 3W3ZB 4O4IB 2FPIA 2OOKA 1T9AA 3H18A 1HLGA 2QSYA 4HGZA 1X92A 2JD2A 1GYRA 3IOMA 1E5XA 3UCXA 5AUPB 1CVLA 2OBXA 4I5GA 3R8XA 1MPTA 2KM1A 5AKLA 1Z6YA 2GX6A 4I5DA 4PHCA 3PD0A 4X1YA 2J0SA 4CM8A 1UK9A 1XMOB 3DQPA 5I7AA 3ZDAA 1RHKA 1G6OA 1JSZA 1W85B 2PVCA 1X1EA 2RHDA 3EFBA 4I4NA 3TDKA 3I64A 3PHJA 4Q1BA 2A3RA 3WC4A 2AOUB 4LKRA 5FIUA 5ETJA 1NSFA 2JFQA 3BD7A 3ZWOA 3QYJA 5J1SB 4PG5A 1NJGA 1NLFA 4OQXA 4BNLA 4Q24A 3HB4X 2Q99A 3SNHA 1VFPA 1B00A 1BH6A 1VL5A 4X0EA 5DF1A 5DRYA 1TVEA 5BWBA 4RCZA 1TOAA 2BH9A 2Q45A 2CJWA 4N7BA 2R00C 1HE3A 1EG7A 4FGSA 3MRVA 5EIBC 1GAQA 2BUBA 2VJOA 4F96A 2VS1A 2UZ1B 4RQAA 5JISA 1YXMA 4YDQA 5HUJA 3HL0A 1V35A 2HPZA 5ED4A 5IEBA 1B8UA 1KK1A 2UAGA 3SOPA 4ZI3A 2ZXEA 4TZ0A 4Q66C 2PM8A 3AT1A 2I9KA 4XLTA 1X1BA 4A16A 3H4VA 5B4VA 2B83A 4XWYA 4IM7A 3IQZA 3Q12A 3F6PA 4FCTA 4FN5A 2HI0A 2N1MA 3WIDA 4H4DA 1UBOS 5EIEA 4GU5A 5K8UA 1LX7A 5K8JB 1W0KD 4PNZA 3VPBA 2ZDHA 4U3JA 1M2NA 1T5OA 5KDLA 5ULLA 3VX3A 3NHKA 1NQ5A 4KI0A 4EPRA 3HNOA 5FL7D 5CNIA 3WKBA 3DMGA 4HX5A 1UAGA 1ZN8A 1TLLA 1N33B 4XX0B 1U3VA 1A9RA 1CQPA 2PRKA 2FWJA 4RZSA 1I5EA 2HCFA 2JBAA 4AWXA 4GRIA 2VJNA 5F2KA 1T0UA 5AIAA 4BNMA 5DNDA 5EHNA 2MSDB 1H0HA 3KAQA 1JRLA 4RFSB 4YN3A 3PHHA 5JADA 3ZEAA 3R9XB 4OB8A 1H1LA 2A33A 4PO3X 4HLCA 1PL8A 5CVJA 3ONNA 1WKBA 3I2HA 4BHTA 1Q15A 5FYDA 4DLXA 4E31A 1GGVA 3NNDA 1YACA 4DG5A 1WKVA 4YQFA 5IYZB 3NORA 3UAYA 4YCSA 4PRYA 2RG1A 4MCAA 3W5JA 2QX6A 2B5WA 1N7IA 1QZ3A 4V2UA 3IJ5A 2YVAA 3MJRA 4NMWA 3ZCVA 5BWOA 1Z4KA 2LKCA 4BNGA 3PGKA 3DTVD 3EB9A 4B6SA 4L0CA 5IC6A 1N5DA 2F1JA 5JOQA 2GERA 1ZH6A 1NMQA 2QTLA 3QA3E 4OHOA 4MWDA 4UAJA 4QPJC 5AVOA 5ITZA 2XDQA 5K3SA 1NSYA 1ORIA 2DWCA 2R85A 3BHJA 3DT8A 2NXEA 4MS4B 5E1BA 4CV2A 1IYZA 1ENYA 3JQ8B 3LHKA 1UPTA 2VA9A 1T13A 4PAQA 1T1IA 4HUJA 3ODGA 5AKGA 3QHQA 3VDXA 4FYPA 2QGFA 2ZJ6A 4IDNA 1ZJZA 4G84A 4M7RA 3FTEA 5J4LA 2I3BA 1JKMA 4KUGA 5HJ5A 1U11A 1W59A 1RP7A 2AT1A 2H1IA 2I55A 2QP3A 4MRPA 1WV0A 1IIBA 2HPHA 4PYIA 2O8CB 2C8LA 1RWBA 1UZMA 4ZT7A 2WG1A 2AJBA 3G9TA 4TWBA 1KJQA 2NO4A 4XGNA 2X3YA 4LMRA 3T34A 5BNWA 2GHQA 1I94B 1A69A 5C8VA 1DKOA 1NW4A 1IEWA 3GNQA 3H11A 4MW4A 4AX8A 1MRNA 1W4RA 4RUKA 1WHSB 2R66A 1IHPA 3IDAA 3CVXA 4YUAA 5F4BA 2IHBA 3DFZA 3WK7A 4YRIA 4E2FA 1E7MA 3FIJA 2O3TA 1GZSA 4N8EA 2CYCA 1CUEA 1YRYE 2QSJA 3NWOA 2JRLA 1M2KA 4BN0A 5FWYB 5FUMA 3VR5H 2XZLA 2ISQA 3FKQA 2ZRFA 4DNOA 3A3PA 3BD9A 5CXQA 3L6RA 2WA1A 4Z8XA 1I5OA 5JDIA 1IVSA 4K87A 2QLLA 2KWIA 1CJCA 2YMMA 3KEQA 4FDTA 2ZE6A 1M3SA 3D54D 4KQWA 5GOTA 4AJJA 1LBTA 3BTOA 5CFPA 2J59A 1XIVA 3IBFA 4WJLA 5T4HA 3NALA 3SLGA 3EC7A 2DETA 2J1LA 3BSSA 1GKYA 1E79A 1GPUA 1RQXA 2IY7A 4P31A 4R8RA 2BGJA 4BCDA 1ST3A 1AO0A 4PTZA 3OM0A 5DN6A 3U1BA 3C1UA 2WLSA 5JBIA 2R8YA 4CWAA 4LRWA 3WGGA 4RVUA 3ZBPA 2BZSA 2ZK7A 1Y9AA 4RNCA 5HJ7A 1TMKA 4ZYXA 1L4FA 3LY7A 2QX8A 3OIVA 4IF6A 1RXVA 4DNFA 3S5UA 5ISMA 5B30A 2ARKA 3AIIA 5BRNA 4NYIQ 5A9TA 4LN1A 2VSNA 2PBFA 4DUGD 4LYJA 1SELA 1R8QA 4AROA 3V1YA 5KHAA 1XR3A 3GFFA 2O3JA 5LQDA 4DRXA 2C2ZA 3G5LA 3DNMA 2QI9F 2FSVC 4LDRA 3I53A 2OHOA 4TM8A 1OF1A 3F3MA 2A84A 4XGKA 1I9GA 1ZMRA 3EZ2A 4G1BA 3MS4A 1QQBA 1MABB 1ZL2A 2BDEA 1XVAA 1L7OA 2IC5A 2WJGA 4HAXA 3KHSA 4LYDA 4UVHA 2J5XA 1H2AS 3T3HA 1ZK1A 2P2NA 2WJVA 4PQEA 4BMZA 4E4RA 5K5EA 2HKIA 2QYTA 4X60A 1ACMA 4DBLE 2XHZA 5ITWA 3M6FA 3J7AC 3O9ZA 1YT5A 1RZRD 4M8LA 1DEKA 3IAFA 4MVJH 2B61A 4D4LA 4AO6A 3UFXB 3RKSA 4RELA 3E0QA 2YV3A 4BEJA 4EJSC 1YFJA 1KF0A 2XWBF 2GEKA 3KT3A 2AV6A 3O8LA 4E13A 3FUUA 3CEMA 6GPBA 1EUYA 4N76A 4CGZA 1DJLA 1DELA 3GJ3A 3IXMA 3PQFA 3O8OB 1DKLA 4MA4A 4EVSA 5HDQA 3QTTA 4CL8A 2FFJA 1N1MA 3QV2A 1IQPA 2AL7A 1ELOA 5AVYA 2YJ5A 3ZGVA 2FA9A 3SQDA 5C1BA 2C9DA 5IH7A 2NVUB 1QLHA 5EP2A 3C1AA 1YUNA 3CF6R 3PJGA 4ZOAA 1UJ4A 2RI0A 2WPNA 1U8CB 1BS1A 2DFPA 2J5BA 1CNFA 5A0VA 2XWJI 3WBBA 2Y92A 3HWRA 5M29A 4PAMA 5BSVA 5FLYA 4FMCF 3K9HA 2O2GA 4EW3A 3DMNA 2ANBA 4I1UA 2PL5A 4OO3A 3UH0A 5BQOA 2PT5A 5E1DA 4DR3B 3ORQA 5K6AC 2A86A 1DQRA 3ZHQA 4LK3A 5ERGB 2A9VA 1H5UA 2EX0A 3N3AC 1OI4A 2JJ8A 1MW9X 4J29A 5HPYB 3ZWVA 1A88A 2YRXA 3VKFA 4BB5A 2ORWA 3L4SO 3NQ41 4HVTA 1VL1A 2C5LA 3I01M 3WYCA 4AMYA 1JKIA 3G7SA 4XYLA 2XCLA 4RJ2A 1E0JA 1KFJB 1NV9A 1ZVQA 2W2KB 2JJMA 2W6IA 3CW9A 3BGOS 4WKGA 1M1UA 1O2DA 1HLDA 3QJGA 1UINA 3FFAA 4CE6A 4M86A 4U7FA 5KYUA 1G8HA 1LPNA 1UMCB 2BJWA 1TI7A 1D1PA 4FK8A 5G0SA 3RYHB 3T7SA 3TXXA 1EDOA 4G1EB 4KR0A 1Z0DA 1EUDB 3CLKA 4QQKA 1A5SB 2BHTA 4LQCA 1AMOA 5L4NA 2L17A 3EGEA 2W2LA 3DFIA 3S8MA 3RRNA 3WGNA 2GBFA 2PBZA 3FI9A 1MVNA 3MWDB 4FI3F 3DMHA 2I80A 2Q0HA 4AULA 1VHLA 1PJ2A 1XFAA 1PYOA 2FSGA 4TV9F 3A11A 2IF2A 3F5FA 3FNGA 4WA8A 1B73A 3RNLA 1DMSA 2ZJAA 3EQ8A 3Q7EA 3GI1A 2HXSA 4Q3BA 3SMQA 5EE3A 3VKWA 4DCMA 7ADHA 2L69A 1TO1E 2CLCX 2LWIA 4QNNA 4UCQA 1DAIA 4L3OA 1NW9B 5DWDA 1INLA 3T9CA 2J0UB 3U4QA 1XU7A 5E38A 1Z6GA 3HB5X 4JI1B 2HBZA 4HSEA 1HQKA 4LJ7A 2PPLA 1ONSA 2V98A 1N2CA 2NV2B 4LGCA 3ZI7A 1PZHA 5GIOE