2VNSA

Crystal structure of the membrane proximal oxidoreductase domain of human steap3, the dominant ferric reductase of the erythroid transferrin cycle
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
180
structure length
180
Chain Sequence
b'PKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLOREDUCTASE STEAP3
publication title Structure of the Membrane Proximal Oxidoreductase Domain of Human Steap3, the Dominant Ferrireductase of the Erythroid Transferrin Cycle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 60
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 1.16.1.2: Diferric-transferrin reductase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vnsA00
1NVGA 3UGKA 3ANMA 4JBIA 4YJGB 3ZWCA 3U09A 4FGSA 3ASUA 4DIFA 5U4QA 2QHXA 4ZQEA 4CLRB 4CR7A 4EGFA 1BTOA 2DTEA 3FNFA 5DT9A 2VT3A 4QUKA 4LRTB 2POQX 2W98A 2VWGA 4YTEA 2DBRA 3JQ9C 4BO4A 4RV9A 4J16A 1EK5A 3L77A 3WX0A 2GYYA 3EVNA 4WK6A 3BMQB 1UAYA 3H9EO 3ZZNA 5TS3A 4CLXA 3ULKA 1WDKA 3ORFA 2YQ4A 2RH4A 1BXZA 4HWKA 4D0SA 3TL2A 3WNVA 3IP1A 5CDGA 2Q1TA 4KP7A 2VYNA 4YAIA 3CKYA 1AUPA 1JLLA 2QQ5A 3OF2A 4XB1A 3BTSA 3TOXA 3I52A 3EK2A 3WDSA 2X5OA 1M6HA 1SO8A 1KVRA 2UV8A 4L75A 5IF3A 1TXGA 3U62A 3RJ9A 4CMCA 1IY8A 3ANLA 4MP6A 5IJZA 1Z7BA 3RASA 4DQXA 1Y6JA 4RF5A 1KVQA 1G0NA 1WP4A 3DOJA 3E18A 4J43A 3C7DB 4BNFA 3WMWA 1E7QA 4E30A 3HFSA 2FOIA 5DP2A 3ICPA 5BR7A 2E49A 2HO5A 4GX2A 4PZDA 3O8QB 1H94A 2B35A 2WDZA 2NTVA 5DCUA 4I1IA 3GDFA 5T8KA 4RDHA 1MC4A 3UXYA 3M6IA 2CDAA 3AFNA 2UYYA 3LVFO 2OXIA 3V1TC 2FR8A 3RUFA 2D4AA 5ICSA 2PA3A 2VHVA 2XPCA 1DEHA 1HYEA 4OO3A 1B15A 4OHUA 1GTMA 4KMSA 2AQKA 4OKIA 4OXKA 5DOZA 2DAPA 4JX8A 2VHXA 5EL0A 1C0PA 2VWPA 4DL9A 2B83A 3UH1A 3WJ7A 3PEFA 3MZ0A 1LC0A 3JYLA 3EYWA 5A3JA 4E5PA 3FR7A 2C07A 4ZD6A 1GPDG 1B14A 2PGDA 3WGTA 1RKXA 4CQMD 3NJ4A 5L95A 1T1RA 4ONEA 3TL3A 5JXWA 3OIDA 4L4XA 4I5FA 5LDHA 5TJHA 3VTZA 3JYNA 1EMDA 1B8PA 4WECA 3KBOA 4PZCA 3PVZA 5JPIA 4A10A 3DL2A 4ZQFA 5AYVA 1QMGA 5K6AC 2PZKA 5U1PA 3WQSB 1U3TA 5IDYA 4ND4A 4BQPA 5JCJD 2A94A 3GVPA 2JHFA 3AK4A 3Q11A 5G2OA 1P1HA 4TMFA 5IN4A 4UVIA 2VZ8A 3GEMA 3NRCA 1GD1O 3PTZA 4NFHA 2AHRA 3PQFA 5A4DA 2GF2A 4IS2A 1JWAB 3LLSA 2AQ8A 1NTOA 1NP3A 1HDYA 2WYWA 2NTNA 4XQ9A 4YB8A 1LXCA 3S55A 5CG2A 4WJZA 4JLWA 4QQRA 2JFHA 5F1OA 4CM4B 2JAHA 2VZ0A 2UVDA 6LDHA 1B3BA 4MKXA 3ZCXA 2XAAA 1I30A 4BNMA 4DLLA 5C7OO 1P1KA 2PZJA 4L4SA 1ZW1A 3C1TA 4MVJG 4CV1A 3OP4A 4M1QA 3N74A 1YBAA 2DT5A 1B26A 3U4HA 3ZV3A 2JD2A 3V1YA 4F46A 1NVMB 4MVJI 1R16A 2OORA 1JTVA 4RQUA 1LX6A 3UFXA 4HNGA 3PIIA 4LRSB 3O38A 4AJ1A 3VPSA 4E12A 3DZBA 1J5PA 3AW9A 1DLJA 2ILTA 3PJFA 4J0FA 4JNKA 1C3VA 4A27A 1U4OA 1E7RA 2QIOA 4D79A 3NYWA 3OQ6A 1PGOA 3UCEA 4GSKA 2Q1SA 3GNTA 1UP6A 4RLSA 4F45A 3I6IA 4MIYA 1UXJA 2GCGA 3EZLA 2GLXA 4LSWA 3UCXA 1QORA 4UVDA 3CZRA 1HYGA 3JQ9A 2EIHA 3BMOB 3X2EA 2DTDA 4R4JA 1KEPA 4Z3KA 3KZVA 1DFIA 1BXGA 1YE3A 2ZB3A 5THQA 4CR8A 2P4QA 4PLCA 4DBZA 5J23A 4B4WA 4BGUA 5LC1A 4BV9A 1X13A 1ISHA 3KLMX 3JTMA 5GY7A 9LDBA 4J4BA 5H82A 2NVBA 3Q6IA 3W8EA 3RD5A 1I33A 2NV6A 3VH4A 1FF9A 1UH5A 2WD8A 4R1UA 2DBZA 1ADBA 2I67A 1MXFA 1X1EA 2HRZA 1IL0A 2WD7A 1L7DA 5JC8A 2BGLA 1C0IA 1E77A 1I24A 3WSVA 4YT8A 2AQHA 1PZEA 1OC2A 2WTBA 3LQFA 3M1LA 1XYGA 3MOGA 4I5DA 3IL2A 5TT0A 1HLDA 1SOVA 1S6YA 1WDMA 4ND3A 1IULA 1UDCA 3DBLA 3HSKA 1TI7A 1N7GA 5HM8A 3WYCA 3B1KA 4BQRA 4GGPA 5CDUA 3H5RA 2VCYA 4YT4A 2Q4EA 1PR3A 3L4BC 3RUHA 4IJUA 4BB6A 4PGFA 1G1AA 5BQFA 5IAAA 1F06A 4RQTA 4XD2A 4EUEA 1BXKA 2VHZA 3RC2A 1ZSVA 2OGUA 4QFCA 5JO9A 3H9JA 4G5HA 3QQPA 4WEOA 4CLDA 4XKJA 4IUYA 4B8ZA 3RCBA 1QR6A 2TMGA 2CY0A 1HDOA 3O4RA 5COAA 4A03A 1R0SA 1H9AA 1TLTA 5CPFA 3MJEA 5A9SA 1PSDA 4OJNA 4I9NA 1ZNQO 5B1YA 2NU9A 4B3HA 2IEBA 1ZSNA 3VPXA 1GFSA 4PG4A 4XB2A 1NM5A 1J0XO 4YR9A 3NAQA 1ISJA 2X23A 1UP4A 4RPKA 3W4KA 1A4IA 3VPFA 3GHYA 1U3VA 2FPIA 4LGVA 1DXYA 1I2ZA 5A05A 4E5KA 3JD4A 4JJFA 2AXQA 2ZB4A 2HRBA 5BNIA 1TVEA 3JV7A 4KWHA 5EMHA 1QYXA 1JVBA 3FPCA 4UVEA 4MVJP 4BNNA 4E2XA 5FI3A 2CNBA 4DTIA 2NVWA 3A9WA 4N5NA 4RORA 1ENYA 3NT2A 3TOZA 4Z9YA 4J2HA 3S2IA 2B0JA 3A4VA 3JYPA 3U9LA 5IXSA 2IYOA 4F6LA 4OAQA 3D5TA 5AVOA 1PR9A 4YT2A 1YBVA 4RF4A 1KEVA 4PLWA 2D5CA 1ZSYA 5KJEA 2Q4BA 2VYND 3PJGA 3K92A 2VWHA 3RROA 3DTTA 1F17A 2NQTA 4J7UA 1I10A 2QW8A 4R01A 1JQBA 1AHHA 1B0AA 2C7VA 2UAGA 3Q1LA 2ZJ0A 4RCVA 5EN4A 3WNQA 2YV1A 1C0KA 2RH8A 4GMFA 4XQGA 3EZYA 1KY5A 2ZKLA 4IY1A 3ROMA 4AJEA 2B4RO 5CFZA 3ZU2A 1P33A 3GUYA 4XQCA 4KUHA 4R51A 4R3WA 2EGHA 1CQIA 5CP8A 3SBOA 3ONFA 2ZK7A 4Z6KA 3EMKA 1JAYA 5ICMA 4CMKA 1Y81A 3PDUA 4JJIA 3GQVA 2WEKA 4GH5A 4BGIA 1JW9B 3WIDA 1GCUA 4WLEA 4YJGA 4CMJA 4NHEA 4RPGA 3G79A 4RVSA 4YEDA 1Y7TA 4CM3A 2DVMA 4CLRA 3QVWA 1HDZA 3W4IA 4J7XA 2Y1CA 1U7HA 1XG5A 3G1UA 1N1GA 4RVFA 3RWBA 4MVJF 4D41A 1ZIDA 3ETEA 3G17A 3NX4A 1L1FA 4NU5A 3QSGA 3DFZA 1PIWA 2IZ0A 4JIGA 4R5MA 2VNAA 2VTEA 3ST7A 3TZKA 5H83A 3ITKA 3JQ8B 1DAPA 3NDIA 3WGQA 3BMQA 5BSEA 3V8BA 4I8XA 1GUFA 1GEEA 3ZNQA 2HJSA 2O3JA 2VYVA 3OIGA 4QO7A 1UXIA 2CF5A 2H1SA 1O8CA 5LDGA 2GN6A 1IUKA 1NHWA 1N9GB 3TFOA 1GL3A 3NTOA 2BFOA 3WGZA 1RM0A 2JCXA 2YFHA 4DIBA 2AE1A 4OMUA 1PQUA 2O4CA 3DHNA 1KVUA 3X2FA 1J6UA 4WCFC 3T7EA 3NGXA 4CM5A 1J49A 4P4GA 3QWIA 1XCBA 3H2SA 1FDWA 5JS6A 1L7EA 1TEHA 5HWSA 5C7LO 1SZJG 2RCYA 4J9VA 2NVUB 1Q2XA 2E37A 4ZU3A 4FB5A 1GQ2A 1RYDA 1A7AA 3GMSA 5FF9A 3WGYA 4CMIB 3QA9A 4HV4A 3T4EA 1IE3A 3G0OA 1R15A 4UULA 3PFFA 3KB6A 1JN0A 3RIHA 3O8QA 1E7YA 2PH5A 4ALMA 2CZCA 2FHSA 3KO8A 3B1JA 2O7QA 1SCUA 4XYBA 1R4NB 4TROA 2DLDA 2BFAA 4LVCA 1Q7CA 2HKIA 3IS3A 2R00A 1GYQA 1KEWA 3L9XA 3SJ7A 3ITDA 5L40A 3H4VA 3GOHA 3BXXA 1N2SA 4XR9A 1T2DA 4L0QA 5ENVA 4PG8A 4BNXA 3JQFC 2W8ZA 2Q2VA 3MWDB 3DWFA 1RM5A 3S2EA 5HS4A 4UEKA 2ZIZA 1OZAA 4FC7A 3GNQA 2GGSA 4B3JA 1E5LA 3FNHA 3MJVA 1ONPA 3FF4A 2W2LA 2V65A 4YJHB 1EEHA 5B4UA 4FCCA 4BNGA 1WVGA 1NQOA 5ER6A 1WDLA 5EQFA 5L7TA 4QSMA 3IQDB 4FIZA 1J4AA 1NNUA 1ZEMA 3AUTA 1EQ2A 2Y1FA 2E48A 1IB6A 2B36A 3CMMA 4RF3A 4H15A 4AJHA 4TVOA 1YGYA 4XWYA 3WGOA 1QLJA 1H9BA 1I32A 2FR1A 3INGA 5KVSA 4CMBA 4GVXA 5I7VA 4PLVA 4PRLA 3U3XA 1QSGA 3UW3A 3DB2A 3WJAA 1ZBQA 3JD2A 2B4TO 4W7HA 4XJSA 1BHSA 3DAGA 4E31A 1Y8QB 2AEFA 2EW2A 1E7SA 3OJEA 1N1EA 4OSPA 3WQQA 5L45A 1DC4A 1V9LA 2VT2A 2H6EA 2AE2A 1HE3A 2GO1A 1MFPA 1Q0LA 1QG6A 1KIFA 2J3HA 2J6IA 2Y66A 4WEQA 1SB8A 4BMNA 1HEUA 5IZCA 1CJCA 1GUZA 3QLJA 1LSOA 1T26A 2FRDA 5T8KC 1DBVO 1LI4A 1YDEA 3NDJA 5I7EA 2RHCA 2PKRA 1HSZA 4BNUA 3DZGA 2PD3A 1I0ZA 3DOCA 4PRKA 4F6CA 1N8KA 5EINA 1QP8A 4UUNA 3ADOA 3PHJA 4ZICA 4OQYA 3E03A 3PZRA 3UICA 1GEGA 1E7MA 3QIVA 1VSVA 1ENOA 3B1FA 1DB3A 3TWOA 6ADHA 2O4UX 5EQDA 4EUHA 4MOWA 4IJWA 4PLFA 4PN3A 3ROKA 3PIDA 3KYDA 3NDRA 1U5AA 4RVHA 3WB9A 4CM1A 8ADHA 3P19A 1LDGA 3I3OA 1MG5A 5ITVA 5IXYA 4Z0PA 3PLNA 1UP7A 2IDZA 2YHIB 4HUJA 4Q9NA 1BW9A 1PJ3A 4U5QA 2FWMX 3BTOA 1VJTA 4ND1A 4DXHA 2QRKA 4ZHSA 3BMOA 4EDFA 4OOEA 3IKVA 4HFJA 3KM0A 1S7CA 5JY6A 3F47A 3OFSA 2CFCA 4JQCA 5DBIA 4BNTA 2AW5A 2X6TA 1KETA 4J0EA 1LSSA 1YWGO 2VWQA 4CM9A 4TRMA 3H3JA 4CMEC 5BSFA 4EEXA 4YAKA 1V3VA 2D1YA 4HNHA 3PPIA 5COBA 4XRGA 4RLHA 4O59O 1XWFA 4IXWA 1SAYA 3I4CA 2ZATA 4RVGA 4E2ZA 3LYLA 1C1DB 2EXXA 3QV1A 3GPDG 4JK3A 3GGPA 1EK6A 1F8GA 4ZVVA 5F5LA 3AUSA 4WCFA 1XA0A 2D5AA 4ZQGA 3FI9A 1V3TA 1X7GA 4M87A 4Q3BA 3WGGA 1P1IA 1PQPA 1A9ZA 1PZGA 4R68A 2J5RA 3GUCA 3JQEA 4G2NA 2HMVA 4P4LA 4CL3A 1YVEI 3RUIA 5KJ6A 1E1NA 4YXFA 1CF2O 3E5RA 4GQAA 4WE3A 5ES3A 1D7OA 2ZB8A 5FEUA 4G81A 3TZCA 1ADGA 5JAIA 3JQCA 2BRUA 3Q3CA 1P74A 4RJTA 5TGDA 1NPDA 3KETA 3HFGA 3PHIA 5DDIP 5G4KB 1DRVA 3TPCA 5DZSA 4YAGA 5IDXA 2QRJA 1KVTA 1EVYA 2JHGA 1GPJA 5L7YA 1ENZA 4OGWA 1NASA 2OFPA 4FDAA 4RF2A 4YAEA 3O26A 2QYTA 4LMPA 4ZJUA 4CUZA 4FGWA 3FTNA 5KKAA 1UR5A 4CMGA 3JQFA 1BDBA 2ZQZA 2ZQYA 3L6OO 3OJOA 2DBQA 3VPGA 5K9ZA 3I9NA 3U49A 1PWXA 4CL8A 5JDCA 3DR3A 3L4SO 3AI2A 1UXGA 3QVOA 7MDHA 4ZQBA 5B4VA 1NQAO 1UXKA 2FP4A 3GZNA 4LCEA 3BMNB 3F5QA 4Q39A 3RC1A 3RUDA 1LNQA 2HU2A 3RFTA 1AE1A 4GL4A 3AWDA 1ZK4A 4PG7A 2J5KA 3IIEA 4TRRA 3W6ZA 1LDMA 4AJKA 4BNLA 3GH3A 2V6GA 4NQZA 2NNLD 4PLGA 3GHHA 4NZ9A 4A73A 4PVCA 4J91A 4FSHA 3BHMA 3I5MA 4U7WA 2OMEA 3AOGA 1FXSA 3NEPX 3OECA 5G0SA 4DREA 2J3JA 5GZ6A 4YRAA 2YDXA 4XCVA 5F5NA 1XU7A 2X5KO 2Z1MA 2B5WA 2LDBA 2ZCVA 3I6QA 3TFQA 2VYVD 1YJ8A 1T25A 4NBTA 2DKNA 3GR6A 1G6KA 3V2UA 3PWKA 1ONNA 7ADHA 2Q99A 3WS7A 2VOEA 4DLBA 3SC4A 2FSSA 2HSDA 3LC1O 3KYCB 5KIAA 4PVDA 4BOYA 1EDZA 2TMDA 4J3FA 3HQ4O 3H5AA 1I8TA 1EUCA 2HJRA 4U8GA 4YJDA 1OC4A 4LK3A 1XIVA 1BGVA 5DOVA 2DU8A 3GGOA 1WLYA 4HXYA 4IDAA 4DPLA 4J7CA 4LN1A 4E21A 4BO0A 2PD6A 3WQRA 3VKVA 1MP0A 5KVCA 3NT4A 1JAXA 1U7TA 2V6BA 1B8UA 4DWVA 5GZ1A 1Z7EA 3D4OA 4B4UA 2G17A 1MFZA 3DHEA 3F1LA 1PS9A 4GLOA 2GN4A 3AY3A 4UEOA 4I9HA 3AM3A 4D46A 1C0LA 3O9ZA 4A2CA 4AJ4A 2YUTA 4K26A 2CSUA 3I9LA 3RFXA 2CVZA 3F46A 1PTJA 5KJFA 3QWFA 3PJEA 1A7KA 1F0YA 4YRBA 1GY8A 3ZWNA 1IHXA 3UOGA 3GDOA 3KOUA 3RKRA 3DMYA 3GK3A 3RAJA 3PDJA 3U5TA 1U5CA 3O03A 4Z9XA 2X9NA 4PLTA 3OJLA 4Q3DA 1BRMA 1I3LA 4B79A 2BFPA 2V7PA 4KZPA 4PFJA 4FFLA 4PLZA 4BVAA 3DXFA 3H65A 1T4BA 1N7HA 2B69A 3L0DA 2NU8A 4DYVA 1A72A 1N9GA 2HLPA 2NU6A 3F4BA 1ZKMA 2W4QA 5A03A 2IXBA 3P5SA 2W2LD 1DC3A 2VNSA 1ZCJA 4H3VA 3ZI0A 1VE9A 3WTBA 3ROPA 1NHGA 1GZ6A 1R4MB 1NBOA 4E4YA 2OHXA 1ADCA 4CMEA 4E3ZA 3UKOA 2DC1A 1FK8A 4BNKA 4IQ8A 2WMDA 2FN7A 3VVCA 1X0XA 1HDGO 4GGOA 5I8ZA 4XA8A 2PLAA 5L4NA 2ZCUA 5U9CA 1LBEA 4P22A 4E13A 1LSJA 1AXEA 4RPLA 4N5LA 4AVYA 3JYOA 2QX7A 4NJMA 5CDSA 3GAFA 4ND5A 2GDZA 5COQA 3ZWMA 4EJ6A 1WAMA 1R4NA 3F6YA 4PLYA 4WOKA 5EJ2A 4ALJA 4R9RA 3WXBA 4DUPA 5L53A 5A1TA 3PYLA 5ILGA 3FCOA 1HWYA 2GERA 3ONDA 3QVTA 1JKFA 4PIVA 3AY6A 2HK7A 3IMFA 4NR0A 4E0BA 4QXMA 1I2CA 2J3KA 3CUKA 4KTVE 4O5OA 1E1LA 5JC1A 3OA0A 4DQUA 4JJGA 1ULSA 3WYBA 3DZFA 2ZTLA 4M89A 1E7WA 3HG7A 3DOOA 2YFQA 1ISIA 4NH4A 4R1TA 3Q9NA 5DF1A 5JDIA 2Y1GA 2UUOA 5T57A 2JAPA 1LLQA 1DSSG 2EV9A 4YJHA 1CEQA 1RJWA 4KDFA 5KVQA 1E3JA 3VOSA 3HN2A 3UCFA 4WGGA 4IIUA 4WOJA 5DCWA 4GX0A 1DRUA 1PJBA 1RM4A 3NTRA 1SPXA 3NUGA 1YRLA 4YJFB 3WSWA 4IPTA 3VTFA 3FPLA 1T24A 2CUKA 2QZZA 3PHHA 3OETA 1P3DA 2GRAA 1JU9A 4XQEA 3C1OA 5ITWA 2G82A 4LMRA 2O3QA 1QRRA 4B3IA 3BTUA 1B2LA 5FI5A 4NBVA 4GLLA 2RHRA 4IM7A 4FW8A 4AICA 3ABIA 2OP0A 1RWBA 4FS3A 1Y8QA 2OBNA 1TT5B 1YONA 3DMTC 4EYEA 1NQ5A 3D7LA 2FPPA 3AU9A 3EVTA 5JNLA 2CVQA 1IZ0A 3R1IA 2X4GA 5FWNA 4RPJA 4XX0A 2JD0A 4D0RA 3DZHA 4KQWA 1M76A 4CM9D 1PU2A 3D1LA 4WNIA 4MVJM 1LC3A 3TZ6A 2J8ZA 3ZWVA 4BNJA 3LDHA 1EVJA 1DIGA 4M8SA 2R00C 3PYXA 3D3WA 3MOIA 1EUDA 5JLAA 1O95A 2Z5LA 4E2YA 1K6JA 4XDZA 2VQ3A 1JDJA 2QZ9A 1D1TA 3H5NA 3AM4A 5MGBA 3H9GA 1PZHA 2PKQO 1ZJZA 2VTDA 3VZSA 2JKVA 1ISFA 2DTXA 3GLQA 4HADA 1C1XA 3MJ4A 3WFJA 3PYMA 4GBJA 3CINA 5ER9A 2EWMA 4OOFA 1GADO 4FOSA 2C20A 3SXPA 2OL4A 4GX1A 2FZWA 4ID9A 1CERA 5JMPA 2HUNA 4AJLA 1LA2A 1DJNA 2X0JA 1LLUA 3KRTA 3NV9A 2YV2A 3VVBA 2E6UX 5GZ3A 2GSDA 4W99A 1DIAA 4O1MA 3A14A 3FD8A 1U1IA 2IEDA 3DZKA 3PXXA 1LSUA 3WLFA 4IIVA 3DONA 1BMDA 4B4VA 2BMAA 2Q49A 2IODA 4JCOA 1ARZA 3D4PA 3K2EA 1NYTA 5CPBA 2WJPA 3F3SA 1NAIA 1MA0A 3BHJA 4NBRA 1I3KA 3LT4A 1XELA 4DGSA 1DFGA 4TKMA 1H6CA 1K6XA 1PGJA 1ZVMA 2NSDA 1SBYA 1NFFA 2P91A 4KDEA 4FJ1A 3ZW9A 1PJTA 1PX0A 2GASA 2WYVA 1C1DA 4NK5A 5I7FA 2PNFA 3LZ6A 4M55A 2BFMA 1DC6A 2H9IA 2WE8A 1R0KA 1H0KA 4CLEA 4D7AA 5IZCC 3JCZA 2GN9A 2C7GA 1OFGA 2Z1NA 3FR8A 4YBZA 4W9NC 3ANNA 2Y1DA 2PY6A 1ZXBA 5B4TA 3ENNA 4JGBA 1UZNA 1FJHA 4KWIA 3C85A 3C8MA 5TF4A 1ADFA 3UN1A 5CDYA 3HDJA 1GQQA 1R6DA 1XLTA 4AJPA 5JFOA 1KC3A 2I3GA 2P5YA 5C7IO 2EJWA 3I4FA 1KERA 2VHWA 5G4KA 1EZ4A 3LF1A 1R66A 3M2TA 3JQBA 5LCXA 3L6EA 3LT0A 4XIYA 1HYHA 2BF7A 2EJVA 3IUSA 1KOLA 3JYQA 3AI3A 4IDCA 1PGPA 3BHIA 1NR1A 3IDSA 5DP1A 3ZU4A 1QYVA 2EEZA 3GA0A 9LDTA 4OXNA 3RQSA 5BSHA 1VJ1A 3AU8A 1ID1A 4B7UA 3HE3A 3JD3A 1ZEJA 3QHAA 1GDHA 1KC1A 4D42A 1PJ4A 4ALKA 4MKZA 2DUWA 5F1KA 1YQGA 5I8WA 3OA2A 3VZQA 1ZXLA 3LT1A 2O7SA 4P8RA 4RO0A 5KKCA 3EW7A 2I6TA 4L4RA 2W2KB 1VI2A 4L9RA 2WSBA 1V3UA 4BNIA 1ULUA 2OP1A 1E6WA 3GY0A 3DC2A 1MGOA 1KYQA 5AXAA 3MJTA 3DO5A 1CETA 4NPCA 3LK7A 4BS9A 4GWKA 1BG6A 4II2A 4TRNA 1LRJA 2X9VA 5T6BA 1C14A 3TQHA 4UVGA 2B4QA 4ND2A 5A5FA 1Z74A 3S8MA 1Y5MA 1MC5A 3PI7A 4CM7A 1U3WA 5JCXA 3QWBA 4XGIA 1XU9A 1WNTA 1UJMA 4ZQHA 4NK4A 4H16A 3WTCA 2W90A 3OMLA 5BNTA 1E6UA 1BWSA 4F3YA 3DMTA 4XGKA 2FPGA 5HRUA 4D44A 4BKQA 4BNZA 4DMMA 4FFOA 3ZGYA 3ZU3A 3GVXA 4HX5A 1P1FA 2GR9A 3RUEA 3DBRB 3NT5A 4IDEA 5G4LA 1SC6A 5T64A 1YL7A 2BHLA 1HZJA 1GV0A 3DAFA 3IOYA 3HHPA 3KXDA 4J9UE 4E6PA 4K9DA 4FOOA 1QXSA 4XYLA 2G5CA 2BLLA 4E32A 4ZGWA 5A3VA 2IE0A 1NQTA 1YB1A 4IJKA 3WBBA 4CV2A 3C7AA 2EF1A 3PQEA 1OI7A 2Y0EA 3JQ7B 5KOIA 1N5DA 5AOVA 4NI5A 3R3JA 2AG8A 4AJJA 1DHTA 5BSGA 2BH9A 1H6BA 4GSLA 4UVHA 4OYRA 3VKUA 3SLKA 2CDCA 3DDNA 4II3A 1CRWG 2B5VA 2IRWA 5JDCC 4JP3A 4PG6A 1Q0HA 4Q3CA 2D3TA 1K0UA 3QE3A 3EC7A 3T4XA 3TJRA 1KS9A 1WPQA 1SMKA 1YOVB 5JYEA 3U4DA 1W6UA 4DVJA 4NMHA 1EVIA 4CJXA 1HZZA 3ADPA 4Q3NA 3GMDA 1I01A 1WZIA 3SJUA 3CMCO 3GN2A 3OQ1A 3QVSA 1A5ZA 4LSMA 4U0KA 1WMAA 3FNEA 4AJ2A 3GRPA 2F00A 3V1UA 1K3TA 4N54A 4WNCA 4YCAA 4BO3A 3EY4A 1GQYA 4IGFA 4Y6SA 2C59A 5C37A 1FDSA 2Q1WA 1ZK0A 5G0UA 1U8XX 1ZK2A 2EP5A 3BYZA 3QY9A 4RZIA 4M54A 1Y1PA 2QRLA 3CH6A 4U6SA 2I5PO 4CPDA 3HDQA 3QW2A 3L07A 2C82A 1PL8A 3L6DA 3ASVA 3N7UA 4D3DA 3V2GA 2ZYAA 1BXGB 4CM4A 3U4CA 2BELA 3ZNOA 1FDTA 1GU7A 1YJQA 1EE2A 4TRJA 1YKFA 2NUAA 4W9NA 1SEVA 2X9GA 4E33A 3W8FA 1V0JA 4WLNA 1B7GO 1OAAA 2HMUA 2RAFA 1HLPA 2RIRA 4UEJA 4BNVA 3IUPA 1NWHA 2F1KA 1Z73A 4W7IA 2WD7B 4YACA 1HDXA 4IZHA 3GVIA 2X86A 4CLOB 4BO2A 3Q2KA 4J4HA 1PL7A 2J3IA 2C54A 5DBGA 2Y1OA 1DC5A 3DQPA 5JE8A 4XR4A 4EBFA 1EFLA 2GPTA 1T2CA 3I23A 1U8FO 4AL4A 3DBLB 4FFRA 3CSDA 2QYSA 2Y05A 3HDYA 4E2WA 4LVUA 3ZWXA 3R3SA 2Q3EA 2O3SA 2X58A 4L74A 1DIRA 3Q0EA 3G49A 2PGJA 2YY7A 4YYZA 1EBFA 3L9WA 5A02A 3HZZA 1XQ6A 5EESA 4W6ZA 4J90A 3VZPA 2I76A 4YJFA 2OOSA 1AN9A 3S2FA 1CWUA 3ONEA 5AXCA 2PV7A 3OBBA 2X8LA 3V2HA 1VM6A 3C7CB 4LISA 4RVUA 5JW6A 2JJYA 5AXBA 1DIBA 2WM3A 4WLFA 3EDMA 1YBMA 2UUPA 3F4LA 4FD3A 3QWAA 1E6EA 3WFIA 1GYRA 3A28A 3FNGA 3SX2A 1HRDA 5IN5A 1R0LA 2VRBA 1SOWA 4BO5A 1HF3A 1U4SA 4EI2A 1WW8A 3DAPA 3K5PA 1TT5A 2EP7A 1X15A 3DBHB 4BNWA 3PJDA 4J2OA 2EKQA 4A0SA 3SC6A 4MVJH 1VKNA 1W73A 3HN7A 3KEQA 1MXHA 2PGLA 4L76A 3WOHA 5I9LA 2CF6A 2R6JA 4B7XA 3RUCA 1MG0A 3RU9A 5CEFA 3NKLA 5CEEA 3AOEC 2OBYA 3BIOA 3RI3A 4IDDA 4TKLA 5CEJA 3TF5A 1NFQA 3ZV6A 4A7PA 4FJ2A 1UXHA 3WICA 2X0IA 1D4FA 3BZUA 4BKPA 4NU6A 1Z6ZA 2Q46A 3CZMA 1T1SA 1MUUA 3I9KA 5JMWA 1PJQA 2LDXA 1E1MA 3I9OA 2VRCD 2YHUA 3PRJA 3QJ5A 4GKBA 3JQAB 3ZDFA 4BL5A 2AG5A 1XR3A 4R1SA 3BAZA 1EFKA 5G0WA 2J5QA 2GZ3A 4ITUA 4OL9A 1LQUA 5JDIC 4R69A 2ZTVA 4A5OA 3KTDA 1PS0A 1W0CA 3E82A 1DDOA 2NQ8A 3CTMA 3MEQA 3GFBA 4J1NA 3G1TA 3MTJA 4KOAA 2VUTA 3AY7A 1K6IA 3HB4X 2I9PA 4Z0HO 3ZHBA 4DBVO 1GZ4A 1P0FA 1X1TA 3GEGA 2EGGA 4CM8B 3R0IA 3U0BA 3T7CA 2G0TA 5B12A 3PGJA 2O50A 3ETDA 2Q2QA 1B16A 4INAA 4IXTA 4Y6PA 3GAZA 4ZA2A 1WXDA 2VUSA 4WUVA 1ORRA 1ZUD1 1B3RA 1O9BA 5CAEA 3ZN2A 3KSDO 3FRJA 1ZK3A 4Z9FA 5CHEA 4BMVA 1PWZA 5KCZA 1JKIA 2O2YA 2YZ7A 4MDHA 5BNFA 4AFNA 3Q2IA 4XYGA 1E5QA 4N5MA 4BO7A 5HTOA 5I9NA 4FR5A 2RBEA 3RC7A 4M86A 4HFMA 3CXRA 3ZWOA 1VJ0A 3LF2A 1X14A 3E9QA 4BGEA 2DBVO 3WGIA 3JQGB 4J1TA 3VHRA 4PZEA 3E5MA 3N58A 3ZW8A 1P44A 2PZMA 4U0JA 4Y98A 3E9MA 4AJNA 1VRWA 2QG4A 2PWZA 3W4JA 3I9MA 4Y6RA 4WKGA 5I9MA 1QV7A 3E8XA 3A06A 3I83A 2GZ2A 2PTGA 4LCJA 1DPGA 1ZH8A 3RJ5A 4OXYA 4CMAA 3F1KA 3K96A 5A5EA 4JBGA 3CPSA 1ZMOA 3DHYA 1PZFA 2JD1A 4JBHA 5H81A 3FWNA 2EW8A 1K89A 1U9JA 2Q1UA 1ZK1A 5DNAA 4BGVA 2Q2WA 2GUGA 1HT0A 5EERA 1IZ9A 1CDOA 4R1NA 2ET6A 3ZWAA 3OSUA 4YA6A 2C0CA 1P0CA 2DPGA 4D3SA 1GCOA 3ON5A 5DBFA 3ZHZA 3VDRA 4BHTA 5IZ4A 2PZLA 1VL8A 3TZHA 1DO8A 1IOLA 3ZHYA 1A4UA 2OZPA 3GZ4A 5FYDA 4OM8A 4YDRA 3JQ8A 4C7KA 4ROSA 1BVUA 5T67A 3P2YA 1K5HA 2HMSA 4E5YA 1SB9A 2CVOA 3P7MA 3PP8A 1CYDA 2W2KA 4FN4A 3WMXA 2FR0A 4IINA 3VC7A 2HDHA 1O0SA 1OBFO 2JCYA 2CDBA 4DIOA 3PZBA 1YS4A 2VN8A 1GUYA 4CQMB 2I3AA 3OH8A 3INTA 1HDRA 4IMRA 5DCYA 2NTJA 4K1LA 1I3MA 4CLHA 2Y99A 1T2AA 1W4ZA 4CQLB 5IFLA 2EHDA 5L4SA 4MVJA 4BV8A 4O0LA 4YPOA 3ZHXA 4CODB 2NACA 1E0DA 3KSUA 4MIEA 3WWZA 1E92A 3DEYX 4Z3DA 2C2XA 2NVUA 2DFVA 4ESOA 1Y9AA 4MP3A 1UDBA 4BIIA 3ICCA 1VC2A 4IDFA 5IG2A 4CMIA 1F14A 3DBRA 4Y9DA 3WWYA 4PLPA 3QWHA 5F1PA 2BGMA 5AQ1A 2G76A 3AOEA 1T4DA 2R2GA 2Q45A 2O2SA 4D3FA 3FTPA 3OICA 2AEMA 2PH3A 1E1KA 3H9UA 3JQBC 3RSHA 5KWEA 3GNSA 2BI8A 3E48A 3JQ7A 4I9UA 4OQZA 3PWZA 1SEPA 4CV0A 3H7AA 5DULA 3K6JA 4C4OA 4TZTA 5F21A 3EGOA 4O6VA 1NPTO 1I5RA 1E3EA 5L7WA 1XQ1A 4J1SA 3WR5A 4ALIA 1PL6A 3PGXA 4IDBA 4OIMA 1XKQA 1WZEA 1V6AA 1PJSA 1N92A 2ZYDA 2P9GA 1NX6A 2XXBA 3TNLA 1YOVA 4HBGA 2X1HA 4IS3A 2GZ1A 5KTKA 4BO6A 3KUXA 2P2SA 4QO8A 3FHLA 4J4TA 4CV3A 2JCVA 4HP8A 3WYEA 1ZJYA 1RPNA 3C24A 4WLVA 1A71A 1VKOA 3FSRA 3FN4A 3TZQA 2DPHA 4PCVA 4BO1A 3KYDB 1YH3A 1XGKA 3LLVA 2EKLA 3TDKA 2Y68A 4DPMA 1QYDA 3H8VA 3GT0A 5L9AA 2AEJA 2HMTA 1Q7BA 2ZJ1A 2C5EA 3BMCB 3INRA 1E3LA 1IYZA 1M67A 4J6FA 4R9SA 4XJTA 1BW9B 1YDWA 4A26A 3NJ8A 3KEOA 1F12A 2V6FA 4YQYA 4XDYA 4GVLA 3UUWA 1YB4A 2O3TA 1X7HA 4AJOA 4I5EA 3JD1A 4XZ3A 2VHYA 1PEDA 4BKRA 3GC6A 2IYPA 2CMDA 5FFFA 3VH2A 1DIHA 4IMPA 1VL6A 2Y0DA 1VPDA 4ZN6A 3RFVA 4R3NA 1E3WB 1P1RA 2XF8A 1P9LA 4FPXA 4RVDA 1GR0A 3Q9UA 3IJPA 4UAGA 3AFMA 1M2WA 4JN6B 3VH1A 3LC2O 1FMCA 4WLOA 3B70A 3IJRA 1T2FA 4HFRA 1HE2A 5A9RA 2BD0A 3RBVA 3QP9A 3CE6A 1EQUA 2NU7A 3UHAA 3K31A 1GV1A 1LUAA 2IXAA 4IJVA 4CLOA 3AM5A 2DFDA 4WCFB 3OJFA 2VUUA 1Y8RB 3GGGA 1UZMA 4ALNA 2OUIA 1I2BA 3K2BA 3PHLA 1UZLA 4DRYA 4FQ8A 3W6UA 1R12A 4R54A 1AGNA 1XHLA 2H5LA 4QT0A 2P5UA 3ROQA 1ENPA 4KTTE 5A04A 3UAGA 4XIJA 4DC1A 4RPHA 2C5AA 2YHIA 4UUMA 2P9CA 3D5QA 4XEHA 4FFMA 3HUDA 4DYDA 1LJ8A 1B8VA 3TSCA 4CR6A 4H7PA 5JAQA 4DC0A 3RC9A 3IP3A 1I3NA 4WCDA 3K30A 3BA1A 3DBVO 2VZ9A 3KHUA 5THKA 2FY8A 4NFYA 1WMBA 2ZTUA 4GMGA 4P38A 1P77A 3B20A 3GF4A 2HK9A 4GAEA 4L8VA 2NM0A 4I08A 2IZ1A 3KYBA 2BGKA 4YVFA 2JL1A 3HADA 1PJLA 2D2IA 1EDOA 4R5HA 2ZB7A 3GEDA 4PG5A 5TNXA 1QYWA 2X5JO 4PLHA 4I5GA 3AUUA 4XRRA 1X7DA 3DBHA 2DM6A 3V5NA 1Y9EA 3GZNB 3LC7O 4EW6A 1LLCA 4NFSA 2NADA 4R41A 2C29D 3KV3O 5B37A 4DMLA 2HAEA 1D3AA 1BSVA 3ZNNA 3WG9A 3GN1A 3DTYA 2VRCA 3JQDA 1PQWA 1HL3A 1JWBB 3I1JA 4TWRA 3E9NA 3H6KA 1M75A 1XSEA 3D3EA 3PFWO 5K6AA 1NWCA 3OIFA 2PD4A 2A35A 3DFUA 3ZU5A 2NLOA 4EEZA 5DN9A 4HFNA 3ZH2A 3JQ6A 3GVCA 2G1UA 4J49A 3A1NA 2PK3A 4Q3AA 5C5IA 5BT9A 4P4NA 3RBXA 4N7RA 3JQAA 1YO6A 3RKUA 3OJ0A 1D8AA 5F3RA 4MO2A 3F5SA 1CIVA 3RVDA 5L51A 5G0TA 5HA5A 1A27A 4XYEA 5ILOA 4ZRMA 3WLEA 3KVOA 5EPOA 3H3FA 4BKUA 1P31A 2A4KA 5TT1A 4W82A 4TVBA 2FMUA 3JD0A 5A06A 3MWEB 2YW9A 1R37A 3GRKA 1LDEA 4CM8A 3PLRA 2B37A 4RGBA 1U28A 4FBGA 4NBWA 1SNYA 1LDNA 3BMNA 4IZIA 5TIIA 1ZMTA 1LQTA 2UDPA 1YQXA 1DAOA 4MINA 1VLLA 5JSFA 2DUUA 1LRKA 1V35A 3CIFA 5TX7A 4E5MA 5JAMA 3M2PA 4JROA 3SLGA 4BO9A 2YV3A 4OH1A 3ZWWA 5T5QA 3I9JA 2YQ5A 4B4OA 4GX5A 4GKVA 3C3XA 4CUJA 4UUPA 1YB5A 4NIMA 3WBFA 3MTGA 3ENKA 1IHYA 3JQGA 2E4AA 1VSUA 4NBUA 2P68A 4X54A 4KQXA 2Y1EA 1W8DA 3VAZA 2PFGA 3M1AA 5KJCA 4QECA 2O23A 3KYCA 1FDVA 4RL6A 1HSOA 4XGNA 3UF0A 4UUOA 3VH3A 4NG5A 1YL6A 5IDQA 4MVJD 3ETGA 4R16A 2DQ4A 4OKNA 2GNAA 3MJCA 1Q0QA 3ZNPA 4QFDA 4EITA 3TRIA 4O63O 1KBZA 3GPIA 3OM9A 3W1VA 2EKPA 2OO5A 1HTBA 2XXJA 3D0OA 4FJ0A 3H2ZA 1U3UA 3MJSA 3W8DA 4BMSA 2JFGA 4C7JA 3LU1A 1NAHA 4FFNA 1AXGA 2X22A 4NJOA 4FC6A 4UREA 4KUGA 2H63A 5A9TA 5TQVA 2HMWA 1H6AA 3HWRA 4Z0TA 4MPDA 1MX3A 4NJMB 2A9FA 1O6ZA 5JY1A 3LT2A 4MKRA 4TQGA 1HE5A 1P45A 1LRLA 1KY4A 1EE9A 4M49A 4BNHA 1IPFA 4CUKA 8LDHA 2BI7A 3D64A 3L4BA 3B6ZA 2AA3A 1GAEO 1PS8A 2D59A 1BDMA 3PWSA 4CQMA 3TN7A 2Z95A 1HXHA 4S3MA 1UAGA 4FFPA 3HJAA 4EJ0A 2WYUA 2YJZA 1H5QA 3P2OA 3K9QO 4G65A 4CQLA 1R4MA 5TSDA 3OQBA 5I7SA 5L4LA 1CQJA 1H93A 4BO8A 3E6AA 4URFA 5IDWA 2ZYGA 5JCJA 1RYEA 3U4IA 2PR2A 1ISMA 1X0VA 2P4HX 2ZTMA 4OSOA 4Q3EA 4YQZA 1XEAA 4S1VA 2EERA 3SEFA 1OMOA 1HKUA 1Z75A 1ML3A 2HQ1A 4HKTA 1E3IA 1O89A 5CG1A 2EG9A 2O3RA 2X0RA 5G0VA 3S1LA 2Q50A 4Y8VA 4IBOA 4GPD1 1V8BA 1E3SA 4WASA 3ZWBA 1IPEA 4B8WA 4WLUA 3AUAA 1M6WA 4D45A 4DA9A 2D8AA 4ALLA 4K6FA 1TT7A 3IC5A 3PK0A 4CM6A 3AJRA 1O5IA 3STHA 1DRWA 4DLAA 1XDWA 1PJ2A 4YRDA 2A92A 4D43A 1T2EA 2WWRA 4NNJA 1I36A 4L73A 5AXDA 3ZV5A 4IGEA 1DOHA 3HNPA 1GYPA 1VL0A 1DLIA 3D4NA 4YAJA 3JSAA 1DFHA 3VDQA 4YT5A 1ISGA 1OOEA 2C2YA 2XOXA 3FBTA 1JVSA 2D0IA 3RUAA 2I99A 4ZRNA 4IDGA 4QEDA 1KVSA 4JXKA 4W4TA 3NTQA 1UUFA 2YDYA 1H2BA 4NDNE 3ZWYA 4BKOA 3EAGA 3UVEA 3K73O 1YXMA 1ZFNA 1FDUA 1M66A 2HCTA 4GWGA 1LDBA 4QX6A 4AJIA 3GVHA 1G0OA 3OEWA 5MDHA 5HBRA 2BKAA 3GG2A 2SCUA 3D3WB 2X0NA 3DZIA 1LLDA 4YWJA 4MP8A 1EBUA 1QLHA 3EUWA 4BNYA 4IQGA 3CEAA 4HY3A 4E5NA 1ZZEA 4TZKA 1BVRA 4MIOA 1Z82A 2JFFA 3KSZO 2V6MA 3ZWPA 1U2DA 1QKIA 5C3MA 1LU9A 3BTVA 3IAHA 1C1XB 3KLPX 3R6DA 5EIOA 3IKTA 3GDGA 1NPYA 4EUFA 1NXQA 5KJ1A 1MLDA 3H9QA 1ZO8A 1NVTA 1LTHR 3BMCA 1H2HA 3NGLA 4J1QA 5A9SB 4MJLA 5ENDA 4BB5A 2PKQP 1F8FA 3K8ZA 1LEHA 1HDCA 1KEUA 1Q1NA 4XYMA 5L3ZA 1QV6A 1JA9A 5JBIA 1UDAA 2Y0CA 4K6CA 2GN8A 3LSYA 4K28A 1EUZA 1H6DA 4EJMA 3VZRA 3RU7A 4B7CA 1HE4A 1AHIA 2IZZA 3DZJA 2AQIA 3F9IA 1WWKA 2P9EA 4ILKA 1K2WA 1P1JA 2I65A 2NWQA 2X7HA 3G3EA 5TRTA 3WIEA 4DQVA 3SVTA 3HDHA 1Z45A 3PQDA 5TC4A 4KUEA 1QYCA 1D1SA 2FSVA 1E3WA 1MB4A 3AI1A 3OEYA 4CMHA 5KVVA 2GD1O 3QVXA 3FBGA 5ADHA 2Y93A 1O94A 1PGNA 5TLSA 5HS6A 2O48X 1HETA 2AMFA 3PHGA 1LDYA 4MVJE 1PJCA 4EZBA 4JP2A 1NFRA 4IQ0A 4QTZA 3VPHA 5CDTA 1YQDA 3QRWA 1JKJA 3C1AA 1Y5RA 1DJQA 2VOJA 4BUCA 1ONOA 3EHEA 3OHSX 1Y8RA 2YYYA 1NR7A 3GFGA 4LW8A 1GZ3A 4U6QA 1PGQA 3WGHA 3FWZA 3E1KA 5KNLA 2E82A 4RZHA 2FZEA 5JYDA 4DPKA 2Y67A 1YL5A 4Y67A 5JO0A 1Q7GA 1TB4A 3JQAD 3RBZA 1RM3A 3COSA 3ZV4A 4AG3A 4N18A 1TA4A 3HB5X 2CD9A 3GG9A 4TSKA 5TJ9A 1A9YA 4GI2A 5GMOA 3S2GA 5JAZA 4RDIA 1EVZA 1MV8A 2O3UA 2WE7A 2HK8A 2I66A 5K0ZA 1U2GA 4WPGA 3MCVA 1DHRA
chains in the Genus database with same CATH superfamily
1XQVA 4LNUA 3ZWCA 5EVJA 2HEGA 3HCBA 2FRVA 3FKJA 1ELOA 4QTUB 2QORA 3LUCA 5BSWA 5U4QA 2QHXA 2F43A 4CR7A 4B75A 1T1GA 2DTEA 1CF4A 3AIOA 2VT3A 5DH9A 3TXYA 3FYUA 4QUKA 4X8MA 2WJ6A 2AD5A 4TQUS 3BK1A 1P80A 1NJGA 1YKSA 3IQHX 5KNBA 5CT6A 3X1XA 4OLAA 5CA1A 2G09A 4PZUA 2MSEB 3INYA 3IUJA 4REMA 1QE3A 3ZV7A 2QW1A 1JXOA 4B0OA 1RHKA 1A2KC 1XFDA 4CDGA 3EVNA 1DV2A 3BMQB 1UAYA 2XMCA 5AOCA 3QVJA 4O4LF 4YJ3B 5TS3A 3GLGA 3LLMA 4YAOA 1SXJD 1WDKA 4G0PA 1IHUA 4R2LA 2YQ4A 4HWKA 4QWMA 3HBMA 4TMWA 3SDZA 4CDNA 4EW2A 3ELBA 4PTLA 4R05A 3FI0A 3Q7RA 3VHXA 3ZG6A 4DADA 4Q4LA 1SHZA 1ZJ5A 2X2EA 2D8MA 4XX1A 1QGUB 3EIFA 3FJYA 3ROZA 3H17A 1A04A 1UFRA 3I52A 1OYYA 3WDSA 2WFAA 4KGZA 4E2WA 1ATZA 1VTKA 1H22A 1KVRA 5K4HA 3QEBZ 1CY0A 2FJUA 2HCFA 4CMCA 3THYB 1AO3A 3ANLA 1NW7A 2ARKA 2V0NA 1W1UA 2WF6A 4QBTA 4D6PA 4FYWA 1JXMA 2PUTA 1Y3IA 2OCIA 1NLYA 3N2KB 1T9ZA 1T8PA 3N07A 3O84A 4LHXA 5CMLA 4RF5A 4D8YA 2HGZA 4ZCIA 3RRXA 2R6FA 1P39A 1KOGA 1KRWA 5FBRB 2CNDA 3A0RB 4RTQA 1YKGA 1Z06A 3DOJA 3LX5A 2FPLA 3ACCA 3C7DB 2B2CA 4INOA 4YUZA 2NXWA 3WMWA 2XRMA 1E7QA 1C0EA 4E30A 1FDOA 5AVXA 4ZC1A 5IYZB 2Q3HA 2WBLC 5DP2A 5BR7A 3NOOA 4GX2A 5TDHA 1H94A 4HZGA 3RVLA 1KH3A 2E6KA 3PR3A 5HIKA 3GDFA 3KUUA 2GETA 4HZIA 4K40A 4NE2A 3ZVNA 1N0HA 3AFGA 4YLYA 5AJWA 1ZIXA 3KD3A 1UT6A 3GX1A 2QRMA 3PKZA 3TRJA 2XT0A 2X1LA 4I66A 5AW5A 3NBAA 4HEA1 5FX2A 2D4AA 3C39A 4KIUA 1BMFA 5ICSA 5J2UF 1R74A 1T3LA 2PA3A 2XUPA 2VHVA 3U7QA 4GMDA 4AY3A 2B4YA 4OHUA 2PJRA 4PYRA 4B48A 4RAOA 5DOZA 1OZHA 5IEJA 2G40A 3REGA 2VHXA 2PZFA 5DM70 3OIUA 4P0QB 2B83A 1T6ZA 3WJ7A 3CLRC 4GEGA 1M9NA 4BAUA 2X8AA 2WKPA 1QBGA 6REQA 1KAGA 1X7YB 1FZTA 1JDUA 3FR7A 3I04A 4ZD6A 4KIJA 4EL5A 4Z3OA 1Q50A 2NP6A 4W8HA 2FG7C 3WGTA 4WZAA 4KCGA 4CEIA 1QGED 5L95A 1IQUA 3IELA 3QYFA 4ONEA 1NJ6A 3IAUA 2PXHA 3OIDA 4IAOA 3UT5A 2H7YA 2AMYA 4I5FA 4K9RA 1RW4A 5TJHA 2AN4A 3GAMA 1QZXA 4L16A 2COKA 2FA9A 4PZCA 5DYNA 5JPIA 2PQMA 4BU1A 1BJRE 4RWEA 1QMGA 3ZYCA 1UKEA 2ZQ5A 5K6AC 3I62A 2GYUA 2HEIA 2ZWAA 3B7PA 3EXG1 4G85A 3KJGA 4ND4A 5JCJD 3JWGA 4PAMA 5LLSA 2JHFA 4LWOA 4LC1A 2Q28A 2IEYA 3ZE8A 1XMIA 3AK4A 2J0EA 2FMIA 2G72A 3WL4A 2HYIC 3JAMA 3G0BA 1GD1O 3R5HA 5GVSA 2Z2KA 2WF9A 2RKWA 4LJ6A 3BCHA 3MCAA 1Z0UA 3EDYA 4GICA 4XQ9A 3WO0A 5HHTA 1T5OA 1L8OA 3HGQA 4K87A 2VJPA 3R6TA 3SFZA 3TNFA 1DV1A 2JAHA 3DF9A 2VZ0A 1R6AA 2CLFB 6LDHA 1KWKA 4YQFA 5IM5A 4MKXA 3AF3A 4ZGGA 5K0GA 3DDWA 2PX2A 1W94A 2C4KA 5GAJA 1E63A 2C4VA 3JVDA 3T7DA 3WKCA 4DLLA 2IS6A 4B3RB 3E81A 2GBCA 2PQ6A 2QMYA 2R87A 2VPYA 1M2OA 4FTWA 4MGKR 3H5VA 1YMUA 1X8LA 2JZNA 4LYDA 4A91A 2W71A 3G6WA 3OP4A 5A4AA 4RY8A 3MT9A 2GZAA 3AB7A 2IU3A 1YBAA 3VR2A 2GHQA 2FX3A 4CETA 4E1BA 3DLBA 1B26A 3L40A 4FMDF 3RYTC 2A78A 3U4HA 3ZV3A 4ARIA 1JHUA 1ZNWA 2J0UB 3QVLA 4FX5A 1W4AA 2JLAA 2OORA 3LVQE 7REQB 4LJKA 3K0EA 4RQUA 4LDZA 1ZH0A 4M1ZA 3LLUA 1BN6A 1P9NA 1WB6A 3D8RA 3NCTA 5I9SA 4K0RA 4OI2A 4OPMA 2JIZD 3RO7A 2XQFA 4AKTA 4X1IB 1LKZA 4BNDB 4A27A 3L02A 2MOKA 1JIKA 1T4MA 3KQUA 4AK9A 3OQ6A 1PGOA 2V7QD 4GSKA 4KQ6A 1X7WA 2Q1SA 2WJYA 3J80A 5L3SB 4F45A 2P5SA 3I6IA 3Q10A 5EE0A 3EZLA 5FKJA 2IX3A 5K0LA 4RLFA 3D0KA 4GXQA 4KDRA 2JEYA 2PSSA 4M4SA 1S4QA 5EP2A 3X2EA 2BCJQ 2DERA 2CCJA 1E8NA 1S8FA 2G0NA 1YE3A 4ZCQA 2AWNA 3WLAA 5JS8A 4WVLA 4DBZA 3T06B 3BRWD 3TVTA 2H7XA 2W6CX 4M9QA 4BV9A 1X13A 4ND8A 4RLQA 3KLMX 4X66B 1YFKA 5GY7A 2OLKA 1NMXA 2BM9A 2ZSAA 3TPZA 3KQPA 2Y77A 3SQMA 2C97A 3AHHA 1UH5A 4EAQA 2I0FA 4AF7A 4R1UA 1ADBA 1QE0A 1YZYA 4K46A 5E1DA 1QP7A 3U4QB 2F8TA 3LY5A 1M2VB 2FWRA 4MNTA 4Y1EA 3ZY4A 5KSYA 4FQ7A 2WD7A 3VPBA 1NMYA 1E5VA 1L7DA 1XMPA 3O3MB 4BDTA 2BGLA 1U99A 2RJOA 4MWOA 4NBTA 4JC8A 4EM6A 5EJ9A 5FPKA 1J0EA 1HNXB 4HAIA 3AUKA 1OX4A 4YT8A 1CY7A 4OX9B 4DCJA 1OC2A 3HBNA 3M6MD 3LPMA 3IL2A 5TT0A 2PQ2A 3U16A 1HLDA 1SOVA 4JJ6A 4Y6OA 1SXIA 4ND3A 5EIEA 2C1EA 3DBLA 3HSKA 1H5UA 4DCUA 1H85A 4DCVA 5LQUA 3CF4A 4TTJA 2F1JA 1LW6E 2R6AA 2QN2A 4C0QC 3DDUA 3LP5A 5E3JA 2P62A 4BQRA 3C15C 5CBPA 1BOFA 1UKVY 4YRNA 3H5RA 3ZCUA 1AOXA 1MCZA 2AXNA 1PR3A 4YT4A 3FOFC 4IJUA 4H31A 4PGFA 5BUQA 5JMTA 4ZVNA 4GIBA 1ZVJA 1UFQA 3NOVA 5BQFA 1F06A 3OZFA 4RQTA 5CBKA 1BXKA 3RC2A 5IAAA 4MZDA 3STYA 4QFCA 2XCRB 3G9XA 4FDMA 5B1SA 3QQPA 4JUAA 1CS0A 4XKJA 3C6ZA 1M0SA 2OFWA 1DJOA 3O4HA 4ZIRA 5LOVA 1ZICA 1E2KA 4V0ME 4RM2A 5COAA 4AT1A 3PL1A 2O8CB 1PEAA 1TLTA 4NSNA 4GOXA 3BCUA 5CPFA 3M9LA 3ASYA 1JU4A 4PZYA 3IDZA 3O8BA 1R8SA 1ZOIA 2I2BA 4P31A 2IEBA 1ZSNA 4EG6A 1GFSA 1VLHA 2ONCA 1NM5A 4PG4A 3EW9A 3L7DA 1IXRC 1QO7A 4RPKA 1W4CA 1VIDA 2HSJA 4HNAA 2R68A 1ESDA 1N2OA 3VPFA 4LGVA 5AHWA 1I2ZA 1NU8A 1PD0A 2ZR7A 4JJFA 1RHMA 2ZB4A 4DJAA 4GUAA 2HRBA 1H65A 1NLFA 4TL7A 1Z6GA 4RZSA 1JDZA 2IDKA 4NYMQ 1UMDB 2NO6A 3PX2A 5EMHA 1QYXA 1JVBA 1FDIA 2PUDA 5FI3A 1UFKA 2PAFA 2NVWA 1D4ZA 3A9WA 4RORA 5GGXA 1YZFA 1U2SA 5BUCA 3NT2A 121PA 1PDOA 3P26A 5JTTA 3C7TA 2J3EA 5F12A 4Z9YA 1DC7A 4I6JA 1MT0A 4NESA 5GWXA 3S2IA 3WC4A 3GLFA 2C84A 4RD1A 3A4VA 2ONYA 3HA7A 5K3FA 1WCIA 4AKGA 1L7QA 2PUHA 1RQGA 3OZIA 5IP5A 2WQ6A 3UOWA 4OAQA 5BN4A 5JYBA 5GIPE 1QVWA 1T1EA 4TMZA 2QX9A 3VR3A 4YUXA 5DIZA 1Q6YA 4RF4A 3IMGA 1CUGA 1TF5A 1KEVA 4XWGA 3ECSA 4L8LA 4D8VA 3QIAA 3LCVB 4II7A 4O33A 3RROA 2NO0A 3DTTA 3OU6A 4LJYA 3IHTA 2FRDC 4R01A 3WNQA 4QBIA 2WJ4A 1J8MF 3KR9A 1IZ7A 3TKAA 2P6RA 2D0DA 4O2AA 2ZJOA 2JJ1A 2OGTA 1P9OA 3EZYA 2JLZA 4KPGA 4AJEA 2XUIA 1U3GA 1QTNA 3OD5A 2DCMA 2ZB2A 3GUYA 5IBQA 2P79A 1JI3A 2QYOA 5E95A 1GG9A 3L7IA 4EBBA 2P7HA 2EL7A 3B5EA 1CUUA 1A5SB 1QPBA 1CB0A 3HSYA 1O6FA 3R8CA 5JQWA 1TZ2A 3EUFA 3LX6A 3RYIB 3EMKA 4Z6KA 2OT3B 1KAHA 2PE5A 5DWDA 1Y81A 1AD2A 3GQVA 4U5XA 3UANA 1AF4A 1U94A 2XWQA 4BFSA 1R1DA 1XTUA 4UQOA 4BGIA 1GCUA 2FB9A 4WLEA 2XTJA 4RVSA 4YEDA 5K03A 4EZIA 4LOAA 3UB2A 4CM3A 4N0QA 3X2SA 4CLRA 3DAYA 4Q93A 2REQA 1K8RA 4XVUA 3TBKA 1U7HA 5F9MA 4CW7A 4TVKA 5TB5A 1QF6A 5DM4A 3RWBA 1RWXA 1C7IA 4MVJF 5B1EA 1GTZA 3HKBB 3NX4A 4QNNA 3EYAA 3ZLTA 1VYVA 4G8JA 2VHTA 1DZIA 2LNDA 3IPAA 4JIGA 3ST7A 1SUDA 1EFUA 1GA6A 1JEQB 1BMFD 1ZD9A 2GDJA 3N2GB 3NDIA 4L8FA 4R7ZA 5AKGA 9ATCA 3VR6H 1JE1A 2OV8A 4RSGA 4Z0NA 4D0GA 3RODA 4AWAA 2VYVA 1V8OA 1IBRA 3DJYA 4TXNA 4COKA 1UXIA 4HHEA 5E38A 1ZNYA 4DSNA 1OWOA 1P7ZA 2QTHA 4AJ9A 3EEIA 3K09C 3E9DA 2H3HA 4DR3B 2XNCA 1AA6A 1WBBA 4OBEA 3TZBA 3NTOA 4DM7A 2NZUG 4GMHA 2FZLA 2ORED 4OLHA 3QU4A 2ID7A 3KT8A 2XJ9A 3GUHA 2ZVPX 3QXHA 4BVFA 1RMTA 2ZP1A 1AKMA 1DQPA 3EFEA 1DAHA 2XNDD 3HR8A 2I7TA 3X2FA 4PX3A 3EZFA 2F3SA 3G7SA 3EWSA 4UNNA 2WWFA 4OU4A 5I9BA 3FTFA 1BMQA 1FXWF 3EN0A 5AJHA 1TEHA 5C51B 4XUDA 4DSZA 1N6HA 4FB5A 2VF4X 4EYGA 3WGYA 4CKWB 3UZUA 2VL7A 3NHBA 3FOWA 3T4EA 5F78A 5KINB 3PFFA 2B8WA 1A8UA 4MCAA 4CN8A 5JYCA 1G5FA 1D2GA 3SF8B 3ADKA 2XY4A 1E7YA 4NAUA 5JWOA 5FQNA 1UKCA 4XASA 1ZOLA 3KO8A 3L8EA 3B1JA 5GOTA 3SEQA 1SCUA 3KE8A 4B74A 5I4CA 3OU2A 5MF6A 4JB0A 4GU5A 3GBPA 4I1SA 1JX6A 4Q47A 4UBKA 4UU8A 2WJ3A 1Q19A 4DIMA 4ZYXA 1AZWA 1T5LA 3IS3A 1ZNZA 4K7JA 5I4KA 1V8ZA 4Q9KA 2R00A 5K0JA 2RGNC 1GYQA 4HYYA 3BPSA 2JEZA 4X1YA 2R4UA 2NXNA 3ITDA 2VHQA 3PV0A 4RJIA 1XCMA 1R50A 3DXYA 5JSYA 3ZCSA 1FSSA 4XR9A 1M2GA 1X80A 5CA0A 1EVLA 2QJFA 4BNXA 4QXPA 2BP7B 4EY5A 1JQJC 2AYZA 3S2EA 1U4NA 1ODJA 1JG1A 1OZAA 2OBLA 1JHMA 2INGX 3HRIA 3OPQA 4FC7A 4Q4HB 2ON6A 2JFYA 4K05A 2A58A 2Z9DA 3GDWA 4NYJQ 5BUZA 2B25A 3WRYC 2CNKA 2IQ5A 4J16C 1ZI9A 3VR2D 3AWIA 1ONPA 3ZXSA 3M6LA 3FFBA 5H80A 2V65A 2UZ4A 4BLSA 1FXUA 2OV2A 4YP0A 4FCCA 5TPWB 4BUZA 1WPRA 1KYZA 1ZGAA 3MWJA 3NTXA 1WDLA 3VJMA 4TTQA 4ZI5A 4CFSA 3BAFA 8MHTA 5TS2A 1T5BA 2OG1A 4FIZA 4QSMA 1J4AA 5B36A 4G1UC 3S2YA 3AUTA 2Z9CA 4Y2HA 4UM9B 5KX5B 3RRBA 2E48A 3CMMA 4TN1A 4QUBA 4EX6A 4H15A 2FFAA 5CFPA 2Q5JA 1F51E 2N75A 4Q4AA 4QDTA 3MQ2A 3OOYA 1JSXA 3T94A 2FEXA 3CR3C 2YRWA 4GVXA 3H5WA 2XCLA 4HL6A 1T6XA 1ZRNA 4PLVA 3TMAA 1EGVB 1KK1A 1YS2X 2CLDX 3O82A 4MRAA 1R6XA 3DUWA 3LKDA 1CRQA 1K8YB 3ABRB 3U3XA 2X41A 2X8JA 3D4BA 3JD2A 2B4TO 2QU8A 3LIPA 1MPXA 2AXPA 3DAGA 4E31A 2DPYA 4C0LA 1I51A 4I50F 3W5JA 2PH1A 3B60A 3OJEA 4QRDA 4GHWA 1XZMA 5CA0F 1Y0BA 2FPPB 3ZGLA 5DNCA 2PS0A 3GNLA 1RYHA 4TT8A 4NBKA 1QHNA 1PUJA 2AE2A 2PFKA 1JQKA 1U5BB 1DS6A 2J6IA 2JHPA 3CW8X 3QFTA 4C0WA 4TT3A 1Y3DE 3HHEA 1PW5A 1CJCA 3DL7A 3MXTA 2XMQA 4TYQA 5CH8A 1T26A 3QEMB 4UJ5A 3KHTA 1LI4A 3EXFB 1OKKA 4MYCA 2AOXA 1R0RE 3CRQA 3ZHSA 2PKRA 4R8RA 1HSZA 4L57A 1X42A 2Y76A 5LBUA 4NEHB 3RAJA 4ZC8A 4PRKA 1M1YB 1N0IA 1N8KA 4WDRA 5EINA 1QP8A 3BXGA 3UJDA 2I6FA 3Q8KA 3FWYA 3ADOA 3PHJA 4ZICA 1EUDB 4OQYA 1ECCA 3UICA 5HUJA 2ZUBA 1E7MA 3QIVA 3IBTA 1ENOA 2WU4A 4PC1A 2OCAA 3D81A 4EYOA 1Y37A 4LMAA 3A1WA 2CXPA 4HDMA 4EUHA 5LXTF 2ZETA 4M7WA 5DVZA 3SOZA 4IJWA 4D56A 2ILVA 4V24A 1DKLA 3K4QA 1U5AA 1USIA 1V39A 2CBGA 2PRZA 3OTGA 1KQNA 3PC6A 2X7JA 3O8OA 1Z13A 3BRCA 3AESA 3I3OA 1EKXA 4PANA 5P21A 4AECA 4BLUA 2H52A 1UP7A 3VX4A 1N6RA 3TMYA 2WB4A 1ILWA 3I12A 1DAIA 3AP3A 4Q9NA 1TJPB 3VR6A 3GJRA 1SD2A 1PJ3A 1XZDA 1XF1A 3LUKA 5CT4A 2J32A 2FWMX 1H8HA 1SUEA 3BS4A 1VJTA 2RK3A 4NKRA 5KYWA 1F4PA 4R1OA 4BDSA 3OQOA 2VDWA 1TYEB 4EDFA 5JZBA 1FP7A 3NM4A 4QU8A 4BATA 4UU1A 1IVSA 2IFTA 1NQVA 1YF3A 4OHWA 3KM0A 4ID3A 2GVNA 3EF1A 2P6OA 5JY6A 1XCPA 3F47A 4JJZA 2WVAA 4HB0A 4N5DA 1JNYA 5ALLA 2HJ9A 2ZE8A 4LY9A 2X6TA 3TMKA 4QELA 1J0AA 2G9UA 5A4IS 2IHJA 3MD0A 3GCGA 3WMEA 5BR8B 4P3KA 3ML1A 4CM9A 3PEEA 4IHJA 4TRMA 4CMEC 1FSFA 2HJGA 4YAKA 3DEKA 1P72A 2YXLA 1ZOSA 3PPIA 2A57A 5B1IA 5LQCA 2RC6A 3GMIA 4BLVA 5K8VA 2EG5A 4P0TA 3IO5A 3L1UA 4URZR 1RQNA 5FT9A 1VJRA 2P9ZA 5LYYA 4LJ5A 3FKQA 4OBWA 3GGPA 5BN3B 4DV0B 2ZZKA 4LSGA 1OXTA 4QXAA 5KNCH 2GT1A 1K7SN 1FMFA 5IMSA 3PXUA 2J1LA 3WGGA 2HJHA 4M87A 1PZGA 1X9IA 3L8MA 1P5ZB 4FHZA 3VISA 2HMVA 3W2EA 3UJHA 4OI1A 4BCDA 4H1VA 1YVEI 5SYNA 5FPSA 5KJ6A 3RVQA 3HBFA 1E1NA 3IALA 4YXFA 1O6CA 5FV7A 2YZNA 3Q4GA 4M6WA 5EMKA 1P5FA 2GM3A 3VR3D 3BIFA 2ZIUB 4G81A 3L8YA 4QOGA 3FNRA 1ADGA 3DA8A 3BK2A 1FFXB 1PNTA 3GA7A 4KLZA 4HN9A 2PVSA 3QF4B 1C9MA 2NPOA 1NURA 2BT4A 5IHPA 1QQTA 3PHIA 5DDIP 5G4KB 2QEQA 3OM1A 4U7PB 3CF2A 3D6AA 5B58T 2QRJA 3IDQA 1RAIA 5C5EA 4Y2YA 1TMKA 1TM1E 4OGWA 5F1YA 3FGPA 3GLIE 2JJ1D 3FPEA 4RF2A 2V9ZA 2WOJA 1ULBA 3T7TA 2P8SA 4AY4A 4CUZA 2B0CA 4CMGA 2EX4A 3UA3A 2ZQZA 3AETB 4QODA 2FFRA 3O95A 5K9ZA 2JGAA 1U7WA 1O54A 1O4WA 1ZBDA 2AKYA 3DCYA 4UU7A 4RHCA 3LJKA 5E8JA 3L4SO 3P9NA 1Z5OA 3B8EA 1L5HA 2X3YA 4AYTA 1QB7A 4FYJA 3JATB 3GZNA 3IOEA 4LCEA 3PKIA 2BEVB 3RFTA 4R8KA 3AVUA 3Q40A 4WY5A 2ZT5A 3P9XA 2BCEA 2JFXA 5DW0A 4PG7A 4DY6A 3SQNA 3IIEA 4I6EA 2IYVA 2YH2A 4EKYA 3P2JA 1ZG3A 3SCZA 4ZI2A 2HOQA 3TZEA 4NQZA 4Y2XA 1G21A 4PLGA 4EHHA 1XU4A 3GHHA 4NZ9A 2GA8A 4NTZA 4DREA 3W2FA 3RT9A 4KXYA 5G0SA 4WXYB 5EXSA 1ESMA 1M2NA 2XDAA 2Z1MA 1RXVA 2XD9A 1M54A 2ZCVA 3I6QA 4BXOA 2JGNA 2VYVD 1YJ8A 5JEEA 1NY6A 3DUFA 3G9QA 4RNCA 7ADHA 1ESEA 3PWKA 1YVRA 3SHOA 1UJ5A 3H1FA 2OILA 3B5JA 2Q99A 1P62B 3N3BC 4Q1VA 3WS7A 5AUPB 2FSSA 2P9BA 1D2NA 4M38A 1M6EX 4BEWA 3ZS8A 5KIAA 3EQ7A 1YHYA 5EJFA 2XE7A 4L22A 4JWTA 2FPGB 1LD3A 3CG4A 3GCZA 3P2EA 1WTAA 1BXRB 1EUCA 2PGAA 3NUZA 1QFSA 3VDNB 5HFAA 2UXBB 1LI7A 3WV5A 5IAOA 2IW3A 2R5WA 4BO0A 1U8TA 2Q5QA 4DMGA 3ZZUA 4D0NA 4KPYA 2BJWA 2EFGA 3Q6MA 3SR4A 1MP0A 1UT8A 2CL7X 4KIFA 3NT4A 5KOHB 5D2CA 3BSYA 3N9IA 2PUBA 4GECA 1U7TA 4YAWA 1B8UA 4NCNA 3PITA 5G02A 5GZ1A 4CL2A 3ZY2A 1YCDA 2G17A 1Q0RA 4GLOA 3Q8WA 1PS9A 4UEOA 1II8B 1SCQA 1C0LA 3QX8A 3HVUA 3L0YA 2B34A 3AQIA 1VE1A 3KQVA 3HB9A 1G7CA 5FOWA 4BX0A 5IRCD 3PJEA 5CM8B 1SRRA 4YRBA 5EHXA 1G8FA 2XYQA 2WIFA 1EWVA 2BH2A 5KVAA 4R2XA 2GF9A 3BUSA 4KH1A 2VC2B 3DMYA 3BHNA 1FNCA 2GK6A 2Y1KA 4DCSA 5CFLA 5IC6A 2DHQA 4QSHA 4NLLA 3WAJA 4RZ2A 3VOTA 1YVDA 3N5CA 4R3UC 4MJXA 1LVGA 4B43A 1HYBA 4IFTA 4KZPA 4ARBA 2XVYA 3ADCA 1T4BA 2B69A 2NU8A 2ZYIA 4DYVA 2XRZA 1A72A 2H5IA 3JY6A 4WNYA 3GWGA 3TI9A 3W5CA 1GVNB 4PRZA 3SHTA 4C5AA 4MW4A 2Q3JA 5TQ2B 4JGIA 2A33A 4Q05A 1MC8A 1PFVA 4W5NA 4JR0A 4NZNA 1HEIA 2PX3A 1IJEA 3ROPA 3QNWA 1Q3HA 3TLMA 4E4YA 1PR1A 1T9KA 2QSJA 3LA6A 3HP7A 4F21A 2V7TA 4E4TA 4I8IA 2DC1A 3UKOA 1QWSA 4CHTA 5KNCA 5DLDA 2WD9A 5D3MB 1KYIA 1VXOA 4JI7B 4G89A 1ZDMA 2F64A 4WIAA 1IBKB 4M0DA 4RACA 3SQXA 3QUCA 1Z33A 3SSOA 2HV8A 4P22A 1MKYA 1S7GA 2BFBB 2FXVA 5BQ5A 2EQAA 2FQ1A 4UPEA 3T0FA 1NDUA 3CRNA 3DAOA 2QOEA 3HH8A 2QX7A 4JFRA 3SQWA 2BHRA 4HWOA 5CM9C 4G5RA 1BS9A 1E5TA 1IN7A 1AF7A 3V1NA 5COQA 2NUAB 4C0XA 4CT5A 1R4NA 4IG9A 2ZWVA 1NE7A 4R9RA 3QUQA 2Q2NA 4RDXA 1QF7A 5IEBA 3G2QA 3LUDA 3WXBA 4DUPA 5A1TA 3Q87B 3ESYA 3CLTD 2XVMA 4RJJA 3P1JA 3RNOA 4PIVA 1PLJA 4KR3A 4OGFA 2GPNA 1SC3A 1YE8A 1I2CA 3DYBA 3LBHA 1LPOA 4TT3D 4YK7A 3TTVA 4P3OA 3OFNA 1QQ7A 2NZVG 1E1LA 2A8YA 4ESEA 3TGLA 2C2WA 1TZCA 3R9KA 1BDIA 1QHYA 4FNAA 1OKKD 1Z3IX 3I72A 1ZPDA 4D3ZA 2ZTLA 3NRJA 1E7WA 3HG7A 1K2VN 2IUSA 2ZSJA 2YFQA 1ISIA 1A2QA 3EOZA 4MV7A 4R1TA 3Q9NA 2CNNA 4X1KB 2R1VB 5JCZA 5JDIA 2Y1GA 5T57A 5B3KA 1E1CA 4ZALA 4IFIA 3ZGVA 4XSVA 2G06A 4PF1A 4KDFA 3EWAA 3T99A 3HB0A 1HM5A 3ETJA 4WOJA 2VJLA 2I7CA 2IOFK 4HVAA 5CLGA 1WEHA 2FMFA 2WINI 1MZVA 2O9JA 3NTRA 4GX0A 2NZ2A 3O31A 3NUGA 4OMDA 1SZPA 1NRXA 3WSWA 3EC2A 4AZ0B 1SCBA 2WG2A 4P54A 5CB0A 2NXJA 3AEKA 3T5CA 3ZDXB 5B3LA 2X42A 3UBTA 4M1OA 3SXJA 4XUGB 3VR6D 2N46A 1TADA 5ITWA 1SVOA 1OZ0A 2Q1YA 4LMRA 4F4DA 4KYUA 1H8HD 2O3QA 1QHHA 2B6HA 1VMIA 1G66A 1CR2A 2N0SA 1G20B 4GLLA 1RABA 2Z58A 2OYCA 3D8UA 1MJHA 4FW8A 4D8XA 4JLDA 4UE3S 1T6BY 3GGSA 4Y7DA 4QL3A 2CV0A 3NBFA 4U2GA 4MQEA 4HNSA 5EP1A 4FZVA 2AZXA 3Q72A 2RKBA 3GJYA 4G2TA 1JG6A 3D7LA 4AI6A 4KAXA 1E2NA 3EVTA 1J8YF 1HUQA 3EWNA 3OZSA 2JD0A 4IH4A 2JGMA 3DZHA 5KWVA 2LCQA 821PA 4PAWA 1EINA 4CM9D 1UFVA 2VQEB 1JR4A 3CH7A 4N0MA 2GAAA 2PKYX 3ZWVA 1LC3A 3TZ6A 2J8ZA 3Q7TA 4B4DA 4B3XA 5KSWB 4TTTS 2ZE5A 4A2WA 1HE8B 3BJRA 4PINA 5AR1A 2IT1A 2JGKA 3JRXA 4I4CA 4CKCA 3HYLA 1UQRA 4BCBA 5DB4A 1RP7A 2XNHA 3M89A 1KJWA 1X7XB 4FM9A 3OKAA 2PMWB 2X0KA 3OQMA 1Y6FA 4E2YA 1K6JA 5K8LA 1JKJB 2CJWB 1D1TA 2QZ9A 1TU0A 3AM4A 2PKQO 5LSAA 1Y8ZA 1BE8A 1M0EA 5AKIA 3VZSA 1TIBA 4LXYA 1ISFA 3BGDA 2OZLA 4IX9A 4LXHA 3SFVA 2IUEA 1XDZA 3FUUA 3MJ4A 5CFRA 3ABSB 5ER9A 2EWMA 4B8YA 4LX0A 4FOSA 4R2JA 1JHYA 5CFOA 1Z25A 4BC0A 3JQPA 4JAVC 4KR2A 1Z0IA 1F5NA 2PBRA 3V4LA 5C52B 2K5UA 2OVFA 1VIYA 2R5NA 1OFHA 2UYQA 3FM9A 4XE5A 3PC8C 2NIPA 4HS9A 2G63A 4OF4A 4JKYA 5HTKA 6ABPA 2ZSFA 1GZHB 3A14A 3FD8A 1U1IA 4O1MA 5E6SA 1Q0ZA 2IEDA 3GFQA 3ZEAA 1R9MA 3WDKA 2JFUA 4IIVA 4AN4A 4P82A 1VFPA 2G4LA 1EPUA 4DJ5X 1S96A 3LG2A 4B4VA 5FLXA 4RELA 2X6RA 3E53A 4JC5A 4JEMA 1GRRA 4JCOA 4ZRDA 2Q4DA 2PGOA 2ZGVA 3K2EA 4P5EA 1SN7A 4U7JA 2WJPA 4B7AA 1MA0A 4NBRA 4RKQA 1G64A 2VLIA 3FLEA 2MTBA 3A6PC 3LT4A 1XELA 4MPPA 2IPXA 6AT1A 4DJJA 1K6XA 1IM5A 4JSTA 4GLJA 4OHFA 1B23P 1SUWA 2WYVA 1IHPA 3F8WA 1H1DA 5I7FA 2X77A 2BFMA 2WE8A 1UJ6A 2A0XA 2TMKA 3GLVA 1P1BA 4HH1A 2QTFA 4XSGA 3RYCB 1PLKA 1BKDR 4F4HA 1FMLA 1PSWA 1Q16A 1T13A 1UK6A 4OJQA 1JMVA 3KQWA 3A6JA 4LDPA 4QJIA 4WINA 2FTKE 4P98A 2NV2B 1ZXBA 3H9BA 3Q2OA 1KI8A 3ENNA 4OFXA 2Z08A 1JLLB 4OLFA 5EJIA 5B4TA 2V9CA 4B83A 1ADFA 5CDYA 2JIRA 1OASA 1MGPA 2IOQA 1JIUA 4D9HA 1LPBB 1KC3A 1HOXA 2P5YA 2MSLA 3A6KA 2LVBA 1FS5A 1ZGGA 3A4IA 5IVDA 4EGCB 2W4IA 1EZ4A 5F3DA 3LF1A 1R66A 2X15A 2BVNA 5LCXA 3LT0A 1T5SA 2QF7A 3DULA 3IUSA 4XI9A 1EVQA 2QAIA 5IJAA 4EA6A 1WZ2A 4IDCA 1MA3A 1XZLA 2L42A 2XMBA 5DBHX 2VKQA 3FPHA 3A4TA 4H3HB 3UATA 3IDSA 2CGEA 4AX8A 1VMDA 3O91A 2O05A 4WESB 4RM3A 1NKSA 3RQSA 3WDMA 1KY3A 1IPHA 1OHHA 1VJ1A 4LV8B 3HP4A 2I7DA 2K2QB 4UPVA 1FFGA 3RK1A 3NDPA 2ICAA 3THWB 1ZEJA 2QRHA 4RS3A 2VYCA 2J48A 4LTNA 4W5OA 5DRYA 3CNNA 4NYMR 1SRQA 4ALKA 4MKZA 4ZKDA 3N0TA 3S0JA 1AS2A 1CZOA 4G0ZA 4LXGA 1PQYA 1YQGA 3TOCA 5DWQA 3VZQA 4IKEA 3K1TA 1H0SA 2FW6A 3ROTA 4L3WA 3LO5A 3O74A 1KAQA 2HU5A 4L4RA 1LH0A 1YA4A 2W2KB 1U9IC 2C2HA 4MWDA 2PGNA 3H2YA 3WGKA 3N8DA 2VPZA 1F60A 5K8IA 3BRQA 3FCEA 4G5FA 5DKFA 4C05A 1SXQA 1R10A 3DC2A 4GKJB 1GGNA 2I1LA 1W35A 3VMFA 1N3BA 1TF2A 5FUVA 1R27A 2BUBA 4JLNA 2XUZA 5I5GA 3SM3A 1W36B 1C30B 3V42A 3DO5A 4OD0A 1CETA 3T1TA 5LUBA 4BS9A 1C7FA 1BG6A 2C4MA 4GWKA 3EULA 4RA9B 4EPVA 4ER0A 5JCOC 4WJKB 1J8QA 1XCOA 2OTCA 2X9VA 3Q3EA 3DKIA 4ND2A 4LF8B 1Z74A 3S8MA 1MC5A 2I29A 1U2RA 1L1QA 1ONBA 1RXSA 1Z4IA 2GSWA 2PX6A 1F8XA 4ZQHA 3ZBQA 2W90A 4R2HA 1YR8A 4BMOB 4QM7A 3SMVA 3RFCA 4BFLA 2ZJZA 3IMCA 3A4LA 3ENZA 4CG3A 4MYSA 4DUYB 5HRUA 3CPJB 2COEA 4BNZA 4IFEA 1L2TA 4MRVA 4EQ6A 1P1FA 1XN1A 3QK7A 5C8DA 4ZT6A 2HIMA 2YN0A 1QH0A 1XF9A 4IOMA 1Z5WA 2LIPA 1C9YA 4MYDA 2JRLA 5KNCD 5C1PA 2W22A 3DDSA 2ZIFA 1GV0A 3EIHA 3IOYA 3KXDA 1PV4A 1WSBA 4LHSA 4H4DA 3OOHA 1TO2E 3VYVA 4DM4A 1J7JA 3GT3A 4I55B 2FK8A 3O90A 5AVJA 1P4RA 1Q1EA 1E8DA 2VUIB 4YGYA 2G5CA 2EKBA 1UBLS 2VQDA 3FETA 4JC4A 1WDWB 1U2TA 4RVNA 4DTCA 1II0A 4ZGWA 3IE0A 4OQNA 3UAXA 4V1CA 4P4SA 1P4AA 2EF1A 5KOIA 2O8BA 1D6MA 1CYEA 1H3FA 5AOVA 4KN6A 1RI5A 4NI5A 1FFBA 4N8SA 5BSGA 1RWKA 3U56A 3ADDA 2RGAA 3NAZA 5DBEX 1MAHA 5JH7B 2NYAA 3S1AB 4YH1A 3HY6A 1V9CA 2IRWA 4PZZA 4L4UA 1PWHA 4Q3CA 1K0UA 1US8B 3ED1A 3HO8A 4TTSA 3V8NA 3RRJA 2WU8A 4K81B 4ZGBA 3TJRA 1KS9A 3A36A 3EZXA 5CVDA 3UKDA 3LHDA 3UK1A 1GQSA 1BE1A 1JR3E 5J2TA 4FHFA 4CJXA 3O2NA 5FOSA 3OFND 1UBEA 4PPQA 1DU4A 2A1IA 2ENWA 1AS0A 2HF2A 3NEJA 3SJUA 1N2CA 4DCPA 1NMEA 3CMCO 3C6YA 1TLLA 1NJ8A 1VE3A 2C7QA 3BGOS 5ALIA 1CF9A 1VA4A 1WMAA 1KSGA 4AJ2A 3UYKA 3I28A 3V8RA 1K3TA 1IDOA 2FDCA 2HA7A 2PZEA 3W5AA 4JODA 5L3QB 2GXUA 1GQYA 3V6LA 1IZ8A 4OIFA 1C8KA 4IGFA 2I2XB 1QHSA 7YASA 2Q1WA 2NNWB 4LGYA 4XQ0A 3TR5A 4JZYA 3SYMA 3BYZA 3H42B 4ARSA 5JVDB 1FRVA 2BEWA 3CH6A 4U6SA 3K3PA 1AV7A 1BCRB 4UJ3A 4CPDA 1FU4A 1MRSA 5CVVA 4CL0A 2VPPA 3OFKA 1F0NA 1UK7A 1Z2AA 4KWCA 4FXOA 1E4OA 1V7ZA 4K5QA 4X95A 1PE0A 1YRWA 3ZOZA 4XDHA 4ZZ1A 1Y3CE 5CDFA 3TTYA 2Z04A 3ZNOA 4G0QA 1YJQA 1XMXA 4NL4H 4X71A 2P4UA 3P9PA 1FYXA 1VXRA 4QOJA 2C9ZA 3C1UA 1DG3A 4PFSA 1G2QA 3BXHA 4NENB 1IJKA 1CW2B 1JTEA 2BFFA 1V0JA 2I4MA 1QCDA 4HH4A 3HTXA 1OAAA 4CKWA 2I2FA 3NIBA 2CXOA 5EXTA 4F8EA 3R7BA 1RRMA 2NUPB 4BNVA 1GRQA 1QS0A 2NGRA 1NWHA 2PKCA 3NHWA 2ABWA 1FNBA 3LPAA 1W2HA 2VXCA 3H2JA 1J00A 3CZQA 5DI3A 3VNUA 3T9AA 2REXB 2Z6QA 4IZHA 1GUDA 4E5VA 4TUYB 1XQYA 3L6RA 4CLOB 1PTJC 1L5KA 5IPFA 1CQPA 2J9FA 5JISA 3IULA 4WADA 1VSBA 3ZZ0A 5AW8A 2ZBDA 3B1VA 1OE0A 3HWSA 2YXNA 3DVRX 3QNUA 4R1QA 2NZJA 1G42A 2GX6A 2QYSA 3OO0A 4PXAA 2UVQA 1QH1B 3N2YA 2IHZA 1E3QA 2X1VA 2Q3EA 4X1IA 3ZWXA 4EMTA 5JNTA 4HAVA 2X58A 4JLAA 4JI6B 1DIRA 1XKLA 5C34B 5F7OA 5IAEA 2YY7A 4JVNA 4TWBA 2ZIXB 4ZCTA 1EFCA 4CNQA 1L7MA 3JAKA 4F2PA 3VZPA 2DQKA 2OOSA 4KQFA 4W9RA 1VJDA 1L9XA 3I6YA 2QD3A 2O20A 5DEIA 1JH9A 2PZAA 5F2NA 2ID9A 3BEDA 4JI0B 1TM4E 2F2TA 1E2GA 2OV3A 2GZSA 4WQMA 1GGVA 521PA 5AVZA 3WL6A 2XECA 1IXKA 1EXDA 1DIBA 3ZJ4A 1T5TA 5F4ZA 3EDMA 4NF2A 2UUPA 1AKTA 4CIXA 3GCDA 4MWCA 4FD3A 2L2QA 1E6EA 3CSUA 1IY9A 5BSUA 4TS9A 3ROGA 2BGGA 4BO5A 5J58A 1DAFA 3M6VA 2QRQA 1MIHA 5TEVA 2M1XA 1KI9A 4YV0A 2GAJA 3WL7A 2CMFA 3EQ8A 1C4WA 3FIUA 3Q0IA 4MLDA 2ID8A 1JG3A 1FW8A 3BKXA 3LWDA 1I13A 3PJDA 3IJ5A 3SC6A 5DNDA 1VKNA 3T9CA 1MXHA 1V2GA 4HNTA 3KQQA 2CF6A 2R6JA 1UM9B 4RCYA 1SVUA 5CXQA 3PGA1 2PUEA 5CEEA 3DV0A 3N8HA 2EFDB 3BIOA 3RI3A 4TKLA 4UFNA 3F8TA 1S2MA 3GI1A 1G98A 5HF6A 5LR6A 1TW2A 2H51A 2GO7A 1QQBA 1E2BA 1Z7GA 4LZJA 1Z62A 1UXHA 3DPUA 3QKRB 1X9GA 3R0VA 4FJ2A 5FRDA 1PQ4A 5EUQB 4BKPA 3NQ41 4CE6A 1A1VA 5JARA 2XZLA 3OZBA 2Q46A 3VRHA 2XCIA 1T34A 2I3ZA 1ZQ1A 2JGJA 2IJGX 3GJTA 3SY8A 1I1OA 1JEAA 2JBWA 4CCAA 3AM1A 1B4DA 4TV8B 3MNFA 1F6DA 4OJTA 4S24A 4IXNA 4MW0A 2P9JA 2VRCD 2YHUA 3UBMA 4CI0B 4H1WA 3PRJA 2XVXA 2EQBA 4GKBA 2GQ0A 1SVSA 2Q6OA 3GW8A 5HEKA 3LPNA 1G60A 1EFKA 1B73A 4KR0A 2YJTD 1IVNA 5C8YB 4CIWA 3OQHA 3QLTA 3A9UA 2B1RA 4R69A 1P2VA 3ZHVA 1SELA