2VO7A

Structure of pka complexed with 4-(4-chlorobenzyl)-1-(7h-pyrrolo(2,3- d)pyrimidin-4-yl)piperidin-4-ylamine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
total genus 107
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vo7A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vo7A02
5HTIA 4O7WA 1JNKA 4YO6A 3AQVA 3O71A 4AZSA 4YR8A 4FKTA 3LM5A 4USDA 5CT0A 4I22A 3FPMA 4KWPA 2R3NA 3NGAA 4EK4A 2YIXA 5JFSA 4XBUA 4NUSA 1V0BA 3HEGA 3Q60A 4IVBA 3QCYA 1XJDA 4RVTA 3QTRA 1DI9A 5GZAA 1CMKE 2IO6A 2W5HA 4KS7A 5IF1A 3AGLA 4BDEA 5TE0A 1K9AA 2VWWA 4DTKA 5CALA 4W4YA 5IUIA 4R6VA 4FTRA 4BCKA 4EBWA 1MQBA 3F61A 2W1CA 3S95A 3OS3A 3LFBA 5AMNA 4RWJA 3D7TA 2OJFE 1WBPA 3JS2A 4GVJA 4E5AX 4PNIA 3ZLWA 2C3IB 3FXWA 5LCKA 4O7SA 3ACKA 5BNJA 4I5PA 3E5AA 4FIEA 4O2ZA 1NVRA 4MBJA 4USEA 1PXLA 4I6QA 3II5A 5HCYA 2R4BA 4C35A 4L7SA 4QYEA 2ITWA 3MI9A 1V1KA 3V3VA 3LM0A 3FPQA 4DH7A 3CSVA 3RK7A 1K2PA 1O9UA 1XH6A 3QQHA 4HCUA 4NT4A 1OECA 4I20A 5DEYA 4ZSJA 4KUJA 5EQEA 2VTNA 3HNGA 3NSZA 4TPTA 5AAEA 4GYGA 3BE9A 4J7BA 2QI8A 3BQRA 5GZ9A 4L43A 4DC2A 2JBPA 4DAWA 1CKJA 3E8DA 2JGZA 4HYIA 4IM0A 1GJOA 1H0WA 4Y95A 3RNYA 4V01A 3SAYA 1VZOA 2IW6A 5CSWA 2F7ZE 2VX0A 3TJCA 4HJOA 4ERWA 2C4GA 3CXWA 2RFEA 1K3AA 4ZSAA 5JFVA 1MRYA 4FYOA 4IX3A 3W8LA 5HLNA 2QOKA 3QRKA 4CVAA 4TWNA 5EM5A 5KHWA 4MCVA 2BKKA 3RK5A 1X8BA 2X0GA 4X3JA 3NYOA 4Z7HA 3MH3A 4YZDA 2KTYA 5AR5A 4FV9A 4RIWA 3CD8A 4NYEA 2YM3A 3KF4A 4RIXB 2JIVA 5A6NA 2ACXA 4FR4A 1XQZA 2BMCA 5J9LA 3Q6WA 2A19B 4OTFA 1VR2A 1W83A 3H9RA 1SM2A 1YDRE 5CU2A 3UJGA 3DBQA 3R1QA 3FZSA 4RIYB 3QZIA 2V55A 4M12A 4XH6A 4FEWA 4IHPA 2BRBA 4H3QA 1U46A 3BEAA 3MYGA 4K8AA 4U81A 5FD2A 4IZYA 4UWYA 2G15A 3IECA 2V7OA 3R7GA 4PMTA 4Q5EA 4EI4A 1W7HA 5BUIA 1WBWA 5TOZA 3FBVA 4C2VA 4HYSA 2GNIA 5B7VA 1UNHA 2BRMA 2ETMA 3TACA 5DHJA 3UTOA 4X2FA 2IG7A 2JDRA 3ORLA 4FZFB 3R8LA 4Z7GA 3GQLA 4NTSA 4MXCA 4B4LA 2W7XA 4G2FA 3PLAE 1UU8A 3NW7A 2C3JA 3WYYA 3IDCA 3UYSA 3F5UA 3W55A 2J5FA 4AT3A 3Q5IA 3LCKA 1SZMA 4ACCA 4OAVB 4B99A 4D2RA 2PVLA 4TWPA 1IAHA 2W4KA 3HA6A 4W8DA 4A7CA 4ZTHA 1I44A 3WF5A 4EUTA 3L8XA 4TNBA 4YHJA 4L44A 3CGFA 3H9FA 4FF8A 3U6HA 2CNUA 4W9WA 4YTFA 1WBTA 3BHUA 3R1YA 4QMZA 2CCHA 3E63A 2IW8A 3CKWA 3QRTA 3ZO3A 5AA8A 2ITNA 2ZM3A 3H3CA 4D1SA 4EH6A 3O51A 4RC4A 3P7CA 3UO6A 3VS1A 4L3PA 2ZM1A 4YTIA 3IO7A 3D0EA 3ZFMA 4EUUA 1T46A 1S9IA 2A4LA 2BDFA 2PZ5A 2XNNA 3V8SA 4G5JA 4DFUA 3EMGA 1PY5A 4S33A 4RVLA 4GYIA 3V5JA 5DYJA 3JY9A 5KMOA 4EQMA 3R21A 4PL5A 3WZJA 4ZMFA 3VBVA 2VWXA 3KK8A 4RJ5A 5LVLA 1BLXA 3ZEWA 3WOWA 5CAVA 3TT0A 1BUHA 3Q2MA 2X8IA 3IPHA 2NP8A 5EOLA 1H08A 3R9HA 3FXZA 4EYJA 1J7UA 3W10A 5ETCA 3V5QA 4RZVA 3CTQA 3S3IA 4O7RA 5LMKA 1G8SA 3A4PA 4BDBA 3ZRKA 4F1TA 1FBNA 3C0HA 2X39A 1CSNA 1ZRZA 4FV6A 3CBLA 3DBDA 3V5WA 2C6DA 2XIZA 3KGAA 1PF8A 5LARA 3AC8A 4AA0A 4AT5A 2DUVA 4TT7A 1HCKA 2V7AA 4C02A 3LZBA 3FKOA 2BRNA 3BBTB 3FJQE 2QHNA 2EU9A 1Q8YA 3PZEA 4BDHA 2ITXA 5CU3A 2C6EA 5ETIA 5DMZA 4JDJA 5JZJA 2JDOA 3QUDA 4PUZA 2VX1A 4XRJA 5GHVA 4KBAA 4BDCA 5CTPA 3D14A 3AC5A 3DPKA 3DU8A 3F5GA 5JRQA 2W1DA 3COKA 1IAJA 4JNWA 3LJ2A 4R5SA 4P2KA 4TKSA 5IA5A 3U51A 4YBJA 4IAZA 2UW3A 2QR8A 1P14A 4XG3A 5H2UA 1KOAA 2R2PA 3P86A 4QMUA 2ZMDA 4RJ6A 2EB2A 3NUYA 5E1EA 5JGBA 4CG9A 3VQUA 1P2AA 4D4YA 4I0RA 4O0WA 1IASA 3QA0A 4X3FB 1M2QA 3R9RA 3I6WA 4AFEA 2VTSA 5BMSA 1Z5MA 4PNKA 3OP5A 4LYNA 3ID6C 4YZMA 1URCA 1F3MC 2BFXA 3QGWA 4WT6A 4UX9A 3OF0A 5CSVA 2H34A 2W4JA 5D41A 3UOLA 4AOIA 3SW7A 4CMTA 3O7LB 4O0TA 4RFMA 1H4LA 2FSMX 5EYKA 3HUCA 4ZEGA 4I5CA 4JG7A 3MJ2A 2C5VA 4C3FA 5JGDA 5HORA 2PUUA 3MTLA 3NNXA 3WILA 4BRXA 4RWKA 5HTCA 1M14A 4UALA 4D4VA 3PWDA 1HCLA 2BZHB 3DZOA 3PWYA 1WFCA 1OUYA 3QKLA 3RP9A 4X6QC 2JIIA 2YIRA 4EL9A 4B0GA 3GT8A 4AP7A 3I0OA 4FOCA 4U42A 3EQRA 4FTCA 4BR3A 1RJBA 4YO4A 3QZGA 3OWJA 3ZUUA 3OEZA 3TUDA 5ITAA 3BHYA 5IEYA 4IB3A 4ALVA 3CGOA 2F7EE 1OL7A 2PVYA 3JYAA 3BHHA 1YI4A 3G33A 3KCKA 1QMZA 1PMUA 1V0PA 3ZLXA 3RPRA 1UV5A 2DQ7X 1WMKA 3DV3A 5D1JA 5EW9A 4ZK5A 4BDDA 3OOMA 4W9XA 3FI3A 2O8YA 3QC4A 5H8EA 2QNJA 2FO0A 2XCHA 4M0YA 4EQCA 4EWHA 1JWHA 4CLIA 4TZRA 5IH5A 5HU9A 3PJ8A 2YM8A 4J53A 4C8BA 3UMWA 1ZZ2A 3D7TB 4GCJA 3NYXA 4JQEA 3PVBA 3R8PA 3K5VA 1ND4A 4DINA 3D83A 4WA9A 4E7WA 2XK8A 1JSTA 4ORKA 2EVAA 4FZ7A 3FZOA 3PLSA 3KULA 3V8TA 5E90A 2OZAA 3FXXA 5TO8A 2XNOA 3GU7A 3ORIA 4H39A 2Y8OA 4BCJA 2UVYA 3MDYA 1UNLA 3RNIA 2AUHA 2YERA 5E8VA 2VO7A 3NPCA 4CV8A 4D28A 5C4KA 5CI7A 4X3FC 4IEBA 3RWQA 3KMWA 4OTDA 3TEIA 3E3BX 4MWIA 3DTWA 1TKIA 3V8WA 2YACA 2VU3A 5FM2A 3VS3A 2UW5A 2VN9A 2PY3A 4MF1A 3VBTA 3QRJA 3SLSA 3HMMA 2XRWA 4NZWB 1R3CA 5HZNA 1SVEA 4C58A 1U54A 2F4JA 3FMMA 1FVRA 3MA6A 1M2PA 3NNUA 2P2HA 4DCEA 4YLLA 2W5BA 3H4JA 4DGMA 4YU2A 1UKHA 2XMYA 4QMOA 3CTHA 3V5PA 5EI6A 3ZHPC 1CM8A 4C34A 4RIWB 4G1WA 3EQFA 4WIHA 2W0JA 4IJ9A 2H96A 1PXOA 4FTMA 3QTUA 2QO2A 3BU6A 1Y8GA 4QP7A 2PUIA 4A4XA 2PUNA 5HE2A 3QHRA 4RZWA 3E7OA 4BBMA 4BDJA 5CEIA 5K3YA 5CSXA 4EK3A 1OIRA 1Y6BA 3VBYA 3HAVA 3S00A 2F2CB 2RFSA 3LAUA 2J0IA 2QLUA 3M11A 4PPCA 4D2WA 3R8ZA 1YOLA 5DNRA 2WMUA 2Z7QA 3TNQB 3TG1A 1Y6AA 3R28A 4CKIA 1XKKA 5FEEA 5AUWA 2JAMA 4R7HA 2YHVA 4UZDA 4QTBA 4BI1A 4X2GA 5IU2A 4L46A 3PPJA 1QPCA 4XLIA 5HIBA 3TKHA 5FTQA 4O83A 2UZVA 1OUKA 4LQMA 2VAGA 1XR1A 1KV2A 2QODA 4FVQA 4ACHA 1ZOEA 2WEIA 3OCSA 4YBKA 3VJOA 2Q83A 2IW9A 4O7YA 4KABA 3D5XA 3R7IA 2B9IA 3PTGA 5DG5A 3FMEA 1Q3DA 5HHWA 4D9TA 5E92A 5AP0A 4O6LA 2YZLA 5KZIA 4EKLA 4YLJA 5L4QA 1LR4A 4S30A 3MN3A 5M4FA 5E8XA 2YABA 3AT3A 3IDPA 4ZJIA 4LV8A 2UZDA 4K11A 4NFMA 4M15A 4OTRA 2WAJA 4GK2A 1PKGA 4K2RA 4M7IA 2R0IA 5M07A 1EH4A 4DH5A 4OTHA 4FV1A 1H8FA 4M3QA 4M8TA 2QOQA 4PDPA 2JDSA 4APCA 3H0YA 2JLDA 3EFKA 3UG1A 4NKAA 1Z9XA 3MY5A 2QU5A 1JSUA 2YIYA 1R0EA 3PP0A 1B6CB 4L68A 4FEUA 2WZJA 5CLPA 3DQWA 3QYWA 2GS2A 3PVGA 5FTGA 3LXNA 4RLKA 3B2TA 2IWIA 4FBXA 5CF6A 5BVFA 4XCUA 5EYDA 3BE2A 4FG7A 5KE0A 4FI1A 1DAYA 1XHAA 2WMSA 4NM3A 4N4SA 3E62A 3P7AA 2QO7A 5HOAA 5AEPA 4UXLA 4CKRA 4O0SA 3RAHA 4JAJA 1JKSA 3UIBA 4BBEA 1GZ8A 2J4ZA 2A0CX 2XNEA 4CTBA 3K54A 5A46A 1NW1A 4PPAA 4DLIA 4N57A 4R5YA 3U54A 4Q5HA 2WD1A 3VVHA 4JR7A 2YAKA 4NJDA 4KBKA 4P90A 4D4SA 5K5NA 3SKCA 4E26A 3C9WA 3UYTA 4XBRA 5DWRA 5EKNA 5JK3A 2JKMA 4UMPA 1Q8UA 4PX6A 3FZPA 3CR0A 2Y6OA 4R3CA 5D7AA 4EK8A 1VJYA 1YHSA 4IM3A 3HV5A 4E6QA 3IGGA 2PMLX 4HPUE 2HCKA 2GQSA 4UBAA 2JITA 3F7WA 4V04A 2A2AA 5AM7A 4YHFA 2GHGA 4UY9A 3GVUA 3ZBFA 5M51A 4UWBA 2JFMA 2XK3A 3D7ZA 4HYHA 4QMQA 1LP4A 2OXXA 5HBHA 2HXQA 2WQMA 4L67A 4X6RA 4FV8A 3V01A 3LFEA 3R8VA 3PDTA 1JBPE 2EWAA 3F3TA 3DKGA 3ITZA 2PHKA 4KKHA 3WI6A 2VNYA 1U5RA 4KAOA 4NCTA 3ZYAA 4CFFA 5E7RA 4NH1A 5IA1A 1M7NA 3QLFA 4BYIA 3ETAA 2BAQA 2G2FA 3FLWA 3BYMA 1FVTA 3WF6A 4BTKA 1U4DA 4CMUA 1PRYA 5BYZA 5DT3A 3PSDA 3CC6A 2HW7A 2XNPA 2WEVA 1PXJA 4RQKA 3W33A 3S1HA 4OBPA 2I0EA 2GTNA 3G6HA 3UMXA 4AZWA 5L6PA 1PXKA 2G9XA 4IACA 5FWKK 3PG3A 3P5KA 5DN3A 5EQYA 3S4QA 3LFFA 3MFUA 1ATPE 1YXSA 4FUYA 5AR8A 3TL8A 4ANMA 3UZRA 4YJUA 2P33A 4IADA 3HL7A 3SQQA 1OIYA 1M17A 4RMZA 4FTAA 3ZU7A 2GDOA 2VTAA 3T3VA 4JR3A 4L9IA 4F09A 4PTEA 1P4FA 4C4GA 3VUMA 2J0KA 1SNXA 3JUHA 2HZ0A 3ZONA 3W2PA 4D1XA 4O7VA 1BI7A 5ICPA 4JG8A 4YZCA 4C4EA 5LMKC 4RIOA 4FZAB 4O1PA 3U87A 3I79A 5CZIA 4AGCA 3G9NA 2WTIA 1OL1A 5CQWA 3QCXA 5JSMA 1ZMVA 1H1SA 4GIHA 3BELA 4LGHA 3RAWA 3VUKA 4MEDA 3GCSA 2ESMA 2XK6A 2AC5A 3EH9A 3DFCB 4U40A 5FTOA 3C7QA 3FQHA 4ONAA 4AA4A 4U45A 1YHVA 3ALOA 2VTIA 4KRDA 3HYHA 1H25A 3NWWA 3MVJA 4A4LA 3V6RA 3SGCA 2ITPA 2WOTA 4DCAA 2XS0A 4J8MA 2OXDA 2XNMA 5AAFA 5T6KA 3ROCA 4DEAA 2FSOX 4B6LA 3QRUA 5L2IA 3ZZWA 2CLXA 4EJ7A 2R3GA 2J0JA 2XIXA 3K3IA 4S34A 2PE0A 4UMUA 3O17A 5FRIA 3F66A 5J79A 5M09A 3B8QA 3KULB 3MVHA 4KBCA 3HRBA 2OLCA 4X2JA 3LPBA 2HY0A 2EXEA 2OZAB 4DGNA 3ZC5A 2YWVA 3QD4A 1M7QA 1ZXEA 3SC1A 3UPXA 4QP9A 4PV0A 4ASXA 3DK6A 1MP8A 2QOHA 1RQQA 2JEDA 5LJJA 2HYYA 4RSSA 2WOUA 5J95A 4C61A 5CEMA 2WQNA 5FGKA 2WMWA 3OUNB 2OO8X 3P7BA 3PJ2A 2FYSA 2Y7JA 4BWKA 1PMVA 4AS0A 3FC2A 5AR3A 1U54B 2BZKB 5CEKA 5M4UA 2ITZA 2OJGA 3A8XA 1YOMA 3RBWA 4ZSGA 4BHZA 4I0SA 5L8KA 1WZYA 2B53A 4ZTRA 4YPSA 5E4HA 3QALE 4QMSA 4TTHB 4UMTA 1H1RA 5I3OA 3UE4A 4O6EA 3RTPA 5CVHA 4YLKA 4E4NA 5J1VA 3U4UA 3A7JA 4PRJA 3PY1A 4FIJA 3BI6A 3KK9A 3DCVA 1PJKA 4EH9A 2GNJA 5IQFA 5EW3A 4G3FA 1OI9A 2ERZE 4JVGA 3I7CA 4XNEA 4CFVA 2P2IA 3ZBXA 4HVDA 4FV3A 5E8ZA 5A4CA 2P0CA 2REIA 3SV0A 1MRUA 4XP2A 3FDNA 5BVKA 4TYHA 2PL0A 2PZRA 4LRKA 3IKAA 4MX9A 3I7BA 4V05A 5FQDC 5LWNA 4X2NA 4MF0A 2ZV7A 2PE1A 4BCIA 3KF7A 2Z2WA 2BCJA 4BB4A 4FV5A 5GJFA 4ITJA 2XNBA 4EH5A 3BU3A 3EQHA 4QOXA 4XRLA 1ZZLA 3KXGA 4M66A 3F2AA 1QPEA 5HG7A 3ULZA 4MXYA 5D10A 4MNEA 5HVYA 3UNJA 2HENA 4Y5QA 5C8NA 3OWLA 3R1NA 3UIXA 3ZSHA 4G3GA 3V5TA 1YWRA 1Q8TA 3NUNA 3FL4A 4O7LA 4FTUA 3DDPA 1WAKA 4EORA 1SNUA 4A9SA 2C0IA 2O3PA 4Q9ZA 5KHXA 3FLQA 5G6VA 3TIYA 3EN7A 2YZAA 2OI4X 4LG4A 1OBGA 3LW0A 3CEKA 4K6ZA 5J9ZA 2WQOA 2B9HA 2WMXA 4U44A 3RM6A 3OEFX 4IX6A 4QNYA 3PA4A 5H8BA 2GMXA 2C3LA 1MRVA 4BIEA 3LCDA 2BDWA 1R0PA 1STCE 3D15A 2J9MA 3C4ZA 3OY3A 2IJMA 5KO1A 3ZM9A 2O5KA 5J87A 3LQ3A 3LVPA 3HMOA 4BCOA 2BFYA 2YLEA 3ZCLA 5JQ5A 3ZFYA 5CNNA 1YI3A 3BZ3A 1W98A 2XM9A 2QU6A 4FV4A 2BIKB 3R30A 4I4FA 4D4RA 4O84A 3UOKA 3DGKA 2QD9A 2R3KA 2FA2A 3VAPA 5IQGA 3MBLA 3SDJA 4FNWA 3LOKA 4XV9A 5FP5A 1ZARA 4CYIA 5DIAA 5TT7A 4DT8A 2B9JA 4FIHA 2R3RA 4MD8E 4RA4A 1NT2A 2FB8A 2VWIA 5AX3A 4I41A 4QP3A 5KBQA 3OROA 4FYNA 5CS6A 4AWIA 2E9UA 3DNDA 4BICA 1OB3A 3LJ0A 2GHMA 4OBQA 4Q9SA 3WBLA 4EOIA 3FSFA 3O50A 2BALA 3OFMA 4C4HA 2BUJA 2IVVA 4BZDA 3AC1A 2UVXA 3MIAA 1XH7A 3OXZA 5HLWA 3NVKI 3HV6A 3N51A 4EOJA 2X9EA 3UG2A 3SW4A 3PXKA 2HIWA 5FLFA 5ANDA 4RG0A 4D5HA 4ZIMA 4DITA 4KIPA 1R78A 3DXQA 3U9CA 3VN9A 4QQJA 4ERKA 3LMHA 2PMOX 3GU6A 2PK9A 4BVUA 4ZZNA 2ZOQA 4ZJVA 3DQXA 4R3PA 2VTOA 2IZRA 3BIZA 2VX3A 3G51A 3PA5A 4BDIA 4U3YA 3D5VA 2G01A 2X7OA 4FSWA 5FG8A 3P4KA 4IDTA 5CZHA 2PUPA 2JKQA 1W8CA 3WE8A 3R7VA 5FXQA 4BI2A 2CHLA 4O86A 4F0GA 4M97A 2R3FA 3OMVA 3FQEA 3OWPA 2UW8A 4IXPA 3REPA 5HBJA 1WBNA 3VS0A 1H1QA 3MFTA 4YJVA 1H0VA 2WU6A 4OGRA 2ETKA 2RKUA 2I0VA 2XIRA 2G2IA 4GS6A 4O1OA 1LUFA 4FNXA 2CKEA 4BCFA 4FKOA 2YEXA 4RBLA 3VS4A 5AP5A 4FE2A 5KMNA 5G1XA 4F9BA 2W05A 1OIUA 3EYHA 3JPVA 4G3CA 3QX2A 3C4CA 2CKQA 3OUKA 4FG8A 4OLIA 4ZAUA 3TZ9A 4C4IA 3LCSA 3VBXA 3QA8A 2GSFA 4KKGA 2ITYA 4KSPA 5LMAA 5HNGA 4XEYA 4IWOA 3BWFA 1DI8A 2FGIA 2OIBA 3GGFA 4E6CA 2W4OA 3HECA 4DN5A 3DNEA 4DGLC 4UMRA 3K5UA 5H8GA 5TR6A 3HKOA 1J91A 3WIKA 2I7QA 3GC7A 3A2CA 4FODA 5C9CA 5HESA 4D1ZA 2EB3A 4DTBA 4HZSA 3FLYA 4FK6A 4UV0A 4XV1A 2HK5A 5H3QA 1WBSA 1GIJA 2J0LA 4J99A 4PPBA 4IB1A 4O7NA 2BAKA 3DJ5A 4YJOA 4YHTA 2CSNA 1XBBA 5IDNA 4Z9LA 4QP2A 4YZNA 4WG4A 1XH9A 1QPJA 2RSVA 4O82A 3EQCA 5BUEA 4PDYA 5FBOA 2G1TA 2AC3A 4IAAA 1Q62A 2ZV9A 4LM5A 5E8UA 2UZTA 1OKVA 1W0XC 3E88A 4FSNA 4QYYA 4AE6A 3R2YA 4B9DA 5EW8A 4CFUA 4PY1A 2OH0E 4FSUA 4DFXE 3ZUTA 5I3RA 1XWSA 4Z3VA 4YZ9A 4ZLZA 2C6KA 4FG9A 4KIKA 4PMPA 4Q2AA 4OTWA 4E6AA 2OFUA 4P4CA 2PVRA 3WZKA 3CD3A 4G16A 2QO9A 5KNJA 3ZUVA 5L6WL 1YXVA 2YDJA 2PTKA 4L01A 4NCTC 4MXAA 3R7UA 4F9AA 2XUUA 2C6MA 2XZSA 2LGCA 4TWOA 3U6JA 3ZOSA 3VC4A 2W9ZB 5H9BA 4MBIA 3MVMA 4KD1A 4AGWA 3LFNA 3LQ8A 3QUEA 3NR9A 2VWYA 3AC4A 5EH0A 3GENA 3O23A 4RLLA 4YTCA 2UW6A 2XNGA 2C6IA 1ZYDA 4U79A 5CSPA 4E93A 3HP5A 4IFGA 1KUTA 5CANA 2HZ4A 2XKFA 2PVFA 1YWVA 3QF9A 1CDKA 5CF5A 4UN0C 3LE6A 3C5UA 3VS5A 2VUWA 1U59A 2PVJA 3F7ZA 4U43A 2LAVA 4M0ZA 3VBQA 2BROA 3PIXA 3UGCA 2HZNA 4KINA 3TUCA 2CDZA 3QWJA 3O7LD 5BVDA 2OKRA 4HGSA 4AOJA 1ZLTA 4K18A 4D9UA 1M2RA 3W18A 5GIOE 3DAKA 5CEPA 2CKPA 2ZB0A 3QTXA 3QZFA 4X7QA 4X0MA 3BGPA 3L8SA 3RM7A 3VHEA 3ZMMA 3ZRMA 3SXFA 4CT1A 4IBMA 4TYHB 5CVGA 3LCOA 4R1YA 5ANOA 2HWPA 4ANLA 4FTNA 4QTAA 5KMKA 4RA5A 1ZMWA 2ONLA 3G6GA 3TV7A 3KRLA 2ZDUA 3HA8A 3MV5A 3EIDA 1BKXA 4N70A 3VUTA 4E8AA 1OMWA 4WNKA 5AFVA 1GZNA 3DLZA 4QPSA 3BWJA 4M84A 4NKSA 3RK9A 4EOPA 1B38A 4QP1A 1O6KA 3AC2A 1SMHA 4JRNA 4C38A 1Y57A 3U55A 3AD5A 4MNEB 4KSQA 4YJRA 5CAPA 3QHWA 4E4MA 5BMMA 2QVSE 2WGJA 3PYYA 4JBQA 3MB7A 4IZ7A 4HGTA 3IOKA 4WRSA 1PYEA 1JKTA 3P0MA 1L3RE 4YJTA 2BHEA 5EM6A 3TDVA 1H26A 3AXWA 2X8DA 4FSTA 4ZY6A 3GXLA 3W32A 4KNBA 4WG3A 3HVCA 3SXSA 3C51A 3LCTA 3VUDA 3I4BA 2CKOA 3QBNA 3UQFA 1Q5KA 4ZMEA 2WNTA 3AG9A 3BLQA 3QQFA 2YA9A 1YDSE 3MH0A 4O38A 5FXSA 5JEBA 2WFYA 4GG5A 5FBNC 3C1XA 3DFAA 5DE2A 4E6DA 3A8WA 4BGGA 4BWPA 2HZIA 2BTRA 4IZ5A 4BL1A 3W16A 4IC8A 4C37A 4BDAA 4RVMA 3JR1A 3DBCA 1H07A 4IB5A 5HKMA 2WTKB 5DH3A 3U6IA 3VO3A 3KVWA 2ITQA 4DBNA 2JIUA 1KV1A 3F9NA 4O7TA 4EHEA 3GQIA 1VYZA 3K2LA 4GVAA 3ZEPA 3OW4A 2Z02A 1OKZA 4NM0A 5AV2A 3HMIA 4L52A 4IJPA 4PTCA 2C47A 2XK7A 3RAKA 5FDXA 3SOCA 2PMNX 5I9WA 2OJIA 2BRGA 5CU4A 1A06A 2A1AB 5AIKA 4CZUA 4DE4A 3FYKX 3R6XA 2R3PA 4QP4A 4XUFA 5DLSA 4A9RA 3HDMA 2YCSA 5AM6A 5AUZA 1RE8A 3QKKA 4USFA 3PVWA 3Q4ZA 4FTIA 2VTRA 3EQBA 3V5LA 3ORPA 1GNGA 4FTKA 2QKRA 1E1XA 3TNHA 4K1BA 3TNPC 4A07A 3RPVA 3UVPA 4TYJA 3JXWA 5AJQA 4BFMA 2ERKA 3L9PA 1H1PA 2XP2A 4GFOA 4DGGA 4AX8A 3E8CA 4F0FA 3HX4A 1ZOHA 1ZY4A 2Y4IB 1UWHA 4IAIA 3R9DA 4FKPA 1YWNA 3F5PA 3KN6A 5FM3A 3RCDA 4J95A 5I9YA 4NJ3A 4F1MA 1BMKA 2PZPA 3DDQA 2WTCA 5F4NA 3VRZA 1J1BA 3QXOA 5CF4A 1E1VA 3TV4A 3QL8A 4LFIA 2VGPA 3IDBA 2WTJA 3PFQA 5CQUA 2B52A 5KBRA 3FZTA 3HP2A 4RQVA 2X6DA 2YDIA 4F7JA 3PY3A 1TQIA 3PJ3A 4XG9A 5EQPA 1VEBA 4W8EA 4AE9A 5EM7A 4G17A 4F7SA 4WKQA 3TUBA 2Z7SA 4IAFA 4BDKA 3CPCA 4BC6A 3NNWA 3LFAA 2WTKC 4JS8A 5D7VA 2X6EA 2BHHA 3OBGA 1Z57A 3VQHA 3QZHA 4H36A 4IAYA 1GY3A 2JFLA 4KIOA 3RHXA 3FLNC 3DBFA 4GJ3A 4DFYA 4ANQA 3PIYA 3FV8A 3KXHA 4HZRA 4OW8A 3CPBA 4B8MA 5L2SA 4JOAA 4S32A 2BZIB 4DFNA 2WIHA 3MPAA 4X2KA 3OT8A 5JH6A 5HGIA 3PIZA 1LPUA 2QG5A 3P9JA 3MPTA 3FI2A 2ZJWA 3BYSA 4NU1A 4R7IA 4Y85A 4ZZOA 5J5TA 3QTIA 4QRCA 2HY81 3ANRA 4CRSA 5IA3A 2GNLA 4QYHA 4DEHA 3QGYA 2C5OA 5EHLA 4G6LA 3A60A 3R0TA 2OXYA 3RI1A 3RJCA 5CEOA 3QKMA 4AN3A 5HG9A 4FT0A 1OM1A 3QU0A 1KSWA 3EFJA 1REKA 4I23A 1YOJA 3D94A 4JAIA 5IA4A 4C7TA 3DK3A 4XOZA 2CGUA 3MB6A 4BYJA 1IA9A 3KY2A 1MUOA 1PKDA 3KKVA 4H1JA 5EK7A 1UA2A 5EI2A 2Y4IC 4DEIA 2FH9A 2OU7A 3FLSA 5B2MA 2VD5A 5L2WA 1IR3A 5CENA 4ALWA 3DS6A 2J6MA 3MFSA 3TZMA 4MWHA 4ZY4A 4TYGA 3AT4A 4I0TA 4U5JA 3R02A 5J8IA 1JKLA 3UO4A 3C0IA 3LLTA 4LRJA 1FQ1B 5B0XA 1O6LA 1IEPA 3CTJA 4GEOA 4QQCA 4D2SA 4KIKB 4OTQA 1Q24A 2VWVA 1XH5A 3MVLA 5BVWA 5GIPE 5DT0A 4H1MA 4J1RA 4RJ7A 3Q6UA 4XP0A 3BRBA 4Y72A 3NEWA 3BLHA 1YI6A 3VULA 3QTWA 4GJ2A 1UWJA 3T8OA 3OZ6A 3DXNA 4GT3A 1ZYJA 2O64A 4O0XA 3Q9WA 5GJGA 4EYMA 3C50A 3K3JA 3NUUA 4KIQA 5CY3A 3WF9A 5L2TA 4JBPA 4O0UA 4A9UA 4FZDB 4AW5A 3TN8A 4OT6A 2BRHA 3DK7A 3C4EA 4ZSEA 5KMMA 5HO8A 4IM2A 2X2MA 3EFLA 2WMQA 5CXHA 3EQGA 2B4SB 3COIA 3PJ1A 5GJDA 2W5AA 3G90X 4IE9A 3M1SA 4TNDA 4ITHA 4F9CA 2VWBA 4QMYA 5L2QA 1OPKA 2W99B 3OOGA 2G2HA 4DBXA 1T45A 3TXOA 4V0GA 3Q9XA 4FKVA 2B54A 5E8WA 4YJSA 3RZFA 2OBJA 3R22A 3ELJA 3FEGA 3ZC6A 4PP9A 4GL9A 3O8UA 1YXUA 4WNPA 3IW4A 2J51A 4C0TA 4HVIA 3ENHA 4CCBA 2AYPA 3IG7A 4APPA 1GOLA 2ITOA 4HYUA 2JDVA 5J7BA 3GU4A 4HNIA 4IH8A 5HI2A 3VS6A 3OCBA 4RWLA 5HVKA 3QTQA 4E20A 5M06A 4LGDA 3R01A 4FVPA 3UP7A 2EXCX 5IA0A 1G3NA 3KXXA 4GFMA 4YGAA 3TI1A 2OSCA 4GFGA 3GFWA 5IQCA 4I6FA 2CGWA 5DRBA 2OH4A 3FZRA 3HMNA 3MWUA 5DR2A 3Q96A 2BDJA 5C4LA 4JG6A 3RPOA 4BGHA 4PWNA 1NY3A 2C5XA 1OBDA 3CY2A 2RFNA 2X4ZA 3WZEA 3ZFXA 5KMIA 3BKBA 4WNMA 5HICA 2QOCA 4M68A 1ZY5A 4ZTLA 4F1OA 4XOYA 2CJMA 5IEVA 4XMOA 4TY1A 5D12A 3ET7A 5LVOA 4IVAA 4MXZA 3EN6A 3PP1A 4RX7A 1IG1A 5L8LA 2DYLA 2QOFA 4XJ0A 4D0XA 5E8YA 4DEBA 3FHIA 5JQ8A 2VWZA 3KRRA 4IDVA 5F9EA 3N4VA 4QMLA 2QOBA 3EN5A 2RIOA 5KZ0A 4C4FA 3EN4A 4EOQA 2R3HA 4D5KA 2NNWB 4LL0A 4FKSA 3OC1A 3AOXA 1YHWA 1Q61A 1YXXA 4FSYA 5FDPA 5CAUA 2PVHA 5HQ0A 4E5WA 2EXMA 4AGUA 2BIYA 4ITIA 2UW9A 1NVSA 1A9UA 4FX3A 4M67A 2UZUE 2R3LA 4GUBA 3ZM4A 4FTLA 1H27A 3ZO2A 2CCIA 5L8JA 5FUTA 1HOWA 4TL0A 2WMTA 1YRPA 5ETFA 2UV2A 3ZXZA 4DG0E 3L8VA 3C4FA 4C3RA 3GC9A 4CG8A 3EB0A 3E8EA 2JD5A 3QQGA 1UKIA 3R73A 4H3BA 4LUDA 4O0YA 4HVGA 3GB2A 4J98A 5DR9A 3VWAA 4F6UA 5LWMA 3EKKA 1NVQA 2QONA 1F0QA 2C1BA 3HUBA 5BUJA 2X7GA 4CQGA 3Q4TA 4RVKA 4RX9A 1CKIA 3WIGA 5AX9A 2F49A 4NM7A 3RINA 4AT4A 5I5ZA 4P5QA 5DVRA 4GSBA 3GEQA 1S9JA 1JAMA 3Q04A 4U8ZA 3PE2A 4AF3A 4FL2A 4FMQA 4EZ5A 2XEZA 3HLLA 5EFQA 1W82A 4OTGA 4AGDA 4YURA 3V51A 1ZYLA 1PHKA 2VTHA 2WPAA 5CYIA 4KS8A 4F9YA 3QCQA 4PP7A 1WVXA 3AMBA 3HRFA 3PXRA 5FXRA 2ONLC 3KMMA 4ZP5A 5C8KA 3W1FA 2XBAA 1JPAA 3WE4A 3AMYA 4C36A 4LV5A 2OZOA 4I5HA 2Y0AA 5A3XA 5HE1A 4K77A 3ZH8A 4FT7A 4XP3A 4E5BA 3RAIA 2CGXA 4BCMA 1G5SA 4FGBA 3DTCA 4W4WA 1ZOGA 4XG2A 5CT7A 2XVDA 4L00A 3ATTA 3ODZX 4CRLA 1ERKA 5E8TA 5I4NA 3LFQA 2VZ6A 5ANGA 5CSHA 3NLBA 3G2FA 3BU5A 3JVRA 2JAVA 1H1WA 3GOPA 4JIAA 1RDQE 3CE3A 4GK3A 4YSJA 4ACDA 3Q9ZA 3ENMA 4WUNA 4AOTA 5CASA 5HX8A 4O0RA 2I40A 3BGZA 3CS9A 4O96A 3FHRA 2J50A 5DA3A 4D2VA 2GQRA 1ZMUA 2FUMA 3EFWA 4G6NA 4ASEA 4DFBA 1XH4A 3WZDA 4I3ZA 3W2SA 4QT1A 4OAUC 3GFEA 5IQAA 3AD6A 4RFZA 2P55A 5EOBA 2XJ0A 4K9YA 3Q4CA 3UP2A 3JVSA 4AN2A 1A48A 2R3JA 3KQ7A 1WCCA 4P7EA 3LXPA 5FEQA 3LHJA 5AR4A 1VYWA 1KWPA 2XKDA 3R8MA 3NX8A 4U80A 4YSMA 4EONA 2QHMA 4JLCA 4JX7A 4ENXA 4F63A 3F88A 3Q4UA 3QD3A 3FUPA 4J8NA 2ITVA 3AGMA 5DPVA 2I6LA 1F5QA 3VUIA 1M52A 2XKEA 4NK9A 5EHOA 3T3UA 4BDFA 4L7FA 5IQIA 2RG6A 2VTLA 2I0YA 4BI0A 3ORMA 3R71A 5K4JA 2UW0A 4AU8A 4FTJA 3AT2A 5EDPA 5HNIX 5HO6A 4BDGA 4MHAA 4ZLOA 2W17A 3NIZA 4CEGA 5J1WA 3OVVA 4FC0A 2BKZA 3E3PA 4AZVA 3KU2A 4ARKA 3NZ0A 4RX8A 2W06A 2VV9A 4S31A 2PSQA 4M14A 4PL3A 1OIQA 4LMUA 4UZHA 4QQ5A 3TTJA 5AUYA 3KRWA 5EM8A 3U9NA 4QMWA 5T3QA 2GCDA 1PXMA 2R3OA 4F70A 2WXVA 5M56A 3IONA 4MQ1A 2CN5A 3NIEA 2W1ZA 4D58A 3NMUF 3W2QA 4YNOA 3CJFA 1P4OA 5DT4A 5AUXA 3R9NA 3TZ7A 4PMSA 5I9VA 2XYUA 4TYEA 3L9NA 1Q41A 3BQCA 4EKKA 3C4WA 2Z7LA 3VF8A 4C2WA 4EOSA 4G3EA 4RT7A 2P3GX 4XG4A 5AP4A 3BHTA 3RHKA 4YC8A 3A62A 1BL7A 2W9FB 3RZBA 1OPJA 1V0OA 2BTSA 2HW6A 3A7GA 3QRIA 5HD7A 3UNZA 4MH7A 4BCGA 3KN5A 3DJ6A 2P4IA 4RGJA 2FSTX 4BHNA 1KE6A 2OIQA 3BYOA 3IK3A 2JBOA 4IANA 4L8MA 2ITUA 4OTPA 3ACJA 3ALNA 4L45A 4IX4A 3ERKA 5HG5A 4AXAA 2WU7A 1BL6A 4E4LA 2BR1A 3G9LX 5HLPA 2VO0A 3KREA 3ZS5A 4HVHA 5LVMA 1TQPA 2O2UA 4QTEA 2H6DA 4XLVA 4KA3A 4NIFA 4V0GB 4I21A 3RWPA 4QMPA 3NS9A 1OVEA 1OL5A 2Z60A 4FKLA 2FVDA 3DAEA 5E91A 5A6OA 3DJ7A 3GC0A 2C5YA 5CAQA 1H01A 4L53A 3MH1A 3R9OA 4DLJA 4ZY5A 2DWBA 4JT3A 4YPDA 4FT9A 4FVRA 2CMWA 2ZMCA 5T68A 2E2BA 2BVAA 3FMKA 3PY0A 4GMYA 5IUHA 2YIQA 3BCEA 4FEQA 1JVPP 4N6ZA 1Q3WA 3F82A 5C03A 2UZLA 2JDTA 5K0XA 2QOIA 2QURA 5J9YA 1KE7A 2IVSA 4WBBB 4ACMA 4YUQA 4TW9A 3RCJA 2GPHA 2X4FA 3OTUA 4GT5A 1OPLA 1PXNA 2ZV8A 2ZAZA 1XO2B 3CQWA 3TTIA 4FKIA 5AP1A 3U8WA 2OICA 3N4TA 3FY2A 4DT9A 4B8LA 4G9RA 1XH8A 3L9MA 3POZA 2B7AA 5LOHA 5C1QB 4IB0A 2XRUA 4ZJJA 2F7XE 3C4XA 3EHAA 4LI5A 3WARA 5IUGA 3SA0A 4QD6A 3HV3A 4FV7A 4LRMA 3ODYX 5AUVA 2NPQA 3DKCA 4L3LA 4ANOA 5E9EA 1H00A 1CTPE 4NFNA 5CEQA 3ZSIA 4BN1A 5BVOA 2XK4A 1NA7A 1OITA 2O0UA 3EL7A 5JZNA 1OKYA 2UZBA 3W8QA 5K4IA 1GIHA 2ITTA 3CJGA 3TCPA 4AAAA 3NUSA 1GZKA 2XBJA 3KVXA 3PXZA 4YNEA 4C33A 5IDPA 2JKKA 4DGOA 3GCUA 4WSQA 2GS7A 3N4UA 3QQUA 3UVQA 3COMA 2BPMA 4ANSA 5B2LA 2XA4A 3ZO1A 3LKMA 3ZDIA 3ZO4A 4JXFA 1FVVA 2OIDA 4R3RA 4FKGA 5ACKA 5AP2A 4CFNA 3KXZA 4EZ3A 3GU8A 4G5PA 4QQTA 3PUPA 4EH7A 1CKPA 3VW6A 2VTMA 4EH4A 1FINA 4C57A 3UQGA 4Z16A 4AFJA 3IQ7A 4FKJA 3TZ8A 3OWKA 4FL1A 3GNIB 4MVFA 4RJ8A 3GUBA 4P5ZA 4YZBA 4F7NA 3UC3A 4U97A 3R00A 2F57A 3QTZA 3GI3A 4TXCA 3UDBA 3HRCA 4OT5A 3QC9A 5DR6A 4KB8A 3BGQA 4AW0A 4EHGA 4DEGA 3I60A 3PSCA 4HPTE 2W96B 1BX6A 4F7LA 5HD4A 5CU6A 4FGRA 5AAGA 3Q5ZA 4F08A 4O81A 1AGWA 3O8TA 4CCUA 3ZTXA 1KE8A 3A7IA 2O63A 1Q4LA 2VO6A 5C27A 4CSVA 4R1VA 3F6XA 3HV4A 5E1SA 3PXFA 4NSTA 3OCGA 3NYVA 5DGZA 3KFAA 3GP0A 3FZ1A 1PMEA 2YM5A 3L1SA 4Y73A 4TWCA 3QFVA 2V0DA 4EC8A 5AP3A 1PXIA 3OXIA 4WO5A 3ZDUA 2GS6A 5A4QA 4EK5A 3UQCA 4ZTMA 3HAMA 5D9HA 2UUEA 2ETRA 2VNWA 1TQMA 3R7YA 4U3ZA 4X21A 3HDNA 4JDKA 3RALA 3QXPA 5HE0A 3THBA 3GCPA 3FMLA 3VIDA 4EOKA 2WELA 3ZLYA 1R39A 2VTJA 5M57A 4KRCA 4J71A 1OL6A 3KEXA 5AWMA 3TIZA 1MQ4A 3D4QA 3F3UA 2HXLA 2XIYA 2OJJA 3FMHA 1L8TA 4U41A 3T9IA 2HAKA 4GT4A 3DLSA 4IWDA 2YFXA 5K9IA 2XCKA 4DHFA 2YCQA 4ZSLA 5LVNA 3EZRA 4ANBA 5IA2A 1GAGA 2W1FA 4GU6A 4IQ6A 2WB8A 3NW6A 3NW5A 3NAYA 5IQHA 5CXZA 4AN9A 5DFPA 2PU8A 3EOCA 3KRJA 4U9AA 3RGFA 1YKRA 2RFDA 4GG7A 4ZOGA 2VTTA 3WZUA 5D11A 1RW8A 3OHTA 3S2PA 4PDOA 4FSRA 4EOOA 1W84A 4AW2A 3G0FA 4HCTA 3HMPA 3OW3A 3UZTA 2UVZA 3L9LA 4K0YA 4C4JA 4TN6A 2C3KA 3RMFA 5ANEA 3W2RA 2X81A 1YDTE 4RJ3A 3IW8A 5CX9A 4LMNA 2IVUA 3OY1A 3KMUA 4QMXA 3H30A 4FEXA 4BWXA 5M4CA 3F69A 4N0SA 4ZLYA 4GKIA 3RPYA 5ANKA 2ZVAA 5TF9A 4DFLA 1JLUE 5ETAA 3A7HA 1SVHA 4QMVA 5IQDA 2WIPA 3LXLA 3LIJA 2C6TA 4F65A 4DEEA 2PYWA 3ZZEA 5AADA 5HG8A 4GRBA 2WO6A 4AUAA 1ZWSA 4G6OA 3SX9A 3GCVA 2XB7A 3CQEA 3I81A 3MIYA 4MXOA 1QPDA 5IKWA 4RX5A 5A4LA 3P1AA 2UZWE 1P5EA 1WVWA 4U0IA 5A54A 3E93A 1JKKA 4I5MA 3Q2JA 5AR7A 3CLYA 5EG3A 5IMXA 3I1AA 3O2MA 3QWKA 2HOGA 5LMBA 4J97A 2Y4PA 2Z7RA 3MA3A 5AV1A 1DS5A 5HEZA 3TNIA 4MD7E 3UZPA 3QTSA 4G34A 4DTAA 2KULA 3GC8A 1REJA 3ROYA 3UO5A 4CXAA 2XKCA 1BYGA 4FL3A 2A27A 3FLZA 4XS2A 3W2OA 4LOPA 3F3ZA 4LUEA 4ZTQA 5C8MA 4E73A 2Q0NA 2UW7A 4O2PA 3F2NA 4WHZA 3PXQA 3DY7A 3P23A 3TKIA 2X8EA 3IW7A 4IAKA 4NM5A 3B2WA 3A4OX 4E4XA 3SRVA 5HCZA 2WMRA 3UIMA 3FWQA 3I0QA 3ZXTA 4CTCA 3WYXA 4HCVA 1JSVA 1UNGA 2CNVA 3BYVA 5AUTA 4H05A 3UNKA 5HU3A 1J7LA 4A06A 2YN8A 3IGOA 2GNHA 5LQFA 3DKOA 4WOVA 2IZSA 3R2BA 3OBJA 3I5ZA 3NAXA 4I6HA 2GQGA 2QG7A 4O7ZA 3QX4A 2IZUA 4DA5A 3Q3BA 5CVFA 3QLGA 2PVKA 4JDHA 5KKRB 5AR2A 4J96A 4LGGA 4DH1A 5ANIA 3E8NA 3EQDA 1OKWA 2JKOA 4AZTA 1Y8YA 3HZTA 3VW8A 4NEUA 4NIFB 5A4EA 4E3CA 2E9OA 4EJNA 5J7HA 1Q8WA 2I1MA 2UZOA 4EOMA 4RPVA 3QD0A 2J90A 4WBOA 4Y83A 3VUHA 5DRDA 3FE3A 3FMNA 2R0UA 5LXMA 2SRCA 4U7ZA 2VTPA 2R9SA 2GHLA 3FAAA 4BZOA 1Q8ZA 4KKEA 4JQ8A 1FOTA 2J2IB 2R7IA 1XBCA 2WKMA 1QCFA 3G0EA 2R3IA 4EHZA 1YW2A 4AA5A 4FICA 3NVMB 4MKCA 2R3MA 4DG2E 4XYFA 1O6YA 1KE9A 3OTVA 4GV1A 3TDWA 3QQLA 4UYNA 4FT5A 3NUXA 2O65A 4M69A 4YP8A 1QL6A 2IVTA 4PTGA 2PPQA 2XEYA 1B39A 3OXTA 5M4IA 3POOA 4I93A 1ZYSA 4W4VA 4C3PA 5CAOA 5AA9A 4I92A 2F2UA 4MAOA 5JFWA 5EI8A 4FTTA 2W1GA 3E92A 4NW5A 3R1SA 4DG3E 3WF8A 5EHYA 3BEGA 2VWUA 2YM7A 5M08A 2C0OA 3SVVA 3EN9A 5HTBA 2XM8A 2R64A 3DB6A 1IA8A 2RGPA 4QP8A 4FKQA 3GOKA 3EL8A 3RKBA 2VGOA 3SXRA 4BCQA 4FTQA 3W2CA 3KXNA 4QMNA 3QD2B 4UWCA 4FIIA 2BILB 5BPYA 3H9OA 4WNOA 4FNYA 4ZZMA 4ZS0A 1LEZA 2YIWA 3EKNA 4M13A 3UOHA 4XG8A 4CZYB 2IN6A 3PJCA 2VTQA 2V22A 4UB7A 4CT2A 4EC9A 5HO7A 2PZYA 3UC4A 2WQEA 4BCPA 5CWZA 1E9HA 5FP6A 1OZ1A 1ZYCA 2NRYA 2PVMA 4JX3A 3E64A 4RC3A 5A4TA 2YCFA 5I0BA 2X1NA 5KKRC 3NUAA 3CKXA 2DS1A 2OF2A 3NRMA 3RVGA 2WMVA 4FTOA 4LL5A 5TKDA 4BY9E 1NXKA 3CCNA 4FNZA 4FV0A 5JT2A 2YITA 3TM0A 2CGVA 3DB8A 4A9YA 4R78A 3BYUA 4ENYA 3LJ1A 2J0MB 3SG9A 4XV3A 5L3AA 3AC3A 4YJPA 3KC3A 2XYNA 1DAWA 1FGIA 3MTFA 2Q0BA 4NW6A 4G9CA 4QMTA 2VRXA 4GUEA 4IFCA 5IPJA 3CIKA 4D0WA 5E8SA 2E9PA 3VNTA 3MFRA 2JC6A 2B55A 2X2LA 2XJ1A 3PPZA 4HOKA 4GK4A 4PMMA 3SHEA 4E1ZA 2E9VA 4YJNA 4BKYA 4EK6A 2CNQA 4RWIA 4AG8A 2YWPA 5KX8A 4FIFA 3VHKA 4CFXA 2HELA 3C0GA 1KOBA 3LFDA 2ZB1A 4FOBA 4MK0A 4EWQA 1PXPA 3A61A 5M53A 2YM4A 5EKOA 4UYAA 3ULIA 3MESA 1WBVA 4HGLA 3C13A 4JL9A 5ACBC 4CLJA 3GCQA 3BBWA 3VUGA 1YXTA 1FGKA 3FQSA 2WTWA 4G3DA 2C1AA 4WG5A 4ANNA 3S0OA 4FV2A 3Q53A 4O27B 4QO9A 1LEWA 1YVJA 3FMDA 4BZNA 4QPAA 4EHVA 4FT3A 2R5TA 4CFWA 2OF4A 4TRLA 4WD5A 3QQJA 3D5WA 3FMJA 5M44A 5AV0A 3Q32A 5FEDA 3VF9A 3MY1A 4AQCA 3QUPA 3VJNA 2PULA 2BAJA 4GIIA 5LCJA 4CZTA 5IH6A 2PMIA 4AZEA 4IIRA 2ZDTA 3FY0A 5JKGA 3EWHA 3MJ1A 3PSBA 3LMIA 3QQKA 4QNAA 2NRUA 4RC2A 3ORXA 3R63A 1U5QA 4AACA 3DZQA 3MY0A 5BX0A 4D55A 3PXYA 2OW3A 3H10A 4UMQA 4S2ZA 4Y46A 4F6WA 4A4OA 2YDKA 3FKLA 4FSZA 4DH8A 2CN8A 4EBVA 3C5IA 4FKWA 2RL5A 3DXPA 5DEWA 4NWMA 4YJQA 3R04A 3MPMA 4GU9A 4MQ2A 4RJ4A 3F2RA 3BPRA 4II5A 3MSSA 4CGAA 4GW8A 5B2KA 3E87A 3R7OA 2R3QA 3COHA 3U4WA 4BKZA 4R8QA 5F1ZA 3T9TA 4QMMA 5HX6A 4QTDA 5KMLA 2ZYBA 4JBVA 4IZAA 2OGVA 4FSMA 5M55A 3SG8A 4IX5A 3ORTA 2PWLA 4QPMA 5AP6A 5JN2A 2WQBA 3BLRA 3D2KA 5HNBA 5K5XA 4XG6A 2ZM4A 1Q97A 2H8HA 2VO3A 4FSQA 5K0KA 4EEVA 5C26A 5AP7A 4WUAA 2I0HA 4ZTSA 5IH4A 1Q99A 4ALUA 5GZ8A 5LVPA 3UPZA 3KL8A 3LFSA 2XJ2A 4FIGA 2XF0A 3GU5A 3KA0A 3UIUA 5ANJA 3OT3A 3KXMA 4LOQA 4YC3A 1URWA 3A7FA 5IEXA 5F94A 4GKHA 5BQ0A 4PDSA 3NYNA 2OG8A 3AD4A 4H3PA 5CI6A 5CU0A 3H0ZA 4CFMA 2RF9A 5F95A 1JOWB 3M2WA 3DAJA 3ORKA 4K33A 3LFCA 3TWJA 2YAAA 2YM6A 3EQIA 3LXKA 1UU9A 3R8UA 1JQHA 1R1WA 3LQ5A 4QYFA 2W1EA 4N6YA 4QYGA 5IZFA 2GTMA 4JQ7A 2V62A 4CD0A 4L6QA 3NNVA 3SRVB 4EH8A 4OTIA 3OD6X 4J52A 5A9UA 4HVSA 1FMOE 3CQUA 3TV6A 3L8PA 3TJDA 3D2IA 3BX5A 3R7EA 1H28A 1DM2A 4ASDA 1FMKA 1PW2A 4R77A 3DBEA 3MGYA 2GU8A 2J5EA 3LMGA 2C5NA 2XH5A 3G5DA 4BKJA 4PQNA 3Q9YA 5BYYA 4I94A 1KE5A 3FI8A 3NUPA 3F3WA 3ZSGA 2BZJA 1H24A 3VS7A 3KCFA 2PVNA 3P78A 1J3HA 4RFYA 4XHKB 2W1HA 3IW5A 5CF8A 3HGKA 4L3JA 2C6OA 3CP9A 3O0GA 3VRYA 5IG1A 2WTDA 3ZRLA 5F20A 4BCNA 4PL4A 3I5NA 5KUPA 4UXQA 4ZS4A 2J7TA 4ZXTA 4HW7A 5KCVA 2WMBA 1J7IA 4B7TA 4R7BA 5EYMA 4FZ6A 3AMAA 4CNHA 5HIDA 4RIXA 4LOOA 5A14A 3N9XA 4IWPA 4QTCA 4Y5HA 2UZNA 4JBOA 3DKFA 4FA2A 2E9NA 4W4XA 4YMJA 4RIYA 4NTTA 3E7VA 3FSKA 3IW6A 4MNFA 3WF7A 2GNFA 4O0VA 1ZAOA 4IVCA 4M69B 2WMAA 5GINE 4AZFA 4EQUA 4IVDA 4MBLA 2QOLA 4BIDA 3EZVA 2B9FA 3PRFA 2C30A 2YJSA 4WSYA 4D2TA 3FL5A 4EZ7A 2ZV2A 3ZLSA 1AQ1A 3ANQA 2UW4A 3JY0A 3HV7A 5DOSA 1AD5A 4F6SA 4ZTNA 5I9UA 1SVGA 5JFXA 4BCHA 3BV2A 2V5QA 4O21A 5I9ZA 4F99A 4MD9E 5J5SA 4F4PA 5HBEA 4NL0A 2FSLX 1UU7A 1BI8A 2QCSA 1YQJA 1PYXA 3ORNA 4RRVA 1TVOA 5DI1A 3O96A 5AV3A 3PA3A 3OG7A 4H58A 3IS5A 1APME 2QQ7A 4BBFA 3D5UA 4BTJA 3PRIA 4CKJA 3FI4A 4I1ZA 4Y8DA 2YJRA 2YLFA 3F5XA 2C6LA 2C69A 2C0TA 5IQEA 4MTAA 2YISA 2RG5A 1OGUA 5EDQA 3R83A 4HNFA 4JIKA 4QP6A 2WHBA 4C62A 3KRXA 1GIIA 2Y9QA 3NCGA 2OWBA 3O8PA 3UODA 5GNKA 4BGQA 2PE2A 1XBAA 3SOAA 4DF3A 4G31A 4CQEA 4I24A 4JJRA 3TKUA 4ACGA 5AIRA 3VBWA 2B0QA 3PG1A 3FC1X 3RPSA 2W1IA 4XX9A 2OK1A 3DOGA 3EQPA 4TYIA 3V6SA 4A9TA 2X7FA 4CYJA 4DFZE 3PE1A 5I9XA 4I4EA 3EJ1A 2CLQA 3P08A 3ORZA 4YTHA 3V04A 4EOLA 5AUUA 4BF2A 4WRGA 4BIBA 2R7BA 3ATSA 4IC7A 2HWOA 1UU3A 4CMOA 5AV4A 3DT1A 5HE3A 3A99A 4D2PA 1UVRA 4GH2A 5JGAA 2H9VA 2X9FA 4XG7A 3M42A 3D9VA 2Y6MA 4IW0A 2UZEA 3PZHA 1SYKA 4O22A 3UVRA 4JI9A 5L6OA 4FK3A 5IMEA 4DEDA 2GFSA 2XK9A 2NO3A 3QCSA 4ID7A 5BYLA 2PZIA 2Z8CA 3DA6A 3I6UA 4OBOA 3FYJX 4BTFA 3MW1A 4Z55A 4OR5A 3NDMA 5JRSA 5HVJA 2GFCA 2EUFB 2WTVA 2F9GA 1OL2A 3GBZA 1GZOA 3B8RA 3P79A 2QKWB 4EH3A 1J1CA 2QLQA 4XV2A 4C59A 5BVNA 4U6RA 4JDIA 5HIEA 5BVEA 2QOOA 4UEUA 2OFVA 5C01A 4F9WA 3Q52A 5EYCA 5CNOA 5DBXA 1Y91A 4YC6A 3LLAA 4CV9A 1FPUA 4FEVA 4HGEA 5JMSA 4JRVA 4DYMA 5KMJA 2X2KA 2IZTA 4O91A 4X3FA 4FKRA 3UOJA 2QR7A 4AW1A 3F3VA 4IMYA 2QC6A 3MS9A 3OCTA 4ASZA 4BTMA 1WVYA 4MXXA 3BV3A 5EDRA 4F64A 4MYGA 2B1PA 3NCZA 2C68A 3KB7A 4IWQA 1IRKA 1WBOA 2CPKE 3MH2A 3SD0A 2OJ9A 3PVUA 5IISA 4I6BA 4OUCA 3IOPA 3PPKA 5HCXA 3FKNA 5IQBA 1I09A 1PMNA 2GNGA 3QAME 3TNWA 4DH3A 3BHVA 2YCRA 2IPXA 3QYZA 2XIKA 4PF4A 4EH2A 3G15A 4L42A 3EYGA 4F0IA 1G8AA 3CY3A 4FUXA 4FKUA 3VS2A 3UBDA
chains in the Genus database with same CATH superfamily
5HTIA 4O7WA 1JNKA 4YO6A 3AQVA 3O71A 4AZSA 4YR8A 4FKTA 3LM5A 4USDA 5CT0A 4I22A 3FPMA 4KWPA 2R3NA 3NGAA 4EK4A 2YIXA 5JFSA 4XBUA 4NUSA 1V0BA 3HEGA 3Q60A 2XALA 4IVBA 3QCYA 1XJDA 4RVTA 3QTRA 1DI9A 5GZAA 1CMKE 2IO6A 2W5HA 4KS7A 5IF1A 3AGLA 4BDEA 5TE0A 1K9AA 2VWWA 4DTKA 5CALA 4W4YA 5IUIA 4R6VA 4FTRA 4BCKA 4EBWA 1MQBA 3F61A 2W1CA 3S95A 3OS3A 3LFBA 5AMNA 4RWJA 3D7TA 2OJFE 1WBPA 3JS2A 4GVJA 4E5AX 4PNIA 3ZLWA 2C3IB 3FXWA 5LCKA 4O7SA 3ACKA 5BNJA 4I5PA 3E5AA 4FIEA 4O2ZA 1NVRA 4MBJA 4USEA 1PXLA 4I6QA 3II5A 5HCYA 2R4BA 4C35A 4L7SA 4QYEA 2ITWA 3MI9A 1V1KA 3V3VA 3LM0A 3FPQA 4DH7A 3CSVA 3RK7A 1K2PA 1O9UA 1XH6A 3QQHA 4HCUA 4NT4A 1OECA 4I20A 5DEYA 4ZSJA 4KUJA 5EQEA 2VTNA 3HNGA 3NSZA 4TPTA 5AAEA 4GYGA 3BE9A 4J7BA 2QI8A 3BQRA 5GZ9A 4L43A 4DC2A 2JBPA 4DAWA 1CKJA 3E8DA 2JGZA 4HYIA 4IM0A 1GJOA 1H0WA 4Y95A 3RNYA 4V01A 3SAYA 1VZOA 2IW6A 5CSWA 2F7ZE 2VX0A 3TJCA 4BJJB 4HJOA 4ERWA 2C4GA 3CXWA 2RFEA 1K3AA 4ZSAA 5JFVA 1MRYA 4FYOA 4IX3A 3W8LA 5HLNA 2QOKA 3QRKA 4CVAA 4TWNA 5EM5A 5KHWA 3NFFB 4MCVA 2BKKA 3RK5A 1X8BA 2X0GA 4X3JA 3NYOA 4Z7HA 3MH3A 4YZDA 2KTYA 5AR5A 4FV9A 4RIWA 3CD8A 4NYEA 2YM3A 3KF4A 4RIXB 2JIVA 5A6NA 2ACXA 4FR4A 1XQZA 2BMCA 5J9LA 3Q6WA 2A19B 4OTFA 1VR2A 1W83A 3H9RA 1SM2A 1YDRE 5CU2A 3UJGA 3DBQA 3R1QA 3FZSA 4RIYB 3QZIA 2V55A 4M12A 4XH6A 4FEWA 4IHPA 2BRBA 4H3QA 1U46A 3BEAA 3MYGA 4K8AA 4U81A 5FD2A 4IZYA 4UWYA 2G15A 3IECA 2V7OA 3R7GA 4PMTA 4Q5EA 4EI4A 1W7HA 5BUIA 1WBWA 5TOZA 3FBVA 4C2VA 4HYSA 2GNIA 5B7VA 1UNHA 2BRMA 2ETMA 3TACA 5DHJA 3UTOA 4X2FA 2IG7A 2JDRA 3ORLA 4FZFB 3R8LA 4Z7GA 3GQLA 4NTSA 4MXCA 4B4LA 2W7XA 4G2FA 3PLAE 1UU8A 3NW7A 2C3JA 3WYYA 4FRFA 3IDCA 3UYSA 3F5UA 3W55A 2J5FA 4AT3A 3Q5IA 3LCKA 1SZMA 4ACCA 4OAVB 4B99A 4D2RA 2PVLA 4TWPA 1IAHA 2W4KA 3HA6A 4W8DA 4A7CA 4ZTHA 1I44A 3WF5A 4EUTA 3L8XA 4TNBA 4YHJA 4L44A 3CGFA 3H9FA 4FF8A 3U6HA 2CNUA 4W9WA 4YTFA 1WBTA 3BHUA 3R1YA 4QMZA 2CCHA 3E63A 2IW8A 3CKWA 3QRTA 3ZO3A 5AA8A 2ITNA 2ZM3A 3H3CA 4D1SA 4EH6A 3O51A 4RC4A 3P7CA 3UO6A 3VS1A 4L3PA 2ZM1A 4YTIA 3IO7A 3D0EA 3ZFMA 4EUUA 1T46A 1S9IA 2A4LA 2BDFA 2PZ5A 2XNNA 3V8SA 4G5JA 4DFUA 3EMGA 1PY5A 4S33A 4RVLA 4GYIA 3V5JA 5DYJA 3JY9A 5KMOA 4EQMA 3R21A 4PL5A 3WZJA 4ZMFA 3VBVA 2VWXA 3KK8A 4RJ5A 5LVLA 1BLXA 3ZEWA 3WOWA 5CAVA 3TT0A 1BUHA 3Q2MA 2X8IA 3IPHA 2NP8A 5EOLA 1H08A 3R9HA 3FXZA 4EYJA 1J7UA 3W10A 5ETCA 3V5QA 4RZVA 3CTQA 3S3IA 3PFYA 5LMKA 4O7RA 1G8SA 3A4PA 4BDBA 3ZRKA 4F1TA 1FBNA 3C0HA 2X39A 1CSNA 1ZRZA 4FV6A 3CBLA 3DBDA 3V5WA 2C6DA 2XIZA 3KGAA 1PF8A 5LARA 3AC8A 4AA0A 4AT5A 2DUVA 4TT7A 1HCKA 2V7AA 4C02A 2X0PA 3LZBA 3FKOA 2BRNA 3BBTB 3FJQE 2QHNA 2EU9A 1Q8YA 3PZEA 4BDHA 2ITXA 5CU3A 2IEWA 2C6EA 4F78A 5ETIA 5DMZA 4JDJA 5JZJA 2JDOA 3QUDA 4PUZA 2VX1A 4XRJA 5GHVA 4KBAA 4BDCA 5CTPA 3D14A 3AC5A 3DPKA 3DU8A 3F5GA 5JRQA 2W1DA 3COKA 3AKLA 1IAJA 4JNWA 3LJ2A 4R5SA 4P2KA 4TKSA 5IA5A 3U51A 4YBJA 4AXCA 4IAZA 2UW3A 2QR8A 1P14A 4XG3A 5H2UA 1KOAA 2R2PA 3P86A 4QMUA 2ZMDA 4RJ6A 2EB2A 3NUYA 5E1EA 5JGBA 4CG9A 3VQUA 1P2AA 4D4YA 4I0RA 4O0WA 1IASA 3QA0A 4X3FB 1M2QA 3R9RA 3I6WA 4AFEA 2VTSA 5BMSA 1Z5MA 4PNKA 3OP5A 4LYNA 3ID6C 4YZMA 1URCA 1F3MC 2BFXA 3QGWA 4WT6A 4UX9A 3OF0A 5CSVA 2H34A 2W4JA 5D41A 3UOLA 4AOIA 3SW7A 4CMTA 3O7LB 4O0TA 4RFMA 1H4LA 2FSMX 5EYKA 3HUCA 1TZDA 4ZEGA 4I5CA 4JG7A 3MJ2A 2C5VA 4C3FA 5JGDA 5HORA 2PUUA 3MTLA 3NNXA 3WILA 4BRXA 3AKJA 4RWKA 5HTCA 1M14A 4UALA 4D4VA 3PWDA 1HCLA 2BZHB 3DZOA 3PWYA 1WFCA 1OUYA 3QKLA 3RP9A 4X6QC 2JIIA 2YIRA 4EL9A 4B0GA 3GT8A 4AP7A 3I0OA 4FOCA 4U42A 3EQRA 4FTCA 4BR3A 1RJBA 4YO4A 3QZGA 3OWJA 3ZUUA 3OEZA 3TUDA 5ITAA 3BHYA 5IEYA 4IB3A 4ALVA 3CGOA 2F7EE 1OL7A 2PVYA 3JYAA 3BHHA 1YI4A 3G33A 3KCKA 1QMZA 1PMUA 1V0PA 3PUFC 3ZLXA 3RPRA 4AAYA 1UV5A 2DQ7X 1WMKA 3DV3A 5D1JA 5EW9A 4ZK5A 4BDDA 3OOMA 4W9XA 3FI3A 2O8YA 3QC4A 5H8EA 2QNJA 2FO0A 2XCHA 4M0YA 4EQCA 4EWHA 1JWHA 4CLIA 4TZRA 5IH5A 5HU9A 3PJ8A 2YM8A 4J53A 4C8BA 3UMWA 1ZZ2A 3D7TB 4GCJA 3NYXA 4JQEA 3PVBA 3R8PA 3K5VA 1ND4A 4DINA 3D83A 4WA9A 4E7WA 2XK8A 1JSTA 4ORKA 2EVAA 4FZ7A 3FZOA 3PLSA 3KULA 3W0MA 3V8TA 5E90A 2OZAA 3FXXA 5TO8A 2XNOA 3GU7A 3ORIA 4H39A 2Y8OA 4BCJA 2UVYA 3MDYA 1UNLA 3RNIA 2AUHA 2YERA 5E8VA 2VO7A 3NPCA 4CV8A 4D28A 5C4KA 5CI7A 4X3FC 4IEBA 3RWQA 3KMWA 4OTDA 3TEIA 3E3BX 4MWIA 3DTWA 1TKIA 3V8WA 2YACA 2VU3A 5FM2A 3VS3A 2UW5A 2VN9A 2PY3A 4MF1A 3VBTA 3QRJA 3SLSA 3HMMA 2XRWA 4NZWB 1R3CA 5HZNA 1SVEA 4C58A 1U54A 2F4JA 3FMMA 1FVRA 3MA6A 1M2PA 3NNUA 2P2HA 4DCEA 4YLLA 2W5BA 3H4JA 4DGMA 4YU2A 1UKHA 2XMYA 4QMOA 3CTHA 3V5PA 5EI6A 3ZHPC 1CM8A 4C34A 4RIWB 4G1WA 3EQFA 4WIHA 2W0JA 4IJ9A 2H96A 1PXOA 4FTMA 3QTUA 2QO2A 3BU6A 1Y8GA 3UDSA 4QP7A 2PUIA 4A4XA 2PUNA 5HE2A 3QHRA 4RZWA 3E7OA 4BBMA 4BDJA 5CEIA 5K3YA 5CSXA 4EK3A 1OIRA 1Y6BA 3VBYA 3HAVA 3S00A 2F2CB 2RFSA 3LAUA 2J0IA 2QLUA 3M11A 4PPCA 4D2WA 3R8ZA 1YOLA 5DNRA 2WMUA 2Z7QA 3TNQB 3TG1A 1Y6AA 3R28A 4CKIA 1XKKA 5FEEA 5AUWA 2JAMA 4R7HA 2YHVA 4UZDA 4QTBA 4BI1A 4X2GA 5IU2A 4L46A 3PPJA 1QPCA 4XLIA 5HIBA 3TKHA 5FTQA 4O83A 2UZVA 1OUKA 4LQMA 2VAGA 1XR1A 1KV2A 2QODA 4FVQA 4ACHA 1ZOEA 2WEIA 3OCSA 4YBKA 3VJOA 2Q83A 2IW9A 4O7YA 4KABA 3D5XA 3R7IA 2B9IA 3PTGA 5DG5A 3FMEA 1Q3DA 5HHWA 4D9TA 5E92A 5AP0A 4O6LA 2YZLA 5KZIA 4EKLA 4YLJA 5L4QA 1LR4A 4S30A 3MN3A 5M4FA 5E8XA 2YABA 3AT3A 1W2FA 3IDPA 4ZJIA 4LV8A 2UZDA 4K11A 4NFMA 4M15A 4OTRA 2WAJA 4GK2A 1PKGA 4I6LA 4K2RA 4M7IA 2R0IA 3UDTA 5M07A 1EH4A 4DH5A 4OTHA 4FV1A 1H8FA 4M3QA 4M8TA 2QOQA 4PDPA 2JDSA 4APCA 3H0YA 2JLDA 3EFKA 3UG1A 4NKAA 1Z9XA 3MY5A 2QU5A 1JSUA 2YIYA 1R0EA 3PP0A 1B6CB 4L68A 4FEUA 2WZJA 5CLPA 3DQWA 3QYWA 2GS2A 3PVGA 5FTGA 3LXNA 4RLKA 3B2TA 2IWIA 4FBXA 5CF6A 2X0QA 5BVFA 4XCUA 5EYDA 3BE2A 4FG7A 5KE0A 4FI1A 1DAYA 1XHAA 2WMSA 4NM3A 4N4SA 3E62A 3P7AA 2QO7A 5HOAA 5AEPA 4UXLA 4CKRA 4O0SA 3RAHA 4JAJA 1JKSA 3UIBA 4BBEA 1GZ8A 2J4ZA 2A0CX 2XNEA 4CTBA 3K54A 5A46A 1NW1A 4PPAA 4DLIA 4N57A 4R5YA 3U54A 4Q5HA 2WD1A 3VVHA 4JR7A 2YAKA 4NJDA 4KBKA 4P90A 4D4SA 5K5NA 3SKCA 4E26A 3C9WA 3UYTA 2XANA 4XBRA 5DWRA 5EKNA 5JK3A 2JKMA 4UMPA 1Q8UA 4PX6A 3FZPA 3CR0A 2Y6OA 4R3CA 5D7AA 4EK8A 1VJYA 1YHSA 4IM3A 3HV5A 4E6QA 3IGGA 2PMLX 4HPUE 2HCKA 2GQSA 4UBAA 2JITA 3F7WA 4V04A 2A2AA 5AM7A 4YHFA 2GHGA 4UY9A 3GVUA 3ZBFA 5M51A 4UWBA 2JFMA 2XK3A 3D7ZA 4HYHA 4QMQA 1LP4A 2OXXA 5HBHA 2HXQA 2WQMA 4L67A 4X6RA 4FV8A 3V01A 3LFEA 3R8VA 3PDTA 1JBPE 2EWAA 3F3TA 3DKGA 3ITZA 2PHKA 4KKHA 3WI6A 2VNYA 1U5RA 1W2DA 4KAOA 4NCTA 3ZYAA 4CFFA 5E7RA 4NH1A 5IA1A 1M7NA 3QLFA 4BYIA 3ETAA 2BAQA 2G2FA 3FLWA 3BYMA 1FVTA 3WF6A 4BTKA 1U4DA 4CMUA 1PRYA 5BYZA 5DT3A 3PSDA 3CC6A 2HW7A 2XNPA 2WEVA 1PXJA 4RQKA 3W33A 3S1HA 4OBPA 2I0EA 2GTNA 3G6HA 3UMXA 4AZWA 5L6PA 1PXKA 2G9XA 4IACA 5FWKK 3PG3A 3P5KA 5DN3A 5EQYA 3S4QA 3LFFA 3MFUA 1ATPE 1YXSA 4FUYA 5AR8A 3TL8A 4ANMA 3UZRA 4YJUA 2P33A 4IADA 3HL7A 3SQQA 1OIYA 1M17A 4RMZA 4FTAA 3ZU7A 2GDOA 2VTAA 3T3VA 4JR3A 4L9IA 4F09A 4PTEA 1P4FA 4C4GA 3VUMA 1G8KA 2J0KA 1SNXA 3JUHA 2HZ0A 3ZONA 3W2PA 2XARA 4D1XA 4O7VA 1BI7A 5ICPA 4JG8A 4YZCA 4C4EA 5LMKC 4RIOA 4FZAB 4O1PA 3U87A 3I79A 5CZIA 4AGCA 3G9NA 2WTIA 1OL1A 5CQWA 3QCXA 5JSMA 1ZMVA 1H1SA 4GIHA 3BELA 4LGHA 3RAWA 3VUKA 4MEDA 3GCSA 2ESMA 2XK6A 2AC5A 3EH9A 3DFCB 4U40A 5FTOA 3C7QA 3FQHA 4ONAA 4AA4A 4U45A 1YHVA 3ALOA 2VTIA 4KRDA 3HYHA 1H25A 3NWWA 3MVJA 4A4LA 3V6RA 3SGCA 2ITPA 2WOTA 4DCAA 2XS0A 4J8MA 2OXDA 2XNMA 5AAFA 5T6KA 3ROCA 4DEAA 2FSOX 4B6LA 3QRUA 5L2IA 3ZZWA 2CLXA 4EJ7A 2R3GA 2J0JA 2XIXA 3K3IA 4S34A 2PE0A 4UMUA 3O17A 5FRIA 3F66A 5J79A 5M09A 3B8QA 3KULB 3MVHA 4KBCA 3HRBA 2OLCA 4X2JA 3LPBA 2HY0A 2EXEA 2OZAB 4DGNA 3ZC5A 2YWVA 3QD4A 1M7QA 1ZXEA 3SC1A 3UPXA 4QP9A 4PV0A 4ASXA 3DK6A 1MP8A 2QOHA 1RQQA 2JEDA 5LJJA 2HYYA 4RSSA 2WOUA 5J95A 4C61A 5CEMA 2WQNA 5FGKA 2WMWA 1G8JA 3OUNB 2OO8X 3P7BA 3PJ2A 2FYSA 2Y7JA 4BWKA 1PMVA 4AS0A 3FC2A 5AR3A 1U54B 2BZKB 5CEKA 5M4UA 2ITZA 2OJGA 3A8XA 1YOMA 3RBWA 4ZSGA 4BHZA 4I0SA 5L8KA 1WZYA 2B53A 4ZTRA 4YPSA 5E4HA 3QALE 4QMSA 4TTHB 4UMTA 1H1RA 5I3OA 3UE4A 4O6EA 3RTPA 5CVHA 4YLKA 4E4NA 5J1VA 3U4UA 3A7JA 4PRJA 3PY1A 4FIJA 3BI6A 3KK9A 3DCVA 1PJKA 4EH9A 2GNJA 5IQFA 5EW3A 4G3FA 1OI9A 2ERZE 4JVGA 3I7CA 4XNEA 4CFVA 2P2IA 3ZBXA 4HVDA 4FV3A 5E8ZA 5A4CA 2P0CA 2REIA 3SV0A 1MRUA 4XP2A 3FDNA 5BVKA 4TYHA 2PL0A 2PZRA 4LRKA 3IKAA 4MX9A 3I7BA 4V05A 5FQDC 5LWNA 4X2NA 4MF0A 2ZV7A 2PE1A 4BCIA 3KF7A 2Z2WA 2BCJA 4BB4A 4FV5A 5GJFA 4ITJA 2XNBA 4EH5A 3BU3A 3EQHA 4QOXA 4XRLA 1ZZLA 3KXGA 4M66A 3F2AA 1QPEA 5HG7A 3ULZA 4MXYA 5D10A 4MNEA 5HVYA 3UNJA 2HENA 4Y5QA 5C8NA 3OWLA 3R1NA 1OGYA 3UIXA 3ZSHA 4G3GA 3V5TA 1YWRA 1Q8TA 3NUNA 3FL4A 4O7LA 4FTUA 3DDPA 1WAKA 4EORA 1SNUA 4A9SA 2C0IA 2O3PA 4Q9ZA 5KHXA 3FLQA 5G6VA 3TIYA 3EN7A 2YZAA 2OI4X 4LG4A 4LDTA 1OBGA 3LW0A 3CEKA 4K6ZA 3P5JC 5J9ZA 2WQOA 2B9HA 2WMXA 4U44A 3RM6A 3OEFX 4IX6A 4QNYA 3PA4A 5H8BA 2GMXA 2C3LA 1MRVA 4BIEA 3LCDA 2BDWA 1R0PA 1STCE 3D15A 2J9MA 3C4ZA 3OY3A 2IJMA 5KO1A 3ZM9A 2O5KA 5J87A 3LQ3A 3LVPA 3HMOA 4BCOA 2BFYA 2YLEA 3ZCLA 1ST4A 5JQ5A 3ZFYA 5CNNA 1YI3A 3BZ3A 1W98A 2XM9A 2QU6A 4FV4A 2BIKB 3R30A 4I4FA 4D4RA 4O84A 3UOKA 3DGKA 2QD9A 2R3KA 2FA2A 3VAPA 5IQGA 3MBLA 3SDJA 4FNWA 3LOKA 4XV9A 5FP5A 1ZARA 4CYIA 5DIAA 5TT7A 4DT8A 2B9JA 4FIHA 2R3RA 4MD8E 4RA4A 1NT2A 2FB8A 2VWIA 5AX3A 4I41A 4QP3A 5KBQA 3OROA 4FYNA 5CS6A 4AWIA 2E9UA 3DNDA 4BICA 1OB3A 3LJ0A 2GHMA 4OBQA 4Q9SA 3WBLA 4EOIA 3FSFA 3O50A 2BALA 3OFMA 4C4HA 2BUJA 2IVVA 4BZDA 3AC1A 2UVXA 3MIAA 1XH7A 3OXZA 5HLWA 3NVKI 3HV6A 3N51A 4EOJA 2X9EA 3UG2A 3SW4A 3PXKA 2HIWA 5FLFA 5ANDA 4RG0A 4D5HA 4ZIMA 4DITA 4KIPA 1R78A 3DXQA 3U9CA 3VN9A 4QQJA 4ERKA 3LMHA 2PMOX 3GU6A 2PK9A 4BVUA 4ZZNA 2ZOQA 4ZJVA 3DQXA 4R3PA 2VTOA 2IZRA 3BIZA 2VX3A 3G51A 3PA5A 4BDIA 4U3YA 3D5VA 2G01A 2X7OA 4FSWA 4DDIA 5FG8A 3P4KA 4IDTA 5CZHA 2PUPA 3W0SA 2JKQA 1W8CA 3WE8A 1XMLA 3R7VA 5FXQA 4BI2A 2CHLA 4O86A 4F0GA 4M97A 2R3FA 3OMVA 3FQEA 3OWPA 2UW8A 4IXPA 3REPA 5HBJA 1WBNA 3VS0A 1H1QA 3MFTA 4YJVA 1H0VA 2WU6A 4OGRA 2ETKA 2RKUA 2I0VA 2XIRA 2G2IA 4GS6A 4O1OA 1LUFA 4FNXA 2CKEA 4BCFA 4FKOA 2YEXA 4RBLA 3VS4A 5AP5A 4FE2A 5KMNA 5G1XA 4F9BA 2W05A 1OIUA 3EYHA 3JPVA 4G3CA 3QX2A 3C4CA 2CKQA 3OUKA 4FG8A 4OLIA 4ZAUA 3TZ9A 4C4IA 3LCSA 3VBXA 3QA8A 2GSFA 4KKGA 2ITYA 4KSPA 5LMAA 5HNGA 4XEYA 4IWOA 3BWFA 1DI8A 2FGIA 2OIBA 3GGFA 4E6CA 2W4OA 3HECA 4DN5A 3DNEA 4DGLC 4UMRA 3K5UA 5H8GA 5TR6A 3HKOA 1J91A 3WIKA 2I7QA 3GC7A 3A2CA 4FODA 5C9CA 5HESA 4D1ZA 2EB3A 4DTBA 4HZSA 3FLYA 4FK6A 4UV0A 4XV1A 2HK5A 5H3QA 1WBSA 1GIJA 2J0LA 4J99A 4PPBA 4IB1A 4O7NA 2BAKA 3DJ5A 4YJOA 4YHTA 2CSNA 1XBBA 5IDNA 4Z9LA 4QP2A 3TMOA 4YZNA 4WG4A 1XH9A 1QPJA 2RSVA 4O82A 3EQCA 5BUEA 4PDYA 5FBOA 2G1TA 2AC3A 4IAAA 1Q62A 2ZV9A 4LM5A 5E8UA 2UZTA 1OKVA 1W0XC 3E88A 4FSNA 4QYYA 4AE6A 3R2YA 4B9DA 5EW8A 4CFUA 4PY1A 2OH0E 4FSUA 4DFXE 3ZUTA 5I3RA 1XWSA 4Z3VA 4YZ9A 4ZLZA 2C6KA 4FG9A 4KIKA 4PMPA 4Q2AA 4OTWA 4E6AA 2OFUA 4P4CA 2PVRA 3WZKA 3CD3A 2NYAA 4G16A 2QO9A 5KNJA 3ZUVA 5L6WL 1YXVA 2YDJA 2PTKA 4L01A 4NCTC 4MXAA 3R7UA 4F9AA 2XUUA 2C6MA 2XZSA 2LGCA 4TWOA 3U6JA 3ZOSA 3VC4A 2W9ZB 5H9BA 4MBIA 3MVMA 4KD1A 4AGWA 3LFNA 3LQ8A 2XAOA 3QUEA 3NR9A 2VWYA 3AC4A 5EH0A 3GENA 3O23A 4RLLA 4YTCA 2UW6A 2XNGA 2C6IA 1ZYDA 4U79A 5CSPA 4E93A 3HP5A 4IFGA 1KUTA 5CANA 2HZ4A 2XKFA 2PVFA 1YWVA 3QF9A 1CDKA 5CF5A 4UN0C 3LE6A 3C5UA 3VS5A 2VUWA 1U59A 2PVJA 3F7ZA 4U43A 2LAVA 4M0ZA 3VBQA 2BROA 3PIXA 3UGCA 2HZNA 4KINA 3TUCA 2CDZA 3QWJA 3O7LD 5BVDA 2OKRA 4HGSA 4AOJA 1ZLTA 4K18A 4D9UA 4DHIB 1M2RA 3W18A 5GIOE 3DAKA 5CEPA 2CKPA 2ZB0A 3QTXA 3QZFA 4X7QA 4X0MA 3BGPA 3L8SA 3RM7A 3VHEA 3ZMMA 3ZRMA 3SXFA 4CT1A 4IBMA 4TYHB 5CVGA 3LCOA 4R1YA 5ANOA 2HWPA 4ANLA 4FTNA 4QTAA 5KMKA 4RA5A 1ZMWA 2ONLA 3G6GA 3TV7A 3KRLA 2ZDUA 3HA8A 3MV5A 3EIDA 1BKXA 4N70A 3VUTA 4E8AA 1OMWA 4WNKA 5AFVA 1GZNA 3DLZA 4QPSA 3BWJA 4M84A 4NKSA 3RK9A 4EOPA 1B38A 4QP1A 1O6KA 3AC2A 1SMHA 4JRNA 4C38A 1Y57A 3U55A 3AD5A 4MNEB 4KSQA 4YJRA 5CAPA 4QDVA 3QHWA 4E4MA 5BMMA 2QVSE 2WGJA 3PYYA 4JBQA 3MB7A 4IZ7A 4HGTA 3IOKA 4WRSA 1PYEA 1JKTA 3P0MA 1L3RE 4YJTA 2BHEA 5EM6A 3TDVA 1H26A 3AXWA 2X8DA 4FSTA 4ZY6A 3GXLA 3W32A 4KNBA 4WG3A 3HVCA 3SXSA 3C51A 3LCTA 3VUDA 3I4BA 2CKOA 3QBNA 3UQFA 1Q5KA 4ZMEA 2WNTA 3AG9A 3BLQA 3QQFA 2YA9A 1YDSE 3MH0A 4O38A 5FXSA 5JEBA 2WFYA 4GG5A 5FBNC 3C1XA 3DFAA 5DE2A 4E6DA 3A8WA 4BGGA 4BWPA 2HZIA 2BTRA 4IZ5A 4BL1A 3W16A 4IC8A 4C37A 4BDAA 4RVMA 3JR1A 3DBCA 1H07A 4IB5A 5HKMA 2WTKB 5DH3A 3U6IA 3VO3A 3KVWA 2ITQA 4DBNA 2JIUA 1KV1A 3F9NA 4LV7A 4EHEA 4O7TA 3GQIA 1VYZA 3K2LA 4GVAA 3ZEPA 3OW4A 2Z02A 1OKZA 4NM0A 5AV2A 3HMIA 4L52A 4IJPA 4PTCA 2C47A 2XK7A 3RAKA 5FDXA 3SOCA 2PMNX 5I9WA 2OJIA 2BRGA 5CU4A 1A06A 2A1AB 5AIKA 4CZUA 4DE4A 3FYKX 3R6XA 2R3PA 4QP4A 4XUFA 5DLSA 4A9RA 3HDMA 2YCSA 5AM6A 5AUZA 1RE8A 3QKKA 4USFA 3PVWA 3Q4ZA 4FTIA 2VTRA 3EQBA 3V5LA 3ORPA 1GNGA 4FTKA 2QKRA 1E1XA 3TNHA 4K1BA 3TNPC 4A07A 3RPVA 3UVPA 4TYJA 3JXWA 5AJQA 4BFMA 2ERKA 3L9PA 1H1PA 2XP2A 4GFOA 4DGGA 4AX8A 3E8CA 4F0FA 3HX4A 1ZOHA 1ZY4A 2Y4IB 1UWHA 4IAIA 3R9DA 4FKPA 1YWNA 3F5PA 3KN6A 5FM3A 3RCDA 4J95A 5I9YA 4NJ3A 4F1MA 1BMKA 2PZPA 3DDQA 2WTCA 5F4NA 3VRZA 1J1BA 3QXOA 5CF4A 1E1VA 3TV4A 3QL8A 4LFIA 2VGPA 3IDBA 2WTJA 3PFQA 5CQUA 2B52A 5KBRA 3FZTA 3HP2A 4RQVA 2X6DA 2YDIA 4F7JA 3PY3A 1TQIA 3PJ3A 4XG9A 5EQPA 1VEBA 4W8EA 4AE9A 5EM7A 4G17A 4F7SA 4WKQA 3TUBA 2Z7SA 4IAFA 4BDKA 3CPCA 4BC6A 3NNWA 3LFAA 2WTKC 4JS8A 5D7VA 2X6EA 2BHHA 3OBGA 1Z57A 3VQHA 3QZHA 4H36A 4IAYA 1GY3A 2JFLA 4KIOA 3RHXA 3FLNC 3DBFA 4GJ3A 4DFYA 4ANQA 3PIYA 3FV8A 3KXHA 4HZRA 4OW8A 3CPBA 4B8MA 5L2SA 4JOAA 4S32A 2BZIB 4DFNA 2WIHA 3MPAA 4X2KA 3OT8A 5JH6A 5HGIA 3PIZA 1LPUA 2QG5A 3P9JA 3MPTA 3FI2A 2ZJWA 3BYSA 4NU1A 4R7IA 4Y85A 4ZZOA 5J5TA 3QTIA 4QRCA 2HY81 3ANRA 4CRSA 5IA3A 2GNLA 4QYHA 4DEHA 3QGYA 4DHJA 2C5OA 5EHLA 4G6LA 3A60A 3R0TA 2OXYA 3RI1A 3RJCA 5CEOA 3QKMA 4AN3A 5HG9A 4FT0A 1OM1A 3QU0A 1KSWA 3EFJA 1REKA 4I23A 1YOJA 3D94A 4JAIA 5IA4A 4C7TA 3DK3A 4XOZA 2CGUA 3MB6A 4BYJA 1IA9A 3KY2A