2VO7A

Structure of pka complexed with 4-(4-chlorobenzyl)-1-(7h-pyrrolo(2,3- d)pyrimidin-4-yl)piperidin-4-ylamine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 107
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vo7A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vo7A02
4IAAA 3TUCA 4RMZA 5EK7A 5AV3A 4NM3A 4FZ7A 2YIYA 3A99A 4DFUA 3VF9A 4FKVA 2ITUA 4K33A 4D0WA 5I9ZA 2C68A 5KKRC 3EZVA 2XKDA 4WO5A 2E9OA 2B9JA 3OY1A 3AT3A 4RIWA 3Q2MA 3RK5A 4BDKA 5H3QA 5A4QA 3BHUA 3ZFMA 1FGKA 4D2VA 4AZFA 3P7AA 3RALA 4RRVA 4GJ2A 3HEGA 5HCZA 4D2RA 1WBSA 3C4WA 4R7HA 5HIEA 3HAMA 4D1SA 4EOIA 4D2PA 2GHGA 4UMQA 3UIBA 4AZWA 4E5AX 3CGOA 4ITIA 3TUBA 1OIYA 4LRJA 5EI2A 5GIPE 3E5AA 1P4FA 4HCVA 4E5BA 4BZNA 4CKJA 3UQGA 3FMJA 3R1QA 5J9LA 1A9UA 3AD4A 3WARA 5HCYA 3IONA 3R9OA 5FXQA 3FYKX 2W06A 2R3FA 2G1TA 3I5ZA 3UG1A 3NUXA 3Q3BA 5EM8A 5KKRB 2EB3A 4W8EA 3OD6X 2I0HA 3NUNA 4EOJA 1M17A 3WZJA 5BVWA 3KULA 3CLYA 2R3IA 4HZSA 3Q9XA 2SRCA 3R7IA 1JBPE 4IX5A 3PXQA 5DEYA 5TKDA 5IEXA 2W1HA 4LV5A 4KRCA 1OVEA 1UNGA 2WNTA 1OL5A 2XUUA 3V04A 2CNQA 3ZBXA 1W83A 4FTQA 2QG7A 1H08A 4AZVA 4AS0A 5BVKA 5JQ5A 2WAJA 4FIGA 5IISA 1GZNA 4M14A 4RPVA 4D2WA 3GVUA 4NEUA 4EOSA 4Q9ZA 4OTHA 5DE2A 3U4UA 3EQHA 4QMMA 4IWPA 4JLCA 2HY0A 4A07A 5L3AA 2JLDA 3TWJA 3DLSA 5HVYA 5EYDA 4QP1A 1OPLA 4RX9A 2YLEA 4YJNA 4Z7GA 2UW3A 3QTQA 4QT1A 3FE3A 3AD6A 3NAYA 2QQ7A 1Y91A 3MBLA 2PVMA 2HZIA 2H6DA 2JAMA 3I81A 3QZFA 2YHVA 2G2FA 3HGKA 3P78A 4R5SA 4BF2A 4JX3A 4FV1A 3GGFA 4U81A 2A19B 1JSUA 1UNHA 3R9DA 4H3PA 4AA5A 3SA0A 3WI6A 5EH0A 1QCFA 3ZSHA 2FB8A 1YDTE 3FXXA 3I0OA 3W2RA 5HGIA 3A60A 5DT4A 4YURA 1PXMA 5LOHA 3TIYA 3IECA 4KBCA 4FG8A 5A9UA 1R78A 4K77A 4PMSA 3EN5A 3O7LB 5I9XA 2H96A 2WFYA 2UZWE 4I6BA 4X3FA 2HW7A 4TZRA 4EUTA 3E87A 2J51A 5FEQA 2WIHA 5CU4A 2R3NA 1QMZA 4YPDA 4QTEA 3UOJA 1UV5A 4YO6A 5GJGA 3OF0A 4FL3A 3ATTA 2VO7A 4FSMA 4JX7A 1BI7A 5C8MA 4FGRA 3D7TB 4YLKA 1GNGA 2GNIA 3QTIA 3TUDA 4BCHA 5HNBA 4FKRA 3VBTA 2GQRA 4QPAA 4JR7A 2JDTA 2W5AA 4FKSA 4GH2A 2HK5A 3MFTA 4EORA 3QCSA 3QU0A 2QOCA 4FV3A 5AIRA 2YCSA 4TT7A 5AM7A 4IVDA 3QFVA 4JXFA 1WZYA 2CN8A 2W5BA 3FXZA 4KRDA 1UVRA 2VTNA 2XRUA 2ONLA 3NZ0A 4JG8A 1PYXA 3BCEA 3C5UA 4ACDA 5DPVA 3ACKA 4M15A 2FSOX 1OITA 4I21A 4U43A 4EK5A 3R0TA 2UW5A 5C26A 5DRDA 5HIDA 1WBNA 4LI5A 4WBOA 4Q9SA 3VS5A 3P0MA 3LXPA 4ZSEA 1SVGA 4OTFA 4ZZNA 4QP2A 5CNOA 3OY3A 3REPA 4MF0A 3P9JA 1H26A 4GYIA 3RWQA 3SXSA 3EQIA 4PPBA 4FKLA 5F95A 2OH4A 1XBAA 3LFDA 5EW9A 2XK6A 2IZTA 3A61A 4YTFA 4AWIA 4UBAA 2QU5A 5ANIA 3UVPA 3ULZA 1JNKA 4YZDA 4CTBA 5M56A 1M2RA 4BKZA 4BTFA 5HD4A 3VVHA 2O2UA 5H8EA 4BCQA 3ZUTA 4F0GA 4F09A 1M52A 2BIYA 2C6LA 4PX6A 4Q5HA 4X2JA 3IW8A 3FZ1A 3KXXA 4Y85A 3QXPA 4ZTNA 4FTMA 3PG1A 4I41A 4O6LA 4ACHA 1SNUA 4F65A 4DG0E 4C62A 1CSNA 2OF4A 2H8HA 2W1GA 3GCPA 3OBJA 3PVWA 3E8CA 5I9UA 1PXIA 2R7BA 4XNEA 5LCKA 4MXCA 3G5DA 4QP7A 4TWOA 4F70A 2IJMA 5L8KA 4HCUA 4RWKA 3BHHA 5FM3A 4V05A 3FZSA 1PMVA 3PWDA 1NW1A 2WQOA 4O7NA 4CRSA 5KX8A 5IQCA 3QRJA 3FLYA 4A4OA 4O7TA 1GIIA 4WUAA 3TTIA 1B38A 4AXAA 5IQBA 1DM2A 5CT7A 5DA3A 2NNWB 4F6UA 4Z16A 4YGAA 4BCOA 3SRVB 5IF1A 4S2ZA 4AACA 1CKJA 3B2TA 2W17A 2WB8A 3G9NA 3H9OA 3QRTA 4FTAA 3SLSA 2HXQA 3CGFA 3PXFA 2GNLA 2PYWA 3ZMMA 3LXLA 2O8YA 1Q62A 2PZPA 3SGCA 5AA9A 3H0YA 2ITWA 3F3UA 3UDBA 3KY2A 2XKFA 2PWLA 3WZUA 4F7LA 2C6IA 1W98A 3G6HA 1WBVA 1YXTA 2W1CA 4MXYA 4II5A 3EKNA 2YIQA 2BRGA 4RWIA 4BIBA 2UW7A 2J90A 1U54A 1TQIA 1PMNA 4ZLYA 4NWMA 5L8LA 2X8DA 2C5XA 3NYOA 1UKIA 2LGCA 4UYNA 5L2IA 2YZAA 3ENMA 2ETKA 4O7LA 2QKWB 3PP0A 3V5TA 4EHGA 2XH5A 1UU9A 4ACGA 1OKZA 3ALNA 2XBAA 3ITZA 4XUFA 4UXQA 4PTGA 4ENYA 5HCXA 4GK2A 5F4NA 3WF6A 3UYSA 1HCLA 1S9JA 3AMYA 4I5CA 4GVAA 3KXHA 4EYJA 3FLQA 3QKMA 3EQCA 5KMOA 5B2LA 2ITQA 2OSCA 5ACBC 3FLWA 4J8NA 2VWZA 3U6IA 2X9FA 5CF6A 3WZDA 4B0GA 3C4XA 2V7OA 3GC7A 4C4IA 2QG5A 2XYUA 3KF4A 5E1SA 3CBLA 4RIOA 4O27B 4RA5A 3KA0A 4FOBA 4NCTA 1VZOA 2PHKA 4IM0A 5DNRA 1MRYA 5J95A 5GJFA 4C8BA 5KMIA 4F6SA 3UMWA 5M51A 3UO4A 3WF9A 5HLWA 3ANRA 3R63A 4CT2A 2F49A 3P7CA 3QA0A 3SQQA 5I9WA 2YJSA 3ACJA 3L9PA 4YLJA 4YZMA 4Z55A 1LEWA 2KULA 3LZBA 3NVKI 3N9XA 1YI4A 4FNZA 1O6LA 1WBWA 2WOTA 3E93A 4GT5A 3R7YA 4DH1A 5J9ZA 2JKOA 4QYGA 3CR0A 4I0RA 4RZWA 2OJGA 4BI1A 3ORTA 5LVNA 4W9XA 2VO0A 5AUXA 4EYMA 4JL9A 3CD3A 4RIYB 4MWIA 5T3QA 5EOLA 2J0JA 4AOIA 4BI0A 4DH7A 5CWZA 5HO7A 4QTAA 1DS5A 4MNEB 2FVDA 2NRUA 3HRFA 4ZLOA 1OKWA 5C01A 4MAOA 3W2OA 4BICA 5KHWA 4CLIA 2IO6A 4IZ5A 4QP8A 1OI9A 4JT3A 4LOPA 4E4XA 5E8VA 1K3AA 5EW8A 3IOPA 5DR9A 1GZKA 2YIRA 3HX4A 4RJ3A 5I3RA 1OZ1A 4B6LA 2WXVA 2C6KA 2WTWA 4TWPA 4NL0A 4GJ3A 2WMWA 2OKRA 3GC8A 1ND4A 3HV6A 4OT5A 3SAYA 2AC3A 4CD0A 2WMQA 1JVPP 3VS4A 3GT8A 2R9SA 1WCCA 4OR5A 4QYYA 5CY3A 5BVOA 2UW8A 3EIDA 3DAJA 4Y5QA 4Z9LA 4AOJA 4DGLC 1Z9XA 3NYXA 4G34A 4TYEA 2ZB1A 4FV7A 4L45A 4EONA 4FUXA 3MY0A 2Y6OA 4FC0A 4O0YA 4KA3A 4ZTHA 1H1PA 2XM8A 3FL4A 1Y6BA 3W2SA 4D2SA 2W1IA 5C1QB 1IR3A 5IH4A 3R8ZA 2ITPA 1OBDA 4ALVA 4F1OA 2VNYA 4ZSLA 2DUVA 1R39A 3TG1A 3FAAA 2J4ZA 4IB3A 4YTHA 3HZTA 3BEGA 3GBZA 3O23A 1OPKA 2G2IA 3ALOA 3HMOA 1Q41A 5CNNA 3QD4A 3PY1A 1V0PA 3ZXTA 4GT3A 4G3CA 1GJOA 1WFCA 4TXCA 4EH2A 4QMUA 3NVMB 4J1RA 4H1JA 4JBPA 3HAVA 2J6MA 1PMUA 3C9WA 3E62A 5CASA 4E5WA 5ANJA 3CTJA 4LMUA 2Z7QA 4D2TA 3WIGA 3S95A 5M09A 4QTDA 1NY3A 4FG9A 4BIEA 5CALA 4LG4A 4L00A 4QP9A 4KINA 2X2KA 3FI3A 4CFUA 5BX0A 5EKNA 4E6AA 1SNXA 4RVTA 1WAKA 1QPJA 4MEDA 4FICA 3CP9A 1TKIA 1UU8A 3HDMA 4N6YA 4BDFA 3D15A 2WMXA 4MKCA 2HWOA 5AEPA 4I92A 1CKIA 3CQUA 4A06A 2VTAA 4M67A 3DJ7A 2ITNA 2XKCA 2GHMA 2OJJA 3DXNA 3NDMA 4FL2A 4MXOA 4PNIA 5HNIX 3W2CA 3BV2A 5DWRA 5TO8A 4E7WA 5M08A 4IMYA 1PXKA 2OK1A 3NR9A 3TI1A 2DS1A 5EDPA 3LPBA 4S31A 4HVGA 4OTPA 3F2RA 2YM4A 5GHVA 4BY9E 4K1BA 3D2IA 4J52A 2GSFA 3U9NA 5FBNC 3Q2JA 2X4FA 5CS6A 2WOUA 3MV5A 3SKCA 4FZAB 3R1SA 1BMKA 2QURA 3HDNA 4MTAA 3E7OA 3F3ZA 3M42A 4PDSA 5AFVA 2B9HA 3HKOA 3VULA 4BRXA 2BRBA 3DJ5A 3P23A 3RINA 5LVPA 2UZBA 2PVLA 3P5KA 4O0VA 1OGUA 3TCPA 4TNBA 1YHVA 4FZFB 4H1MA 5DGZA 4C4GA 2YDIA 4WT6A 3LJ2A 2E9NA 2XS0A 5IQIA 2VUWA 5LQFA 5I0BA 3QQKA 3GOPA 3M1SA 3RAHA 3VAPA 4AT3A 4BDGA 3QQLA 1NT2A 3T9IA 4EK8A 3AGLA 2GMXA 3V6SA 5L2WA 4FKWA 3T8OA 3M2WA 3MB7A 4YBKA 2BRMA 3B2WA 4CFVA 5D1JA 1J7UA 3UVQA 1BL6A 2PL0A 5EHLA 1TVOA 3CXWA 3GU8A 4QP6A 3T3VA 4YJTA 3V5QA 3WF5A 5IPJA 5LWMA 3PLAE 5FRIA 1AGWA 5JFSA 4EQUA 3FDNA 5BUIA 3QYWA 3ZOSA 4ZZMA 2PZYA 2B54A 4U5JA 3FYJX 2YABA 3DB6A 1P14A 2R3MA 1TQPA 3KCFA 4RQKA 5F9EA 5EQYA 4XG7A 4LL5A 4USEA 3LIJA 4FVPA 4WNOA 4WRSA 3RI1A 4E20A 3QKKA 4JRVA 5E8YA 4DHFA 5LJJA 4NYEA 1CMKE 2PULA 4U41A 3EB0A 1R0EA 1JOWB 4BL1A 3QTXA 2V5QA 4FK3A 1Y8GA 2W99B 4TYHB 5C8NA 3ORLA 2GFSA 3E92A 4BDHA 3FY0A 4EC9A 3FZPA 3VS3A 1Q3WA 2PMNX 3K3JA 3ZO2A 2XM9A 5I4NA 2QOLA 3F7ZA 2QODA 4FKGA 4J98A 3VC4A 5DT3A 3WF7A 3LVPA 3MB6A 1XH6A 3EMGA 4X2FA 5J7HA 4D0XA 3TNQB 3FHRA 3H4JA 4YC3A 3GU5A 4XOYA 2VTRA 3DQWA 2OIDA 4RX7A 3F9NA 4EH7A 3ZRLA 4K0YA 4RJ8A 2O5KA 1PW2A 4FV8A 1KE9A 2VWYA 3HA6A 5BMMA 1PMEA 1ZY5A 4G1WA 1XR1A 1R0PA 2V0DA 2XYNA 2E2BA 2E9VA 3F69A 3NCGA 4TRLA 2DWBA 3DK6A 2OZAB 2W4KA 3PVUA 4G5JA 1YVJA 3ORKA 3OCGA 3PUPA 1T46A 2PMOX 2Z60A 3QTUA 4S30A 5D41A 4ZSJA 4R1YA 2IW8A 3KEXA 3MJ2A 4M13A 5KMLA 4DTAA 4YTIA 3DNDA 2YDJA 4LYNA 4DFLA 3K5UA 4KIKA 3ZM9A 1DI9A 1VJYA 4NIFA 4U9AA 3UOHA 4U42A 1F3MC 3IDPA 3KMUA 5HIBA 3RKBA 5K5NA 3LM5A 2YWVA 5AUYA 5A4CA 5GZAA 3GCVA 3HMMA 3LFNA 1ZZ2A 2OZOA 1K2PA 3FZTA 4IAFA 4G3DA 2Y9QA 5J1WA 2BKKA 4ID7A 4O0TA 2BTSA 3R21A 4WRGA 2UW6A 2ZV9A 3BU5A 3GENA 2CMWA 1E1XA 2PE2A 3ZO4A 4F9AA 3RBWA 5FUTA 4QNYA 2UVYA 3RTPA 1YWVA 2O65A 4KD1A 2V62A 3GUBA 1REKA 2PZ5A 1GY3A 2OXXA 1XKKA 5IUIA 5D7VA 2PVFA 4APPA 5M4CA 2XJ2A 3HMPA 4YZCA 4BYJA 3LCTA 4ZOGA 4AA0A 3OW4A 4GMYA 3O8PA 4O82A 3RJCA 3BRBA 3L8SA 5EYCA 2YA9A 2ZM3A 3BGPA 4OAVB 3QD3A 4EBVA 3ATSA 1RJBA 4YHTA 5HLPA 2R2PA 1V0BA 5LARA 3EFKA 4BKYA 2BILB 2WTCA 1SVHA 4J95A 4NM7A 2LAVA 3W10A 1JKKA 1XH5A 3DBFA 2FH9A 1SMHA 3QRUA 1YXXA 3SX9A 3ZLWA 4UMRA 3CJGA 4IW0A 1H8FA 4O0RA 1Z57A 4WNMA 3EL7A 4FYOA 2OGVA 2CNVA 4IFCA 2F7ZE 2I40A 4ZAUA 3FEGA 4ZLZA 4PNKA 2R7IA 4DEAA 3LXKA 4X21A 2RSVA 5HE3A 4B8MA 3ORPA 3EN6A 4QQJA 1W82A 1GIHA 4GW8A 5DH3A 4I0TA 1A06A 5KMNA 2CKQA 1YKRA 4FV6A 4QMLA 5TR6A 3UE4A 2QCSA 3VQUA 3FJQE 4C34A 3RZBA 4EKLA 2C3LA 2XKEA 2XNNA 2ZJWA 4ANBA 1Q8WA 4LUEA 1UU3A 2XF0A 4RC4A 5AUTA 3DU8A 1IRKA 2ERZE 1I44A 4G9CA 3HMNA 3L8XA 3VW8A 2VWXA 4TN6A 2YEXA 3ORMA 5AAEA 5CU3A 4ZZOA 5K3YA 2PVNA 3IS5A 4CEGA 3H0ZA 4CCUA 5TE0A 3TTJA 4GG7A 5BYZA 3W1FA 4BBMA 2YIWA 3HP5A 4RGJA 4FV0A 4YO4A 5HLNA 3TJDA 4C7TA 5A4TA 3QQFA 4RG0A 1DAYA 2R3JA 2WTDA 3G2FA 2WMRA 2IZRA 3OXZA 4JRNA 5AJQA 2R3GA 3U6JA 2Z7SA 4CKRA 1ERKA 3FI2A 4E8AA 4JOAA 4LOOA 5G6VA 3DQXA 3PWYA 1AD5A 4PDOA 2ZV2A 4B99A 5CAQA 5BVFA 3EFLA 2QO7A 4FL1A 2BDFA 2A0CX 3W16A 5K0XA 2HIWA 3QHRA 3UO5A 1KV1A 4ASXA 3MGYA 3DBCA 3MWUA 2JDVA 3R28A 4RVMA 2J2IB 2UW4A 1LPUA 3HV5A 3OG7A 4PWNA 4D4SA 4L7FA 3D5XA 3KULB 5HHWA 1JKSA 4BZOA 3QTSA 3EFWA 3W18A 3CIKA 5ITAA 4MH7A 4G2FA 3U54A 4WUNA 3L9NA 4YLLA 4AW5A 2C5OA 2F2UA 1ZOHA 1IAHA 4IAZA 3FMKA 3VS1A 4JQ7A 4XG3A 5CEKA 4MBJA 2JDOA 3LJ0A 4IZYA 4C33A 3BE2A 5JFVA 3GI3A 4QQ5A 5ANDA 3GU4A 3QZIA 4EI4A 2PTKA 5CAPA 4LGHA 4U3ZA 3NCZA 2PSQA 3ZSIA 4QQTA 1PXLA 4YPSA 4O84A 2YISA 4H39A 3PXYA 1M14A 4HNFA 2XK3A 1MRUA 3DFAA 3DKCA 3GU6A 3BHYA 3NW6A 3FMNA 1QPCA 3R8PA 4D4VA 2GU8A 4BCPA 3C0HA 4G16A 4BHZA 3QCQA 4C61A 3PPZA 2E9UA 4QRCA 4KS8A 4V04A 5AUVA 3RPRA 3NIEA 3E88A 4QMYA 2RG5A 3OZ6A 3EHAA 2X39A 2BRNA 1F5QA 4H3BA 3ZO1A 4ANSA 3Q6WA 4CV9A 1VYZA 2WTKC 2BFXA 1XH9A 3ZC6A 5CLPA 4YC6A 5EYMA 4EWHA 4FTIA 3V5PA 2PUPA 2RG6A 4H3QA 4O86A 3DT1A 3AC3A 3WE4A 4OT6A 3VS0A 3PSBA 3R00A 5EQEA 3DBEA 4KNBA 4OLIA 5AR7A 5BNJA 1ZMUA 4P5QA 5AR5A 3NEWA 3UP2A 2OIBA 4W4WA 5E8TA 3LE6A 5I9YA 1BYGA 3BQRA 1H27A 3NYVA 3R7VA 3RZFA 4CSVA 2R3HA 2WTJA 3W8QA 4DCEA 5CF8A 4RLKA 3RCDA 4FKQA 4IZ7A 1PF8A 4KIPA 2XIZA 2WTKB 5M53A 2F57A 4HW7A 3NUUA 1CM8A 4EH4A 2C1BA 4HVHA 3SG8A 4IC8A 3A4OX 1ZRZA 4CRLA 1IEPA 2QI8A 3LOKA 4JDIA 3R83A 3OMVA 4F0FA 5A6NA 2WMVA 4NM0A 2GFCA 5HESA 2YZLA 1NVRA 2J0LA 2EUFB 2VV9A 3RWPA 4F6WA 4DH3A 3WBLA 2Z02A 5GNKA 4W8DA 4JIKA 4WA9A 5A46A 2OBJA 4PF4A 1V0OA 4F1MA 3N51A 4X0MA 1XH4A 5CXHA 4CT1A 5HX6A 3GQIA 3MVJA 4WNKA 3ZZWA 4EK6A 2CKEA 3PTGA 5D10A 3PJ2A 5C8KA 4O96A 3N4VA 5GZ8A 3HUBA 3EYHA 4XJ0A 3D83A 5AR4A 4M12A 4C4FA 2HENA 3OCTA 4DEHA 3TM0A 4R5YA 2YCRA 5ETIA 4QMTA 1PXJA 2BAQA 2ETMA 3FZRA 3F3WA 4OTWA 3U4WA 2F9GA 4FTCA 4E4MA 4EQMA 4BTJA 4P2KA 4HVDA 4FF8A 4I5PA 4PP9A 3E63A 3OWJA 4JDJA 4UWCA 3OUNB 3NW5A 3PYYA 1FVVA 2IWIA 2UZEA 3CY3A 4K9YA 4XS2A 4FOCA 5BVNA 3OS3A 5AV2A 5HD7A 1MP8A 2PK9A 2H34A 4YBJA 4BCJA 3JPVA 4FYNA 3HYHA 3UG2A 4DFZE 4C4HA 1J7LA 3PZHA 3ZC5A 4U79A 4TKSA 4ZS0A 2X8IA 5DEWA 3I0QA 2QO9A 2QONA 4EOLA 5M57A 3QKLA 4KKHA 4CFWA 4IACA 5CAUA 2VZ6A 1LP4A 2UZLA 1ZY4A 2O3PA 2WTIA 4FTJA 3G9LX 5IA5A 2OH0E 4EOPA 4XP2A 1YXVA 4K2RA 4Y72A 2C3KA 3OXTA 4HGEA 5BMSA 5B7VA 4HCTA 5HBHA 2R3KA 4A7CA 4C3FA 3FMHA 4FSTA 5AX3A 5HG8A 2B52A 4EK3A 4IADA 1KE7A 4Q2AA 4WBBB 4MXZA 5JGAA 2X7GA 4O1OA 4DH5A 1H1RA 3VUGA 1FOTA 1JLUE 2XIKA 3PVBA 4AE6A 4IWQA 5E1EA 4M0YA 5AP0A 4LMNA 5KE0A 3UIMA 4KUJA 3ENHA 3LFAA 3RPOA 2IVVA 2JD5A 4HJOA 4MQ2A 4U45A 2JITA 4E4NA 4YJPA 5A4EA 2UZTA 4QYEA 5E8ZA 4J99A 5M4UA 4N70A 4ZY6A 4WSQA 3C4FA 4GG5A 1OM1A 5LMKA 4ORKA 2AYPA 4YP8A 3WIKA 3L9LA 3S4QA 1H28A 4PL3A 3MN3A 1P5EA 2WELA 4QMNA 4FSZA 3U8WA 3QD0A 3KVWA 3TV4A 4XCUA 2VTSA 4AW2A 3KCKA 3QLGA 2YDKA 1H07A 2ITOA 2QLUA 5HG5A 4A4LA 2X6DA 3G51A 2O63A 3QF9A 4LRKA 4D5KA 1OL6A 4EZ5A 5HQ0A 3AXWA 5IQEA 4IAKA 3NMUF 4BZDA 1A48A 3LFEA 1YOJA 3AOXA 3P86A 4JQEA 4M3QA 4C37A 4IWOA 3PP1A 4G9RA 4F7SA 2NP8A 4FSWA 4NCTC 5L6WL 1XH7A 3LXNA 2PY3A 4I22A 4O0UA 5DN3A 4YC8A 5ETAA 5I3OA 5CANA 2GNJA 4ERKA 5IEYA 4NKSA 3RPYA 4EHZA 4EOMA 3VS7A 4R7BA 4DLJA 4L7SA 3D5UA 3R8LA 3S3IA 5CQWA 2F2CB 3LFCA 4GKHA 2GHLA 4B9DA 5EM5A 5E90A 4DBXA 2C30A 5CU2A 3QGYA 1Y6AA 3NSZA 4G6OA 2BZHB 4FK6A 1Q8TA 4KAOA 2ESMA 2VTLA 5EYKA 3KKVA 3BYSA 3ZXZA 5FEDA 4HYIA 4CFMA 1IA9A 4ENXA 2HELA 3LM0A 4XYFA 5CEQA 4D5HA 3BI6A 2C5YA 3VHEA 5CQUA 2XEYA 5GINE 4R6VA 4WHZA 5HO8A 2YERA 2C6MA 5CTPA 4BC6A 2YACA 5LVOA 2WMUA 3C13A 3QZHA 4RJ4A 2REIA 3VRYA 4PRJA 4C58A 4CMOA 4WKQA 3RVGA 4ZJJA 4AT5A 5M06A 2BHEA 3BKBA 4O7YA 4EH5A 5JRSA 4LFIA 2YLFA 5ICPA 1L3RE 1OL1A 3RGFA 3MH2A 2P4IA 3DBQA 4JDHA 4ZS4A 5H2UA 1OIUA 3E8NA 3OWPA 3C51A 4UZDA 2J7TA 2J0IA 3LQ8A 4UALA 4O0SA 3R8VA 4BGHA 3LFSA 4ZY4A 3BIZA 3PSCA 1JPAA 5IA2A 4AQCA 1O6KA 4S32A 4U7ZA 4UZHA 4I3ZA 4OTQA 3Q5ZA 4U44A 2DYLA 3QZGA 2RFEA 2WU6A 3FLSA 1M7NA 4OTGA 2OXYA 4L46A 3UZRA 4FTOA 3IKAA 2OICA 5E91A 5EOBA 1Q99A 2XNOA 4L43A 2ZAZA 5FG8A 2CLXA 5AP6A 2R0IA 5J8IA 2QD9A 4W9WA 4HNIA 1PXPA 2JKKA 4NH1A 4O1PA 3TEIA 4ANNA 4NFMA 2X2LA 2XP2A 3T3UA 2BIKB 3ELJA 3DBDA 2EXMA 4MD9E 4A9TA 2X2MA 3FI8A 2WTVA 3OUKA 4OBOA 3W2QA 3WYXA 4MYGA 3THBA 3EYGA 2PZIA 3MYGA 2GPHA 2P55A 3QC4A 2QHMA 4HPTE 3IW5A 3DZOA 5A6OA 4M8TA 1YOLA 3QD2B 3D7ZA 4KS7A 4XLIA 3IDBA 5KBQA 4I5MA 5KHXA 1XWSA 2QOQA 4IM3A 4FE2A 2QOOA 1CDKA 3VUKA 5A3XA 4FTKA 2VTTA 2WZJA 4FT5A 4O6EA 1Q5KA 2OJFE 4R7IA 2OIQA 4AE9A 2WIPA 2A2AA 4GVJA 4AW0A 3COKA 4USFA 2HW6A 1G8AA 2IPXA 5E4HA 3V5LA 3D5WA 1XJDA 3MPTA 4XOZA 4XP3A 3JXWA 3BU6A 1IASA 4X3JA 3FMMA 4BDBA 2PUUA 3UQFA 3OCSA 2R3QA 3G0EA 3DTWA 2W1EA 3Q5IA 4EL9A 1U5RA 3UIXA 3ZTXA 2XNBA 5KBRA 4AA4A 5IQAA 3VUDA 2UZUE 2ZDTA 3TXOA 4TPTA 3VBQA 3NPCA 2A27A 2R3RA 2VAGA 3DFCB 4R77A 5L4QA 2C6DA 4YHJA 1H24A 4IWDA 5CAVA 1OL2A 4FT3A 4IXPA 4NTSA 5GIOE 2JDSA 2I0VA 4A9UA 4I93A 2XK9A 3L9MA 2OFUA 2OU7A 4FIFA 4O0XA 3DXPA 4E6QA 3MTLA 2YWPA 3FWQA 4F1TA 1Y57A 2OW3A 2BZJA 4GFGA 4BTKA 5JGBA 4IQ6A 4MXAA 4EHVA 3OCBA 4QMPA 4NM5A 1BL7A 4IVBA 3I5NA 4FIEA 4C36A 1KWPA 4IEBA 4KKEA 3ORXA 2PVHA 4PDYA 3QUPA 5JFXA 2FUMA 1S9IA 4C4JA 3KRWA 4PMPA 2XIXA 3W33A 3NAXA 4R8QA 4CZUA 3Q96A 3MPMA 2OWBA 1WBOA 2JFLA 4RSSA 4DEGA 4FT9A 4QO9A 4UEUA 4FSNA 3EFJA 4BYIA 4RWJA 5J1VA 3IG7A 2PMIA 4QMWA 4ANMA 3PE1A 4HVIA 4DG2E 3EH9A 3LLAA 3ZEPA 3VN9A 4UN0C 3HUCA 1JKTA 4O0WA 5EKOA 3V51A 1JSTA 1R1WA 1ZOGA 4J7BA 3UZPA 2Q0BA 4AOTA 4DEEA 3PXRA 4GV1A 2VTIA 1VYWA 4C02A 3D0EA 4LGGA 4RLLA 1HOWA 2JIIA 2R5TA 3F5UA 3PY0A 3LQ3A 3VBYA 4BCKA 3R02A 2X9EA 5IH5A 4U8ZA 4I0SA 4IBMA 1PKGA 3F2AA 5IQDA 4L53A 4CG8A 2PVRA 2UW0A 3MH0A 1H00A 3EN9A 1BI8A 3FUPA 4LL0A 4RIXB 3R71A 2W1DA 2NPQA 3OTVA 2EXCX 3QUEA 4PV0A 4FKTA 5JK3A 2G9XA 1Q8ZA 3TNPC 1WVXA 3Q60A 3R7OA 5LXMA 4LUDA 3R7EA 2GS2A 3BWFA 4AGWA 5HVKA 4C0TA 3R6XA 4FTRA 2IN6A 4CTCA 2RF9A 4IB1A 2WO6A 1YI3A 2J0MB 3GNIB 4FTNA 4W4XA 4QPMA 2GQSA 2JC6A 4CYJA 2PE1A 3CS9A 2GCDA 2XK7A 4ITJA 5JQ8A 3AMBA 3EQDA 1U59A 4AN9A 4IE9A 5E8XA 2CGUA 4NU1A 4IB5A 5CU6A 3JS2A 3P08A 4IHPA 5CYIA 1NA7A 2X7FA 5E9EA 2NO3A 3EN4A 3V8TA 4IIRA 2BAKA 2W1ZA 5LWNA 3TKIA 3C0GA 3IGOA 4ZTLA 5FBOA 4CQGA 4ACMA 1UNLA 1PJKA 3PIZA 3H9FA 4FT7A 2RKUA 3FC1X 3I6WA 4EUUA 3O96A 5DHJA 4FNYA 4HGLA 3ZM4A 4QPSA 3TNHA 1PY5A 5M44A 2B7AA 5IEVA 3DJ6A 4RFMA 3NNVA 5IA3A 1UA2A 1B39A 2G15A 2W7XA 2AC5A 5AAFA 3U55A 4JIAA 4EOKA 4X7QA 3ORIA 5CF5A 2A4LA 5E7RA 2I7QA 4P4CA 2WGJA 4XV1A 2V55A 3W2PA 3POZA 3E8DA 5GJDA 4F64A 1WMKA 3G0FA 3GQLA 3OP5A 4MVFA 4FI1A 4CFFA 1STCE 1ZARA 3E7VA 1Z5MA 3MDYA 1Q97A 3ZRKA 1SM2A 3HVCA 4BDJA 2HZ0A 3R2YA 4E6DA 3VJNA 3L8VA 4GIHA 3LKMA 3EJ1A 1O6YA 4G3GA 3QBNA 3AD5A 5FTGA 3QRKA 4QTCA 2E9PA 3NNXA 3PXKA 3DLZA 2J5EA 3ZUUA 3V8WA 5FDPA 2ITYA 2PMLX 4KKGA 3LJ1A 2YM8A 3PIYA 1JAMA 2QR7A 4FA2A 1F0QA 1CTPE 2QLQA 2X4ZA 3QUDA 4FZ6A 4CVAA 3IW4A 4GKIA 3MVHA 3P79A 1RDQE 4D58A 4Q5EA 4I1ZA 5AV1A 5CEPA 2PU8A 2RFDA 3FMEA 4CYIA 4R3CA 3DKFA 5C03A 4EZ7A 4ASDA 2CKOA 3NUYA 3R22A 3HA8A 4CZTA 2QNJA 2BMCA 4HGTA 4HPUE 5J9YA 1XH8A 4N57A 4L8MA 2ITTA 2ACXA 1ZYSA 2Z7RA 3QWKA 4EKKA 2Q0NA 4F9WA 3P1AA 1OECA 4K18A 4PMTA 4W4YA 1YXUA 5CZIA 4FV5A 3PA3A 4QP3A 5HG9A 4FG7A 4P7EA 4Y8DA 4FEQA 1J7IA 3EQGA 3BBTB 3QHWA 3ETAA 3KL8A 5D11A 4LGDA 4GFOA 1BUHA 5BUJA 4MK0A 3EN7A 4XH6A 4BB4A 3O2MA 3BLHA 4DEIA 2FSLX 3SOAA 3R1NA 3TDVA 4OW8A 3QQUA 5JMSA 5IH6A 3KXGA 4UMUA 1ZXEA 3JVSA 4F0IA 4IJ9A 2UZDA 5L8JA 2OO8X 4ZTRA 3M11A 3TJCA 4L67A 3TZ7A 3LCKA 4EWQA 1YWRA 3HECA 4B8LA 4JBVA 4XBUA 4CV8A 4F7NA 3D4QA 3LAUA 4EHEA 3NYNA 4S34A 2W96B 3KXMA 3QA8A 5HNGA 3ZFYA 4MF1A 4C59A 2YM5A 3IGGA 3NUSA 2VRXA 2HOGA 2P2HA 3E64A 3FV8A 3PA4A 4ZJVA 4J53A 5IA4A 4RVLA 3FI4A 2WQMA 1MRVA 2VTOA 4X6RA 4G5PA 3AG9A 4J71A 2ZV8A 3A7HA 3ANQA 4APCA 5BYYA 2IVTA 3FZOA 3ROCA 2FA2A 4FKOA 4NJ3A 4MCVA 3VUHA 4XG2A 3VO3A 4YJSA 2H9VA 3TZMA 5CI7A 2W1FA 4TYHA 5CSXA 5AP2A 3ZH8A 4AT4A 2PVYA 4GSBA 3RK9A 3ID6C 4TTHB 4GT4A 4TL0A 2BHHA 3CPBA 3OEZA 4C2VA 5IMEA 2CJMA 4PQNA 3O0GA 5AV4A 2R4BA 4I6FA 4DF3A 2EU9A 3BX5A 3NGAA 2G2HA 2YIXA 3LW0A 5CSWA 5AADA 2JAVA 2ZMDA 4JBQA 3PPKA 3C4CA 2GNGA 1ZAOA 2C3JA 3MH3A 5EDRA 3MY5A 3QWJA 3UOLA 3OT3A 1FINA 4NUSA 4WOVA 1YDRE 3PJ3A 4O2ZA 4A9YA 3R9RA 2OZAA 2YITA 2VTQA 4LRMA 4IM2A 4F9YA 4RFYA 3DCVA 3OWLA 3TNIA 4ASEA 5JT2A 4Y46A 3FLNC 4ONAA 3OHTA 5HTIA 4L42A 1W0XC 3E3PA 3A4PA 4IDVA 1K9AA 4OBQA 3RPVA 3H30A 3ZU7A 4FEXA 4MBIA 4MWHA 4XV3A 1G5SA 4C57A 3GC9A 4BDIA 3DDQA 3P7BA 2J50A 2BRHA 5CVHA 4HYSA 3BELA 3UJGA 4A9SA 4RIWB 3KMMA 3WZEA 3CKWA 4BVUA 4O7RA 3ZLYA 2VX0A 5L6OA 4QYFA 3QALE 4H36A 3N4TA 5K9IA 4D4RA 3I4BA 5B2KA 1XBCA 3UBDA 4CQEA 3BYVA 4K8AA 1W7HA 4ZK5A 4ALUA 2JBOA 4NSTA 3CEKA 2UVXA 3CY2A 1KSWA 3IO7A 3OBGA 1OBGA 5FD2A 2XK8A 4M66A 3BPRA 4DLIA 2QKRA 4RFZA 5AP5A 2BPMA 5HTCA 1WBTA 3UOKA 5KUPA 4IANA 4DH8A 4YNOA 4DGOA 5D12A 2JDRA 4R1VA 3SD0A 2Y4IB 5AP3A 4FV2A 4M97A 4YU2A 3IPHA 3NS9A 2PVKA 3QTZA 3UPZA 2QHNA 5KZ0A 2OXDA 1OUKA 2VTMA 2ZMCA 1FMKA 3Q53A 3RNIA 1YRPA 3PE2A 3NUAA 2QOFA 3O8UA 4DCAA 1J1BA 1XBBA 3OFMA 1NVQA 1Q8UA 3T9TA 4XBRA 1M7QA 3NWWA 1P2AA 4JI9A 4RA4A 1XHAA 4AGCA 4MQ1A 2QVSE 5FEEA 4OAUC 4ANOA 4ERWA 3LMGA 1WVWA 4QMOA 4C2WA 4CCBA 4NW5A 4BBEA 4RQVA 5CEIA 1KE8A 4V0GA 1E9HA 3H10A 4D1ZA 1G3NA 2B9IA 3PLSA 4TNDA 3SOCA 3UC3A 5LMBA 4YNEA 3CTQA 4JDKA 2V22A 5DG5A 5KZIA 5BPYA 5M4IA 4RVKA 3IW7A 5CENA 1OUYA 3ULIA 3KXNA 1AQ1A 1UKHA 3U87A 2XCHA 4JG6A 3C1XA 4TWNA 3TV7A 4BCGA 1KUTA 2YAKA 3KRLA 4TW9A 1MQ4A 3UNJA 4DFYA 3CCNA 2R3PA 3A7JA 4JVGA 3ZLSA 4E73A 3CSVA 4BN1A 4UB7A 4X3FC 4BDDA 5AIKA 4FIHA 2CLQA 1ZWSA 2OLCA 3HV7A 4CNHA 3I7BA 1VEBA 3NIZA 5FLFA 4CGAA 5CAOA 5EDQA 2C0IA 5ANKA 2GNHA 3JVRA 5HE0A 3ZUVA 4CXAA 3QQGA 5AA8A 1FVTA 4PL4A 3GFWA 2R64A 2BZKB 3A7IA 4WG4A 5DYJA 5HU3A 1YHWA 2Z2WA 2GS6A 2XNGA 3R04A 3TL8A 1U5QA 3QL8A 4TYJA 2UZVA 3A7GA 3HRCA 4R3RA 3UMXA 2X81A 1JQHA 2C1AA 3TKUA 3KRXA 4QMSA 3V3VA 4X3FB 3C5IA 4G6NA 3FLZA 4QP4A 3NNUA 2ONLC 2ZB0A 3E8EA 3IQ7A 1OIRA 3FKOA 3PY3A 5ANEA 5L6PA 2BR1A 2I0YA 5B0XA 3TT0A 4EH9A 3MIAA 3OW3A 2HY81 1YI6A 4YZBA 2YAAA 2ZVAA 3GCQA 5M55A 2YM6A 4M69A 4Y83A 2ZDUA 3OOMA 4GUBA 4JQ8A 1GAGA 5EM6A 4AW1A 5LMKC 5DIAA 4ZY5A 4YUQA 4G17A 1V1KA 3PJCA 3GU7A 5C27A 2XA4A 3DPKA 4I94A 3KK8A 3U51A 4JNWA 2JFMA 3NLBA 4ARKA 5EFQA 4R78A 3I60A 5HORA 1WBPA 2YCFA 3QXOA 5IDPA 4M0ZA 3HMIA 1T45A 5I9VA 2JIUA 5K4JA 5IKWA 4W4VA 2J9MA 3F5GA 2Y7JA 4MBLA 5J5TA 2ZM1A 3KRRA 3F6XA 3W32A 4XG4A 4F4PA 3VJOA 4UWYA 4WNPA 3FMLA 2XRWA 4FNWA 1YDSE 4PUZA 2GS7A 3POOA 3IW6A 5HE1A 5CSVA 3V8SA 1PYEA 2UW9A 2Z7LA 2WMTA 2G01A 3ZBFA 3COIA 5A54A 1P4OA 4EH3A 4XMOA 3RM6A 2EWAA 3FXWA 4BWKA 1MUOA 1EH4A 3FBVA 2WEVA 5HKMA 1OL7A 3FQSA 4O83A 4FZDB 3K2LA 4AP7A 2YFXA 3ZONA 2QOIA 3VNTA 2J5FA 2VTHA 3GCUA 4OTDA 4XRJA 3OXIA 2P3GX 4KSPA 3VUTA 3AGMA 3SV0A 4I23A 3KXZA 2EB2A 3TZ8A 4ANLA 2VX3A 4RC3A 4DG3E 3MVLA 4IAYA 3TN8A 2JEDA 2QU6A 1Q24A 3BEAA 3ZYAA 4YJOA 3KU2A 2CCHA 3RAIA 5C4KA 4I20A 4ZSGA 4U40A 3R7UA 4UWBA 1NXKA 3D5VA 3O17A 4U3YA 4G3FA 5TF9A 3MTFA 3LFFA 5LVLA 1UWHA 4PL5A 3AC2A 3NUPA 4V01A 4DEBA 3QQHA 3BGQA 3G15A 1YW2A 4NJDA 4X2GA 3L1SA 5AM6A 5C4LA 4ZP5A 3KREA 2YM7A 4BR3A 3ODZX 5IA1A 4O81A 4ITHA 3FSKA 3TV6A 1MQBA 3HL7A 4RJ5A 4DC2A 4J97A 4H58A 2IZUA 2CGVA 4FSYA 4JR3A 5GZ9A 3AMAA 5BVDA 2W5HA 2XNPA 3MIYA 5D9HA 2CSNA 3VBWA 2GTNA 2PE0A 4FV9A 5HBJA 3LMHA 1G8SA 3VHKA 5AP4A 2Y4PA 3LLTA 2QOBA 3BYUA 4EH6A 2XZSA 3EQPA 2J0KA 3GXLA 3MFSA 4KB8A 4L3LA 2ITVA 2VWBA 5EHOA 5F1ZA 4FKJA 3RM7A 4HYUA 5KCVA 3BWJA 5EG3A 5HG7A 4O7WA 3QGWA 2PPQA 3KRJA 3Q4TA 5A14A 3GEQA 1XQZA 1FVRA 1GZOA 4KIOA 1APME 3DK7A 5H8BA 2WEIA 5HE2A 3WYYA 2IG7A 3ZHPC 4UY9A 3FSFA 2W05A 3I7CA 1H1QA 4JJRA 3PSDA 2XIYA 3IK3A 3QTRA 4KBAA 4USDA 4N6ZA 4NT4A 1W8CA 5FQDC 3FPQA 2VD5A 5AUWA 5AR3A 3W8LA 1U54B 3PVGA 5T68A 4DTKA 4YSJA 2DQ7X 2HZNA 5AP1A 2ITXA 4AUAA 3UP7A 3C4ZA 2XIRA 3ZZEA 3O51A 3R73A 4BCFA 4DGGA 4E26A 4AN3A 2BUJA 4FTUA 3LFBA 2R0UA 4MHAA 4OTRA 3F3TA 5CSPA 4EK4A 2XK4A 4N0SA 4RC2A 4L9IA 3MI9A 4AZTA 3S0OA 4FEUA 1H1WA 5HI2A 4FUYA 3BYOA 5HOAA 3W55A 3D7TA 4UX9A 3ZEWA 3N4UA 3KVXA 3EQBA 2UZNA 1LR4A 2I6LA 4HGSA 1ZYDA 4FKIA 4XHKB 5M4FA 3F2NA 3A7FA 2WKMA 4B4LA 1OKVA 4RJ7A 3R2BA 2XMYA 3FKLA 3EQRA 4BIDA 3K3IA 3UC4A 4WIHA 4FSUA 3QLFA 5AMNA 3PRIA 5K5XA 4I6QA 1FPUA 4OUCA 5AX9A 3SC1A 1I09A 3EWHA 4YJUA 5H9BA 4AZSA 5ACKA 4U0IA 2JGZA 2VO6A 2Z8CA 4EBWA 3MW1A 3VBVA 1REJA 3FQHA 4G31A 4PY1A 5CSHA 3R9NA 5JZJA 4FT0A 3OTUA 3EL8A 2CCIA 2BTRA 2XJ1A 5FXRA 4JS8A 2B4SB 1OIQA 3UNKA 5FTOA 2X7OA 3TNWA 1Q3DA 2VU3A 5CVFA 3TACA 2FSTX 3II5A 4O91A 3MESA 3O50A 3GC0A 1OMWA 2YN8A 3OOGA 4B7TA 4BWXA 2C47A 3BQCA 3DNEA 4AU8A 2OI4X 3SHEA 3VS2A 2OG8A 4IZAA 3KN5A 1H0WA 5HEZA 3QTWA 5AP7A 4K6ZA 3TIZA 3PG3A 1DI8A 4D4YA 1GOLA 1ZLTA 3KF7A 4L52A 2HAKA 5G1XA 5HVJA 2RFNA 4AFJA 5EW3A 4L3PA 4I4FA 3UO6A 4KIQA 3EKKA 3F5XA 3JY9A 4EJNA 2QR8A 3ODYX 4AX8A 3KK9A 3QYZA 3UNZA 4BGGA 1FMOE 5H8GA 2CGWA 1OPJA 1FQ1B 4BHNA 4E93A 3WOWA 4DAWA 2F7XE 4TWCA 3A2CA 5TOZA 3GB2A 1KV2A 3RPSA 1ZYLA 5DOSA 5DR2A 2VNWA 3R9HA 3VBXA 4CMTA 4F99A 5IQGA 4ZTMA 4HOKA 4ZEGA 4ALWA 4RT7A 3S00A 1PHKA 2WQEA 3UVRA 5AUUA 3NW7A 3MSSA 4L68A 3VS6A 3PPJA 1YHSA 3H9RA 3VUIA 1IAJA 4QQCA 4L3JA 5IZFA 1OKYA 4GCJA 4F9BA 5ETCA 5LVMA 2BZIB 2RIOA 3OC1A 4WD5A 4RWLA 3BYMA 3F61A 3SRVA 2VGOA 3KC3A 3BBWA 3AC4A 5FTQA 3V01A 3DTCA 5JN2A 3I6UA 3LCDA 2UZOA 4LV8A 2R3LA 3PJ8A 3DKGA 4NK9A 4QMXA 1RW8A 4UV0A 4GRBA 3VRZA 3ZO3A 5A4LA 3AC5A 2P0CA 5ETFA 1GZ8A 2PUNA 2C6EA 1WVYA 2O0UA 4YSMA 5DRBA 2XNMA 4J96A 2YM3A 4LOQA 4YZ9A 4GUEA 2P33A 3PJ1A 3SXRA 2CPKE 4BCIA 2X6EA 3DAEA 2CN5A 3ZFXA 3LHJA 4PDPA 5FGKA 3PXZA 3S2PA 1H4LA 4EC8A 3LCSA 2W0JA 3K5VA 4IX6A 2Y0AA 4M68A 2OJIA 4BDEA 4KABA 4BDCA 1FBNA 2BAJA 3R30A 3VIDA 1B6CB 1H25A 4FIIA 4DYMA 4FX3A 5ANGA 4IJPA 5HBEA 2BDJA 4ZXTA 2C0OA 1JSVA 3EZRA 4EOOA 4FEVA 5F94A 4ZMFA 4TYIA 2XCKA 4EJ7A 2PZRA 1SZMA 5IQHA 3DS6A 4RBLA 3ZSGA 4RX8A 3FKNA 3WF8A 3K54A 4NKAA 3QX4A 3F66A 2UV2A 5EQPA 3MA3A 4O22A 4UXLA 4KBKA 3HRBA 3LFQA 2RL5A 3BLRA 2B55A 5TT7A 3SXFA 5CEOA 1DAWA 4M7IA 4OBPA 1PXOA 5HTBA 3ORNA 4DGNA 4QMQA 5F20A 4DEDA 2WMSA 5IQFA 4Z3VA 3IOKA 4O7SA 3MFUA 4DFBA 5FP6A 3Q04A 4DBNA 3JY0A 4AZEA 4G3EA 4DT8A 4F63A 5IU2A 3FQEA 5C9CA 4DA5A 3R01A 1IG1A 5B2MA 1ZYCA 5HO6A 3ZS5A 3COHA 5CEMA 1SVEA 3UIUA 4C38A 4K11A 3OEFX 2ZV7A 2IW9A 3U6HA 2Y6MA 4Y95A 5DI1A 4L6QA 4UMPA 3ERKA 4ACCA 4RZVA 4I4EA 3HP2A 5KMKA 5L2SA 3L8PA 4S33A 4RIYA 3CD8A 4EZ3A 5JSMA 1R3CA 2XB7A 3AT4A 3HLLA 3BLQA 3QCXA 2QC6A 3UGCA 2B9FA 3MVMA 4IB0A 3MJ1A 2BCJA 4O7VA 2WQBA 1Q8YA 3D14A 4MNEA 3WE8A 1U4DA 5EM7A 1UWJA 1IA8A 2XVDA 5DR6A 3ZDIA 2WMAA 4BBFA 3SDJA 2RFSA 2PUIA 2V7AA 4IVAA 4YZNA 4AF3A 1PXNA 4OTIA 3RAWA 3DAKA 1OB3A 4GFMA 2IVSA 4GU9A 4MD8E 4NTTA 5DLSA 5HICA 4N4SA 2IVUA 3RK7A 2XEZA 2WQNA 3BE9A 1Q4LA 3QRIA 4ZJIA 5CXZA 3QX2A 4EH8A 4X2KA 2ZYBA 4TY1A 3ZDUA 4DGMA 3GOKA 4YMJA 2CNUA 2JKMA 2JKQA 1H1SA 3RCJA 2BALA 5IA0A 4H05A 5HZNA 3VF8A 4C3PA 4XP0A 4I24A 2Q83A 4O7ZA 4E6CA 4I6HA 4BI2A 2W9FB 1TQMA 3DOGA 2BFYA 4QMZA 5E92A 3GCSA 2GDOA 5JRQA 2PVJA 3HV4A 3D2KA 4O2PA 4L01A 1GIJA 2JIVA 2F7EE 2RGPA 2R3OA 3QAME 4GU6A 1QPDA 5AR8A 3DXQA 1O9UA 4IX3A 4D9TA 5J5SA 3BGZA 5CI6A 1M2PA 4DT9A 3S1HA 5M07A 3D94A 3TZ9A 2C3IB 3CJFA 4FMQA 5JEBA 4UMTA 5KNJA 3RHXA 4IX4A 1NVSA 4C4EA 3PDTA 3ORZA 4CZYB 4CLJA 4RJ6A 2C5VA 5HU9A 3DGKA 3BV3A 1H0VA 3FPMA 4P90A 4PTCA 2WMBA 4KIKB 1RE8A 4NIFB 4P5ZA 4X2NA 2QOKA 2JBPA 4RIXA 5T6KA 4GIIA 1X8BA 5BYLA 4HYHA 3DZQA 5CX9A 2QOHA 3EQFA 3F5PA 4PPCA 3P4KA 5CT0A 1URWA 4LM5A 5E8UA 4ZIMA 1KOBA 3ZCLA 3CPCA 4BWPA 4E3CA 4EOQA 2P2IA 2A1AB 3DDPA 1UU7A 5K0KA 2Y8OA 3C7QA 3B8QA 4PPAA 4DE4A 4ZTQA 2X8EA 4XLVA 3Q9YA 4HZRA 3UQCA 5JKGA 2QO2A 2X0GA 3DV3A 3QC9A 3ZRMA 4AFEA 1M2QA 3FHIA 3Q4CA 3UYTA 3MS9A 2XJ0A 2BROA 1YOMA 3SW4A 4CFXA 4YHFA 2HXLA 4YTCA 3RAKA 2VWWA 3RP9A 4KWPA 4MXXA 3U9CA 2VN9A 3SVVA 1ZYJA 3IDCA 3KGAA 3Q9WA 4CKIA 1YXSA 4EQCA 2VX1A 5E8SA 1YQJA 2KTYA 3LCOA 4NW6A 4U97A 2GNFA 5CF4A 4TYGA 5L2TA 4BDAA 4GS6A 3QCYA 3A8XA 4ASZA 4M84A 4MX9A 4FIJA 4BTMA 1ZMVA 2C5NA 3AC8A 4FR4A 3LQ5A 4DFNA 3PA5A 2C69A 2YCQA 3F7WA 4FTTA 3WILA 3C50A 2ITZA 4DITA 3BHVA 3FMDA 4AGUA 5DMZA 2B0QA 3EOCA 3BHTA 4FKPA 3TDWA 4X6QC 3PRFA 2WU7A 4FTLA 3FC2A 2EVAA 3MPAA 4I5HA 2ZOQA 3PFQA 4AN2A 4BGQA 3CQWA 5DBXA 5CVGA 3H3CA 3ET7A 4DINA 5CU0A 3OT8A 2NRYA 2ERKA 2BKZA 1ATPE 1Q61A 3D9VA 3Q4ZA 3RMFA 4CFNA 3JUHA 4PMMA 1JKLA 4J8MA 4O38A 4XV9A 3GFEA 4GYGA 5CZHA 4JAJA 5BQ0A 2W4JA 2X1NA 4GEOA 3VWAA 4BKJA 4ZMEA 3MA6A 3KMWA 3MH1A 3R7GA 4GK3A 4FV4A 3MFRA 2IZSA 2XBJA 4DFXE 5EHYA 2C6OA 3JYAA 4UYAA 5D7AA 5FWKK 3NX8A 4Y5HA 3F88A 4GL9A 1KE5A 3G90X 5IUHA 4FVQA 3DK3A 3FL5A 4QOXA 3RHKA 4A9RA 4A4XA 4YJRA 3FY2A 2HZ4A 3A62A 3JR1A 3G33A 2OFVA 5AR2A 5BVEA 1H01A 1LEZA 3R8MA 1PRYA 1QPEA 1Y8YA 4FBXA 2C6TA 2WHBA 3CTHA 4Y73A 4JG7A 3NRMA 4ZTSA 5FXSA 3R8UA 3TKHA 3V6RA 2OF2A 5AUZA 1URCA 1SYKA 4BCMA 2W4OA 2IW6A 5ANOA 3HV3A 2FYSA 4YJQA 5J87A 1BKXA 2B53A 2OJ9A 5DVRA 3CC6A 4QYHA 3UPXA 3SG9A 2VGPA 2YJRA 3AC1A 4NZWB 2F4JA 3ROYA 4ANQA 1LUFA 1JWHA 4O21A 4IVCA 3O8TA 3BU3A 3I1AA 3PZEA 4FNXA 3CKXA 3OVVA 4GK4A 2C4GA 5FP5A 4HVSA 4RX5A 3C4EA 3COMA 3KN6A 3KQ7A 4BCNA 5J7BA 2XNEA 1FGIA 4FKUA 3F3VA 1XO2B 3Q32A 4OGRA 3VUMA 3V5WA 3PIXA 5IMXA 4XV2A 1L8TA 3DKOA 2WD1A 2FO0A 3O7LD 2AUHA 3Q52A 2Y4IC 3CQEA 4FVRA 5IUGA 2HYYA 1E1VA 2UUEA 3Q6UA 2B1PA 2EXEA 4V0GB 4L44A 4FODA 1VR2A 4XG9A 3LMIA 2I0EA 3KB7A 3OROA 3E3BX 3Q9ZA 3RNYA 5EI6A 4C35A 4CMUA 3SW7A 4NFNA 2I1MA 2BVAA 4F7JA 1RQQA 1ZZLA 4IH8A 5AAGA 4XEYA 4DN5A 4XX9A 3C0IA 3B8RA 4FGBA 3CE3A 4U6RA 2W9ZB 4QMVA 4AGDA 4E1ZA 4WSYA 4E4LA 4EEVA 5K4IA 5AV0A 5KMMA 2CHLA 5KMJA 2HWPA 4FEWA 2O64A 4QD6A 3G6GA 4FSQA 1HCKA 3KFAA 5JGDA 3OWKA 1ZOEA 1U46A 4JBOA 4MNFA 2ETRA 3AQVA 5DFPA 2VWUA 4JAIA 5FM2A 2BDWA 1KOAA 3ZLXA 2VTPA 3WZKA 2UVZA 1J91A 2ZM4A 3DY7A 1BLXA 1KE6A 4WG5A 4D9UA 3R1YA 2CDZA 5FDXA 4AAAA 2C0TA 2CGXA 4FSRA 2VO3A 4XG6A 1W84A 5E8WA 2VTJA 3UODA 4Z7HA 5JH6A 1QL6A 4IFGA 4C3RA 2CKPA 4BFMA 1J3HA 1ZMWA 1BX6A 4MD7E 3BZ3A 3QQJA 4IDTA 5L2QA 5AWMA 4QNAA 4PTEA 4QTBA 1YWNA 2HCKA 5KO1A 5JFWA 5J79A 4YR8A 4YJVA 4F08A 4R3PA 4ZSAA 2FSMX 5I5ZA 5EI8A 5BUEA 3DA6A 4U80A 2GQGA 2WPAA 3MY1A 4G6LA 4DTBA 1J1CA 4CG9A 4IC7A 4D55A 2VWVA 5IG1A 3VQHA 4PP7A 5HX8A 2VWIA 1PKDA 3GP0A 3I79A 4XRLA 3NNWA 3A8WA 3UTOA 3Q4UA 3VW6A 1CKPA 3HNGA 3F82A 4KSQA 4M69B 4WG3A 5LMAA 4D28A 3DB8A 4D1XA 3V5JA 5IDNA 5LCJA 3UZTA 4AG8A 2GTMA 3AT2A 4IAIA 4LQMA 5DT0A 4F9CA 3O71A 4XG8A 5JZNA 2FGIA
chains in the Genus database with same CATH superfamily
4IAAA 3TUCA 5BV3A 4RMZA 5EK7A 5AV3A 4DHZA 4NM3A 4FZ7A 2YIYA 3A99A 4DFUA 3VF9A 4FKVA 3W0NA 2ITUA 4K33A 4D0WA 5I9ZA 2C68A 5KKRC 3EZVA 2XKDA 4WO5A 2E9OA 2B9JA 3OY1A 3AT3A 4RIWA 3Q2MA 3RK5A 4BDKA 5H3QA 5A4QA 3BHUA 3ZFMA 1FGKA 4D2VA 4AZFA 3P7AA 3RALA 4RRVA 4GJ2A 3HEGA 5HCZA 4D2RA 1WBSA 3C4WA 4R7HA 5HIEA 3HAMA 4D1SA 4EOIA 4D2PA 2GHGA 4UMQA 3UIBA 4AZWA 4E5AX 3CGOA 4ITIA 3TUBA 1OIYA 4LRJA 5EI2A 1G8JA 3E5AA 1P4FA 4HCVA 4E5BA 4BZNA 4CKJA 3UQGA 3FMJA 3R1QA 5J9LA 1A9UA 3AD4A 3WARA 5HCYA 3IONA 3R9OA 5FXQA 3FYKX 2W06A 2R3FA 2G1TA 3I5ZA 3UG1A 3NUXA 3Q3BA 5EM8A 5KKRB 2EB3A 4W8EA 3OD6X 2I0HA 3NUNA 4EOJA 1M17A 3WZJA 5BVWA 3KULA 3CLYA 2R3IA 4HZSA 3Q9XA 2SRCA 3R7IA 1JBPE 4IX5A 3PXQA 5DEYA 5TKDA 5IEXA 2W1HA 4LV5A 4KRCA 1OVEA 1UNGA 2WNTA 1OL5A 2XUUA 3V04A 2CNQA 3ZBXA 1W83A 4FTQA 2QG7A 1H08A 4AZVA 4AS0A 5BVKA 5JQ5A 2WAJA 4FIGA 5IISA 1GZNA 4M14A 4RPVA 4D2WA 3GVUA 4NEUA 4EOSA 4Q9ZA 4OTHA 5DE2A 3U4UA 3EQHA 4QMMA 4IWPA 4JLCA 2HY0A 4A07A 5L3AA 2JLDA 3TWJA 3DLSA 5HVYA 5EYDA 4QP1A 1OPLA 4RX9A 2YLEA 4YJNA 4Z7GA 2UW3A 3QTQA 4QT1A 3FE3A 3AD6A 3NAYA 2QQ7A 1Y91A 3MBLA 2PVMA 2HZIA 2H6DA 2JAMA 3I81A 3QZFA 2YHVA 2G2FA 3HGKA 3P78A 4R5SA 4BF2A 4JX3A 4FV1A 3GGFA 4U81A 2A19B 1JSUA 1UNHA 3R9DA 4H3PA 4AA5A 3SA0A 3WI6A 5EH0A 1VLRA 1QCFA 3ZSHA 2FB8A 1YDTE 3FXXA 3I0OA 3W2RA 5HGIA 3A60A 5DT4A 4YURA 1PXMA 5LOHA 3TIYA 3IECA 4KBCA 4FG8A 5A9UA 1R78A 4K77A 4PMSA 3EN5A 3O7LB 5I9XA 2H96A 2WFYA 2UZWE 4I6BA 4X3FA 2HW7A 4TZRA 4EUTA 3E87A 2J51A 5FEQA 2WIHA 5CU4A 2R3NA 1QMZA 4YPDA 4QTEA 3UOJA 1UV5A 4YO6A 5GJGA 3OF0A 4FL3A 3ATTA 2VO7A 4FSMA 4JX7A 1BI7A 5C8MA 4FGRA 3D7TB 4YLKA 1GNGA 2GNIA 3QTIA 3TUDA 4BCHA 5HNBA 4FKRA 3VBTA 2GQRA 4QPAA 4JR7A 2JDTA 2W5AA 4FKSA 4GH2A 2HK5A 3MFTA 4EORA 3QCSA 3QU0A 2QOCA 4FV3A 5AIRA 2YCSA 4TT7A 5AM7A 4IVDA 3QFVA 4JXFA 1WZYA 2CN8A 2W5BA 3FXZA 4KRDA 1UVRA 2VTNA 2XRUA 2ONLA 3NZ0A 4JG8A 1PYXA 3BCEA 3C5UA 4ACDA 5DPVA 3ACKA 4M15A 2FSOX 1OITA 4I21A 4U43A 4EK5A 3R0TA 2UW5A 5C26A 5DRDA 5HIDA 1WBNA 4LI5A 4WBOA 4Q9SA 3VS5A 3P0MA 3LXPA 4ZSEA 1SVGA 4OTFA 4ZZNA 4QP2A 5CNOA 3OY3A 3REPA 4MF0A 3P9JA 1H26A 4GYIA 3RWQA 3SXSA 3EQIA 4PPBA 4FKLA 5F95A 2OH4A 1XBAA 3LFDA 5EW9A 2XK6A 2IZTA 3A61A 4YTFA 4AWIA 4UBAA 2QU5A 5ANIA 3UVPA 3ULZA 1JNKA 4YZDA 4CTBA 5M56A 1M2RA 4BKZA 4BTFA 5HD4A 3VVHA 2O2UA 5H8EA 4BCQA 3ZUTA 4F0GA 4F09A 1M52A 2BIYA 2C6LA 4PX6A 4Q5HA 4X2JA 1W2FA 3IW8A 3FZ1A 3KXXA 4Y85A 3QXPA 4ZTNA 4FTMA 3PG1A 4I41A 4O6LA 4ACHA 1SNUA 4F65A 4DG0E 4C62A 1CSNA 2OF4A 2H8HA 2W1GA 3GCPA 3OBJA 3PVWA 3E8CA 5I9UA 1PXIA 2R7BA 4XNEA 5LCKA 4MXCA 3G5DA 4QP7A 4TWOA 4F70A 2IJMA 5L8KA 4HCUA 4RWKA 3BHHA 5FM3A 4V05A 3FZSA 1PMVA 3PWDA 1NW1A 2WQOA 4O7NA 4CRSA 5KX8A 5IQCA 3QRJA 3FLYA 4A4OA 4O7TA 1GIIA 4WUAA 3TTIA 1B38A 4AXAA 5IQBA 1DM2A 5CT7A 5DA3A 2NNWB 4F6UA 4Z16A 4YGAA 4BCOA 3SRVB 5IF1A 4S2ZA 4AACA 1CKJA 3B2TA 2W17A 2WB8A 3G9NA 3H9OA 3QRTA 4FTAA 3SLSA 2HXQA 3CGFA 3PXFA 2GNLA 2PYWA 3ZMMA 3LXLA 2O8YA 1Q62A 2PZPA 3SGCA 5AA9A 3H0YA 2ITWA 3F3UA 3UDBA 3KY2A 2XKFA 2PWLA 3WZUA 4F7LA 2C6IA 1W98A 3G6HA 1WBVA 1YXTA 2W1CA 4MXYA 4II5A 3EKNA 2YIQA 2BRGA 4RWIA 4BIBA 2UW7A 2J90A 1U54A 1TQIA 1PMNA 4ZLYA 4NWMA 3KIOC 5L8LA 2X8DA 2C5XA 3NYOA 1UKIA 2LGCA 4UYNA 5L2IA 2YZAA 3ENMA 2ETKA 4O7LA 2QKWB 3PP0A 3V5TA 4EHGA 3TYKA 2XH5A 1UU9A 4ACGA 1OKZA 3ALNA 2XBAA 3ITZA 4XUFA 4UXQA 4PTGA 4ENYA 5HCXA 4GK2A 5F4NA 3WF6A 3UYSA 1HCLA 1S9JA 3AMYA 4I5CA 4GVAA 3KXHA 4EYJA 3FLQA 3QKMA 3EQCA 5KMOA 5B2LA 2ITQA 2OSCA 5ACBC 3FLWA 4J8NA 2VWZA 3NFGB 3U6IA 2X9FA 5CF6A 3WZDA 4B0GA 3C4XA 2V7OA 3GC7A 4C4IA 2QG5A 2XYUA 3KF4A 5E1SA 3CBLA 4RIOA 4O27B 4RA5A 3KA0A 4FOBA 4NCTA 1VZOA 2PHKA 4IM0A 5DNRA 1MRYA 5J95A 5GJFA 4C8BA 5KMIA 4F6SA 3UMWA 5M51A 3UO4A 3WF9A 5HLWA 3ANRA 3R63A 4CT2A 2F49A 3P7CA 3QA0A 3SQQA 5I9WA 2YJSA 3ACJA 3L9PA 4YLJA 4YZMA 4Z55A 1LEWA 2KULA 3LZBA 3NVKI 3N9XA 1YI4A 4FNZA 1O6LA 1WBWA 2WOTA 3E93A 4GT5A 3R7YA 4DH1A 5J9ZA 2JKOA 4QYGA 3CR0A 4I0RA 4RZWA 2OJGA 4BI1A 3ORTA 5LVNA 4W9XA 2VO0A 5AUXA 4EYMA 4JL9A 3CD3A 4RIYB 4MWIA 5T3QA 5EOLA 2J0JA 4AOIA 3BL9A 4BI0A 4DH7A 5CWZA 5HO7A 4QTAA 1DS5A 4MNEB 2FVDA 2NRUA 3HRFA 4ZLOA 1OKWA 5C01A 4MAOA 3W2OA 4BICA 5KHWA 4CLIA 2IO6A 4IZ5A 4QP8A 1OI9A 4JT3A 4LOPA 4E4XA 5E8VA 1K3AA 5EW8A 3IOPA 5DR9A 1GZKA 2YIRA 3HX4A 4RJ3A 5I3RA 1OZ1A 4B6LA 2WXVA 2C6KA 2WTWA 4TWPA 4NL0A 4GJ3A 2WMWA 2OKRA 3VONA 3GC8A 1ND4A 3HV6A 4OT5A 3SAYA 2AC3A 4CD0A 2WMQA 1JVPP 3VS4A 3GT8A 2R9SA 1WCCA 4OR5A 4QYYA 5CY3A 5BVOA 2UW8A 3EIDA 3DAJA 4Y5QA 4Z9LA 4AOJA 4DGLC 1Z9XA 3NYXA 4G34A 4TYEA 2ZB1A 4FV7A 4L45A 4EONA 4FUXA 3MY0A 2Y6OA 4FC0A 4O0YA 4KA3A 4ZTHA 1H1PA 2XM8A 3FL4A 1Y6BA 3W2SA 4D2SA 2W1IA 5C1QB 1IR3A 5IH4A 3R8ZA 2ITPA 1OBDA 4ALVA 4F1OA 2VNYA 4ZSLA 2DUVA 1R39A 3TG1A 3FAAA 2J4ZA 4IB3A 4YTHA 3HZTA 3BEGA 3GBZA 3O23A 1OPKA 2G2IA 3ALOA 3HMOA 1Q41A 5CNNA 3QD4A 3PY1A 1V0PA 3ZXTA 4GT3A 4G3CA 1GJOA 1WFCA 4TXCA 4EH2A 4QMUA 3NVMB 4J1RA 4H1JA 4JBPA 3HAVA 2J6MA 1PMUA 3C9WA 3E62A 5CASA 4E5WA 5ANJA 3CTJA 4LMUA 2Z7QA 4D2TA 3WIGA 3S95A 5M09A 4QTDA 1NY3A 4FG9A 4BIEA 5CALA 4LG4A 4L00A 4QP9A 4KINA 2X2KA 3FI3A 4CFUA 5BX0A 5EKNA 4E6AA 1SNXA 4RVTA 1WAKA 1QPJA 4MEDA 4FICA 3CP9A 1TKIA 1UU8A 3HDMA 4N6YA 4BDFA 3D15A 2WMXA 4MKCA 2HWOA 5AEPA 4I92A 1CKIA 3CQUA 4A06A 2VTAA 4M67A 3DJ7A 2ITNA 2XKCA 2GHMA 2OJJA 3DXNA 3NDMA 4FL2A 4MXOA 4PNIA 5HNIX 3W2CA 3BV2A 5DWRA 5TO8A 4E7WA 5M08A 4IMYA 3UDZA 1PXKA 2OK1A 3NR9A 4AXFA 3TI1A 2DS1A 5EDPA 3LPBA 4S31A 4HVGA 4OTPA 3F2RA 2YM4A 5GHVA 4BY9E 3O5AA 4K1BA 3D2IA 4J52A 2GSFA 3U9NA 5FBNC 3Q2JA 2XALA 2X4FA 5CS6A 2WOUA 3MV5A 3SKCA 4FZAB 3R1SA 1BMKA 2QURA 3HDNA 4MTAA 3E7OA 3F3ZA 3M42A 4PDSA 5AFVA 2B9HA 3HKOA 3VULA 4BRXA 2BRBA 3DJ5A 3P23A 3RINA 5LVPA 3W0MA 2UZBA 2PVLA 3P5KA 4O0VA 1OGUA 3TCPA 4TNBA 1YHVA 4FZFB 4H1MA 5DGZA 4C4GA 2YDIA 4WT6A 3LJ2A 2E9NA 2XS0A 5IQIA 2VUWA 5LQFA 5I0BA 3QQKA 3GOPA 3M1SA 3RAHA 3VAPA 4AT3A 4BDGA 3QQLA 1NT2A 3T9IA 4EK8A 3AGLA 2GMXA 3V6SA 5L2WA 4FKWA 3T8OA 3M2WA 3MB7A 4YBKA 2BRMA 3B2WA 4CFVA 5D1JA 1J7UA 3UVQA 1BL6A 2PL0A 5EHLA 1TVOA 3CXWA 3GU8A 4QP6A 3T3VA 4YJTA 3V5QA 3WF5A 5IPJA 5LWMA 3PLAE 5FRIA 1AGWA 5JFSA 2IF8A 4EQUA 3FDNA 5BUIA 3QYWA 3ZOSA 4ZZMA 2PZYA 2B54A 4U5JA 3FYJX 2YABA 3DB6A 1P14A 2R3MA 1TQPA 3KCFA 4RQKA 5F9EA 5EQYA 4XG7A 4LL5A 4USEA 3LIJA 4FVPA 4WNOA 4WRSA 3RI1A 4E20A 3QKKA 4JRVA 5E8YA 4DHFA 5LJJA 4NYEA 1ST0A 1CMKE 2PULA 4U41A 3EB0A 1R0EA 1JOWB 4BL1A 3QTXA 2V5QA 4FK3A 1Y8GA 2W99B 4TYHB 5C8NA 3ORLA 2GFSA 3E92A 4BDHA 3FY0A 4EC9A 3FZPA 3VS3A 1Q3WA 2PMNX 3K3JA 3ZO2A 2XM9A 5I4NA 2QOLA 3F7ZA 2QODA 4FKGA 4J98A 3VC4A 5DT3A 3WF7A 3LVPA 3MB6A 1XH6A 3EMGA 4X2FA 5J7HA 4D0XA 3TNQB 3FHRA 3H4JA 4YC3A 3GU5A 4XOYA 2VTRA 3DQWA 2OIDA 4RX7A 3F9NA 4EH7A 3ZRLA 4K0YA 4RJ8A 2O5KA 4QEBA 1PW2A 4FV8A 1KE9A 2VWYA 3HA6A 5BMMA 1PMEA 1ZY5A 4G1WA 1XR1A 1R0PA 2V0DA 2XYNA 2E2BA 2E9VA 3F69A 3NCGA 4TRLA 2DWBA 3DK6A 2OZAB 2W4KA 3PVUA 4G5JA 1YVJA 3ORKA 3OCGA 3PUPA 1T46A 2PMOX 2Z60A 3QTUA 4S30A 5D41A 4ZSJA 4R1YA 2IW8A 3KEXA 3MJ2A 4M13A 5KMLA 4DTAA 4YTIA 3DNDA 2YDJA 4LYNA 4DFLA 4DHJA 3K5UA 4KIKA 3ZM9A 1DI9A 1VJYA 4NIFA 4U9AA 3UOHA 4U42A 1F3MC 3IDPA 3KMUA 5HIBA 3RKBA 4BJJB 5K5NA 2X0OA 3LM5A 2XAMA 2YWVA 5AUYA 5A4CA 5GZAA 3GCVA 3HMMA 3LFNA 1ZZ2A 2OZOA 1K2PA 3FZTA 4IAFA 4G3DA 2Y9QA 5J1WA 2BKKA 4ID7A 4O0TA 2BTSA 3R21A 4WRGA 2UW6A 2ZV9A 3BU5A 3GENA 2CMWA 1E1XA 2PE2A 3ZO4A 4F9AA 3RBWA 5FUTA 4QNYA 2UVYA 4DDIA 3RTPA 1YWVA 2O65A 4KD1A 2V62A 3GUBA 1REKA 3W0QA 2PZ5A 1GY3A 2OXXA 1XKKA 5IUIA 5D7VA 2PVFA 4APPA 5M4CA 3UDSA 2XJ2A 3HMPA 4YZCA 4BYJA 3LCTA 4ZOGA 4AA0A 3OW4A 4GMYA 3O8PA 4O82A 3RJCA 3BRBA 3L8SA 5EYCA 2YA9A 2ZM3A 3BGPA 4OAVB 3QD3A 4EBVA 3ATSA 1RJBA 4YHTA 5HLPA 2R2PA 1V0BA 4O4BB 5LARA 3EFKA 4BKYA 2BILB 2WTCA 1SVHA 4J95A 4NM7A 2LAVA 3W10A 1JKKA 1XH5A 3DBFA 2FH9A 1SMHA 3QRUA 1YXXA 3SX9A 3ZLWA 4UMRA 3CJGA 4IW0A 1H8FA 4JMQA 4O0RA 1Z57A 4WNMA 3EL7A 4FYOA 2OGVA 2CNVA 4IFCA 2F7ZE 2I40A 4ZAUA 3FEGA 4ZLZA 4PNKA 2R7IA 4DEAA 3LXKA 4X21A 2RSVA 5HE3A 4B8MA 3ORPA 3EN6A 4QQJA 1W82A 1GIHA 4GW8A 5DH3A 4I0TA 1A06A 5KMNA 2CKQA 1YKRA 4FV6A 4QMLA 5TR6A 3UE4A 2QCSA 3VQUA 3FJQE 4C34A 3RZBA 4EKLA 2C3LA 2XKEA 2XNNA 2ZJWA 4ANBA 1Q8WA 4LUEA 1UU3A 2XF0A 4RC4A 5AUTA 3DU8A 1IRKA 2ERZE 1I44A 4G9CA 3HMNA 3L8XA 3VW8A 2VWXA 4TN6A 2YEXA 3ORMA 5AAEA 5CU3A 4ZZOA 5K3YA 2PVNA 3IS5A 4CEGA 3H0ZA 4CCUA 5TE0A 3TTJA 4GG7A 5BYZA 3W1FA 4BBMA 2YIWA 3HP5A 4RGJA 4FV0A 4YO4A 5HLNA 3TJDA 4C7TA 5A4TA 3QQFA 4RG0A 1DAYA 2R3JA 2WTDA 3G2FA 2WMRA 2IZRA 3OXZA 4JRNA 5AJQA 3UDTA 4O4DA 2R3GA 3U6JA 2Z7SA 4CKRA 1ERKA 3FI2A 4E8AA 4JOAA 4LOOA 5G6VA 3DQXA 3PWYA 1AD5A 4PDOA 2ZV2A 4B99A 5CAQA 5BVFA 3EFLA 2QO7A 4FL1A 2BDFA 2A0CX 3W16A 5K0XA 2HIWA 3QHRA 3UO5A 1KV1A 4ASXA 3MGYA 3DBCA 3MWUA 2JDVA 3R28A 4RVMA 2J2IB 2UW4A 1LPUA 3HV5A 3OG7A 4PWNA 4D4SA 4L7FA 3D5XA 3KULB 5HHWA 1JKSA 4BZOA 3QTSA 3EFWA 3W18A 3CIKA 5ITAA 4MH7A 4G2FA 3U54A 4WUNA 3L9NA 4YLLA 4AW5A 2C5OA 2F2UA 1ZOHA 1IAHA 4IAZA 3FMKA 3VS1A 4JQ7A 4XG3A 5CEKA 4MBJA 2JDOA 3LJ0A 4IZYA 4C33A 3BE2A 5JFVA 3GI3A 4QQ5A 5ANDA 3GU4A 3QZIA 4EI4A 2PTKA 5CAPA 4LGHA 4U3ZA 3NCZA 2PSQA 3ZSIA 4QQTA 1PXLA 4YPSA 4O84A 2YISA 4H39A 3PXYA 1M14A 4HNFA 2XK3A 1MRUA 3DFAA 3DKCA 3GU6A 3BHYA 3NW6A 3FMNA 1QPCA 3R8PA 4D4VA 2GU8A 4BCPA 3C0HA 4G16A 4BHZA 3QCQA 4C61A 4O4EA 3PPZA 2E9UA 4QRCA 4KS8A 4V04A 5AUVA 3RPRA 3NIEA 3E88A 4QMYA 2RG5A 3OZ6A 3EHAA 2X39A 2BRNA 1F5QA 4H3BA 3ZO1A 4ANSA 3Q6WA 4CV9A 1VYZA 2WTKC 2BFXA 1XH9A 3ZC6A 5CLPA 4YC6A 5EYMA 4EWHA 4FTIA 3V5PA 2PUPA 2RG6A 4H3QA 4O86A 3DT1A 3AC3A 3WE4A 4OT6A 3VS0A 3PSBA 3R00A 1OGYA 3DBEA 3AKLA 5EQEA 4KNBA 4OLIA 5AR7A 5BNJA 1ZMUA 4P5QA 5AR5A 3NEWA 3UP2A 2OIBA 4W4WA 5E8TA 3LE6A 5I9YA 1BYGA 3BQRA 1H27A 3NYVA 3R7VA 3RZFA 4CSVA 2R3HA 2WTJA 3W8QA 4DCEA 5CF8A 4RLKA 3RCDA 4FKQA 4IZ7A 1PF8A 4KIPA 2XIZA 2WTKB 5M53A 2F57A 4HW7A 3NUUA 1CM8A 4EH4A 2C1BA 4HVHA 3SG8A 4IC8A 3A4OX 1ZRZA 4CRLA 1IEPA 2QI8A 3LOKA 4JDIA 3R83A 3OMVA 4F0FA 5A6NA 2WMVA 4NM0A 2GFCA 5HESA 2YZLA 1NVRA 2J0LA 2EUFB 2VV9A 3RWPA 4F6WA 4DH3A 3WBLA 2Z02A 5GNKA 4W8DA 4JIKA 4WA9A 5A46A 2OBJA 4PF4A 1V0OA 4F1MA 3N51A 4X0MA 1XH4A 5CXHA 4CT1A 5HX6A 3GQIA 3MVJA 4WNKA 3ZZWA 4EK6A 2CKEA 3PTGA 5D10A 3PJ2A 5C8KA 4O96A 3N4VA 5GZ8A 3HUBA 3EYHA 4XJ0A 3D83A 5AR4A 4M12A 4C4FA 2HENA 3OCTA 4DEHA 3TM0A 4R5YA 2YCRA 5ETIA 4QMTA 1PXJA 2BAQA 2ETMA 3FZRA 3F3WA 4OTWA 3U4WA 2F9GA 4FTCA 4E4MA 4EQMA 4BTJA 4P2KA 4HVDA 4FF8A 4I5PA 4PP9A 3E63A 3OWJA 4JDJA 4UWCA 3OUNB 3NW5A 3PYYA 1FVVA 2IWIA 2UZEA 3CY3A 4K9YA 4XS2A 4FOCA 5BVNA 3OS3A 5AV2A 5HD7A 1MP8A 2PK9A 2H34A 4YBJA 4BCJA 3JPVA 4FYNA 3HYHA 3UG2A 4DFZE 4C4HA 1J7LA 3PZHA 3ZC5A 4U79A 4TKSA 4ZS0A 2X8IA 5DEWA 3I0QA 2QO9A 2QONA 4EOLA 5M57A 3QKLA 4KKHA 4CFWA 4IACA 5CAUA 2VZ6A 1LP4A 2UZLA 1ZY4A 2O3PA 2WTIA 4FTJA 3G9LX 5IA5A 2OH0E 4EOPA 4XP2A 1YXVA 4K2RA 4Y72A 2C3KA 3OXTA 4HGEA 5BMSA 5B7VA 4HCTA 5HBHA 2R3KA 4A7CA 4C3FA 3FMHA 4FSTA 5AX3A 5HG8A 2B52A 4EK3A 4IADA 1KE7A 4Q2AA 4WBBB 4MXZA 5JGAA 2X7GA 4O1OA 4DH5A 1H1RA 3VUGA 1FOTA 1JLUE 2XIKA 3PVBA 4AE6A 4IWQA 5E1EA 4M0YA 5AP0A 4LMNA 5KE0A 3UIMA 4KUJA 3ENHA 3LFAA 3RPOA 2IVVA 2JD5A 4HJOA 4MQ2A 4U45A 2JITA 4E4NA 4YJPA 5A4EA 2UZTA 4QYEA 5E8ZA 4J99A 5M4UA 2NYAA 4N70A 4ZY6A 4WSQA 3C4FA 4GG5A 1OM1A 5LMKA 4ORKA 2AYPA 4YP8A 3WIKA 3L9LA 3S4QA 1H28A 4PL3A 3MN3A 2XARA 1P5EA 2WELA 4QMNA 4FSZA 3U8WA 3QD0A 3KVWA 3TV4A 4XCUA 2VTSA 4AW2A 4AXEA 3KCKA 3QLGA 2YDKA 1H07A 2ITOA 2QLUA 5HG5A 4A4LA 2X6DA 3G51A 2O63A 3QF9A 4LRKA 4D5KA 1OL6A 4EZ5A 5HQ0A 3AXWA 5IQEA 4IAKA 3NMUF 4BZDA 1A48A 3LFEA 1YOJA 3AOXA 3P86A 4JQEA 4M3QA 4C37A 4IWOA 3PP1A 4G9RA 4F7SA 2NP8A 4FSWA 4NCTC 5L6WL 1XH7A 3LXNA 2PY3A 4I22A 4O0UA 5DN3A 4YC8A 5ETAA 5I3OA 5CANA 2GNJA 4ERKA 5IEYA 4NKSA 3RPYA 4EHZA 4EOMA 3VS7A 4R7BA 4DLJA 4L7SA 3D5UA 3R8LA 3S3IA 5CQWA 2F2CB 3LFCA 4GKHA 2GHLA 4B9DA 5EM5A 5E90A 4DBXA 2C30A 5CU2A 3QGYA 1Y6AA 3NSZA 4G6OA 2BZHB 4FK6A 1Q8TA 4KAOA 2ESMA 2VTLA 5EYKA 3KKVA 3BYSA 3ZXZA 5FEDA 4HYIA 4CFMA 1IA9A 4ENXA 2HELA 3LM0A 4XYFA 5CEQA 4D5HA 3BI6A 2C5YA 3VHEA 5CQUA 2XEYA 5GINE 4R6VA 4WHZA 5HO8A 2YERA 2C6MA 5CTPA 4BC6A 2YACA 5LVOA 2WMUA 3C13A 3QZHA 4RJ4A 2REIA 3VRYA 4PRJA 4C58A 4CMOA 4WKQA 3RVGA 4ZJJA 4AT5A 5M06A 2BHEA 3BKBA 4O7YA 4EH5A 5JRSA 4LFIA 2YLFA 5ICPA 1L3RE 1OL1A 3RGFA 3MH2A 2P4IA 3DBQA 4JDHA 4ZS4A 5H2UA 1OIUA 3E8NA 3OWPA 3C51A 4UZDA 2J7TA 1TZDA 2J0IA 3LQ8A 4O0SA 4UALA 3R8VA 3LFSA 4BGHA 4ZY4A 3BIZA 3PSCA 1JPAA 5IA2A 4AQCA 1O6KA 4S32A 4U7ZA 4UZHA 4I3ZA 4OTQA 3Q5ZA 4U44A 2DYLA 3QZGA 2RFEA 2WU6A 3FLSA 1M7NA 4OTGA 2OXYA 4L46A 3UZRA 4FTOA 3IKAA 2OICA 5E91A 5EOBA 1Q99A 2XNOA 4L43A 2ZAZA 5FG8A 2CLXA 5AP6A 2R0IA 5J8IA 2QD9A 4W9WA 4HNIA 1PXPA 2JKKA 4NH1A 4O1PA 3TEIA 4ANNA 4NFMA 2X2LA 2XP2A 3T3UA 2BIKB 3ELJA 3DBDA 2EXMA 4MD9E 4A9TA 2X2MA 3FI8A 2WTVA 3OUKA 4OBOA 3W2QA 3WYXA 4MYGA 3THBA 3EYGA 2PZIA 3MYGA 2GPHA 2P55A 3QC4A 2QHMA 4HPTE 3IW5A 3DZOA 5A6OA 4DDGA 4M8TA 1YOLA 3QD2B 3D7ZA 4KS7A 4XLIA 4AAYA 3IDBA 5KBQA 4I5MA 5KHXA 1XWSA 2QOQA 4IM3A 4FE2A 2QOOA 1CDKA 3VUKA 5A3XA 4FTKA 2VTTA 2WZJA 4FT5A 4O6EA 1Q5KA 2OJFE 4R7IA 2OIQA 4AE9A 2WIPA 2A2AA 4GVJA 4AW0A 3COKA 4USFA 2HW6A 1G8AA 2IPXA 5E4HA 3V5LA 3D5WA 1XJDA 3MPTA 4XOZA 4XP3A 3JXWA 3BU6A 1IASA 4X3JA 3FMMA 4BDBA 1XMLA 2PUUA 3UQFA 3OCSA 2R3QA 3G0EA 3DTWA 2W1EA 3Q5IA 4EL9A 1U5RA 3UIXA 3ZTXA 2XNBA 5KBRA 4AA4A 5IQAA 3VUDA 2UZUE 2ZDTA 3TXOA 4TPTA 3VBQA 3NPCA 2A27A 2R3RA 2VAGA 3DFCB 4R77A 5L4QA 2C6DA 4YHJA 1H24A 5GIPE 4IWDA 5CAVA 1OL2A 4FT3A 4IXPA 4NTSA 5GIOE 2JDSA 2I0VA 4A9UA 4I93A 2XK9A 3L9MA 2OFUA 2OU7A 4FIFA 4O0XA 3DXPA 4E6QA 3MTLA 2YWPA 3FWQA 4F1TA 1Y57A 2OW3A 2BZJA 4GFGA 4BTKA 5JGBA 4IQ6A 4MXAA 4EHVA 3OCBA 4QMPA 4NM5A 1BL7A 4IVBA 3I5NA 4FIEA 4C36A 1KWPA 4IEBA 4KKEA 3ORXA 2PVHA 4PDYA 3QUPA 5JFXA 2FUMA 1S9IA 4C4JA 3KRWA 4PMPA 2XIXA 3W33A 3NAXA 4R8QA 4CZUA 3Q96A 3MPMA 2OWBA 1WBOA 2JFLA 4RSSA 4DEGA 4FT9A 4QO9A 4UEUA 4FSNA