2VO7A

Structure of pka complexed with 4-(4-chlorobenzyl)-1-(7h-pyrrolo(2,3- d)pyrimidin-4-yl)piperidin-4-ylamine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 107
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vo7A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vo7A02
1H24A 3PG3A 1GZ8A 1Z9XA 3CPBA 2R7BA 3H0YA 5J1WA 3VHEA 3IW5A 3VO3A 3KF4A 5HO8A 1XH6A 1TKIA 3TACA 3MFTA 5K4JA 2F4JA 3BE2A 3Q5IA 4NM7A 5AR5A 4PL4A 3ZFYA 2NRYA 2BZHB 1J1BA 3SXRA 4LL0A 4DTAA 3QTZA 1YDSE 3QHRA 2OLCA 4X2KA 4XG2A 3POZA 4KB8A 4XV3A 5TT7A 2WNTA 4C4HA 4M67A 5M4IA 4ID7A 3SOCA 2F7XE 3FL5A 5KCVA 5AM6A 3OWKA 4WNPA 3VF8A 5I9YA 3AD5A 2OIDA 4M3QA 4H58A 1OBGA 4W9WA 3TV6A 5CU6A 2RFSA 4RIXB 3GB2A 2W99B 1FGKA 4PNIA 4JBQA 3CSVA 3LE6A 3O0GA 5C26A 1ZZ2A 4NM5A 4ZTMA 4QMZA 3E64A 1CSNA 3HAVA 5HZNA 3D94A 1J1CA 3AD4A 3HNGA 2VTTA 5J9YA 5HNIX 1PMVA 4RWIA 4FIHA 2W4KA 3R2BA 3K5VA 3RM6A 3P08A 4OT6A 5GIOE 5KUPA 3OWJA 3PZEA 1BKXA 4FV0A 2QD9A 3DZOA 3UZPA 3WF9A 1U46A 2GHMA 2JDVA 2WMXA 4CLIA 3OMVA 5CXZA 5L2QA 3VQHA 3UOLA 2G9XA 3DBQA 5CAUA 2R3IA 4DBXA 1XKKA 4FNZA 4LG4A 1OIUA 5KNJA 4U7ZA 3S1HA 3C0GA 4O7SA 5HU3A 4MF0A 4AZTA 3IW8A 3WF8A 2VX0A 2OH0E 2JKKA 3KCFA 4I41A 4PDOA 4C34A 1ZXEA 4BDAA 2CJMA 3D14A 2CN5A 4QYHA 2DQ7X 4GSBA 4HYSA 1RW8A 3KVWA 1V1KA 4IX4A 3RMFA 4AZVA 3UVQA 4CT1A 2UW5A 4CTCA 3U55A 2YM8A 4UMRA 2YHVA 4GK4A 4E4LA 3QXPA 3EMGA 3R21A 1WBPA 3F7WA 3R8UA 1A48A 4CRSA 4AZWA 4CG8A 2WTJA 4EHVA 4ACCA 4K2RA 5FEEA 3FHIA 1VZOA 5CQUA 5EQEA 3W2QA 4GUEA 1WBNA 4FVQA 1APME 1O6KA 1PHKA 3MPMA 4AAAA 3LM5A 2HXLA 5HCYA 3DDQA 3QZGA 5TF9A 3O7LD 4G3FA 4RC3A 3KF7A 3UBDA 2FUMA 1JNKA 2ETKA 4R1VA 4WRSA 4AOIA 5D1JA 4QMOA 2C3KA 3UYTA 4DGNA 4CQEA 2QNJA 2R3QA 2O8YA 3G15A 2GCDA 4KRDA 1UKIA 4FIFA 4J98A 5DLSA 5G6VA 3R83A 3NW5A 2OJGA 2W4OA 4RWKA 5AX3A 1M52A 4X7QA 2C0OA 4X3JA 3GC7A 4YMJA 1Y6BA 1VJYA 3JYAA 2JAMA 2E9VA 1P5EA 1KWPA 3FZOA 3G9NA 3HECA 3ORLA 5EM5A 5FM2A 4EYJA 1OVEA 5FXQA 3QD2B 3L8XA 2VAGA 4FYOA 3FKOA 4O0YA 1CKJA 1CM8A 1OIRA 5DIAA 5L4QA 5M53A 4XG3A 4RWJA 2R5TA 5A4QA 2PYWA 4LOOA 3VBXA 4XRLA 3AD6A 4G9CA 2UV2A 2X9EA 3ZBFA 3ATTA 5IQBA 3PLAE 2PY3A 1LUFA 2QOOA 5KKRC 4S30A 5EYMA 4DEHA 4MK0A 4I6HA 3OEZA 2GHLA 5M44A 4Y73A 3K2LA 4AFEA 4S2ZA 2UW7A 4FT7A 3RPYA 2CSNA 1SVHA 1PXMA 3TCPA 5FTOA 1QPJA 4KSPA 5AM7A 4YJUA 1H0VA 4MWHA 1XBAA 1JBPE 3EQBA 5AR8A 5KMOA 3SQQA 5DE2A 4LOQA 4FV2A 4E6CA 4O83A 3UG1A 3R7UA 3DDPA 3LM0A 3IECA 4IZ7A 5AUYA 4BI1A 5HTBA 4OW8A 4FL3A 4MQ1A 4L6QA 4EOIA 3KCKA 2XA4A 1PRYA 1YW2A 4FSNA 5EW3A 4DG0E 1YDTE 2VTJA 2W1GA 3E3PA 5L8JA 3RZBA 1O9UA 4AFJA 5ANIA 2H96A 4D1XA 2I7QA 1REKA 3DKGA 2ITNA 5GHVA 1XHAA 2XH5A 1U4DA 3FLWA 3MPTA 3NUNA 4W4VA 2JKMA 1OL6A 1XH5A 2VGOA 5DOSA 3S0OA 1Z57A 3LCTA 1YXSA 2YLEA 2IZTA 4YLKA 3D7TA 5H8EA 3FAAA 3PXFA 5DR2A 5HNGA 3H9FA 3B2WA 4RMZA 1Q8UA 3IQ7A 3MDYA 4BDKA 3R9DA 2FSTX 2W96B 1IG1A 2IN6A 4WKQA 5TO8A 3WE4A 3NMUF 5TE0A 4BL1A 2R3LA 3KRXA 5HTCA 4KINA 4PNKA 4R77A 1ZOEA 1U54A 3I60A 3II5A 5CI7A 3VULA 2W5BA 2VN9A 2XKFA 3KULB 1OIYA 3SW4A 3QBNA 3TZMA 2Z02A 4XLIA 2EXCX 3LFDA 5CQWA 4AN3A 4TNBA 2QOHA 4FOBA 3ORZA 3COHA 4I23A 4G9RA 4L3JA 2QLUA 4A9YA 3FLYA 4CEGA 2W9ZB 3QQUA 4D2TA 4EH2A 3KK8A 3MJ1A 3G6HA 5BVEA 5DYJA 2BZKB 4BWKA 4RBLA 3EZRA 4DN5A 4ZY5A 4XRJA 4BGGA 4GYIA 2CGWA 4EJNA 2UVZA 4HPUE 2CNVA 3ACKA 3FSFA 1P4FA 5HLNA 3AQVA 3LCKA 4IAFA 4LL5A 3N4VA 1FBNA 3N51A 4IWQA 4U97A 3FQEA 5AV4A 3O96A 2J50A 3E93A 3OY3A 5LOHA 3MB7A 1P4OA 4IZAA 2B1PA 2X0GA 3FJQE 4FKRA 1K3AA 3VUTA 3SGCA 2G2FA 3PUPA 2JD5A 3QUEA 3CD8A 3KGAA 2ZM1A 3L8VA 1DAWA 3BBWA 2ITVA 3I7CA 5JK3A 5EM6A 2XNOA 4DH7A 1NW1A 4XV2A 4HVHA 4AW5A 1H27A 4UMPA 5FP6A 3SAYA 5BYYA 3UIMA 4EOJA 3SVVA 4W4YA 3VUIA 2HWPA 3FXWA 4FSWA 4IM0A 4FEVA 3EN7A 3CLYA 4Y5HA 3G9LX 3QQKA 2XJ0A 3HA6A 1OL1A 3RK5A 4HVSA 3TG1A 4RX7A 3V8TA 1NT2A 3H30A 3QX4A 4ZJIA 1ZYLA 4LUEA 2W9FB 5HKMA 2CPKE 4RJ3A 5JFSA 4H1MA 2UW8A 4E5WA 2JFLA 5E1SA 3ZM4A 2ACXA 4XUFA 3R1SA 2XYUA 2XNEA 1H4LA 1LP4A 3W55A 3D7TB 4DLJA 3U6JA 3N4UA 4PP7A 2WEIA 1GZNA 4UBAA 4FKWA 4BWXA 4RJ5A 3F3WA 4YTHA 4DF3A 3BLRA 2HZNA 2VTAA 2O0UA 3QQHA 5H8GA 4ZSAA 5KMKA 3QRKA 2PK9A 5AADA 3EN4A 3LFFA 4MXAA 5IG1A 5HICA 1U54B 5A6NA 4YNOA 3OTVA 2C0TA 4P5QA 2OFVA 3OBJA 4UB7A 3TZ8A 1BUHA 4BC6A 3DAJA 4I4EA 1IAHA 2BRMA 2CLXA 1UWJA 3BYVA 3R8MA 4MXCA 4BZNA 3P7AA 3NEWA 3Q4TA 3EN9A 3DK3A 4C4JA 3V6SA 1OPKA 3NUSA 3M42A 2WQEA 2UZUE 4KIKB 3CTQA 4MBIA 5HIDA 5AP3A 5HG8A 4H3QA 4HYHA 4P4CA 3DLSA 5BNJA 4ZMEA 2A0CX 2FGIA 3BHUA 4FKGA 1JKLA 1GJOA 3I5NA 3BHHA 1OKWA 2ITUA 2PMLX 3GOPA 4DTKA 4G2FA 3KXMA 5HORA 2OWBA 4GYGA 4F7NA 3FLQA 3O71A 2PULA 2GNHA 2XM9A 2P55A 4I5CA 3ZSHA 3ULZA 4EC9A 4O6EA 4DGOA 5J9ZA 5H9BA 5FBNC 5EOLA 4WD5A 4DGLC 2BIYA 3QRTA 4XMOA 1LPUA 2YITA 3C4XA 5J79A 4D4YA 5HO6A 5AX9A 4IC8A 3PXYA 1PYEA 4CLJA 1YOJA 2CHLA 5B2MA 4X3FC 4AGUA 3E88A 4AN9A 3MFRA 4F6SA 4F08A 4OGRA 3HUBA 3F2RA 2YA9A 5LVNA 4BR3A 4ZLYA 3GC0A 5C03A 4FE2A 3F5UA 2CKQA 2HZIA 3CPCA 3CJFA 3IDPA 1WFCA 4HJOA 4I5HA 3GCSA 4F1OA 3LQ3A 4PV0A 1R0EA 4CV8A 3W10A 4CVAA 4FIJA 3QTRA 2YWVA 3UZRA 1H0WA 2UW3A 3RAKA 3AMAA 2GS2A 5C27A 3DKOA 3LMIA 4UMQA 4WSYA 5IMEA 1ZY5A 4TWCA 2XBAA 3KL8A 2X7GA 5AP2A 1VR2A 4LOPA 4QMUA 4HCUA 3OT3A 4QQJA 5I0BA 2C6TA 3PVBA 4O1PA 3BYMA 5CNNA 4IVBA 3B8QA 3QCXA 3JUHA 4DH1A 5F95A 1E1VA 3HMNA 4XCUA 3HDMA 3MTLA 5L6WL 2ETRA 5IA0A 3HX4A 3QC9A 1DI9A 4JIAA 4O0VA 4PPAA 4FT5A 4IM3A 3SKCA 1NA7A 4BCIA 1WZYA 3PY0A 1Q24A 3PZHA 4FSZA 2GPHA 4BTFA 3PP0A 1M2QA 3LJ0A 4RSSA 4CTBA 5DT3A 4Y95A 2PL0A 3DK7A 3LFCA 4GU6A 3D2KA 3MA6A 3R6XA 1KE7A 2YJSA 1L3RE 1ZAOA 2Z60A 5D41A 3SLSA 2XK7A 3GXLA 2YM6A 1ZMWA 2OBJA 2QCSA 2R7IA 3DLZA 3MA3A 5DN3A 3CBLA 5J8IA 1G8SA 4EZ5A 3NVKI 2CNQA 1J7LA 1OMWA 3E7OA 4Y83A 5E8SA 4DFXE 4OBQA 5AV0A 1YKRA 3QRIA 2C5OA 3LCSA 4P2KA 4EK3A 3L9PA 4LGDA 4KABA 4I6FA 2A2AA 2Z2WA 2YAKA 2W0JA 2E2BA 4FTLA 3OCSA 4RLKA 2ONLA 4GG7A 5ANOA 4B8LA 2X8EA 3DBFA 3LAUA 3DKFA 3TUDA 3UODA 3CS9A 3RBWA 4D2PA 3NR9A 4U43A 1WBSA 4L3PA 3HP5A 4FL1A 2G2HA 3BLQA 3PPJA 4XHKB 5AUXA 4E5BA 5BQ0A 5JGBA 5M57A 4UMTA 5JSMA 3F3ZA 1S9IA 1YXTA 3H0ZA 2ZM4A 4RVTA 4TKSA 3ZLYA 2Z7RA 4ALUA 3ENMA 4FKOA 4YJOA 3GBZA 5IQEA 5CVHA 4EJ7A 2ONLC 5DEYA 3TKIA 4YZCA 3QTXA 2FSLX 3RCJA 3KXXA 3MVLA 1M17A 3EKNA 4BCJA 2I6LA 4QMXA 3ORTA 3RVGA 4DEAA 1H1QA 4CT2A 2PSQA 2UUEA 2XK6A 3PWDA 4KA3A 3RCDA 4MXXA 4FKPA 3FMEA 4CKRA 3V3VA 5AR2A 1FVRA 2OU7A 1WAKA 3DKCA 3KXZA 4DA5A 1UU3A 3LFAA 4JAIA 3LMHA 2GHGA 2PWLA 4O0XA 4EBVA 2C5VA 4DH5A 4XNEA 4U6RA 1QMZA 5AP4A 3QUPA 3VIDA 5CALA 1PW2A 3FMJA 5CZHA 4L7FA 1QPCA 1FOTA 2W1DA 3HV7A 4BYJA 4UN0C 3SA0A 3PRFA 3R7VA 4A9UA 1IASA 4UY9A 4EK8A 4Q9SA 4CMUA 2VWYA 5ETIA 4BCNA 3U87A 2XIRA 3ORMA 3JVSA 3BWFA 2XCHA 4EOPA 4CFWA 5KMMA 3D2IA 4RVMA 4E4MA 4R7IA 3F7ZA 3SG9A 1UNLA 3GU8A 5CAQA 2OF2A 4EH7A 4IFGA 3E5AA 2RG5A 1S9JA 4IX5A 4DH3A 1WBWA 3ZO2A 2VNYA 5AWMA 4HZRA 4M12A 3N9XA 4FTKA 3VS5A 5I9XA 2VTMA 3R7IA 3UP2A 3FEGA 4AG8A 4GU9A 4EH6A 1PXKA 3TUCA 2IZRA 5FRIA 1H26A 3PY1A 4QMQA 2GTNA 3FV8A 4IJ9A 4CFNA 2YIWA 3KRLA 4M13A 1ZY4A 1OITA 2WMBA 3QQJA 3C4ZA 5EDQA 5JRSA 5AUUA 4U9AA 3GEQA 2OICA 3W2OA 1Z5MA 3QKMA 4XEYA 4JJRA 2J0LA 3DXQA 4D2SA 2UW0A 3Q9YA 4PMSA 4F09A 4KIQA 1PXIA 3UJGA 3BRBA 1IEPA 1PXPA 4IX6A 4IMYA 4ZSGA 4EUTA 5EH0A 4OTDA 3G2FA 3N4TA 5HQ0A 2BUJA 3F3VA 3WF7A 3QTUA 4M84A 3Q32A 4CXAA 4ARKA 3FBVA 1TQIA 4MH7A 5F94A 1M2RA 2WIPA 4KD1A 4KIPA 1Q8TA 4TN6A 4C33A 2X7FA 3D5WA 2R3MA 4J7BA 4R3RA 4FA2A 1K9AA 1MQ4A 3DCVA 4WG4A 5EK7A 2WMTA 4HGLA 4IBMA 4GKIA 2B9JA 4M14A 3FMDA 3R9HA 2WEVA 4KNBA 3WZDA 3P7BA 3TWJA 1OPJA 4TWOA 3I1AA 3COKA 3EQPA 2V55A 3LFBA 4YC8A 4PL5A 4RIWA 2OJJA 3E8EA 3Q4UA 2QO2A 3R7EA 5M06A 4C3FA 1E1XA 2Q83A 2X6EA 3U4WA 4GCJA 2VTPA 2BTRA 4CQGA 5CEMA 5EHOA 4FV4A 5HIEA 4HGSA 5BVDA 4FTQA 4BI0A 3ZO4A 4AW0A 4QP1A 1SVGA 2XNGA 3DJ5A 3NIEA 2OKRA 4XG9A 3OG7A 3IG7A 3E92A 2J51A 4APPA 3LJ1A 3GC9A 5FG8A 5C8KA 5T6KA 5KMJA 4M7IA 2QG5A 2GNIA 3ALOA 4OR5A 1PXLA 4FUXA 4D28A 2YDKA 3BYOA 3R22A 2P0CA 3PSBA 1P2AA 5KBQA 1JLUE 4E6QA 1UA2A 1UU9A 5A6OA 3HRFA 3MESA 4PX6A 4L3LA 4F70A 4ACDA 5JN2A 4TL0A 2QO9A 4FSUA 4QNYA 3AC5A 4E26A 4K77A 3EQFA 2RF9A 1NVSA 3IDBA 3R7OA 4KAOA 4Y5QA 2BZIB 5CX9A 4AWIA 3FDNA 1OL5A 5FDPA 2PUIA 4TW9A 4CFMA 5A4LA 2PZIA 1ZMVA 4OTQA 5LVMA 1ND4A 4WUNA 3Q60A 4Z3VA 4BYIA 4EK5A 4MYGA 3VS6A 4ANBA 3OXTA 3FI2A 2O63A 3QUDA 3V5LA 2ZOQA 3QC4A 4AA5A 4E4XA 3HZTA 3I5ZA 3P86A 4FG8A 1H25A 2SRCA 2YISA 3AC3A 4O1OA 5CLPA 1H8FA 4EZ3A 3ERKA 4YPDA 1YWNA 4QMSA 5CF8A 3OBGA 3KRWA 4BDEA 5J7HA 4DC2A 4ASDA 2C30A 3VUGA 4MBLA 1GNGA 3KMUA 3QRUA 4F1TA 4LYNA 4O81A 2B7AA 4BTJA 3D15A 3SW7A 4ITIA 5E1EA 3WF6A 4U8ZA 3BKBA 4K1BA 3L8SA 2AUHA 3SDJA 3WZEA 3EYHA 4U44A 5BVOA 5K9IA 3F5PA 4FV3A 5CSHA 4BB4A 1LEZA 3E8NA 5FEDA 1IR3A 4IAZA 4USDA 3O23A 2IVTA 2WMUA 3VBQA 4TWNA 4I0RA 3HMIA 4HPTE 3G51A 4DCAA 4RJ7A 2F9GA 5CNOA 5E7RA 2CKEA 3BU5A 4J99A 3VHKA 4RIWB 4G16A 3PJ1A 5D9HA 2PVRA 5BVWA 5DH3A 5KMNA 3QQLA 3E7VA 5FUTA 5J95A 3HUCA 4AX8A 3R02A 1FMKA 3I7BA 2XIXA 5M4UA 3OW4A 5CU2A 2W5AA 1M14A 1V0BA 4DFZE 3IONA 2Y0AA 2OFUA 3COMA 4O2ZA 5FP5A 5HX8A 1G5SA 2VTOA 4G34A 4Z16A 4C35A 4QMYA 1MRUA 2X2MA 3ZS5A 3OW3A 4RQKA 4GVAA 3PJ8A 2J2IB 2IW9A 3ZTXA 5JKGA 2BILB 4QOXA 3HDNA 4P7EA 3C5IA 4O7TA 2DWBA 4DEDA 2QI8A 5KE0A 1Y57A 2C6MA 4L45A 4WBOA 4EUUA 5CY3A 3FQHA 3FZSA 4UALA 4KUJA 1PXNA 2PUNA 5T3QA 2HW6A 3BHTA 4YU2A 2CNUA 3DNEA 5K5NA 3LXPA 5BVKA 2WB8A 3RPSA 3HVCA 3K5UA 2BHEA 3GP0A 2BKKA 2ZV7A 2ITZA 4H39A 5HOAA 4HZSA 4A9RA 2HK5A 4QRCA 2UZBA 3CEKA 3D7ZA 4IHPA 3RWPA 5CAOA 3ID6C 4RJ4A 3DBCA 1KOBA 2YIYA 3JVRA 3FY2A 3MN3A 3SX9A 2YIQA 5BVNA 4FKQA 3AGMA 2X7OA 3QAME 4TXCA 5EI8A 3ZLWA 1SM2A 4U5JA 3DV3A 4YURA 3UO5A 1ERKA 4W8DA 4LRMA 2ETMA 5L2IA 3R9NA 4JBPA 3FHRA 5EI2A 3WI6A 5M56A 3BE9A 3HRCA 5K5XA 4IFCA 5HBJA 4FNXA 1XBBA 2X2LA 4RFMA 2YDJA 5EKOA 5EW9A 2R3JA 4F9AA 3VUKA 3NWWA 2RFEA 3DBEA 4BHNA 5BYZA 2OXDA 5EW8A 3AT2A 4NL0A 1CMKE 4AA0A 2PMOX 2FSMX 4WNKA 1OL2A 3PY3A 2ZB0A 4QP9A 4BKZA 5F4NA 1AD5A 2B0QA 3NNXA 5L3AA 3KN5A 4QYFA 4FKIA 4AXAA 4CKIA 2DUVA 3IK3A 2VTSA 4HNFA 5AUVA 2I0EA 4CD0A 3OP5A 2HCKA 1HCKA 2XF0A 2ZVAA 3PG1A 4MXOA 5EHYA 5FDXA 4AE9A 3MY5A 1F3MC 5CEQA 3LW0A 3D5XA 3RPRA 5CEIA 2V5QA 4B8MA 3ODYX 4J71A 5EHLA 4C38A 4QTAA 4DFYA 2LAVA 4U80A 1IAJA 4C62A 4JVGA 1GIHA 1OKZA 3CY2A 4PL3A 4QPSA 2FB8A 2G1TA 3GCQA 4UWYA 4YC6A 4F63A 5LVOA 4BHZA 4IB0A 5M09A 5IQGA 3OXIA 3QZFA 5KMIA 4CZTA 1GZOA 4KSQA 3PPKA 4CSVA 3OOMA 3HMOA 2PVHA 4AT5A 5E9EA 2P4IA 4X2FA 2XB7A 4F7SA 4CKJA 1X8BA 1YI4A 5CZIA 4FGRA 2HZ0A 1UKHA 4LV5A 2JKOA 3H4JA 4C8BA 2WMVA 1L8TA 5I9WA 4A9TA 2BRHA 3ANRA 3MH1A 2C6LA 3CIKA 3MWUA 4AOTA 1KOAA 1W0XC 3AT3A 5HVJA 3DGKA 1DS5A 4IH8A 5C9CA 4FX3A 4DT8A 1OECA 1UNGA 4JOAA 5CXHA 3LCOA 4IAKA 4PQNA 2XK4A 3VUDA 4F6WA 1YI6A 3TKHA 1Y6AA 4XBUA 5CU4A 1JPAA 3FL4A 5IH5A 1JQHA 4NUSA 1G3NA 3EFJA 3F69A 3QHWA 5HG7A 2R3NA 2PU8A 3RGFA 2J7TA 2P3GX 4D9TA 3KREA 3TXOA 3FZRA 3VS1A 2WZJA 3IW7A 2VUWA 5HNBA 3T3UA 4FKVA 3V5QA 2OI4X 4FTIA 3W33A 4HGTA 4FZ7A 5EM7A 4F1MA 1YI3A 2PVNA 4FSQA 5D7VA 2JLDA 4A7CA 3MTFA 2ITQA 4U79A 3T9TA 3PRIA 3WOWA 1Q41A 4QPAA 5E92A 4NYEA 5HD7A 4FTOA 2H8HA 2YDIA 4E7WA 5HE2A 5CEKA 4W4WA 3FXXA 4NT4A 4G3CA 4XX9A 4HVGA 2C68A 2PHKA 4NM0A 5JT2A 4ANOA 2W1FA 3R2YA 4F9YA 3O8TA 4J8MA 3MVMA 5BMSA 1ZOGA 4NIFA 4ZIMA 3FPQA 1OKVA 5ANGA 4ACHA 3TTJA 3OTUA 1Q97A 1U5QA 4QPMA 5AV2A 3C4CA 3QGYA 1OB3A 3EFWA 3E63A 4LMUA 4MEDA 4IVCA 4GT4A 2R0UA 4OUCA 4AA4A 1W98A 3BEGA 4FTCA 4LFIA 3W16A 3VBVA 1ZZLA 3M1SA 5BPYA 4WOVA 4CRLA 3TNPC 3UNZA 4BIDA 3DBDA 4FT9A 2PVFA 3NLBA 4G6NA 2CKOA 4NH1A 3PTGA 4XG8A 3ZBXA 3Q6WA 2VNWA 4NKSA 4EH8A 4CFXA 4I5MA 3S00A 5IUGA 3WZKA 1PJKA 1H1PA 2X1NA 4X6QC 5E4HA 1HOWA 1OUYA 1Y91A 2ZYBA 2C5YA 2RG6A 3NW7A 5B0XA 4FK6A 3HL7A 3UO6A 2JIUA 5JMSA 4A9SA 1W7HA 2WU6A 3KC3A 2VV9A 2BROA 3KQ7A 4I6BA 1TQPA 2VO3A 3ZEWA 2IW8A 3P4KA 1QPEA 2WAJA 4NKAA 3UPZA 3RPVA 1Q3DA 3NAYA 1BX6A 4ZTNA 3BCEA 4LGHA 5HE0A 3TJCA 2ZV9A 1KE5A 3ZFXA 3D83A 4O7ZA 4FIGA 5EDPA 2UZWE 3R8VA 1FPUA 1GZKA 1BI8A 4YJVA 3ZZWA 4OBPA 4FEWA 2NRUA 5DVRA 1B38A 3QYZA 2UW4A 5GJGA 4D0WA 2LGCA 1FGIA 5KKRB 4KBCA 4D2WA 2XBJA 3I6WA 3ZHPC 3NCGA 4TYEA 5IISA 3NX8A 3F82A 4OTRA 4R5YA 3CY3A 1UVRA 1PMNA 2XNPA 3FYKX 4O0SA 3DY7A 2W17A 3QKKA 4IM2A 3WE8A 5HVKA 2ZM3A 3R1YA 4AW1A 2QODA 3DAEA 2UZTA 3EQRA 1O6LA 3LMGA 4GIHA 4TT7A 3KRRA 4MQ2A 4S32A 2OF4A 5LCKA 5HHWA 5L2TA 3PFQA 5TR6A 4O27B 3KA0A 3ET7A 2XUUA 3THBA 5L6OA 3UG2A 5LARA 1ZYSA 1KE9A 3JR1A 4S31A 2UW9A 3PXZA 1G8AA 3CGFA 1CKIA 4XBRA 2XNMA 4IADA 3NCZA 2C3JA 3V8SA 4YJQA 3PE1A 2QOKA 2OH4A 4NIFB 2ZB1A 2PVJA 4FV1A 4O2PA 3ZZEA 4Y46A 5J5SA 3MVHA 5BX0A 4E73A 3DFCB 3UIUA 3NS9A 4YC3A 1SYKA 4YSMA 4BI2A 1JOWB 3G33A 3SD0A 1Q4LA 4U0IA 4NSTA 3NNUA 2YM4A 4A07A 5DHJA 2EWAA 3AC2A 2JITA 3DQWA 3C9WA 3U51A 5E8YA 4EQUA 2H6DA 3FMKA 3PSDA 4J52A 2WFYA 5K4IA 3ZXZA 5EKNA 2XK9A 4YO4A 3UOKA 4H3PA 5J9LA 3R0TA 3MYGA 4MD8E 3P79A 4YJRA 4G6OA 1UU7A 4H36A 4TYIA 4BGHA 3MY1A 2VRXA 4RA4A 3EHAA 4M97A 3NAXA 4A06A 2CCHA 3Q3BA 3QLGA 4FSRA 3UVPA 4YUQA 5GZAA 4O7LA 5H8BA 3Q9XA 3UQFA 2C69A 1XO2B 4EHGA 2YFXA 2ZMCA 4EBWA 4ZMFA 2I0YA 3EQDA 2J9MA 3QQGA 4BDIA 3ZYAA 1B39A 3BBTB 3T3VA 2QOCA 4BIEA 3NRMA 3FLNC 3RAIA 3BIZA 4FBXA 4FV6A 4MKCA 2CGVA 2R3FA 2BRGA 2C6EA 5IA2A 2HY81 4FEUA 3BGZA 1RE8A 1UWHA 4OBOA 4MNEA 4AU8A 4O7VA 5FEQA 3FUPA 4DEIA 1EH4A 4GH2A 5HBHA 4C57A 1ZOHA 3ZLXA 4XP3A 3W2CA 1WBTA 3BHYA 4GT3A 2J5EA 2PE0A 4MCVA 4KS7A 4Y85A 3TNHA 4X21A 3D4QA 4JL9A 1OKYA 2HELA 2W05A 2BCJA 3BELA 2EU9A 2X6DA 4QMLA 2OO8X 5DT4A 4HCVA 2PMNX 3C51A 3UO4A 4IE9A 4E5AX 3HKOA 3ROCA 5A54A 3A7JA 4FUYA 3HA8A 3PVWA 4X3FA 5IQIA 1REJA 2R3GA 4UMUA 5M51A 3PDTA 4FTMA 3AT4A 3DJ6A 4RIOA 4YBKA 5ACKA 4FK3A 3WYXA 5A46A 5DI1A 3S95A 2W1IA 2JKQA 4QP2A 2VWBA 4F0GA 5AA9A 4LRJA 1GOLA 4NCTC 3HYHA 3QL8A 3OXZA 3ZRLA 3KU2A 3TL8A 1JVPP 3CQEA 5A9UA 2WTIA 3LQ5A 4EH3A 3ETAA 4JR7A 1YOMA 2QOFA 1XH7A 1RQQA 3A7FA 5BYLA 1VEBA 4CMTA 4OTPA 4BCOA 2W7XA 3NUPA 1H08A 4YZ9A 3UMXA 4DGGA 3ZUVA 4WUAA 4YHJA 3V5PA 5ANEA 3GCUA 3ZMMA 2FA2A 1AQ1A 3ZSGA 1H07A 2WXVA 3BYUA 3GENA 3LLTA 3F5GA 2HAKA 2B4SB 2RSVA 5BUEA 2BZJA 2BR1A 4BVUA 5CF4A 4G6LA 3NYOA 3C50A 4PMPA 2B9FA 3SOAA 5A4TA 2WU7A 2OIBA 2QOIA 3BV2A 4QMPA 3ZDIA 3ZCLA 4W8EA 3OUKA 2WTCA 1Q3WA 3FSKA 4O96A 2XIZA 1W82A 4PPBA 3KXGA 1JKSA 3WBLA 3IGOA 4ANQA 5AV3A 3AG9A 4BDGA 2E9UA 5AAEA 1M7QA 4BCFA 3NW6A 4PDPA 4DEEA 4DG2E 3GNIB 3KXHA 4M8TA 2PVKA 3CKXA 4RX8A 2J0JA 4PF4A 3WIGA 2F57A 3ZEPA 4XV9A 4YZBA 1OM1A 2C6KA 2XKEA 3KN6A 4MNEB 5E8VA 2G01A 4EKLA 3KFAA 4AP7A 4FNYA 1PYXA 2XKDA 4N0SA 2GQSA 4L53A 1OUKA 2DYLA 4FKLA 4JQ8A 5DG5A 3EN6A 5EDRA 4K33A 4NFMA 3DB8A 3GVUA 3WARA 4GKHA 4DAWA 1PKDA 4WSQA 3PP1A 4X3FB 3Q2MA 3NNWA 2IWIA 2J90A 2NO3A 2Y4IC 3R04A 5AFVA 4PDSA 3OFMA 3DJ7A 3O8PA 4RJ6A 4UXLA 4AT4A 2A27A 1K2PA 2BDJA 4DGMA 4CMOA 4QMVA 1YXXA 5IEVA 2A4LA 2P33A 5IDPA 4EOLA 2OW3A 4KBKA 3Q04A 3GU4A 4GFMA 4Z7HA 4NW5A 4UX9A 3TV7A 3NZ0A 4GG5A 2IG7A 3KY2A 3CQUA 2WMRA 3LXNA 2WTVA 2VWWA 2BAQA 4MD7E 4MVFA 4YZMA 5HEZA 4LV8A 5KHXA 3TUBA 5IKWA 5DBXA 3UQGA 4E3CA 4J53A 5LVPA 5IQDA 4R6VA 2X4ZA 2QHMA 3UIXA 3ZO1A 4D4VA 3MI9A 3FLSA 2YAAA 4ERKA 1ZMUA 3R8LA 3NVMB 4IAAA 2HENA 5HLPA 1OGUA 3NUXA 4AUAA 5AR7A 5JFXA 4I94A 5JQ8A 4BICA 4U3YA 3GFEA 3UZTA 3QXOA 4M0YA 4F6UA 2Y7JA 2CLQA 1J7UA 1YVJA 5DEWA 4O7YA 4BDDA 3O8UA 2F7ZE 4ZAUA 4NTTA 3V5TA 1H1SA 1R3CA 3QU0A 4ZZOA 4R7BA 3EJ1A 1HCLA 5ETAA 3L9LA 3OT8A 5I5ZA 3LPBA 2GDOA 4M0ZA 1TQMA 3I0OA 4JDJA 2JEDA 1XH9A 4TZRA 1R0PA 4IAIA 2ZJWA 5M4FA 4LM5A 4E93A 1BI7A 3PIZA 4XOYA 4NZWB 3TNWA 1QCFA 1SZMA 3BX5A 4FTRA 3V5JA 4F7LA 3CR0A 5ITAA 3F3TA 5L2SA 3HMMA 1J7IA 3ATSA 3F61A 3ACJA 4GV1A 3Q9ZA 3P78A 4C4GA 3KK9A 1BMKA 3EQIA 4YHTA 3OCTA 2VTQA 2Y4IB 4G5JA 5EG3A 4M15A 2O2UA 4QMTA 4NW6A 2EVAA 4GEOA 3V04A 3V5WA 5CEOA 5TOZA 1GY3A 3VQUA 4O0UA 4I24A 5DPVA 4D2VA 5IQFA 4Q5HA 4RZWA 4FKTA 2NPQA 3GU7A 4ANMA 4FMQA 4AT3A 4D2RA 5KHWA 2QKRA 5IA5A 4BBMA 3UYSA 3LFNA 4I20A 3R00A 5IH6A 3FWQA 2ZAZA 2XK3A 4N57A 5CT0A 3AC4A 3Q96A 5LXMA 5HE3A 4FR4A 2IZUA 5EQYA 1W83A 5FTGA 4L52A 4YR8A 4FTAA 4RX5A 4X2JA 3AOXA 3ZRMA 3OWPA 2F7EE 4I6QA 4H05A 4FTJA 3VAPA 2BALA 2WMSA 3MH2A 4H1JA 5EYDA 2X4FA 5AR3A 5C01A 1PMUA 5GNKA 4I1ZA 3G90X 4BCHA 2R3KA 2C6IA 3E8CA 3H10A 4C61A 3DXNA 5L8LA 1WVWA 4HNIA 4LGGA 5EOBA 4PPCA 4IB1A 1Q8WA 4X6RA 2O64A 1YRPA 3P1AA 3VUMA 1ZYJA 4C36A 3Q9WA 4K9YA 2NNWB 3A7HA 3QQFA 4ALVA 3NYVA 1Q8YA 3PJ2A 5JH6A 3UQCA 5IDNA 3R30A 5EYKA 4DG3E 4DFNA 3MB6A 5D11A 3U4UA 2QR8A 1W8CA 3F88A 1IA8A 2PE2A 4FKUA 4IDTA 2E9OA 4KKEA 3SRVA 4HVDA 5FXRA 2OSCA 2Q0NA 3TTIA 1WMKA 3ELJA 2XRWA 3MFUA 4EONA 2JFMA 4QMMA 2V22A 4QQCA 3RAWA 4C3PA 3VN9A 4O0RA 4BIBA 5D12A 3QTWA 3EL8A 1GIJA 4ZJVA 4D0XA 2I0HA 5AJQA 5L8KA 5HVYA 4IACA 3SV0A 2WTKC 2XK8A 5CSPA 5ANJA 4JBOA 3FZPA 2J0KA 5IUIA 1OL7A 4MF1A 3CE3A 3MJ2A 4FT0A 4ZTQA 4FG7A 5C4LA 3FC1X 4FI1A 1XQZA 5JFVA 3ZM9A 1YWVA 3WZJA 4KIOA 3JXWA 3FZ1A 4H3BA 4KBAA 4FSMA 3QCSA 3JS2A 4WNOA 2YM5A 3ZLSA 3B2TA 4C2WA 2ITOA 4EORA 3I6UA 2ITYA 4TNDA 2A1AB 3A99A 3UOHA 4RFZA 5LMBA 4FT3A 3MVJA 3EQCA 3E8DA 1M7NA 5CU3A 4WHZA 1V0OA 3C4FA 4I3ZA 4PP9A 4L44A 1KV1A 4FF8A 2RFNA 3C7QA 5DT0A 2PZPA 4ACMA 2C47A 5B2KA 4AGWA 3GUBA 2AYPA 2ERKA 2C3IB 2O3PA 3VUHA 4AGDA 2C5NA 4USEA 2NP8A 4JR3A 4G1WA 3W1FA 4R78A 3C0IA 1NVRA 3B8RA 4FV7A 4DFBA 3TNQB 4D4SA 4GS6A 4JDIA 4L9IA 3Q4CA 4EWQA 3EN5A 5EM8A 3DB6A 4BKYA 1VYZA 3TT0A 5LJJA 2W06A 1KE8A 4RVKA 5E91A 2VTIA 1KSWA 2OK1A 3F66A 2JC6A 4QYGA 3EIDA 2ITXA 5HG5A 3TV4A 3FLZA 5FLFA 2YM7A 1ZYCA 2GFSA 3A61A 2CDZA 3GGFA 4ZTHA 2OJFE 3DTWA 2BHHA 3VVHA 2PUUA 4FV9A 4QP6A 5A3XA 5DR9A 3UPXA 2VTNA 3D5UA 5CU0A 2HYYA 3S3IA 3H9OA 3OCGA 4QP7A 4RWLA 1NXKA 2J4ZA 5CF5A 4U40A 2WHBA 3QCYA 2PMIA 3SRVB 2VO0A 4ZEGA 3RPOA 2QC6A 3PVUA 4JX3A 4M66A 4TRLA 4CYIA 3QWJA 4FTTA 4Z9LA 3HV3A 1MUOA 4UEUA 4ZLOA 5GINE 3RNYA 2B53A 2UW6A 3KEXA 4EH4A 3FYJX 3U9CA 4X2NA 3LVPA 2XIYA 5I9VA 3ENHA 3L9NA 3QD0A 3IW4A 3QRJA 2V0DA 4QTBA 4XG4A 3RI1A 4J1RA 4BCQA 4XG6A 2BAJA 2UVXA 4ANNA 2JDTA 2R64A 2W1EA 3AGLA 4EZ7A 4PTGA 4WG5A 4RT7A 3A60A 5AP7A 1Q8ZA 3VBTA 3P9JA 2QKWB 2Z8CA 4ZS0A 5BMMA 4P5ZA 2HOGA 3EL7A 4BDBA 4JRNA 1ZYDA 5EI6A 5HCZA 2Z7LA 3LCDA 4AZEA 3IW6A 1RJBA 4IB3A 4PMTA 2HY0A 5TKDA 3LFEA 3FMHA 4WA9A 3LHJA 3OCBA 1MRVA 2H34A 3L1SA 3UC3A 4CNHA 1OI9A 3R63A 4V04A 1I09A 3MW1A 2J0IA 4FV5A 3VS0A 3TZ9A 4AE6A 3C4WA 4DYMA 4ZTRA 5IA4A 1FQ1B 4IZ5A 4ANLA 3OVVA 5AIRA 3HP2A 1XJDA 4O7NA 4OT5A 4D5HA 2WPAA 1TVOA 2GNJA 2XVDA 3LZBA 2UZVA 3FZTA 4YPSA 4B0GA 3KXNA 2GQRA 3GQIA 3DU8A 3S4QA 4PTCA 2HW7A 1BL7A 2ITTA 2JAVA 2QU6A 2CCIA 2YIRA 2W1HA 5CSWA 4UYNA 1OPLA 4C59A 3LQ8A 3QALE 1PKGA 5CTPA 5E90A 2C3LA 4O0TA 2RGPA 4P90A 4XP2A 5DRBA 2IW6A 3COIA 4JQ7A 5DWRA 4U42A 1PXOA 2WTWA 3C0HA 1KV2A 4DE4A 4TPTA 2WQOA 5F1ZA 3VF9A 2JBOA 3DT1A 4QQ5A 3BZ3A 3EFLA 3NGAA 3RAHA 2VX1A 3LFQA 3MS9A 2YIXA 4KKGA 3ZRKA 4J97A 5GZ8A 2HZ4A 2ZV2A 4BCMA 4CG9A 4IAYA 4ZLZA 1JSVA 4E1ZA 4N4SA 4YTFA 2XKCA 4AOJA 3QFVA 3DS6A 4V01A 3UC4A 1SMHA 4BY9E 1JSTA 3VW6A 3GFWA 4YO6A 4CZYB 4IVDA 5B7VA 2R0IA 3DOGA 3U6IA 1ZWSA 2RL5A 4Y8DA 2P2IA 2XJ1A 4F9CA 1AGWA 3FMMA 5CAPA 3GI3A 4TYHA 5I3RA 2QR7A 3LXLA 3FI8A 4ERWA 4I92A 2YABA 3ANQA 4YJPA 4F64A 4ITHA 1NY3A 3GT8A 3U6HA 3OHTA 2QQ7A 3BU3A 5HG9A 3ZDUA 5GIPE 5JFWA 4ASEA 3K54A 3VNTA 4FVPA 4OTFA 4B7TA 1U5RA 5CENA 4JDKA 5KMLA 2IVUA 3QTSA 2H9VA 5I4NA 5HIBA 5IMXA 1OBDA 2GFCA 2W5HA 3G0FA 2FVDA 3VS3A 4AZFA 4ZXTA 3TKUA 1R39A 2PTKA 2O65A 4I21A 3VJNA 4C37A 3R28A 1YHSA 2IPXA 4ZY4A 2WELA 2IJMA 4RG0A 4EOSA 3OD6X 4GVJA 3K3IA 4K11A 3CKWA 3G0EA 4XJ0A 4EHZA 5IQHA 4ONAA 3RALA 4CFFA 5HE1A 4F9WA 3V51A 5HESA 1OIQA 2X8IA 5AP0A 3ZOSA 4RA5A 3HV5A 3EKKA 4E20A 3GOKA 4BDHA 4FZAB 1ZARA 4FODA 2GSFA 5FBOA 4AF3A 5HGIA 3NSZA 2R3OA 4MWIA 4BKJA 3W8LA 1R78A 4BDFA 5AUZA 3F6XA 5JGDA 2VO6A 1IRKA 1YDRE 5KZ0A 1KUTA 4XG7A 2VU3A 2XM8A 1YXUA 1J3HA 4XS2A 2PZRA 4B99A 4EH9A 4PMMA 3BV3A 4GFOA 2ITPA 4UWBA 4JIKA 4A4LA 5DGZA 4A4XA 4MXZA 3KULA 4WBBB 4UYAA 3C5UA 4JI9A 4IWOA 4O6LA 5FTQA 3BQRA 3JY9A 3RKBA 3DPKA 1UNHA 2YCSA 4QTCA 4EOOA 2VWUA 5K0KA 5A4EA 3HV6A 1PMEA 3ULIA 5LWMA 5G1XA 3H9RA 4QTEA 3LLAA 4EHEA 4ZP5A 4FEQA 4EOMA 3S2PA 4QO9A 1QPDA 2F2UA 4HGEA 2CGUA 1DM2A 3ZXTA 4ZOGA 4C0TA 1U59A 5CASA 3KRJA 2OIQA 5JEBA 3UOJA 4JG8A 5K3YA 3IGGA 4CZUA 4DCEA 5IQAA 4TYHB 4FVRA 1FVTA 2WKMA 5L6PA 3BGPA 3DQXA 4LRKA 2YEXA 3EZVA 3BWJA 3MY0A 3UE4A 4E4NA 2JIIA 4NEUA 5I9ZA 1MP8A 3BU6A 3HLLA 3R8ZA 2XIKA 3VS4A 4MBJA 4JG7A 4FKSA 2UVYA 3ODZX 2YCFA 4ZSJA 5M55A 3A4PA 3UNJA 2UZLA 5CF6A 5IPJA 5KBRA 4LI5A 2IVVA 1R1WA 2Y6MA 4U45A 4CGAA 3PXKA 4MAOA 4DTBA 3REPA 1NVQA 3L8PA 2BAKA 2WMAA 3OY1A 4YLJA 4W9XA 2F2CB 2C6DA 5CS6A 4BGQA 5K0XA 2FO0A 1XBCA 2PZYA 2Y8OA 4NM3A 4FNWA 5LCJA 4OAUC 3OOGA 5GZ9A 3CCNA 5C8NA 5IZFA 4ZY6A 1JAMA 4YTCA 2XEYA 4RQVA 4ZK5A 2OG8A 4NWMA 5E8ZA 3U8WA 3CXWA 4ANSA 2XRUA 2BRNA 2J6MA 3BPRA 3AMBA 4PTEA 3GCPA 3CQWA 1J91A 1YXVA 2AC5A 4GUBA 5CSVA 5HI2A 2RKUA 3RZFA 4CCUA 3I0QA 4ORKA 2R2PA 5FGKA 4CV9A 2UZDA 5JZNA 4YBJA 4IB5A 3T8OA 4D1ZA 3CGOA 3ITZA 2YERA 5CSXA 2UZNA 3ZC6A 4RX9A 3FE3A 4ENXA 4R5SA 2PPQA 4M68A 2YCRA 5CWZA 4O7RA 4XV1A 1F5QA 4G5PA 4FIIA 1XWSA 4YJTA 2Z7SA 4EK6A 4IWDA 2QHNA 3E62A 3UP7A 3VBYA 5M07A 3FKNA 2YJRA 3Q5ZA 3FMNA 3RHKA 1URWA 3PXQA 5GJFA 4S33A 1A06A 4TTHB 2WMQA 1YQJA 4HYUA 5AP6A 4M69A 3POOA 4D1SA 1WCCA 3QGWA 2CMWA 4DBNA 4AW2A 3EB0A 4YHFA 4F0IA 4NJ3A 2EB3A 4KIKA 4LQMA 1WVYA 5FM3A 3W8QA 4IC7A 2B9HA 2XNBA 4G31A 2JDRA 4IVAA 4LUDA 2QOQA 3IOPA 3ROYA 2WQBA 5B2LA 5IA3A 3O50A 1JKKA 4RC2A 3RP9A 4BWPA 4F9BA 3D5VA 4JS8A 4B9DA 4D55A 4X0MA 3MIAA 4APCA 3VW8A 2E9NA 2UZEA 3OWLA 2B54A 3P0MA 4XP0A 4NTSA 4DFUA 2BRBA 4K8AA 2RFDA 3TZ7A 3W2RA 3PYYA 4L68A 5AUTA 4I0SA 4EOQA 4V0GA 1URCA 1ZLTA 5LMKA 4OLIA 2EXEA 4JXFA 3I4BA 4WO5A 3WILA 4FZ6A 4U3ZA 3P23A 4YP8A 1Q5KA 4C4FA 4TY1A 5M4CA 3AXWA 4UZHA 4ENYA 3TDVA 1GAGA 4E6DA 2X9FA 4EWHA 4GMYA 4UXQA 1DAYA 2PZ5A 3BGQA 3DK6A 2XP2A 2GQGA 2C1BA 4FKJA 4IIRA 4PY1A 1YHVA 3HV4A 2XZSA 2HWOA 5CEPA 2X2KA 4D9UA 4OTWA 4TWPA 4KS8A 2KTYA 3ZH8A 4DFLA 4ZSEA 2EUFB 5LMKC 2XCKA 2YZLA 2GTMA 2PVYA 5AUWA 3TDWA 5CI6A 3KMWA 4RLLA 4K6ZA 1Q62A 3IPHA 2WIHA 2XYNA 2Y6OA 1XH4A 1UU8A 3E87A 4OTHA 4Q9ZA 3FI4A 4MXYA 3PA4A 4RFYA 4FYNA 1MQBA 4UZDA 3GQLA 2F49A 4IANA 4EL9A 4F99A 5CYIA 3ORNA 4NFNA 3R7GA 2R3PA 5FQDC 3I81A 3MBLA 3SHEA 4NCTA 3ORPA 3W2PA 2FH9A 2YZAA 3PWYA 4EI4A 2X81A 3D0EA 3EH9A 3PJCA 3CTJA 4HYIA 3MGYA 5JGAA 2VD5A 4ZS4A 4G3EA 4OAVB 2C5XA 2QVSE 4WG3A 4QQTA 4DLIA 4ZZMA 3RM7A 3Q52A 4XH6A 5D10A 1YWRA 5D7AA 4R3CA 3ZO3A 4YNEA 5BUIA 3C13A 4C2VA 3HEGA 3PE2A 3A7GA 4M69B 2ITWA 3UDBA 4BZDA 4V05A 4EC8A 4YTIA 2ZMDA 2C4GA 3DFAA 5CVFA 2FYSA 5EYCA 4QMNA 3OROA 5JQ5A 5IQCA 2E9PA 3GCVA 3MH3A 2R3HA 4BBEA 5DMZA 3EQGA 2VTLA 3PA3A 2WD1A 4GJ2A 4IEBA 4L01A 1JWHA 3NIZA 3QZHA 3R01A 2Y9QA 4J8NA 4QD6A 4RIYA 4HW7A 4FTNA 2VWZA 3FXZA 4D4RA 1Y8GA 2BIKB 3MV5A 2RIOA 3SXFA 4I22A 3GU5A 3MSSA 3VC4A 4ALWA 1BLXA 5F20A 3SG8A 4I0TA 4II5A 1FMOE 4CFUA 4GK3A 3PIXA 5AIKA 3U54A 1QL6A 5GJDA 4L67A 3QWKA 3FPMA 3UTOA 1PF8A 3BYSA 1SNUA 1UV5A 4GW8A 4Y72A 3ZU7A 5AAFA 5J1VA 4V0GB 1E9HA 5LWNA 5HBEA 3KB7A 4FEXA 1OZ1A 2YN8A 3P5KA 1YOLA 2PUPA 4U41A 5CANA 4PRJA 5AV1A 2I40A 3TIYA 4OTIA 3W2SA 3F3UA 2JBPA 1KE6A 5KX8A 3LIJA 2BDWA 4WNMA 2A19B 3SC1A 4USFA 3RK7A 3HGKA 4Q5EA 4IWPA 2YLFA 4RC4A 3NYNA 4HOKA 3LKMA 2XMYA 4O7WA 2VTRA 4DT9A 3E3BX 4IQ6A 4Q2AA 4IXPA 4BCPA 4ZJJA 4Z7GA 1LEWA 3L9MA 3F2AA 3JY0A 2BFXA 2WQNA 4GIIA 5LVLA 1WVXA 4ITJA 4WRGA 3U9NA 4G17A 4MHAA 2QG7A 3HAMA 3VJOA 3A62A 5AMNA 2IZSA 5CAVA 4GJ3A 3QTIA 4EYMA 3QZIA 3PA5A 2O5KA 2C0IA 2UZOA 5ETCA 4FZDB 4UV0A 2JDSA 3EFKA 2Q0BA 1H00A 2AC3A 5HTIA 4C4EA 4XLVA 3AC1A 4ZTSA 2WO6A 2GS6A 5T68A 4QYEA 4BRXA 2WTDA 3RINA 3IDCA 5E8WA 3ORKA 2QONA 3OS3A 4L8MA 4BCGA 4O91A 3V8WA 2WMWA 5ANDA 1P14A 2W4JA 3NDMA 4RVLA 3TI1A 1VYWA 5FWKK 3QD4A 3TN8A 4CFVA 5IUHA 3I79A 1XR1A 2OZAA 4FICA 2BTSA 3IO7A 4FL2A 4O38A 1H1RA 3HMPA 1SVEA 3FKLA 2B9IA 3M2WA 4RIYB 4NJDA 3ZC5A 2KULA 4YJNA 4BBFA 2QU5A 3EWHA 4J95A 2ERZE 3A8WA 5H2UA 2Y4PA 2R3RA 2BDFA 2QO7A 4GT5A 5BVFA 3ORIA 4J96A 2OJIA 4EKKA 4OTGA 3NUYA 4AS0A 5J87A 3PIYA 2YCQA 4DINA 5AAGA 3TEIA 5HCXA 4YZNA 3MPAA 1WBOA 4QYYA 2BMCA 2BVAA 2VWVA 4WT6A 3R9OA 3IOKA 3UIBA 5BUJA 4EH5A 3R9RA 2WQMA 4E8AA 2QURA 5HO7A 3M11A 1WBVA 3W32A 4BFMA 5EFQA 4I5PA 4NU1A 2IVSA 4XOZA 1H1WA 4IZYA 4EQMA 3LFSA 2V7AA 5HLWA 5J5TA 4S34A 2GU8A 5F9EA 3F5XA 3SXSA 4QTDA 4EK4A 4FTUA 2JDOA 4AACA 4JQEA 3ORXA 2YM3A 3MH0A 5LQFA 3ALNA 3W18A 5DNRA 2CGXA 3RK9A 1Y8YA 5FD2A 4KWPA 3Q6UA 1RDQE 3O7LB 2OJ9A 2REIA 3ZONA 4BTKA 2JIVA 1V0PA 2EXMA 4L42A 3UGCA 4ZSLA 4A4OA 4KKHA 4QNAA 4BN1A 2ZDTA 1STCE 4O86A 4EOKA 4MNFA 3FQSA 3PXRA 4HVIA 3CTHA 2I1MA 4F4PA 4O82A 3OEFX 4B4LA 4JBVA 5ANKA 1B6CB 4IDVA 4I4FA 4K0YA 3NNVA 5DA3A 2VWIA 4PWNA 4C58A 3V01A 3O17A 4FOCA 3RTPA 3T9IA 2BFYA 3OUNB 1PXJA 4BDCA 2QLQA 3AMYA 3QCQA 4JNWA 2GNFA 3CD3A 5KZIA 2XEZA 1Q99A 3CC6A 4IX3A 4QP4A 4BCKA 4RJ8A 3BI6A 2P2HA 3F9NA 3Q53A 3V6RA 1I44A 4FSTA 4R8QA 2V7OA 2YACA 3ZSIA 2QOLA 4CCBA 5C1QB 5E8UA 3EQHA 3O51A 2PVMA 4F0FA 2V62A 4FSYA 4FIEA 2X39A 5HD4A 2OZAB 3BHVA 5C4KA 3WIKA 1FVVA 1W84A 4FV8A 4MX9A 1GIIA 5J7BA 5IEXA 5DR6A 3QA8A 2ZV8A 5FXSA 5IU2A 2VO7A 3A7IA 3O2MA 2C1AA 4EEVA 4RGJA 3DTCA 4EQCA 1ZRZA 3H3CA 3R1NA 4G3DA 3MIYA 2OZOA 3R8PA 4BZOA 3FMLA 2W1CA 3BEAA 4GL9A 5JZJA 5DFPA 2WOUA 4GFGA 5L2WA 3UNKA 3WYYA 5A4CA 3MFSA 3BQCA 4O21A 4TYJA 4NK9A 1T46A 4X2GA 3AC8A 4JLCA 5I3OA 3DAKA 3UMWA 3IS5A 3FY0A 4LMNA 3WF5A 3CP9A 4N70A 4ACGA 4L43A 3OF0A 1MRYA 4PUZA 4RZVA 4BDJA 1CKPA 5ETFA 4C02A 4I93A 3A4OX 3PVGA 5AP1A 2FSOX 4JRVA 3QF9A 4TYGA 4MD9E 5H3QA 1CTPE 4ASZA 1BYGA 3LXKA 2HXQA 1F0QA 1Q61A 3Q4ZA 2B55A 4RPVA 1IA9A 3DNDA 3NPCA 3GC8A 4FGBA 3LJ2A 3QKLA 5AR4A 3VS7A 4C7TA 2CKPA 2C6OA 3QYWA 3CJGA 3TNIA 5A14A 2G2IA 4JT3A 5EQPA 3TM0A 3EYGA 4FC0A 3PSCA 3ZUTA 3FC2A 3QTQA 3NYXA 5IF1A 2ZDUA 1BL6A 4GK2A 4BF2A 4IW0A 3A2CA 3RWQA 2J0MB 2G15A 1XH8A 2BKZA 2XS0A 3QA0A 5E8XA 4QP3A 1ATPE 1CDKA 3R73A 3UVRA 2BPMA 4PDYA 3TIZA 3TJDA 3KVXA 5DRDA 4Z55A 3R1QA 2OGVA 4JAJA 4WIHA 2GS7A 3P7CA 4G3GA 4R1YA 5ACBC 5IA1A 5ICPA 4O84A 1H01A 4F65A 3VS2A 4R7HA 4IJPA 4RRVA 4UWCA 5CT7A 4DH8A 3PPZA 5AA8A 2CN8A 4B6LA 1SNXA 4N6YA 2VZ6A 2JGZA 3RJCA 3VRYA 2VGPA 4YJSA 4DEBA 2DS1A 3F2NA 5IH4A 4F7JA 3QD3A 3WZUA 4ASXA 3DA6A 3DZQA 2EB2A 2OXXA 3K3JA 5C8MA 4RIXA 4DITA 4N6ZA 2WTKB 4DEGA 2PE1A 3R7YA 3HRBA 1O6YA 2GNLA 5HU9A 1H28A 4O0WA 5HX6A 5LMAA 4YGAA 4YSJA 2I0VA 3VWAA 3QX2A 4YZDA 3IKAA 2OXYA 4AN2A 2GNGA 2WOTA 1JSUA 5CVGA 5I9UA 4JDHA 4L46A 2VTHA 3C4EA 2WGJA 4O22A 4AQCA 3VBWA 5KO1A 3BLHA 2R4BA 2B52A 1FINA 5AP5A 3ZUUA 4K18A 5M08A 3FI3A 2W1ZA 2IO6A 2XJ2A 1M2PA 4QMWA 3VRZA 3G6GA 4C3RA 4L7SA 2QOBA 3G5DA 4HCTA 5AEPA 3PLSA 3KKVA 4ZZNA 4W4XA 3RHXA 3KMMA 2HIWA 4ZTLA 3OC1A 4GRBA 3NUAA 2VWXA 3Q2JA 4CYJA 3OZ6A 3RNIA 2YWPA 3A8XA 3R71A 2Z7QA 2J5FA 4QT1A 3C1XA 4U81A 1LR4A 3JPVA 4DHFA 4AGCA 3LOKA 4FG9A 4FZFB 4QP8A 4YLLA 1PY5A 5JRQA 2ESMA 1YHWA 2GMXA 3D9VA 4C4IA 1DI8A 1T45A 4L00A 2PVLA 4E6AA 3GU6A 3DXPA 4MTAA 3NUUA 3QLFA 3PJ3A 4JX7A 4XYFA 4D58A 3ZFMA 4D5KA 4AZSA 5E8TA 2R9SA 1JKTA 2X8DA 3EOCA 4JG6A 2VX3A 4BTMA 4KRCA 2XNNA 5IEYA 1A9UA 4R3PA
chains in the Genus database with same CATH superfamily
1H24A 3PG3A 1GZ8A 1Z9XA 3CPBA 2R7BA 3H0YA 5J1WA 3VHEA 3IW5A 3VO3A 3KF4A 5HO8A 1XH6A 1TKIA 3TACA 3MFTA 5K4JA 2F4JA 3BE2A 3Q5IA 4NM7A 5AR5A 4PL4A 3ZFYA 1OGYA 2NRYA 2BZHB 1J1BA 3SXRA 4LL0A 4DTAA 3QTZA 1YDSE 3QHRA 2OLCA 4X2KA 4XG2A 4I6LA 3POZA 4KB8A 4XV3A 5TT7A 2WNTA 4C4HA 4M67A 5M4IA 4ID7A 3SOCA 2F7XE 3FL5A 5KCVA 5AM6A 3OWKA 4WNPA 3VF8A 5I9YA 3AD5A 2OIDA 4M3QA 4H58A 1OBGA 4W9WA 3TV6A 5CU6A 2RFSA 4RIXB 3GB2A 2W99B 1FGKA 4PNIA 4JBQA 3CSVA 3LE6A 3O0GA 5C26A 1ZZ2A 4NM5A 4ZTMA 4QMZA 3E64A 1CSNA 3HAVA 5HZNA 3ML1A 3D94A 1J1CA 3AD4A 3HNGA 2VTTA 5J9YA 5HNIX 1PMVA 4RWIA 2XANA 4FIHA 2W4KA 3R2BA 4QEBA 3K5VA 3RM6A 3P08A 4OT6A 5GIOE 5KUPA 3OWJA 3PZEA 1BKXA 4FV0A 2QD9A 3DZOA 3UZPA 3WF9A 1U46A 2GHMA 2JDVA 2WMXA 4CLIA 3OMVA 5CXZA 5L2QA 3VQHA 3UOLA 2G9XA 3DBQA 5CAUA 2R3IA 4DBXA 1XKKA 4FNZA 4LG4A 1OIUA 5KNJA 4U7ZA 3S1HA 3C0GA 4O7SA 5HU3A 4MF0A 4AZTA 3IW8A 3WF8A 2VX0A 2OH0E 2JKKA 3KCFA 4I41A 4PDOA 4C34A 1ZXEA 4BDAA 2CJMA 3D14A 2CN5A 4QYHA 2DQ7X 4GSBA 4HYSA 1RW8A 3KVWA 1V1KA 4IX4A 3RMFA 4AZVA 3UVQA 4CT1A 2UW5A 4CTCA 3U55A 2YM8A 4UMRA 2YHVA 4GK4A 4E4LA 3QXPA 3EMGA 3R21A 1WBPA 3F7WA 3R8UA 1A48A 4CRSA 4AZWA 4CG8A 2WTJA 4EHVA 4ACCA 4K2RA 5FEEA 3FHIA 1VZOA 5CQUA 5EQEA 3W2QA 4GUEA 1WBNA 4FVQA 1APME 1O6KA 1PHKA 3MPMA 4AAAA 3LM5A 2HXLA 5HCYA 3DDQA 3QZGA 5TF9A 3O7LD 4G3FA 4RC3A 3KF7A 3UBDA 2FUMA 1JNKA 2ETKA 4R1VA 4WRSA 4AOIA 5D1JA 4QMOA 2C3KA 3UYTA 4DGNA 4AXEA 4CQEA 2QNJA 2R3QA 2O8YA 3G15A 2GCDA 4KRDA 1UKIA 4FIFA 4J98A 5DLSA 5G6VA 3R83A 3NW5A 2OJGA 2W4OA 4RWKA 5AX3A 1M52A 4X7QA 2C0OA 4X3JA 3GC7A 4YMJA 1Y6BA 1VJYA 3JYAA 2JAMA 2E9VA 1P5EA 1KWPA 3FZOA 3G9NA 3HECA 3ORLA 5EM5A 5FM2A 4EYJA 1OVEA 5FXQA 3QD2B 3BL9A 3L8XA 2VAGA 4FYOA 3FKOA 4O0YA 1XMMA 1CKJA 1CM8A 1OIRA 5DIAA 5L4QA 5M53A 4XG3A 4RWJA 2R5TA 5A4QA 2PYWA 4LOOA 3VBXA 4XRLA 3AD6A 4G9CA 2UV2A 2X9EA 3ZBFA 3ATTA 5IQBA 3PLAE 2PY3A 1LUFA 2QOOA 5KKRC 4S30A 5EYMA 4DEHA 4MK0A 4I6HA 3OEZA 2GHLA 5M44A 4Y73A 3K2LA 4AFEA 4S2ZA 2UW7A 4FT7A 3RPYA 2CSNA 1SVHA 1PXMA 3TCPA 5FTOA 1QPJA 4KSPA 5AM7A 4YJUA 1H0VA 4MWHA 1XBAA 1JBPE 3EQBA 5AR8A 5KMOA 3SQQA 5DE2A 2XALA 4LOQA 4FV2A 4E6CA 4O83A 3UG1A 3R7UA 3DDPA 3LM0A 3IECA 4IZ7A 5AUYA 4BI1A 5HTBA 4OW8A 4FL3A 4MQ1A 4L6QA 4EOIA 3KCKA 2XA4A 1PRYA 1YW2A 4FSNA 5EW3A 4DG0E 1YDTE 2VTJA 2W1GA 3E3PA 5L8JA 3RZBA 1O9UA 4AFJA 5ANIA 2H96A 4D1XA 2I7QA 1REKA 3TMOA 3DKGA 2ITNA 5GHVA 1XHAA 2XH5A 1U4DA 3FLWA 3MPTA 3NUNA 4W4VA 2JKMA 1OL6A 1XH5A 2VGOA 5DOSA 3S0OA 3UDZA 4DDIA 1Z57A 3LCTA 1YXSA 2YLEA 2IZTA 4YLKA 3D7TA 5H8EA 3FAAA 3PXFA 5DR2A 5HNGA 3H9FA 3B2WA 4RMZA 1Q8UA 3IQ7A 3MDYA 4BDKA 3R9DA 2FSTX 2W96B 1IG1A 2IN6A 4WKQA 5TO8A 3WE4A 3NMUF 5TE0A 4BL1A 2R3LA 3KRXA 5HTCA 4KINA 4PNKA 4R77A 1ZOEA 1U54A 3I60A 3II5A 5CI7A 3VULA 2W5BA 2VN9A 2XKFA 3KULB 1OIYA 3SW4A 3QBNA 3TZMA 2Z02A 4XLIA 2EXCX 3LFDA 5CQWA 4AN3A 4TNBA 2QOHA 4FOBA 3ORZA 3COHA 4I23A 4G9RA 4L3JA 2QLUA 4A9YA 3FLYA 4CEGA 2W9ZB 3QQUA 4D2TA 4EH2A 3KK8A 3MJ1A 3G6HA 5BVEA 5DYJA 2BZKB 4BWKA 4RBLA 3EZRA 4DN5A 4ZY5A 4XRJA 4BGGA 4GYIA 2CGWA 4EJNA 2UVZA 4HPUE 2CNVA 3ACKA 3FSFA 1P4FA 5HLNA 3AQVA 3LCKA 4IAFA 4LL5A 3N4VA 1FBNA 3N51A 4IWQA 4U97A 3FQEA 5AV4A 4O4DA 3O96A 2J50A 3E93A 3OY3A 5LOHA 3MB7A 1P4OA 4IZAA 2B1PA 2X0GA 3FJQE 4FKRA 1K3AA 3VUTA 3SGCA 2G2FA 3PUPA 2JD5A 3QUEA 3CD8A 3KGAA 2ZM1A 3L8VA 1DAWA 3BBWA 2ITVA 3I7CA 5JK3A 5EM6A 2XNOA 4DH7A 1NW1A 4XV2A 4HVHA 4AW5A 1H27A 4UMPA 5FP6A 3SAYA 5BYYA 3UIMA 4EOJA 3SVVA 4W4YA 3VUIA 2HWPA 3FXWA 4FSWA 4IM0A 4FEVA 3EN7A 3CLYA 4Y5HA 3G9LX 3QQKA 2XJ0A 3HA6A 1OL1A 3RK5A 4HVSA 3TG1A 4RX7A 3V8TA 1NT2A 3H30A 3QX4A 4ZJIA 1ZYLA 4LUEA 2W9FB 5HKMA 4LDTA 2CPKE 4RJ3A 5JFSA 4H1MA 2UW8A 4E5WA 2JFLA 5E1SA 3ZM4A 2ACXA 4XUFA 3R1SA 2XYUA 2XNEA 1H4LA 1LP4A 3W55A 3D7TB 4DLJA 3U6JA 3N4UA 4PP7A 2WEIA 1GZNA 4UBAA 4FKWA 4BWXA 4RJ5A 3F3WA 4YTHA 4DF3A 3BLRA 2HZNA 2VTAA 2O0UA 3QQHA 5H8GA 4ZSAA 5KMKA 3QRKA 2PK9A 5AADA 3EN4A 3LFFA 4MXAA 5IG1A 5HICA 1U54B 5A6NA 3AKJA 3NFFB 4YNOA 3OTVA 2C0TA 4P5QA 2OFVA 3OBJA 4UB7A 3TZ8A 1BUHA 4BC6A 3DAJA 4I4EA 1IAHA 2BRMA 2CLXA 1UWJA 3BYVA 3R8MA 4MXCA 4BZNA 3P7AA 3NEWA 3Q4TA 3EN9A 3DK3A 4C4JA 3V6SA 1OPKA 3NUSA 3M42A 2WQEA 2UZUE 4KIKB 3CTQA 4MBIA 5HIDA 5AP3A 5HG8A 4H3QA 4HYHA 4P4CA 3DLSA 5BNJA 4ZMEA 2A0CX 2FGIA 3BHUA 4FKGA 1JKLA 1GJOA 3I5NA 3BHHA 1OKWA 2ITUA 2PMLX 3GOPA 4DTKA 4G2FA 3KXMA 5HORA 2OWBA 4GYGA 4F7NA 3FLQA 3O71A 2PULA 2GNHA 2XM9A 2P55A 4I5CA 3ZSHA 3ULZA 4EC9A 4O6EA 4DGOA 5J9ZA 5H9BA 5FBNC 5EOLA 4WD5A 4DGLC 2BIYA 3QRTA 4XMOA 1LPUA 2YITA 3C4XA 5J79A 4D4YA 5HO6A 5AX9A 4IC8A 3PXYA 1PYEA 4CLJA 1YOJA 2CHLA 5B2MA 4X3FC 4AGUA 3E88A 4AN9A 3MFRA 4F6SA 4F08A 4OGRA 3HUBA 3F2RA 2YA9A 5LVNA 4BR3A 4ZLYA 3GC0A 5C03A 4FE2A 3F5UA 2CKQA 2HZIA 3CPCA 3CJFA 3IDPA 1WFCA 4HJOA 4I5HA 3GCSA 4F1OA 3LQ3A 4PV0A 1R0EA 4CV8A 3W10A 4CVAA 4FIJA 3QTRA 2YWVA 3UZRA 1H0WA 2UW3A 3RAKA 3AMAA 2GS2A 5C27A 3DKOA 3LMIA 4UMQA 4WSYA 5IMEA 1ZY5A 4TWCA 2XBAA 3KL8A 2X7GA 5AP2A 1VR2A 4LOPA 4QMUA 4HCUA 3OT3A 4QQJA 5I0BA 2C6TA 3PVBA 4O1PA 1W2FA 3BYMA 5CNNA 4IVBA 3B8QA 3QCXA 2NYAA 3JUHA 4DH1A 5F95A 1E1VA 3HMNA 4XCUA 3HDMA 3MTLA 5L6WL 2ETRA 5IA0A 3HX4A 3QC9A 1DI9A 4JIAA 4O0VA 4PPAA 4FT5A 4IM3A 3SKCA 1NA7A 4BCIA 1WZYA 3PY0A 1Q24A 3PZHA 4FSZA 2GPHA 4BTFA 3PP0A 1M2QA 3LJ0A 4RSSA 4CTBA 5DT3A 4Y95A 2PL0A 3DK7A 3LFCA 4GU6A 3D2KA 3MA6A 3R6XA 1KE7A 2YJSA 1L3RE 1ZAOA 2Z60A 5D41A 3SLSA 2XK7A 3GXLA 2YM6A 1ZMWA 2OBJA 2QCSA 2R7IA 3DLZA 3MA3A 5DN3A 3CBLA 5J8IA 1G8SA 4EZ5A 3NVKI 2CNQA 1J7LA 1OMWA 3E7OA 4Y83A 5E8SA 4DFXE 4OBQA 5AV0A 1YKRA 3QRIA 2C5OA 3LCSA 4P2KA 4EK3A 3L9PA 4LGDA 4KABA 4I6FA 2A2AA 2Z2WA 2YAKA 3W0NA 2W0JA 2E2BA 4FTLA 3OCSA 4RLKA 2ONLA 4GG7A 5ANOA 4B8LA 2X8EA 3DBFA 3LAUA 3DKFA 3TUDA 3UODA 3CS9A 3RBWA 4D2PA 3NR9A 4U43A 1WBSA 4L3PA 3HP5A 4FL1A 2G2HA 3BLQA 3PPJA 4XHKB 5AUXA 4E5BA 5BQ0A 5JGBA 5M57A 4UMTA 5JSMA 3F3ZA 1S9IA 1YXTA 3H0ZA 2ZM4A 4RVTA 4TKSA 3ZLYA 2Z7RA 4ALUA 3ENMA 4FKOA 4YJOA 3GBZA 5IQEA 5CVHA 4EJ7A 2ONLC 5DEYA 3TKIA 4YZCA 3QTXA 2FSLX 3RCJA 3KXXA 3MVLA 1M17A 3EKNA 4BCJA 2I6LA 4QMXA 3ORTA 3RVGA 4DEAA 1H1QA 3W0OA 4CT2A 2PSQA 2UUEA 2XK6A 3PWDA 3UDTA 4KA3A 3RCDA 4MXXA 4FKPA 3FMEA 4CKRA 3V3VA 5AR2A 1FVRA 2OU7A 1WAKA 3DKCA 3KXZA 4DA5A 1UU3A 3LFAA 4JAIA 3LMHA 2GHGA 2PWLA 4O0XA 4EBVA 2C5VA 4DH5A 4XNEA 4U6RA 1QMZA 5AP4A 3QUPA 3VIDA 5CALA 2XARA 1PW2A 3FMJA 5CZHA 4L7FA 1QPCA 1FOTA 2W1DA 3HV7A 4BYJA 4UN0C 3SA0A 3PRFA 3R7VA 4A9UA 1IASA 4UY9A 4EK8A 4Q9SA 4CMUA 2VWYA 5ETIA 4BCNA 3U87A 2XIRA 3ORMA 3JVSA 3BWFA 2XCHA 4EOPA 4CFWA 5KMMA 3D2IA 4RVMA 4E4MA 4R7IA 3F7ZA 3SG9A 1UNLA 3GU8A 5CAQA 2OF2A 4EH7A 4IFGA 3E5AA 2RG5A 4FJVA 1S9JA 4IX5A 4DH3A 1WBWA 3ZO2A 2VNYA 5AWMA 4HZRA 4M12A 3N9XA 4FTKA 3VS5A 5I9XA 2VTMA 3R7IA 3UP2A 3FEGA 4AG8A 4GU9A 4EH6A 1PXKA 3TUCA 2IZRA 5FRIA 1H26A 3PY1A 4QMQA 2GTNA 3FV8A 4IJ9A 4CFNA 2YIWA 3KRLA 4M13A 1ZY4A 1OITA 2WMBA 3QQJA 3C4ZA 5EDQA 5JRSA 5AUUA 4U9AA 3GEQA 2OICA 3W2OA 1Z5MA 3QKMA 4XEYA 4JJRA 2J0LA 3DXQA 4D2SA 2UW0A 3Q9YA 4PMSA 4F09A 4KIQA 1PXIA 3UJGA 3BRBA 1IEPA 1PXPA 4IX6A 4IMYA 4ZSGA 4EUTA 5EH0A 4OTDA 3G2FA 3N4TA 5HQ0A 2BUJA 3F3VA 3WF7A 3QTUA 4M84A 3Q32A 4CXAA 4ARKA 3FBVA 1TQIA 4MH7A 5F94A 1M2RA 2WIPA 1G8KA 4KD1A 4KIPA 1Q8TA 4TN6A 4C33A 2X7FA 3D5WA 2R3MA 4J7BA 4R3RA 4FA2A 1K9AA 1MQ4A 3DCVA 4WG4A 5EK7A 2WMTA 4HGLA 4IBMA 4GKIA 2B9JA 4M14A 3FMDA 3R9HA 2WEVA 4KNBA 3WZDA 3P7BA 3TWJA 1OPJA 4TWOA 3I1AA 3COKA 3EQPA 2V55A 3LFBA 4YC8A 4PL5A 4RIWA 2OJJA 3E8EA 3Q4UA 2QO2A 3R7EA 5M06A 4C3FA 1E1XA 2Q83A 2X6EA 3U4WA 4GCJA 2VTPA 2BTRA 4CQGA 5CEMA 5EHOA 4FV4A 5HIEA 4HGSA 5BVDA 4FTQA 4BI0A 3ZO4A 4AW0A 4QP1A 1SVGA 2XNGA 3DJ5A 3NIEA 2OKRA 4O4BB 4XG9A 3OG7A 3IG7A 3E92A 2J51A 4APPA 3LJ1A 3GC9A 5FG8A 5C8KA 5T6KA 5KMJA 4M7IA 2QG5A 2GNIA 3ALOA 4OR5A 1PXLA 4FUXA 4D28A 2YDKA 3BYOA 3R22A 2P0CA 3PSBA 1P2AA 5KBQA 1JLUE 4E6QA 1UA2A 1UU9A 5A6OA 3HRFA 3MESA 4PX6A 4L3LA 4F70A 4ACDA 5JN2A 4TL0A 2QO9A 4FSUA 4QNYA 3AC5A 4E26A 4K77A 3EQFA 2RF9A 4AXCA 1NVSA 3IDBA 3R7OA 4KAOA 4Y5QA 2BZIB 5CX9A 4AWIA 3FDNA 1OL5A 5FDPA 2PUIA 4TW9A 4CFMA 5A4LA 2PZIA 1ZMVA 4OTQA 5LVMA 1ND4A 4WUNA 3Q60A 4Z3VA 4BYIA 4EK5A 4MYGA 3VS6A 4ANBA 3OXTA 3FI2A 2O63A 3QUDA 3V5LA 2ZOQA 3QC4A 4AA5A 4E4XA 3HZTA 3I5ZA 3P86A 4FG8A 1H25A 2SRCA 2YISA 3AC3A 4O1OA 5CLPA 1H8FA 4EZ3A 3ERKA 4YPDA 1YWNA 4QMSA 5CF8A 2XAMA 3OBGA 3KRWA 4BDEA 5J7HA 4DC2A 4ASDA 2C30A 3VUGA 4MBLA 1GNGA 3KMUA 3QRUA 4F1TA 4LYNA 4O81A 2B7AA 4BTJA 3D15A 3SW7A 4ITIA 5E1EA 3WF6A 4U8ZA 3BKBA 4K1BA 3L8SA 2AUHA 3SDJA 3WZEA 3EYHA 4U44A 5BVOA 5K9IA 3F5PA 4FV3A 5CSHA 4BB4A 1LEZA 3E8NA 5FEDA 1IR3A 4IAZA 4USDA 3O23A 2IVTA 2WMUA 3VBQA 4TWNA 4I0RA 3HMIA 4HPTE 3G51A 4DCAA 4RJ7A 2F9GA 5CNOA 5E7RA 2CKEA 3BU5A 4J99A 3VHKA 4RIWB 4G16A 3PJ1A 5D9HA 2PVRA 5BVWA 5DH3A 5KMNA 3QQLA 3E7VA 5FUTA 5J95A 3HUCA 4AX8A 1W2CA 3R02A 1FMKA 3I7BA 2XIXA 5M4UA 3OW4A 5CU2A 2W5AA 1M14A 1V0BA 4DFZE 3IONA 2Y0AA 2OFUA 3COMA 4O2ZA 5FP5A 2A98A 5HX8A 1G8JA 1G5SA 2VTOA 4G34A 4Z16A 4C35A 4QMYA 1MRUA 2X2MA 3ZS5A 3OW3A 4RQKA 4GVAA 3PJ8A 2J2IB 2IW9A 3ZTXA 5JKGA 2BILB 4QOXA 3HDNA 4P7EA 3C5IA 4O7TA 2DWBA 4DEDA 2QI8A 5KE0A 1Y57A 2C6MA 4L45A 4WBOA 4EUUA 5CY3A 3FQHA 3FZSA 4UALA 4KUJA 1PXNA 2PUNA 5T3QA 2HW6A 3BHTA 4YU2A 2CNUA 3DNEA 5K5NA 3LXPA 5BVKA 2WB8A 3RPSA 3HVCA 4DDGA 3K5UA 2BHEA 3GP0A 2BKKA 2ZV7A 2ITZA 4H39A 5HOAA 4HZSA 4A9RA 2HK5A 4QRCA 1XMLA 2UZBA 3CEKA 3D7ZA 4IHPA 3RWPA 5CAOA 3ID6C 4RJ4A 3DBCA 1KOBA 2YIYA 3JVRA 3FY2A 3MN3A 3SX9A 2YIQA 5BVNA 4FKQA 3AGMA 2X7OA 3QAME 4TXCA 5EI8A 3ZLWA 1SM2A 4U5JA 3DV3A 4YURA 3UO5A 1ERKA 4W8DA 4LRMA 2ETMA 5L2IA 3R9NA 4JBPA 3FHRA 5EI2A 3WI6A 5M56A 3BE9A 3HRCA 5K5XA 4IFCA 5HBJA 4FNXA 1XBBA 4AXDA 2X2LA 4RFMA 2YDJA 5EKOA 5EW9A 2R3JA 4F9AA 3VUKA 3NWWA 2RFEA 3DBEA 4BHNA 5BYZA 2OXDA 5EW8A 3AT2A 4NL0A 1CMKE 4AA0A 2PMOX 2FSMX 4WNKA 1OL2A 3PY3A 2ZB0A 4QP9A 4BKZA 5F4NA 1AD5A 2B0QA 3NNXA 5L3AA 3KN5A 4QYFA 4FKIA 4AXAA 4CKIA 2DUVA 3IK3A 2VTSA 4HNFA 5AUVA 2I0EA 4CD0A 3OP5A 2HCKA 1HCKA 2XF0A 2ZVAA 3PG1A 4MXOA 5EHYA 5FDXA 4AE9A 3MY5A 1F3MC 5CEQA 3LW0A 3D5XA 3RPRA 5CEIA 2V5QA 4B8MA 3ODYX 4J71A 5EHLA 4C38A 4QTAA 4DFYA 2LAVA 4U80A 1IAJA 4C62A 4JVGA 1GIHA 1OKZA 3CY2A 4PL3A 4QPSA 2FB8A 2G1TA 3GCQA 4UWYA 4YC6A 4F63A 5LVOA 4BHZA 4IB0A 5M09A 5IQGA 3OXIA 3QZFA 5KMIA 4CZTA 1GZOA 4KSQA 3PPKA 4CSVA 3OOMA 3AKKA 3HMOA 2PVHA 4AT5A 5E9EA 2P4IA 4X2FA 2XB7A 4F7SA 4CKJA 1X8BA 1YI4A 5CZIA 4FGRA 2HZ0A 1UKHA 4LV5A 2JKOA 3H4JA 4C8BA 2WMVA 1L8TA 5I9WA 4A9TA 2BRHA 3ANRA 3MH1A 2C6LA 3CIKA 4QDEA 3MWUA 4AOTA 1KOAA 1W0XC 3AT3A 5HVJA 3DGKA 1DS5A 4IH8A 5C9CA 4FX3A 4DT8A 1OECA 1UNGA 4JOAA 5CXHA 3LCOA 4IAKA 4PQNA 2XK4A 3VUDA 4F6WA 1YI6A 3TKHA 1Y6AA 4XBUA 5CU4A 1JPAA 3FL4A 5IH5A 1JQHA 4NUSA 1G3NA 3EFJA 3F69A 3QHWA 5HG7A 2R3NA 2PU8A 3RGFA 2J7TA 2P3GX 4D9TA 3KREA 3TXOA 3FZRA 3VS1A 2WZJA 3IW7A 2VUWA 5HNBA 3T3UA 4FKVA 3V5QA 2OI4X 4FTIA 3W33A 4HGTA 2X0QA 4FZ7A 5EM7A 4F1MA 1YI3A 2PVNA 4FSQA 5D7VA 2JLDA 4A7CA 3MTFA 2ITQA 4U79A 3T9TA 3PRIA 3WOWA 1Q41A 4QPAA 5E92A 4NYEA 5HD7A 4FTOA 2H8HA 2YDIA 4E7WA 5HE2A 5CEKA 4DHJA 4W4WA 3FXXA 4NT4A 4G3CA 4XX9A 4HVGA 2C68A 2PHKA 4NM0A 5JT2A 4ANOA 2W1FA 3R2YA 4F9YA 3O8TA 4J8MA 3MVMA 5BMSA 1ZOGA 4NIFA 4ZIMA 3FPQA 1OKVA 5ANGA 4ACHA 3TTJA 3OTUA 1Q97A 1U5QA 4QPMA 5AV2A 3C4CA 3QGYA 1OB3A 3EFWA 3E63A 4LMUA 4MEDA 4IVCA 4GT4A 2R0UA 4OUCA 4AA4A 1W98A 3BEGA 4FTCA 4LFIA 3W16A 3VBVA 1ZZLA 3M1SA 5BPYA 4WOVA 4CRLA 3TNPC 3UNZA 4BIDA 3DBDA 4FT9A 2PVFA 3NLBA 4G6NA 2CKOA 4NH1A 3PTGA 4XG8A 3ZBXA 3Q6WA 2VNWA 4NKSA 4EH8A 4CFXA 4I5MA 3S00A 5IUGA 3WZKA 1PJKA 1H1PA 2X1NA 4X6QC 5E4HA 1HOWA 1OUYA 1Y91A 2ZYBA 2C5YA 2RG6A 3NW7A 5B0XA 4FK6A 3HL7A 3UO6A 2JIUA 5JMSA 4A9SA 1W7HA 2WU6A 3KC3A 2VV9A 2BROA 3KQ7A 4I6BA 1TQPA 2VO3A 3ZEWA 2IW8A 3P4KA 1QPEA 2WAJA 4NKAA 3UPZA 3RPVA 1Q3DA 3NAYA 1BX6A 4ZTNA 3BCEA 4LGHA 5HE0A 3TJCA 2ZV9A 1KE5A 3ZFXA 3D83A 4O7ZA 4FIGA 5EDPA 2UZWE 3R8VA 1FPUA 1GZKA 1BI8A 4YJVA 3ZZWA 4OBPA 4FEWA 2NRUA 5DVRA 1B38A 3QYZA 2UW4A 5GJGA 4D0WA 2LGCA 1FGIA 5KKRB 4KBCA 4D2WA 2XBJA 3I6WA 3ZHPC 3NCGA 4TYEA 5IISA 3NX8A 3F82A 4OTRA 4R5YA 3CY3A 1UVRA 1PMNA 2XNPA 3FYKX 4O0SA 2AEGA 3DY7A 2W17A 3QKKA 4IM2A 3WE8A 5HVKA 2ZM3A 3R1YA 4AW1A 2QODA 3DAEA 2UZTA 3EQRA 1O6LA 3LMGA 4GIHA 4TT7A 3KRRA 4MQ2A 4S32A 2OF4A 5LCKA 5HHWA 5L2TA 3PFQA 5TR6A 4O27B 3KA0A 3ET7A 2XUUA 3THBA 5L6OA 3UG2A 5LARA 3KIOC 1ZYSA 1KE9A 3JR1A 4S31A 2UW9A 3PXZA 1G8AA 3CGFA 1CKIA 4XBRA 1TFFA 2XNMA 4IADA 3NCZA 3BLAA 2C3JA 3V8SA 4YJQA 3PE1A 2QOKA 2OH4A 4NIFB 2ZB1A 2PVJA 4FV1A 4O2PA 2X0OA 4Y46A 3ZZEA 5J5SA 3MVHA 5BX0A 4E73A 3DFCB 3UIUA 3NS9A 4YC3A 1SYKA 4YSMA 4BI2A 1JOWB 3G33A 3SD0A 1Q4LA 4U0IA 4NSTA 3NNUA 2YM4A 4A07A 5DHJA 2EWAA 3AC2A 2JITA 3DQWA 3C9WA 3U51A 5E8YA 4EQUA 2H6DA 3FMKA 3PSDA 4J52A 2WFYA 5K4IA 3ZXZA 5EKNA 2XK9A 4YO4A 3UOKA 4H3PA 5J9LA 3R0TA 3MYGA 4MD8E 3P79A 4YJRA 4G6OA 1UU7A 4H36A 4TYIA 4BGHA 3MY1A 2VRXA 4RA4A 3EHAA 4M97A 3NAXA 4A06A 2CCHA 3Q3BA 3QLGA 4FSRA 3UVPA 4YUQA 5GZAA 4O7LA 5H8BA 3Q9XA 3UQFA 2C69A 1XO2B 4EHGA 2YFXA 2ZMCA 4EBWA 3UDSA 4ZMFA 2I0YA 3EQDA 2J9MA 3QQGA 4BDIA 4O4EA 3ZYAA 1B39A 3BBTB 3T3VA 2QOCA 4BIEA 3NRMA 3FLNC 3RAIA 3BIZA 4FBXA 4FV6A 4MKCA 2CGVA 2R3FA 2BRGA 2C6EA 5IA2A 2HY81 4FEUA 3BGZA 1RE8A 1UWHA 4OBOA 4MNEA 4AU8A 4O7VA 5FEQA 3FUPA 4DEIA 1EH4A 4GH2A 5HBHA 4C57A 1ZOHA 3ZLXA 4XP3A 3W2CA 1WBTA 3BHYA 4GT3A 2J5EA 2PE0A 4MCVA 4KS7A 4Y85A 3TNHA 4X21A 3D4QA 4JL9A 1OKYA 2HELA 2W05A 2BCJA 3BELA 2EU9A 2X6DA 4AXFA 4QMLA 2OO8X 5DT4A 4HCVA 2PMNX 3C51A 3UO4A 4IE9A 4E5AX 3HKOA 3ROCA 5A54A 3A7JA 4FUYA 3HA8A 3PVWA 4X3FA 5IQIA 1REJA 2R3GA 4UMUA 5M51A 3PDTA 4FTMA 3AT4A 3DJ6A 4RIOA 4YBKA 5ACKA 4FK3A 3WYXA 5A46A 5DI1A 3S95A 2W1IA 2JKQA 4QP2A 2VWBA 4F0GA 5AA9A 4LRJA 1GOLA 4NCTC 3HYHA 3QL8A 3OXZA 3ZRLA 3KU2A 3TL8A 1JVPP 3CQEA 5A9UA 2WTIA 3LQ5A 4EH3A 4MUQA 3ETAA 4JR7A 1YOMA 2QOFA 1XH7A 1RQQA 3A7FA 5BYLA 1VEBA 4CMTA 4OTPA 4BCOA 2W7XA