2VOCA

Thioredoxin a active site mutants form mixed disulfide dimers that resemble enzyme-substrate reaction intermediate
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
b'AIVKATDQSFSAETSEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHLLEHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Thioredoxin A active-site mutants form mixed disulfide dimers that resemble enzyme-substrate reaction intermediates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Electron transport
total genus 29
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vocA00
5G30A 4WF5A 5KEJA 2HZEB 4NV5A 2FNOA 3ZZXA 3ZFLA 2FY6A 1NW2A 3A2VA 3DRNA 5IO0A 3ZFBA 1XW5A 5CO3A 1QK8A 1OVNA 3UBLA 4DSSB 2DLXA 2CV4A 5H5QA 4RQRA 4TXOB 1V40A 2MBTA 2HXKA 4KCEA 2M72A 1PD21 2PBJA 1GSUA 1R5PA 4NHWA 3W8JA 3CSIA 2ALBA 2AB6A 3EYTA 3IRAA 4BL7A 1K0NA 1WE0A 4KX4A 2X64A 3FEUA 4DSRA 2K6VA 2J23A 3D22A 5AIXA 4EL1A 1A2MA 2VCTA 4I6XA 4IBPA 2IFQA 2K9FA 4ECBA 3EURA 1EGRA 3GH9A 2ON5A 1DUGA 2YANA 1J0FA 3QFBC 1VF4A 5G1KA 3CYNA 5B6NA 4OO5A 1WIKA 1ZL9A 2RIIA 4BWSA 2HT9A 4HOJA 3QCPA 2AHEA 2M80A 4GSSA 1OC8A 4EC0A 1EV9A 3KH7A 2L5OA 2GZZA 3QR6A 5DQYA 2JSZA 5DAKB 4ZL7A 3U5RE 2IMKA 1M99A 5ECLB 1KTEA 1PKZA 2WCIA 4F0BA 2C8UA 1R7HA 1XWAA 3GTUA 1M9AA 2KP1A 2EIOA 3FR6A 4NPBA 2OE0A 1TJDA 1SKSB 1PL2A 2I81A 2R4VA 4TR4A 2MMOA 1EZKA 2GT6A 2VAFA 2PUKC 3SWLA 2X8CA 3KGKA 2H8LA 3GUSA 3W6GA 1OE8A 2X99A 1X9MB 1AQVA 1M0UA 1GUMA 3LORA 6GSXA 1FAAA 4PGTA 1X9SB 2GQLA 4TR0A 6GSSA 4IQAA 1EP8A 2N5BA 2V2GA 4OMVA 3LFLA 1K3YA 3NOFA 4XS4A 1MDJA 2ZCTA 2AJQB 4MPGA 3RPNA 2HFDA 1B8XA 1XIYA 4RQXA 4XTSA 1K0MA 4E8EA 5HR2A 2L6DA 4XS6A 2OACA 5EL8A 4RI7A 3EVIA 3TCOA 4EUYA 1WPIA 4MF6A 1YDKA 4POMA 3MDKA 2OBKA 2XPDA 1SL0B 1A2LA 2N5FA 3DD3A 2HI7A 1XWKA 2NPBA 6GSYA 3DVXA 4PQHA 2O89A 5J9BA 1SL1B 1PX7A 2WZ9A 2NBSA 1BQ7A 3UL3A 3DVWA 3GMFA 1BEDA 4CW9A 2JSYA 3IPZA 2LKUA 10GSA 2E2GA 3IE3A 5ECIB 4IS0A 1M7TA 2IN3A 4N30A 2DSAA 2VM1A 1PN9A 2PMTA 3GL5A 4IELA 4PUFC 1TK5B 4MABA 2KOKA 3EU4A 5DVBA 2O85A 3ZIJA 3L0HA 4NWYA 18GSA 1K0DA 3A2WA 3IXRA 4AF2A 1PMTA 2ES7A 3KIJA 1Y25A 4IVFA 5D93A 5ELGA 4XHMA 1TK0B 1MEKA 4MMMA 5F06A 2L4QA 1XZOA 2DIZA 3ZRDA 1V98A 4PNGA 2GSSA 2NVLA 2F51A 3TKQA 4BA7A 4MK3A 3G7JA 4WR4A 3EINA 3D4MA 1SKWB 3M9KA 3E0UA 4MDCA 3KMOA 1ZGNA 2GSQA 3GX0A 3IR4A 1F3AA 1VF3A 2XPEA 5E4WA 3EMPA 1M9BA 2MMNA 1GULA 1BG5A 1PGTA 1SK0A 2IPAA 1YEXA 3F63A 1XWBA 3IBHA 1B9YC 1OAZA 3CXGA 5CREA 4BWQA 1KEBA 2B3SA 5C04A 1XW6A 2B7JA 4O7HA 3GHAA 5HQPA 3D6IA 3IAS2 1JZDA 2L59A 2YNXA 2TRXA 5ECSA 1SK1A 3GSTA 5F8BA 1SD9A 3TB2A 3AY8A 4PXOA 1USBA 5ECOB 4IP6A 1WOUA 2VLUA 3KZQA 2C1YA 2CQ9A 1G7EA 1TOFA 3PR8A 4WEYA 3UOMA 3E9JB 3GKMA 2M46A 5G1LA 3TKSC 3TGZA 3VLNA 4MF5A 5CAXA 2B5YA 1F2EA 2F9SA 2YWNA 2I4AA 7GSSA 3UVHA 2MBSA 2BMXA 4KAEA 2FWFA 1S3AA 1E6BA 3HVSA 4BPYA 3ZLPA 1SJ6A 3C1RA 3TJFA 3VWVA 3LG6A 4HJMA 4X43A 8GSSA 2L57A 5IMAA 2LJAA 22GSA 2OKAA 5CNWA 1PX6A 3L78A 2B7KA 3HYPA 4EVMA 3CRTA 1YKAA 2I9HA 2LJKA 2LQQA 2GQMA 2GLRA 1GWCA 2C3NA 1ZYQB 2GSRA 2H1DA 1SJIA 2FWGA 1TK8B 4TN8A 1XPVA 4YAPA 3RDWA 2G2QA 4ULXA 3M0FA 4ECCA 1QGVA 4F2IA 4DEJA 4I97A 1Z6NA 2JL4A 5B6MA 4IN0A 2F8FA 2YN1A 4ACSA 1B4QA 1XCCA 3F9UA 4P3YB 3LEFA 1S3DA 2YWIA 5ECQB 5ECNB 3GX8A 3VWWA 5DBQA 3VI5A 3QOUA 1GRXA 2YP6A 3QAWA 5IQYA 3TJBA 1TRVA 2QKEA 2VCVA 2DJ3A 1SD8A 2QGVA 4X1UA 1PL1A 4OFMA 4MCUA 4G9HA 4N10A 5ID2A 5IO2A 1ML6A 3MAKA 1ERTA 2YJ7A 2YWOA 1OC9A 3ED3A 3FY7A 3A3TA 3LYKA 1GTAA 1EGOA 1N2AA 1F37A 1YF0A 1X5EA 3WT1A 4G19A 1XBSA 2AAWA 5A5KA 3LYPA 1TP9A 1CQHA 4EDYA 4D73B 2TIRA 3PGTA 5DALB 3TOUA 3GFKA 1HD2A 1ILOA 3G9BA 1G6WA 3J7Yk 2VCZA 12GSA 4POBA 4KGIA 2WB9A 2VCQA 2LUSA 3UJ1A 2RM5A 4WETA 2CVKA 4V2LA 2XBQA 3GN3A 2RLIA 1TRSA 3ZVJA 1BAYA 3G7IA 5DCGA 3UIWA 2KLXA 3C1SA 1HQOA 2FUG2 4ML6A 4MJBA 3SBCA 3ZREA 1V58A 1T1VA 5ECRB 3R2QA 2DJ0A 1M2AA 4KUNA 4WBJA 1W89A 2ZUPA 1EV4A 2WFCA 1EWXA 2IL3A 3GKNA 2KHPA 3UBKA 1A0RP 1E2YA 1PA3A 3ERWA 3F6DA 3TJJA 3TRPA 2J9HA 4ZB9A 4FO5A 2IJYA 4LA1A 5F0GA 2VL2C 1QQ2A 3QAVA 3NZNA 1AQXA 5A4WA 3IAM2 4GCIA 3IK7A 2HE3A 1A0FA 1ERWA 2H70A 4PUAA 1X5CA 3QFAC 1O8XA 4KH7A 3HHVA 5D9TA 3CMIA 4XCSA 3FR9A 1EOHA 2WULA 2FWHA 1PRXA 5L71A 1U3AA 16GSA 5F05A 1TXXA 1QFNA 5DDLA 2VCXA 5J5NA 4DSQA 4KCAA 4OD7A 4POLA 3CTFA 3L9UA 3GA4A 3TRXA 4I2UA 3IDVA 2WJUA 2GZYA 2HRNA 3PINA 4MJCA 4PX1A 4HEA2 3V1WA 2YZUA 2JADA 2FGXA 1X9WB 3FW2A 4AJ8A 4FIWA 5A4VA 1GTIA 3LQ7A 3LSZA 4YQVA 2P0GA 2PGTA 1K0AA 4HS1A 2R6KA 5KN3A 3QDNA 2VM2A 2C3TA 4KDYA 4ZL8A 3A5WA 1K3OA 2LNTA 1YF1A 3JCML 4F03A 1R4WA 2DJJA 6GSTA 3G7YA 2LNSA 1TI3A 1BYEA 2XC2A 3GRXA 5JWQB 4ZB8A 5ELAA 5KN1A 5AN1A 3KP9A 1FO5A 5ECPB 2FWEA 3CRUA 5IOXA 5J4UA 1T3BA 1GLPA 3TKRA 4IHUA 1TRWA 2WS2A 4YH2A 1JFUA 2CA8A 5C00A 1YY7A 1DE2A 1Q98A 3L9SA 3H8QA 3PH9A 4IJ3A 2B5XA 2MYGA 1GP1A 2GTUA 1X0RA 4MJAA 4K9ZA 5CRGA 3DWVA 2L4CA 1EOGA 5CP1A 2E2MA 2KUCA 3US3A 4EXJA 3KM6A 5HR3A 1Z7RA 5G5EA 4H86A 5IMZA 3MNGA 4NV2A 4K0GA 5LD0A 3M1GA 4K7IA 3HDCA 1UC7A 2V1MA 1A8LA 4WR5A 2FA8A 2IFQB 2B5EA 2F3MA 1UA5A 3WD6A 2WRTA 4L5OA 19GSA 4F9ZA 1OKTA 1RQMA 2VIMA 3WGEA 2P31A 2C0DA 1VRSD 4EDZA 1Z5YE 4OO4A 2PVOC 3ME8A 4XRAA 1F9MA 1ERUA 1NM3A 1NHOA 5GSTA 2A2RA 2DJ1A 1MD4A 3IK9A 1JHBA 3P90A 1M2BA 2H0IA 6GSVA 2C80A 5AGYA 5ENUA 2GS3A 3FYGA 3GTUB 3DKSA 1M2DA 1Z6MA 4FYBA 3P8WA 4KSMA 2VD1A 2H1GA 5IMVA 1TW9A 2H66A 3VFIA 3KMNA 1AW9A 4TKYA 4NAXA 5LNKe 1ERVA 4KNDA 1ZCPA 2CT6A 5KN2A 4D73A 4ZBDA 3GNJA 2IIYA 2R37A 4GSTA 1KNGA 2GSTA 4HU9A 1THXA 2CZ3A 3HVXA 4I8BA 4EE0A 3F3RA 4X0XA 5ECHB 2OJLA 4J2FA 2PWJA 3VPTA 1B48A 3FK8A 4TR3A 1SK2A 3IC4A 17GSA 1MDIA 2IWTA 2RM6A 4XS4B 5EVOA 2DBCA 1T00A 3BCKA 4GLTA 2CAQA 2WDUA 1VF1A 2NDOA 3APSA 2BJXA 1GSQA 4POKA 3KCMA 1YEPA 4GQFA 2YWMA 4ISDA 3LXTA 4K6XA 3FRCA 14GSA 3H79A 2GDRA 2ON7A 1J9BA 2V32A 3BD2A 5GAND 5IPGA 3DXBA 2FCHA 1HNBA 1DSBA 5D9WA 1GNWA 1LJRA 2HZEA 3P7XA 4LMVA 4J57E 3CSHA 3IV4A 3K8NA 1U88A 1PSQA 4MP4A 5AIVA 3OR5A 4RUVA 1FOVA 4DSSA 3FZAA 3F4RA 4TOPA 5HFKA 5B7CA 4O32A 2RUFA 4TXOA 3LXZA 1JLWA 1UN2A 2DMLA 2LRCA 3H4KA 3HD5A 2HSHA 3CSJA 4TVEA 4JZQA 2H74A 4J56E 5ABRA 1GSDA 3HJPA 3FZ5A 1RW1A 4L0UA 2GGTA 2C3QA 1WJKA 3C73A 2CVBA 1XXUA 3GL3A 1A24A 1UVZA 2CVDA 5A4UA 5DJLA 3Q6OA 4TR1B 1FG4A 1V9WA 1J08A 1Z3EA 1GL8A 1WRYA 4KE3A 2XBIA 9GSSA 4V2MA 5CRHA 4LLRA 2LRTA 3TKSE 2IMFA 4WF4A 1G0TA 1H75A 3Q19A 2IMDA 1T7PB 1XOAA 5DAKA 4K7NA 1EP7A 3D5JA 5E59A 3WYWA 3FKFA 2VLTA 3GKKA 1K0CA 2ZNMA 5D96A 4ZBAA 1TI1A 4MJEA 3O3TA 1G7OA 5H5RA 4JBBA 4IKHA 3N9JA 1YZXA 5EPFA 2XHFA 5GSSA 1BJXA 1QUWA 5DCHA 4MZCA 4MZBA 4YQMA 1DE1A 2MMZA 1N8JA 1GSSA 1OC3A 3VI7A 2AUVA 4IJIA 3ZMLA 2H73A 3DMLA 1WMJA 3N5OA 1BX9A 3TKSA 3UVTA 3I6AA 3UARA 2H76A 1THOA 4V1Ag 5JCUA 5JWOB 3ZVJD 2VUPA 3DIEA 4TXVA 4WXTA 3FHKA 4L8EA 3D0ZA 3F3QA 1TKDB 1WP0A 1F6MC 2EIRA 4JRRA 3I9V2 3C7MA 2MMAA 2HRFA 1T8EB 1Q4JA 2H75A 2X8HA 1LU4A 3QD9A 1K3LA 1KBNA 3BOAA 1HYUA 3H1NA 3HCZA 3DEXA 4JU5A 3E3EA 2YV9A 4QQ7A 4BVXA 4O92A 2PVQA 2HYXA 1SENA 5CYYA 4MF7A 3ZL5A 3BCIA 4CDOA 3FZ9A 4K1FA 1YJ6A 5IPHA 3APOA 1O6JA 4NMUA 2FA4A 3F4SA 4EO3A 2K8VA 3IOSA 1NSWA 4ZB6A 2FHEA 4TRXA 1G6YA 1B9XC 1FHEA 4YAVA 1XVWA 5CRWA 5D9VA 1T4ZA 1TU8A 2B6MA 3FR3A 4IQ1A 3I69A 3KTBA 4JE1A 4N0VA 1CQGA 3C71A 2GT5A 5IIZA 4E8HA 3GURA 2AV4A 1QMVA 2LEGA 1O7UA 4F82A 1SYXA 4EF0A 2H71A 3ZITA 2REMA 3APQA 5ID2B 1C72A 4IGJA 1LBKA 2JZRA 2C0GA 3UAPA 2GZPA 1ZMAA 4FH8A 3TUEA 2LV3A 1OYJA 1VF2A 4ZBBA 1OC9B 2YPMA 3BBYA 3KP8A 5IMFA 4ECIA 3F0IA 4ZL9A 5GZZB 2H6XA 4WBRD 4HDEA 1ZZYA 4BVYA 1H4OA 2YOIA 13GSA 1FVKA 3TJGA 2E7PA 2R2JA 4PURA 5IOWA 2OE1A 1B4PA 4KB3A 5EY6A 2VD0A 4WKWA 3RAZA 3F6FA 1GH2A 1YKCA 5GAPD 2QC7A 2H30A 1GNEA 1XWCA 5F07A 5FWGA 1O8WA 4Q5FA 2R3XA 4L0WA 4LL1B 3Q74A 3LJRA 4Q5NA 1X5DA 2RUEA 2CZ2A 3EWLA 3QAGA 2DJ2A 4XS1A 3O76A 1ZYEA 3L4NA 4L5LA 2O87A 3KXOA 4HQZA 2NTOA 5D73A 2V6KA 1I5GA 1FB6A 2B1KA 3VWXA 3WGDA 1WWJA 2KP2A 2FLSA 2OE3A 5D9XA 4ZXGA 4MLYA 5IM9A 3RPPA 1SL2B 4OWYA 5JCWA 1OKDA 1IYIA 3WT2A 1O81A 3DGQA 4G2EA 1U3IA 5B8BA 2DMMA 2PERA 4GXZA 1SJZA 1NHYA 4EKZA 1JZOA 1EEMA 2HNLA 3ISOA 4MH3A 2HZFA 4HUAA 1GSFA 1XOBA 5INYA 3KH9A 5HR1A 1GUHA 3DYRA 4Q5RA 4V2NA 2MZCA 3ME7A 1GTBA 5IMDA 3UMAA 2BTOT 4KSOA 2VL2A 1TTZA 4JR4A 3HJOA 4MA9A 2K8SA 3GYKA 3BJ5A 1SYRA 5D8IA 4Z7XA 4ILFA 3KD0A 5FT3A 1K0BA 4FYCA 2V6OA 1AIUA 4JR6A 1JZRA 3FZ4A 1T4YA 5DQSA 3ERGA 3GIXA 1IYHA 1FW1A 1XFLA 1K0OA 4V1Ap 2Z9SA 1EEJA 1A8YA 1R5AA 1Z9HA 2JACA 1GUKA 4CHSA 2VOCA 1O85A 3ERFA 1A23A 3A2XA 2FD3A 1F3BA 3U6VA 3S9FA 1OE7A 4OFNA 2C4JA 1A2JA 2H6YA 4TR1A 4ZIJA 4TW5A 5AISA 3D21A 5B8AA 2B1LA 4K2DA 2C0FA 5CRDA 3HJMA 2D2ZA 1HNAA 3EMXA 4I2TA 3IHQA 2LS5A 2E0QA 4KDUA 5COHA 3W8SA 4MPFA 3Q18A 1XW9A 3VPQA 2O7KA 4PQIA 1TRUA 4QL9A 5IMCA 4LMWA 1QXHA 4PNFA 5DALA 2H0HA 4N0ZA 1ACVA 3J7Yb 3HZ4A 3H93A 2P5RA 2GQKA 3GV1A 1AUCA 5J9CA 3GSSA 2LSTA 1TDIA 3M9JA 1YQ1A 2JZSA 4OFTA 2I3YA 2OBIA 1RK4A 1FB0A 2H0GA 2GVPA 4PQ1A 3TJKA 3RBTA 1AQWA 2PN8A 1SKRB 4YQUA 4DVCA 2A4VA 4F0CA 5HFIA 2PU9C 3I43A 3F4TA 2LTKA 1ST9A 3HKRA 2G0FA 2YJHA 3CTGA 1AC1A 1S3CA 5KN0A 2HLSA 1HNCA 3ZMKA 2LQOA 4HZ4A 3MWHA 3CBUA 2DC5A 1U87A 1DBYA 3NIVA 2YCDA 2L6CA 3RHBA 3UEMA 2JZTA 1AAZA 4KW6A 5G31A 3L9VA 4GRFA 1MDKA 4FYUA 4GQCA 2VLVA 5HR0A 3EC3A 2C0EA 2OA7A 2VL3A 3EE2A 1ABAA 1MD3A 2VL9A 3HA9A 1URMA 4KDXA 4K8MA 4AJ7A 3HXSA 4AGSA 4OCFA 4HU7A 1W4VA 3TRQA 2P5QA 1PKWA 2R5GA 2DJKA 5JWRB 3IA1A 3VWUA 4GSNA 2H19A 2DIYA 5ECKB 4HZ2A 2A2SA 1MTCA 1V57A 1AXDA 1GSEA 6GSUA 3KTLA 4NXIA 3GH6A 4RI6A 2QSIA 1Y6EA 5LCZA 2X8GA 5G5FA 4AJ6A 2OADA 3C8EA 2WGRA 4GF0A 3TKPA 1TU7A 1JZWA 4XIHA 2CAIA 3M8NA 4G10A 3D4TA 2H72A 2H6ZA 3QPMA 3GKXA 1R26A 4IP1A 1XWGA 4GTUA 2H1BA 2IMIA 4ZILA 3TDGA 3WGXA 11GSA 4K7OA 2YV7A 3HY2A 4IW9A 2VCWA 4HI7A 3LWAA 5J3RA 5JCGA 2HSYA 2V41A 5HFGA 1U6TA 4N11A 1ZOFA 1O73A 4HQSA 4XRDA 2EC4A 5FHIA 3LGCA 1GLQA 4MH2A 1VGLA 4K0NA 1I9DA 4I5QA 3RHCA 2N5AA 3HZ8A 2EIQA 3KJYA 3VURA 3KEBA 1V2AA 4Q5QA 3ZIVA 4ID0A 5H5SA 5DJMA 2CX4A 3P2AA 2O8VB 4ECJA 3ZTLA 2YZHA 2CX3A 4JEDA 2H1AA 3O6TA 3QMXA 2LJRA 1Z7PA 5J41A 4GWRA 4MZWA 2AYTA 1JLVA 1XVQA 2PPTA 2F8AA 3MSZA 1SU9A 3VK9A 3ZYWA 2K18A 4OCEA 3HVVA 4NHZA 5ECMB 2I1UA 2L5LA 2IMEA 5G2ZA 1GTUA 1FVJA 2VO4A 3EU3A 2H01A 3F8UA 1ON4A 2JU5A 4O5RA 2TRCP 4ML1A 6GSWA 2LRNA 4QL7A 1PQNA 20GSA 4HJ2A 4KA0A 4LL4B 3TOTA 1GSYA 3M3MA
chains in the Genus database with same CATH superfamily
5G30A 4WF5A 5KEJA 2HZEB 4NV5A 2FNOA 3ZZXA 3ZFLA 2FY6A 1NW2A 3A2VA 3DRNA 5IO0A 3ZFBA 1XW5A 5CO3A 1QK8A 1OVNA 3UBLA 4DSSB 2DLXA 2CV4A 5H5QA 4RQRA 4TXOB 1V40A 2MBTA 2HXKA 2QA2A 4KCEA 2M72A 1PD21 2PBJA 1GSUA 1R5PA 4NHWA 3W8JA 3CSIA 2ALBA 2AB6A 3EYTA 3IRAA 4BL7A 1K0NA 1WE0A 4KX4A 2X64A 3FEUA 4DSRA 2K6VA 2J23A 3D22A 5AIXA 4EL1A 1A2MA 2VCTA 4I6XA 3PPUA 2IFQA 2K9FA 4IBPA 4ECBA 3EURA 4YKGA 1EGRA 3GH9A 2ON5A 1DUGA 2YANA 1J0FA 3QFBC 1VF4A 5G1KA 3CYNA 5B6NA 4OO5A 1WIKA 1ZL9A 2RIIA 4BWSA 2HT9A 4HOJA 3QCPA 2AHEA 2M80A 4GSSA 1OC8A 4EC0A 1EV9A 3KH7A 2L5OA 2GZZA 3QR6A 5DQYA 2JSZA 5DAKB 4ZL7A 3U5RE 2IMKA 1M99A 5ECLB 1KTEA 4X4JA 1PKZA 2WCIA 4F0BA 2C8UA 1R7HA 4A5PA 1XWAA 3GTUA 1M9AA 2KP1A 2EIOA 5BRTA 3FR6A 4NPBA 2OE0A 1TJDA 1SKSB 1PL2A 2I81A 2R4VA 4TR4A 2MMOA 1EZKA 2GT6A 2VAFA 2PUKC 3SWLA 2X8CA 3KGKA 2H8LA 3GUSA 3W6GA 1OE8A 2X99A 1X9MB 1AQVA 1M0UA 1GUMA 3LORA 6GSXA 1FAAA 4PGTA 1X9SB 2GQLA 4TR0A 6GSSA 4IQAA 1EP8A 2N5BA 2V2GA 4OMVA 3LFLA 1K3YA 3NOFA 4XS4A 3FMWA 1MDJA 2ZCTA 2AJQB 4MPGA 3RPNA 2HFDA 1B8XA 1XIYA 4ICYA 4RQXA 4XTSA 1K0MA 4E8EA 5HR2A 2L6DA 4XS6A 2OACA 5EL8A 4RI7A 3EVIA 3TCOA 4EUYA 1WPIA 4MF6A 1YDKA 4POMA 3MDKA 4BVXB 2OBKA 2XPDA 1SL0B 1A2LA 2N5FA 3DD3A 2HI7A 1XWKA 2NPBA 6GSYA 3DVXA 4PQHA 2O89A 5J9BA 4O5UA 1SL1B 1PX7A 2WZ9A 2NBSA 1BQ7A 3UL3A 3DVWA 3GMFA 1BEDA 4CW9A 2JSYA 3IPZA 2LKUA 10GSA 2E2GA 3IE3A 5ECIB 4IS0A 1M7TA 2IN3A 4N30A 2DSAA 2VM1A 1PN9A 2PMTA 3GL5A 4IELA 4PUFC 1TK5B 4MABA 2KOKA 3EU4A 5DVBA 2O85A 3ZIJA 3L0HA 4NWYA 18GSA 1K0DA 3A2WA 3IXRA 4AF2A 4CY8A 1PMTA 2ES7A 3KIJA 1Y25A 4IVFA 5D93A 5ELGA 4XHMA 1TK0B 1MEKA 4MMMA 2L4QA 5F06A 1XZOA 2DIZA 3ZRDA 1V98A 4PNGA 2GSSA 2NVLA 2F51A 3TKQA 4BA7A 4MK3A 3EPTA 3G7JA 4WR4A 3EINA 3D4MA 1SKWB 3M9KA 3E0UA 4MDCA 3KMOA 1ZGNA 2GSQA 3GX0A 3IR4A 1F3AA 1VF3A 4BVYB 2XPEA 5E4WA 3EMPA 1M9BA 2MMNA 1GULA 1BG5A 1PGTA 1SK0A 2IPAA 1YEXA 3F63A 1M3IA 1XWBA 3IBHA 1B9YC 1OAZA 3CXGA 5CREA 4BWQA 1KEBA 2B3SA 5C04A 1XW6A 2B7JA 4O7HA 3GHAA 5HQPA 3D6IA 3IAS2 3IC8A 1JZDA 2L59A 2YNXA 2TRXA 5ECSA 1SK1A 3GSTA 5F8BA 1SD9A 3TB2A 3AY8A 4PXOA 1USBA 5ECOB 4IP6A 1WOUA 2VLUA 3KZQA 2C1YA 2CQ9A 1G7EA 2HRKA 1TOFA 3PR8A 4WEYA 3UOMA 3E9JB 3GKMA 2M46A 5G1LA 3TKSC 3TGZA 3VLNA 4MF5A 5CAXA 2B5YA 1F2EA 2F9SA 2YWNA 2I4AA 7GSSA 3UVHA 2MBSA 2BMXA 4KAEA 2FWFA 1S3AA 1E6BA 3HVSA 4BPYA 3ZLPA 1SJ6A 3C1RA 3TJFA 3VWVA 3LG6A 4HJMA 4X43A 8GSSA 2L57A 5IMAA 2LJAA 22GSA 2OKAA 5CNWA 1PX6A 3L78A 2B7KA 3HYPA 4EVMA 3CRTA 1YKAA 2I9HA 2LJKA 2LQQA 2GQMA 2GLRA 1GWCA 2C3NA 1ZYQB 2GSRA 2H1DA 1SJIA 2FWGA 1TK8B 4TN8A 1XPVA 4YAPA 3RDWA 1FOHA 2G2QA 4ULXA 3M0FA 4ECCA 1QGVA 4F2IA 4DEJA 4I97A 1Z6NA 2JL4A 5B6MA 4IN0A 2F8FA 5KOXA 2YN1A 4ACSA 1B4QA 1XCCA 3F9UA 4P3YB 3LEFA 1S3DA 2YWIA 5ECQB 5ECNB 3GX8A 3VWWA 5DBQA 3VI5A 3QOUA 1GRXA 2YP6A 3QAWA 5IQYA 3TJBA 1TRVA 2QKEA 2VCVA 2DJ3A 1SD8A 2QGVA 4X1UA 1PL1A 4OFMA 4MCUA 4G9HA 4N10A 5ID2A 5IO2A 1ML6A 3MAKA 1ERTA 2YJ7A 2YWOA 1OC9A 3ED3A 3FY7A 3A3TA 3LYKA 1GTAA 1EGOA 1N2AA 1F37A 1YF0A 1X5EA 3WT1A 2QA1A 4G19A 1XBSA 2AAWA 5A5KA 3LYPA 1TP9A 1CQHA 4EDYA 4D73B 2A2PA 2TIRA 3PGTA 5DALB 3TOUA 3GFKA 1HD2A 1ILOA 3G9BA 1G6WA 3J7Yk 2VCZA 12GSA 4POBA 4KGIA 2WB9A 2VCQA 2LUSA 3UJ1A 2RM5A 4G0KA 4WETA 2CVKA 4V2LA 2XBQA 3GN3A 2RLIA 1TRSA 3ZVJA 1BAYA 3G7IA 5DCGA 3UIWA 2KLXA 3C1SA 1HQOA 2FUG2 4ML6A 4MJBA 3SBCA 3ZREA 1V58A 1T1VA 5ECRB 3R2QA 2DJ0A 1M2AA 4KUNA 4WBJA 1W89A 2ZUPA 1EV4A 2WFCA 1EWXA 2IL3A 3GKNA 2KHPA 3UBKA 1A0RP 1E2YA 1PA3A 3ERWA 3F6DA 3TJJA 3TRPA 4K5RA 2J9HA 4ZB9A 4FO5A 2IJYA 4LA1A 5F0GA 2VL2C 1QQ2A 3QAVA 3NZNA 1AQXA 5A4WA 3IAM2 4GCIA 3IK7A 4FQUA 2HE3A 1A0FA 1ERWA 2H70A 4PUAA 1X5CA 3QFAC 1O8XA 4KH7A 3HHVA 5D9TA 3CMIA 4XCSA 3FR9A 1EOHA 2WULA 2FWHA 1PRXA 5L71A 1U3AA 16GSA 5F05A 1TXXA 1QFNA 5DDLA 2VCXA 5J5NA 4DSQA 4KCAA 4OD7A 4POLA 3CTFA 3L9UA 3GA4A 3TRXA 4I2UA 3IDVA 2WJUA 2GZYA 2HRNA 3PINA 4MJCA 4PX1A 4HEA2 3V1WA 2YZUA 2JADA 2FGXA 1X9WB 3FW2A 4AJ8A 4FIWA 5A4VA 5BMUA 1GTIA 3LQ7A 3LSZA 4YQVA 2P0GA 2PGTA 1K0AA 4Z2UA 4HS1A 2R6KA 5KN3A 3QDNA 2VM2A 2C3TA 4KDYA 4ZL8A 3A5WA 1K3OA 2LNTA 1YF1A 3JCML 4F03A 1R4WA 2DJJA 6GSTA 3G7YA 2LNSA 1TI3A 1BYEA 2XC2A 3GRXA 5JWQB 4ZB8A 5ELAA 5KN1A 5AN1A 3KP9A 1FO5A 5ECPB 2FWEA 3CRUA 5IOXA 5J4UA 1T3BA 1GLPA 3TKRA 4IHUA 3A5IA 4PTSA 1TRWA 2WS2A 4YH2A 1JFUA 2CA8A 5C00A 1YY7A 1DE2A 1Q98A 3L9SA 3H8QA 3PH9A 4IJ3A 2B5XA 2MYGA 1GP1A 2GTUA 1X0RA 4MJAA 4K9ZA 5CRGA 3DWVA 2L4CA 1EOGA 5CP1A 2E2MA 2KUCA 3US3A 4EXJA 3KM6A 5HR3A 1Z7RA 5G5EA 4H86A 5IMZA 4BL7B 3MNGA 4NV2A 4K0GA 5LD0A 3M1GA 4K7IA 3HDCA 1UC7A 2V1MA 1A8LA 4WR5A 2FA8A 2IFQB 2B5EA 2F3MA 1UA5A 3WD6A 1ZYPA 2WRTA 4L5OA 2X49A 19GSA 4F9ZA 1OKTA 2R0PA 1RQMA 2VIMA 3WGEA 2P31A 2C0DA 1VRSD 4EDZA 1Z5YE 4OO4A 2PVOC 3ME8A 4XRAA 1F9MA 1ERUA 1NM3A 1NHOA 5GSTA 2A2RA 2DJ1A 1MD4A 3IK9A 1JHBA 3P90A 1M2BA 2H0IA 4G0IA 6GSVA 2C80A 5AGYA 5ENUA 2GS3A 3FYGA 3GTUB 3DKSA 1M2DA 1Z6MA 4FYBA 4CY6A 3P8WA 4KSMA 2VD1A 2H1GA 5IMVA 1TW9A 2H66A 3VFIA 3KMNA 1AW9A 4TKYA 4NAXA 5LNKe 1XG8A 1ERVA 4KNDA 1ZCPA 2CT6A 5KN2A 4D73A 4ZBDA 3GNJA 2IIYA 1M3JA 2R37A 4GSTA 1KNGA 2GSTA 4HU9A 1THXA 2CZ3A 3HVXA 4I8BA 4EE0A 3F3RA 4X0XA 5ECHB 2OJLA 4K2XA 4J2FA 2PWJA 3VPTA 1B48A 3FK8A 4TR3A 1SK2A 3IC4A 17GSA 1MDIA 2IWTA 2RM6A 4XS4B 5EVOA 2DBCA 1T00A 3BCKA 4GLTA 2CAQA 2WDUA 1VF1A 2NDOA 3APSA 2BJXA 1GSQA 4POKA 3KCMA 1YEPA 4GQFA 2YWMA 4ISDA 3LXTA 4K6XA 3FRCA 14GSA 3H79A 2GDRA 2ON7A 1J9BA 2V32A 3BD2A 5GAND 5IPGA 3DXBA 2FCHA 1HNBA 1DSBA 5D9WA 1GNWA 1LJRA 2HZEA 3P7XA 4LMVA 4J57E 3CSHA 3IV4A 3K8NA 1U88A 1PSQA 4MP4A 5AIVA 3OR5A 4RUVA 1FOVA 4DSSA 3FZAA 3F4RA 4TOPA 4KF9A 5HFKA 5B7CA 4O32A 2RUFA 2X4AA 4TXOA 3LXZA 4BIKA 1JLWA 1UN2A 2DMLA 2LRCA 3H4KA 3HD5A 2HSHA 3CSJA 4TVEA 4JZQA 2H74A 4J56E 5ABRA 1GSDA 3HJPA 3FZ5A 1RW1A 4L0UA 2GGTA 2C3QA 1WJKA 3C73A 2CVBA 1XXUA 3GL3A 1A24A 1UVZA 2CVDA 5A4UA 5DJLA 3Q6OA 4TR1B 1FG4A 1V9WA 1J08A 1Z3EA 1GL8A 1WRYA 4KE3A 2XBIA 9GSSA 4V2MA 5CRHA 4LLRA 2LRTA 3TKSE 2IMFA 4WF4A 1G0TA 1H75A 3Q19A 2IMDA 1T7PB 1XOAA 5DAKA 4K7NA 1EP7A 3D5JA 5E59A 3WYWA 3FKFA 2VLTA 3GKKA 3R3EA 1K0CA 2ZNMA 5D96A 4ZBAA 1TI1A 4MJEA 3O3TA 1G7OA 5H5RA 4JBBA 4IKHA 3N9JA 1YZXA 5EPFA 2XHFA 5GSSA 1BJXA 1QUWA 5DCHA 4MZCA 4MZBA 4YQMA 1DE1A 2MMZA 1N8JA 1GSSA 1OC3A 3VI7A 2AUVA 4IJIA 3ZMLA 2H73A 3DMLA 1WMJA 3N5OA 1BX9A 3TKSA 3UVTA 3I6AA 3UARA 2H76A 1THOA 4V1Ag 5JCUA 5JWOB 3ZVJD 2VUPA 3DIEA 4TXVA 3IHGA 4WXTA 3FHKA 4L8EA 3D0ZA 3F3QA 1TKDB 1WP0A 1F6MC 2EIRA 4JRRA 3I9V2 3C7MA 2MMAA 2HRFA 1T8EB 1Q4JA 2H75A 2X8HA 1LU4A 3QD9A 1K3LA 1KBNA 3BOAA 1HYUA 3H1NA 3HCZA 3DEXA 4JU5A 3E3EA 2YV9A 4O5QA 4QQ7A 4BVXA 4O92A 2PVQA 2HYXA 1SENA 5CYYA 4MF7A 3CQFA 3ZL5A 2UZ8A 3BCIA 4CDOA 3FZ9A 4K1FA 1YJ6A 5IPHA 3APOA 1O6JA 4NMUA 2FA4A 3F4SA 4EO3A 2K8VA 3IOSA 1NSWA 4ZB6A 2FHEA 4TRXA 1G6YA 1B9XC 1FHEA 4YAVA 1XVWA 5CRWA 5D9VA 1T4ZA 1TU8A 2B6MA 3FR3A 4IQ1A 3I69A 3KTBA 4JE1A 4N0VA 1CQGA 3C71A 2GT5A 5IIZA 4E8HA 3GURA 2AV4A 1QMVA 2LEGA 1O7UA 4F82A 1SYXA 4EF0A 2H71A 3ZITA 2REMA 3APQA 5ID2B 1C72A 4IGJA 1LBKA 2JZRA 2C0GA 3UAPA 2GZPA 1ZMAA 4FH8A 3TUEA 2LV3A 1OYJA 1VF2A 4ZBBA 1OC9B 2YPMA 3BBYA 3KP8A 5IMFA 4ECIA 4EIQA 3F0IA 4ZL9A 5GZZB 2H6XA 4WBRD 4HDEA 1ZZYA 4BVYA 1H4OA 2YOIA 13GSA 1FVKA 3TJGA 2E7PA 2R2JA 4PURA 5IOWA 2OE1A 1B4PA 4KB3A 5EY6A 2VD0A 4WKWA 3RAZA 3F6FA 1GH2A 1YKCA 5GAPD 2QC7A 2H30A 1GNEA 1XWCA 5F07A 2HRAA 5FWGA 1O8WA 4Q5FA 2R3XA 4L0WA 4LL1B 3Q74A 3LJRA 4Q5NA 1X5DA 2RUEA 2CZ2A 3EWLA 3QAGA 2DJ2A 4XS1A 3O76A 1ZYEA 3L4NA 4L5LA 2O87A 3KXOA 4HQZA 2NTOA 4MNNA 5D73A 2V6KA 1I5GA 1FB6A 2B1KA 3VWXA 3WGDA 1WWJA 2KP2A 2FLSA 2OE3A 5D9XA 4ZXGA 4MLYA 5IM9A 3RPPA 1SL2B 4OWYA 5JCWA 1OKDA 1IYIA 3WT2A 1O81A 3DGQA 4G2EA 1U3IA 5B8BA 2DMMA 2PERA 4GXZA 1SJZA 1NHYA 4EKZA 1JZOA 1EEMA 2HNLA 3ISOA 4MH3A 2HZFA 4HUAA 1GSFA 1XOBA 5INYA 3KH9A 5HR1A 1GUHA 3DYRA 4Q5RA 4V2NA 2MZCA 3ME7A 1GTBA 5IMDA 3UMAA 2BTOT 4KSOA 2VL2A 1TTZA 4JR4A 4USSA 3HJOA 4MA9A 2K8SA 3GYKA 3BJ5A 1SYRA 5D8IA 4Z7XA 4ILFA 3KD0A 5FT3A 1K0BA 4FYCA 2V6OA 1AIUA 4JR6A 1JZRA 3FZ4A 1T4YA 5DQSA 3ERGA 3GIXA 1IYHA 1FW1A 4Z2RA 1XFLA 1K0OA 4V1Ap 2Z9SA 1EEJA 1A8YA 1R5AA 1Z9HA 2JACA 1GUKA 4CHSA 2VOCA 1O85A 3ERFA 1A23A 3A2XA 2FD3A 1F3BA 1PN0A 3U6VA 3S9FA 1OE7A 4OFNA 2C4JA 1A2JA 2H6YA 4EIPA 4TR1A 4ZIJA 4TW5A 5AISA 3D21A 5B8AA 2B1LA 4K2DA 2C0FA 5CRDA 3HJMA 2D2ZA 1HNAA 3EMXA 4I2TA 3IHQA 2LS5A 2E0QA 4KDUA 5COHA 3W8SA 4MPFA 3Q18A 1XW9A 3VPQA 2O7KA 4PQIA 1TRUA 4QL9A 5IMCA 2R0CA 4LMWA 1QXHA 4PNFA 5DALA 2H0HA 4N0ZA 1ACVA 3J7Yb 3HZ4A 3H93A 2P5RA 2GQKA 3GV1A 1AUCA 5J9CA 3GSSA 2LSTA 1TDIA 3M9JA 1YQ1A 2JZSA 4OFTA 2I3YA 2OBIA 1RK4A 1PFOA 1FB0A 2H0GA 2GVPA 4PQ1A 3TJKA 3RBTA 1AQWA 2PN8A 1SKRB 4YQUA 4DVCA 2A4VA 4F0CA 5HFIA 3MYDA 2PU9C 3I43A 3F4TA 2LTKA 4Z2TA 1ST9A 3HKRA 2G0FA 2YJHA 3CTGA 1AC1A 1S3CA 5KN0A 2HLSA 1HNCA 3ZMKA 2LQOA 4HZ4A 3MWHA 3CBUA 2DC5A 1U87A 1DBYA 3NIVA 2YCDA 4YKFA 2L6CA 3HVNA 3RHBA 3UEMA 2JZTA 1AAZA 4KW6A 5G31A 2R0GA 3L9VA 4GRFA 1MDKA 4FYUA 4GQCA 2VLVA 5HR0A 3EC3A 5KOWA 2C0EA 2OA7A 2VL3A 3EE2A 1ABAA 1MD3A 2VL9A 3HA9A 1URMA 4KDXA 4K8MA 4AJ7A 3HXSA 4AGSA 4OCFA 4HU7A 1W4VA 3TRQA 2P5QA 1PKWA 2R5GA 2DJKA 5JWRB 3IA1A 3VWUA 4GSNA 2H19A 2DIYA 5ECKB 4HZ2A 2A2SA 1MTCA 1V57A 1AXDA 1GSEA 6GSUA 3KTLA 4NXIA 3GH6A 4RI6A 2QSIA 1Y6EA 2HSMA 5LCZA 3MIXA 2X8GA 5G5FA 4AJ6A 2OADA 3C8EA 2WGRA 4GF0A 3TKPA 1S3RA 1TU7A 1JZWA 4XIHA 2CAIA 3M8NA 4G10A 3D4TA 2H72A 2H6ZA 3QPMA 3GKXA 1R26A 4IP1A 1XWGA 2DKIA 4GTUA 2H1BA 2IMIA 4ZILA 3TDGA 3WGXA 11GSA 4K7OA 2YV7A 3HY2A 4IW9A 2VCWA 4HI7A 3LWAA 5J3RA 5JCGA 2HSYA 2V41A 5HFGA 1U6TA 4N11A 1ZOFA 2A4HA 1O73A 4HQSA 4XRDA 2EC4A 5FHIA 3LGCA 1GLQA 4MH2A 1VGLA 4K0NA 1I9DA 4I5QA 3RHCA 2N5AA 3HZ8A 2EIQA 3KJYA 3VURA 3KEBA 1V2AA 4Q5QA 3ZIVA 4ID0A 5H5SA 5DJMA 2CX4A 3P2AA 2O8VB 4ECJA 3ZTLA 4G0LA 2YZHA 2CX3A 2DKHA 4JEDA 4K5SA 2H1AA 3O6TA 3QMXA 2LJRA 1Z7PA 5J41A 4GWRA 4MZWA 2AYTA 1JLVA 1XVQA 2PPTA 2F8AA 3MSZA 1SU9A 3VK9A 3ZYWA 2K18A 4OCEA 3HVVA 4NHZA 3LW9A 5ECMB 2I1UA 2L5LA 2IMEA 5G2ZA 1GTUA 1FVJA 2VO4A 3EU3A 2H01A 3F8UA 1ON4A 2JU5A 4O5RA 2TRCP 4ML1A 6GSWA 2LRNA 4QL7A 4KA0A 1PQNA 20GSA 4HJ2A 1ZYNA 4HSCX 4LL4B 1GSYA 3M3MA 3TOTA
chains in the Genus database with same CATH topology
5G30A 4WF5A 5KEJA 2HZEB 4NV5A 2FNOA 3ZZXA 3ZFLA 2FY6A 1NW2A 3A2VA 3DRNA 5IO0A 3ZFBA 1XW5A 5CO3A 1QK8A 1OVNA 3UBLA 4DSSB 2DLXA 2CV4A 5H5QA 4RQRA 4TXOB 1V40A 2MBTA 2HXKA 2QA2A 4KCEA 2M72A 1PD21 2PBJA 1GSUA 1R5PA 4NHWA 3W8JA 3CSIA 2ALBA 2AB6A 3EYTA 3IRAA 4BL7A 1K0NA 1WE0A 4KX4A 2X64A 3FEUA 4DSRA 2K6VA 2J23A 3D22A 5AIXA 4EL1A 1A2MA 2VCTA 4I6XA 3PPUA 2IFQA 2K9FA 4IBPA 4ECBA 3EURA 4YKGA 1EGRA 3GH9A 2ON5A 1DUGA 2YANA 1J0FA 3QFBC 1VF4A 5G1KA 3CYNA 5B6NA 4OO5A 1WIKA 1ZL9A 2RIIA 4BWSA 2HT9A 4HOJA 3QCPA 2AHEA 2M80A 4GSSA 1OC8A 4EC0A 1EV9A 3KH7A 2L5OA 2GZZA 3QR6A 5DQYA 2JSZA 5DAKB 4ZL7A 3U5RE 2IMKA 1M99A 5ECLB 1KTEA 4X4JA 1PKZA 2WCIA 4F0BA 2C8UA 1R7HA 4A5PA 1XWAA 3GTUA 1M9AA 2KP1A 2EIOA 5BRTA 3FR6A 4NPBA 2OE0A 1TJDA 1SKSB 1PL2A 2I81A 2R4VA 4TR4A 2MMOA 1EZKA 2GT6A 2VAFA 2PUKC 3SWLA 2X8CA 3KGKA 2H8LA 3GUSA 3W6GA 1OE8A 2X99A 1X9MB 1AQVA 1M0UA 1GUMA 3LORA 6GSXA 1FAAA 4PGTA 1X9SB 2GQLA 4TR0A 6GSSA 4IQAA 1EP8A 2N5BA 2V2GA 4OMVA 3LFLA 1K3YA 3NOFA 4XS4A 3FMWA 1MDJA 2ZCTA 2AJQB 4MPGA 3RPNA 2HFDA 1B8XA 1XIYA 4ICYA 4RQXA 4XTSA 1K0MA 4E8EA 5HR2A 2L6DA 4XS6A 2OACA 5EL8A 4RI7A 3EVIA 3TCOA 4EUYA 1WPIA 4MF6A 1YDKA 4POMA 3MDKA 4BVXB 2OBKA 2XPDA 1SL0B 1A2LA 2N5FA 3DD3A 2HI7A 1XWKA 2NPBA 6GSYA 3DVXA 4PQHA 2O89A 5J9BA 4O5UA 1SL1B 1PX7A 2WZ9A 2NBSA 1BQ7A 3UL3A 3DVWA 3GMFA 1BEDA 4CW9A 2JSYA 3IPZA 2LKUA 10GSA 2E2GA 3IE3A 5ECIB 4IS0A 1M7TA 2IN3A 4N30A 2DSAA 2VM1A 1PN9A 2PMTA 3GL5A 4IELA 4PUFC 1TK5B 4MABA 2KOKA 3EU4A 5DVBA 2O85A 3ZIJA 3L0HA 4NWYA 18GSA 1K0DA 3A2WA 3IXRA 4AF2A 4CY8A 1PMTA 2ES7A 3KIJA 1Y25A 4IVFA 5D93A 5ELGA 4XHMA 1TK0B 1MEKA 4MMMA 2L4QA 5F06A 1XZOA 2DIZA 3ZRDA 1V98A 4PNGA 2GSSA 2NVLA 2F51A 3TKQA 4BA7A 4MK3A 3EPTA 3G7JA 4WR4A 3EINA 3D4MA 1SKWB 3M9KA 3E0UA 4MDCA 3KMOA 1ZGNA 2GSQA 3GX0A 3IR4A 1F3AA 1VF3A 4BVYB 2XPEA 5E4WA 3EMPA 1M9BA 2MMNA 1GULA 1BG5A 1PGTA 1SK0A 2IPAA 1YEXA 3F63A 1XWBA 3IBHA 1B9YC 1OAZA 3CXGA 5CREA 4BWQA 1KEBA 2B3SA 5C04A 1XW6A 2B7JA 4O7HA 3GHAA 5HQPA 3D6IA 3IAS2 3IC8A 1JZDA 2L59A 2YNXA 2TRXA 5ECSA 1SK1A 3GSTA 5F8BA 1SD9A 3TB2A 3AY8A 4PXOA 1USBA 5ECOB 4IP6A 1WOUA 2VLUA 3KZQA 2C1YA 2CQ9A 1G7EA 2HRKA 1TOFA 3PR8A 4WEYA 3UOMA 3E9JB 3GKMA 2M46A 5G1LA 3TKSC 3TGZA 3VLNA 4MF5A 5CAXA 2B5YA 1F2EA 2F9SA 2YWNA 2I4AA 7GSSA 3UVHA 2MBSA 2BMXA 4KAEA 2FWFA 1S3AA 1E6BA 3HVSA 4BPYA 3ZLPA 1SJ6A 3C1RA 3TJFA 3VWVA 3LG6A 4HJMA 4X43A 8GSSA 2L57A 5IMAA 2LJAA 22GSA 2OKAA 5CNWA 1PX6A 3L78A 2B7KA 3HYPA 4EVMA 3CRTA 1YKAA 2I9HA 2LJKA 2LQQA 2GQMA 2GLRA 1GWCA 2C3NA 1ZYQB 2GSRA 2H1DA 1SJIA 2FWGA 1TK8B 4TN8A 1XPVA 4YAPA 3RDWA 1FOHA 2G2QA 4ULXA 3M0FA 4ECCA 1QGVA 4F2IA 4DEJA 4I97A 1Z6NA 2JL4A 5B6MA 4IN0A 2F8FA 5KOXA 2YN1A 4ACSA 1B4QA 1XCCA 3F9UA 4P3YB 3LEFA 1S3DA 2YWIA 5ECQB 5ECNB 3GX8A 3VWWA 5DBQA 3VI5A 3QOUA 1GRXA 2YP6A 3QAWA 5IQYA 3TJBA 1TRVA 2QKEA 2VCVA 2DJ3A 1SD8A 2QGVA 4X1UA 1PL1A 4OFMA 4MCUA 4G9HA 4N10A 5ID2A 5IO2A 1ML6A 3MAKA 1ERTA 2YJ7A 2YWOA 1OC9A 3ED3A 3FY7A 3A3TA 3LYKA 1GTAA 1EGOA 1N2AA 1F37A 1YF0A 1X5EA 3WT1A 2QA1A 4G19A 1XBSA 2AAWA 5A5KA 3LYPA 1TP9A 1CQHA 4EDYA 4D73B 2A2PA 2TIRA 3PGTA 5DALB 3TOUA 3GFKA 1HD2A 1ILOA 3G9BA 1G6WA 3J7Yk 2VCZA 12GSA 4POBA 4KGIA 2WB9A 2VCQA 2LUSA 3UJ1A 2RM5A 4G0KA 4WETA 2CVKA 4V2LA 2XBQA 3GN3A 2RLIA 1TRSA 3ZVJA 1BAYA 3G7IA 5DCGA 3UIWA 2KLXA 3C1SA 1HQOA 2FUG2 4ML6A 4MJBA 3SBCA 3ZREA 1V58A 1T1VA 5ECRB 3R2QA 2DJ0A 1M2AA 4KUNA 4WBJA 1W89A 2ZUPA 1EV4A 2WFCA 1EWXA 2IL3A 3GKNA 2KHPA 3UBKA 1A0RP 1E2YA 1PA3A 3ERWA 3F6DA 3TJJA 3TRPA 4K5RA 2J9HA 4ZB9A 4FO5A 2IJYA 4LA1A 5F0GA 2VL2C 1QQ2A 3QAVA 3NZNA 1AQXA 5A4WA 3IAM2 4GCIA 3IK7A 4FQUA 2HE3A 1A0FA 1ERWA 2H70A 4PUAA 1X5CA 3QFAC 1O8XA 4KH7A 3HHVA 5D9TA 3CMIA 4XCSA 3FR9A 1EOHA 2WULA 2FWHA 1PRXA 5L71A 1U3AA 16GSA 5F05A 1TXXA 1QFNA 5DDLA 2VCXA 5J5NA 4DSQA 4KCAA 4OD7A 4POLA 3CTFA 3L9UA 3GA4A 3TRXA 4I2UA 3IDVA 2WJUA 2GZYA 2HRNA 3PINA 4MJCA 4PX1A 4HEA2 3V1WA 2YZUA 2JADA 2FGXA 1X9WB 3FW2A 4AJ8A 4FIWA 5A4VA 5BMUA 1GTIA 3LQ7A 3LSZA 4YQVA 2P0GA 2PGTA 1K0AA 4Z2UA 4HS1A 2R6KA 5KN3A 3QDNA 2VM2A 2C3TA 4KDYA 4ZL8A 3A5WA 1K3OA 2LNTA 1YF1A 3JCML 4F03A 1R4WA 2DJJA 6GSTA 3G7YA 2LNSA 1TI3A 1BYEA 2XC2A 3GRXA 5JWQB 4ZB8A 5ELAA 5KN1A 5AN1A 3KP9A 1FO5A 5ECPB 2FWEA 3CRUA 5IOXA 5J4UA 1T3BA 1GLPA 3TKRA 4IHUA 3A5IA 4PTSA 1TRWA 2WS2A 4YH2A 1JFUA 2CA8A 5C00A 1YY7A 1DE2A 1Q98A 3L9SA 3H8QA 3PH9A 4IJ3A 2B5XA 2MYGA 1GP1A 2GTUA 1X0RA 4MJAA 4K9ZA 5CRGA 3DWVA 2L4CA 1EOGA 5CP1A 2E2MA 2KUCA 3US3A 4EXJA 3KM6A 5HR3A 1Z7RA 5G5EA 4H86A 5IMZA 4BL7B 3MNGA 4NV2A 4K0GA 5LD0A 3M1GA 4K7IA 3HDCA 1UC7A 2V1MA 1A8LA 4WR5A 2FA8A 2IFQB 2B5EA 2F3MA 1UA5A 3WD6A 1ZYPA 2WRTA 4L5OA 2X49A 19GSA 4F9ZA 1OKTA 2R0PA 1RQMA 2VIMA 3WGEA 2P31A 2C0DA 1VRSD 4EDZA 1Z5YE 4OO4A 2PVOC 3ME8A 4XRAA 1F9MA 1ERUA 1NM3A 1NHOA 5GSTA 2A2RA 2DJ1A 1MD4A 3IK9A 1JHBA 3P90A 1M2BA 2H0IA 4G0IA 6GSVA 2C80A 5AGYA 5ENUA 2GS3A 3FYGA 3GTUB 3DKSA 1M2DA 1Z6MA 4FYBA 4CY6A 3P8WA 4KSMA 2VD1A 2H1GA 5IMVA 1TW9A 2H66A 3VFIA 3KMNA 1AW9A 4TKYA 4NAXA 5LNKe 1ERVA 4KNDA 1ZCPA 2CT6A 5KN2A 4D73A 4ZBDA 3GNJA 2IIYA 2R37A 4GSTA 1KNGA 2GSTA 4HU9A 1THXA 2CZ3A 3HVXA 4I8BA 4EE0A 3F3RA 4X0XA 5ECHB 2OJLA 4K2XA 4J2FA 2PWJA 3VPTA 1B48A 3FK8A 4TR3A 1SK2A 3IC4A 17GSA 1MDIA 2IWTA 2RM6A 4XS4B 5EVOA 2DBCA 1T00A 3BCKA 4GLTA 2CAQA 2WDUA 1VF1A 2NDOA 3APSA 2BJXA 1GSQA 4POKA 3KCMA 1YEPA 4GQFA 2YWMA 4ISDA 3LXTA 4K6XA 3FRCA 14GSA 3H79A 2GDRA 2ON7A 1J9BA 2V32A 3BD2A 5GAND 5IPGA 3DXBA 2FCHA 1HNBA 1DSBA 5D9WA 1GNWA 1LJRA 2HZEA 3P7XA 4LMVA 4J57E 3CSHA 3IV4A 3K8NA 1U88A 1PSQA 4MP4A 5AIVA 3OR5A 4RUVA 1FOVA 4DSSA 3FZAA 3F4RA 4TOPA 4KF9A 5HFKA 5B7CA 4O32A 2RUFA 2X4AA 4TXOA 3LXZA 1JLWA 1UN2A 2DMLA 2LRCA 3H4KA 3HD5A 2HSHA 3CSJA 4TVEA 4JZQA 2H74A 4J56E 5ABRA 1GSDA 3HJPA 3FZ5A 1RW1A 4L0UA 2GGTA 2C3QA 1WJKA 3C73A 2CVBA 1XXUA 3GL3A 1A24A 1UVZA 2CVDA 5A4UA 5DJLA 3Q6OA 4TR1B 1FG4A 1V9WA 1J08A 1Z3EA 1GL8A 1WRYA 4KE3A 2XBIA 9GSSA 4V2MA 5CRHA 4LLRA 2LRTA 3TKSE 2IMFA 4WF4A 1G0TA 1H75A 3Q19A 2IMDA 1T7PB 1XOAA 5DAKA 4K7NA 1EP7A 3D5JA 5E59A 3WYWA 3FKFA 2VLTA 3GKKA 3R3EA 1K0CA 2ZNMA 5D96A 4ZBAA 1TI1A 4MJEA 3O3TA 1G7OA 5H5RA 4JBBA 4IKHA 3N9JA 1YZXA 5EPFA 2XHFA 5GSSA 1BJXA 1QUWA 5DCHA 4MZCA 4MZBA 4YQMA 1DE1A 2MMZA 1N8JA 1GSSA 1OC3A 3VI7A 2AUVA 4IJIA 3ZMLA 2H73A 3DMLA 1WMJA 3N5OA 1BX9A 3TKSA 3UVTA 3I6AA 3UARA 2H76A 1THOA 4V1Ag 5JCUA 5JWOB 3ZVJD 2VUPA 3DIEA 4TXVA 3IHGA 4WXTA 3FHKA 4L8EA 3D0ZA 3F3QA 1TKDB 1WP0A 1F6MC 2EIRA 4JRRA 3I9V2 3C7MA 2MMAA 2HRFA 1T8EB 1Q4JA 2H75A 2X8HA 1LU4A 3QD9A 1K3LA 1KBNA 3BOAA 1HYUA 3H1NA 3HCZA 3DEXA 4JU5A 3E3EA 2YV9A 4O5QA 4QQ7A 4BVXA 4O92A 2PVQA 2HYXA 1SENA 5CYYA 4MF7A 3ZL5A 2UZ8A 3BCIA 4CDOA 3FZ9A 4K1FA 1YJ6A 5IPHA 3APOA 1O6JA 4NMUA 2FA4A 3F4SA 4EO3A 2K8VA 3IOSA 1NSWA 4ZB6A 2FHEA 4TRXA 1G6YA 1B9XC 1FHEA 4YAVA 1XVWA 5CRWA 5D9VA 1T4ZA 1TU8A 2B6MA 3FR3A 4IQ1A 3I69A 3KTBA 4JE1A 4N0VA 1CQGA 3C71A 2GT5A 5IIZA 4E8HA 3GURA 2AV4A 1QMVA 2LEGA 1O7UA 4F82A 1SYXA 4EF0A 2H71A 3ZITA 2REMA 3APQA 5ID2B 1C72A 4IGJA 1LBKA 2JZRA 2C0GA 3UAPA 2GZPA 1ZMAA 4FH8A 3TUEA 2LV3A 1OYJA 1VF2A 4ZBBA 1OC9B 2YPMA 3BBYA 3KP8A 5IMFA 4ECIA 4EIQA 3F0IA 4ZL9A 5GZZB 2H6XA 4WBRD 4HDEA 1ZZYA 4BVYA 1H4OA 2YOIA 13GSA 1FVKA 3TJGA 2E7PA 2R2JA 4PURA 5IOWA 2OE1A 1B4PA 4KB3A 5EY6A 2VD0A 4WKWA 3RAZA 3F6FA 1GH2A 1YKCA 5GAPD 2QC7A 2H30A 1GNEA 1XWCA 5F07A 2HRAA 5FWGA 1O8WA 4Q5FA 2R3XA 4L0WA 4LL1B 3Q74A 3LJRA 4Q5NA 1X5DA 2RUEA 2CZ2A 3EWLA 3QAGA 2DJ2A 4XS1A 3O76A 1ZYEA 3L4NA 4L5LA 2O87A 3KXOA 4HQZA 2NTOA 4MNNA 5D73A 2V6KA 1I5GA 1FB6A 2B1KA 3VWXA 3WGDA 1WWJA 2KP2A 2FLSA 2OE3A 5D9XA 4ZXGA 4MLYA 5IM9A 3RPPA 1SL2B 4OWYA 5JCWA 1OKDA 1IYIA 3WT2A 1O81A 3DGQA 4G2EA 1U3IA 5B8BA 2DMMA 2PERA 4GXZA 1SJZA 1NHYA 4EKZA 1JZOA 1EEMA 2HNLA 3ISOA 4MH3A 2HZFA 4HUAA 1GSFA 1XOBA 5INYA 3KH9A 5HR1A 1GUHA 3DYRA 4Q5RA 4V2NA 2MZCA 3ME7A 1GTBA 5IMDA 3UMAA 2BTOT 4KSOA 2VL2A 1TTZA 4JR4A 4USSA 3HJOA 4MA9A 2K8SA 3GYKA 3BJ5A 1SYRA 5D8IA 4Z7XA 4ILFA 3KD0A 5FT3A 1K0BA 4FYCA 2V6OA 1AIUA 4JR6A 1JZRA 3FZ4A 1T4YA 5DQSA 3ERGA 3GIXA 1IYHA 1FW1A 4Z2RA 1XFLA 1K0OA 4V1Ap 2Z9SA 1EEJA 1A8YA 1R5AA 1Z9HA 2JACA 1GUKA 4CHSA 2VOCA 1O85A 3ERFA 1A23A 3A2XA 2FD3A 1F3BA 1PN0A 3U6VA 3S9FA 1OE7A 4OFNA 2C4JA 1A2JA 2H6YA 4EIPA 4TR1A 4ZIJA 4TW5A 5AISA 3D21A 5B8AA 2B1LA 4K2DA 2C0FA 5CRDA 3HJMA 2D2ZA 1HNAA 3EMXA 4I2TA 3IHQA 2LS5A 2E0QA 4KDUA 5COHA 3W8SA 4MPFA 3Q18A 1XW9A 3VPQA 2O7KA 4PQIA 1TRUA 4QL9A 5IMCA 2R0CA 4LMWA 1QXHA 4PNFA 5DALA 2H0HA 4N0ZA 1ACVA 3J7Yb 3HZ4A 3H93A 2P5RA 2GQKA 3GV1A 1AUCA 5J9CA 3GSSA 2LSTA 1TDIA 3M9JA 1YQ1A 2JZSA 4OFTA 2I3YA 2OBIA 1RK4A 1FB0A 2H0GA 2GVPA 4PQ1A 3TJKA 3RBTA 1AQWA 2PN8A 1SKRB 4YQUA 4DVCA 2A4VA 4F0CA 5HFIA 3MYDA 2PU9C 3I43A 3F4TA 2LTKA 4Z2TA 1ST9A 3HKRA 2G0FA 2YJHA 3CTGA 1AC1A 1S3CA 5KN0A 2HLSA 1HNCA 3ZMKA 2LQOA 4HZ4A 3MWHA 3CBUA 2DC5A 1U87A 1DBYA 3NIVA 2YCDA 4YKFA 2L6CA 3RHBA 3UEMA 2JZTA 1AAZA 4KW6A 5G31A 2R0GA 3L9VA 4GRFA 1MDKA 4FYUA 4GQCA 2VLVA 5HR0A 3EC3A 5KOWA 2C0EA 2OA7A 2VL3A 3EE2A 1ABAA 1MD3A 2VL9A 3HA9A 1URMA 4KDXA 4K8MA 4AJ7A 3HXSA 4AGSA 4OCFA 4HU7A 1W4VA 3TRQA 2P5QA 1PKWA 2R5GA 2DJKA 5JWRB 3IA1A 3VWUA 4GSNA 2H19A 2DIYA 5ECKB 4HZ2A 2A2SA 1MTCA 1V57A 1AXDA 1GSEA 6GSUA 3KTLA 4NXIA 3GH6A 4RI6A 2QSIA 1Y6EA 2HSMA 5LCZA 3MIXA 2X8GA 5G5FA 4AJ6A 2OADA 3C8EA 2WGRA 4GF0A 3TKPA 1TU7A 1JZWA 4XIHA 2CAIA 3M8NA 4G10A 3D4TA 2H72A 2H6ZA 3QPMA 3GKXA 1R26A 4IP1A 1XWGA 2DKIA 4GTUA 2H1BA 2IMIA 4ZILA 3TDGA 3WGXA 11GSA 4K7OA 2YV7A 3HY2A 4IW9A 2VCWA 4HI7A 3LWAA 5J3RA 5JCGA 2HSYA 2V41A 5HFGA 1U6TA 4N11A 1ZOFA 2A4HA 1O73A 4HQSA 4XRDA 2EC4A 5FHIA 3LGCA 1GLQA 4MH2A 1VGLA 4K0NA 1I9DA 4I5QA 3RHCA 2N5AA 3HZ8A 2EIQA 3KJYA 3VURA 3KEBA 1V2AA 4Q5QA 3ZIVA 4ID0A 5H5SA 5DJMA 2CX4A 3P2AA 2O8VB 4ECJA 3ZTLA 4G0LA 2YZHA 2CX3A 2DKHA 4JEDA 4K5SA 2H1AA 3O6TA 3QMXA 2LJRA 1Z7PA 5J41A 4GWRA 4MZWA 2AYTA 1JLVA 1XVQA 2PPTA 2F8AA 3MSZA 1SU9A 3VK9A 3ZYWA 2K18A 4OCEA 3HVVA 4NHZA 3LW9A 5ECMB 2I1UA 2L5LA 2IMEA 5G2ZA 1GTUA 1FVJA 2VO4A 3EU3A 2H01A 3F8UA 1ON4A 2JU5A 4O5RA 2TRCP 4ML1A 6GSWA 2LRNA 4QL7A 1PQNA 20GSA 4HJ2A 4KA0A 1ZYNA 4LL4B 3TOTA 1GSYA 3M3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G30 A;  4WF5 A;  5KEJ A;  2HZE B;  4NV5 A;  2FNO A;  3ZZX A;  3ZFL A;  2FY6 A;  1NW2 A;  3A2V A;  3DRN A;  5IO0 A;  3ZFB A;  1XW5 A;  5CO3 A;  1QK8 A;  1OVN A;  3UBL A;  4DSS B;  2DLX A;  2CV4 A;  5H5Q A;  4RQR A;  4TXO B;  1V40 A;  2MBT A;  2HXK A;  4KCE A;  2M72 A;  1PD2 1;  2PBJ A;  1GSU A;  1R5P A;  4NHW A;  3W8J A;  3CSI A;  2ALB A;  2AB6 A;  3EYT A;  3IRA A;  4BL7 A;  1K0N A;  1WE0 A;  4KX4 A;  2X64 A;  3FEU A;  4DSR A;  2K6V A;  2J23 A;  3D22 A;  5AIX A;  4EL1 A;  1A2M A;  2VCT A;  4I6X A;  4IBP A;  2IFQ A;  2K9F A;  4ECB A;  3EUR A;  1EGR A;  3GH9 A;  2ON5 A;  1DUG A;  2YAN A;  1J0F A;  3QFB C;  1VF4 A;  5G1K A;  3CYN A;  5B6N A;  4OO5 A;  1WIK A;  1ZL9 A;  2RII A;  4BWS A;  2HT9 A;  4HOJ A;  3QCP A;  2AHE A;  2M80 A;  4GSS A;  1OC8 A;  4EC0 A;  1EV9 A;  3KH7 A;  2L5O A;  2GZZ A;  3QR6 A;  5DQY A;  2JSZ A;  5DAK B;  4ZL7 A;  3U5R E;  2IMK A;  1M99 A;  5ECL B;  1KTE A;  1PKZ A;  2WCI A;  4F0B A;  2C8U A;  1R7H A;  1XWA A;  3GTU A;  1M9A A;  2KP1 A;  2EIO A;  3FR6 A;  4NPB A;  2OE0 A;  1TJD A;  1SKS B;  1PL2 A;  2I81 A;  2R4V A;  4TR4 A;  2MMO A;  1EZK A;  2GT6 A;  2VAF A;  2PUK C;  3SWL A;  2X8C A;  3KGK A;  2H8L A;  3GUS A;  3W6G A;  1OE8 A;  2X99 A;  1X9M B;  1AQV A;  1M0U A;  1GUM A;  3LOR A;  6GSX A;  1FAA A;  4PGT A;  1X9S B;  2GQL A;  4TR0 A;  6GSS A;  4IQA A;  1EP8 A;  2N5B A;  2V2G A;  4OMV A;  3LFL A;  1K3Y A;  3NOF A;  4XS4 A;  1MDJ A;  2ZCT A;  2AJQ B;  4MPG A;  3RPN A;  2HFD A;  1B8X A;  1XIY A;  4RQX A;  4XTS A;  1K0M A;  4E8E A;  5HR2 A;  2L6D A;  4XS6 A;  2OAC A;  5EL8 A;  4RI7 A;  3EVI A;  3TCO A;  4EUY A;  1WPI A;  4MF6 A;  1YDK A;  4POM A;  3MDK A;  2OBK A;  2XPD A;  1SL0 B;  1A2L A;  2N5F A;  3DD3 A;  2HI7 A;  1XWK A;  2NPB A;  6GSY A;  3DVX A;  4PQH A;  2O89 A;  5J9B A;  1SL1 B;  1PX7 A;  2WZ9 A;  2NBS A;  1BQ7 A;  3UL3 A;  3DVW A;  3GMF A;  1BED A;  4CW9 A;  2JSY A;  3IPZ A;  2LKU A;  10GS A;  2E2G A;  3IE3 A;  5ECI B;  4IS0 A;  1M7T A;  2IN3 A;  4N30 A;  2DSA A;  2VM1 A;  1PN9 A;  2PMT A;  3GL5 A;  4IEL A;  4PUF C;  1TK5 B;  4MAB A;  2KOK A;  3EU4 A;  5DVB A;  2O85 A;  3ZIJ A;  3L0H A;  4NWY A;  18GS A;  1K0D A;  3A2W A;  3IXR A;  4AF2 A;  1PMT A;  2ES7 A;  3KIJ A;  1Y25 A;  4IVF A;  5D93 A;  5ELG A;  4XHM A;  1TK0 B;  1MEK A;  4MMM A;  5F06 A;  2L4Q A;  1XZO A;  2DIZ A;  3ZRD A;  1V98 A;  4PNG A;  2GSS A;  2NVL A;  2F51 A;  3TKQ A;  4BA7 A;  4MK3 A;  3G7J A;  4WR4 A;  3EIN A;  3D4M A;  1SKW B;  3M9K A;  3E0U A;  4MDC A;  3KMO A;  1ZGN A;  2GSQ A;  3GX0 A;  3IR4 A;  1F3A A;  1VF3 A;  2XPE A;  5E4W A;  3EMP A;  1M9B A;  2MMN A;  1GUL A;  1BG5 A;  1PGT A;  1SK0 A;  2IPA A;  1YEX A;  3F63 A;  1XWB A;  3IBH A;  1B9Y C;  1OAZ A;  3CXG A;  5CRE A;  4BWQ A;  1KEB A;  2B3S A;  5C04 A;  1XW6 A;  2B7J A;  4O7H A;  3GHA A;  5HQP A;  3D6I A;  3IAS 2;  1JZD A;  2L59 A;  2YNX A;  2TRX A;  5ECS A;  1SK1 A;  3GST A;  5F8B A;  1SD9 A;  3TB2 A;  3AY8 A;  4PXO A;  1USB A;  5ECO B;  4IP6 A;  1WOU A;  2VLU A;  3KZQ A;  2C1Y A;  2CQ9 A;  1G7E A;  1TOF A;  3PR8 A;  4WEY A;  3UOM A;  3E9J B;  3GKM A;  2M46 A;  5G1L A;  3TKS C;  3TGZ A;  3VLN A;  4MF5 A;  5CAX A;  2B5Y A;  1F2E A;  2F9S A;  2YWN A;  2I4A A;  7GSS A;  3UVH A;  2MBS A;  2BMX A;  4KAE A;  2FWF A;  1S3A A;  1E6B A;  3HVS A;  4BPY A;  3ZLP A;  1SJ6 A;  3C1R A;  3TJF A;  3VWV A;  3LG6 A;  4HJM A;  4X43 A;  8GSS A;  2L57 A;  5IMA A;  2LJA A;  22GS A;  2OKA A;  5CNW A;  1PX6 A;  3L78 A;  2B7K A;  3HYP A;  4EVM A;  3CRT A;  1YKA A;  2I9H A;  2LJK A;  2LQQ A;  2GQM A;  2GLR A;  1GWC A;  2C3N A;  1ZYQ B;  2GSR A;  2H1D A;  1SJI A;  2FWG A;  1TK8 B;  4TN8 A;  1XPV A;  4YAP A;  3RDW A;  2G2Q A;  4ULX A;  3M0F A;  4ECC A;  1QGV A;  4F2I A;  4DEJ A;  4I97 A;  1Z6N A;  2JL4 A;  5B6M A;  4IN0 A;  2F8F A;  2YN1 A;  4ACS A;  1B4Q A;  1XCC A;  3F9U A;  4P3Y B;  3LEF A;  1S3D A;  2YWI A;  5ECQ B;  5ECN B;  3GX8 A;  3VWW A;  5DBQ A;  3VI5 A;  3QOU A;  1GRX A;  2YP6 A;  3QAW A;  5IQY A;  3TJB A;  1TRV A;  2QKE A;  2VCV A;  2DJ3 A;  1SD8 A;  2QGV A;  4X1U A;  1PL1 A;  4OFM A;  4MCU A;  4G9H A;  4N10 A;  5ID2 A;  5IO2 A;  1ML6 A;  3MAK A;  1ERT A;  2YJ7 A;  2YWO A;  1OC9 A;  3ED3 A;  3FY7 A;  3A3T A;  3LYK A;  1GTA A;  1EGO A;  1N2A A;  1F37 A;  1YF0 A;  1X5E A;  3WT1 A;  4G19 A;  1XBS A;  2AAW A;  5A5K A;  3LYP A;  1TP9 A;  1CQH A;  4EDY A;  4D73 B;  2TIR A;  3PGT A;  5DAL B;  3TOU A;  3GFK A;  1HD2 A;  1ILO A;  3G9B A;  1G6W A;  3J7Y k;  2VCZ A;  12GS A;  4POB A;  4KGI A;  2WB9 A;  2VCQ A;  2LUS A;  3UJ1 A;  2RM5 A;  4WET A;  2CVK A;  4V2L A;  2XBQ A;  3GN3 A;  2RLI A;  1TRS A;  3ZVJ A;  1BAY A;  3G7I A;  5DCG A;  3UIW A;  2KLX A;  3C1S A;  1HQO A;  2FUG 2;  4ML6 A;  4MJB A;  3SBC A;  3ZRE A;  1V58 A;  1T1V A;  5ECR B;  3R2Q A;  2DJ0 A;  1M2A A;  4KUN A;  4WBJ A;  1W89 A;  2ZUP A;  1EV4 A;  2WFC A;  1EWX A;  2IL3 A;  3GKN A;  2KHP A;  3UBK A;  1A0R P;  1E2Y A;  1PA3 A;  3ERW A;  3F6D A;  3TJJ A;  3TRP A;  2J9H A;  4ZB9 A;  4FO5 A;  2IJY A;  4LA1 A;  5F0G A;  2VL2 C;  1QQ2 A;  3QAV A;  3NZN A;  1AQX A;  5A4W A;  3IAM 2;  4GCI A;  3IK7 A;  2HE3 A;  1A0F A;  1ERW A;  2H70 A;  4PUA A;  1X5C A;  3QFA C;  1O8X A;  4KH7 A;  3HHV A;  5D9T A;  3CMI A;  4XCS A;  3FR9 A;  1EOH A;  2WUL A;  2FWH A;  1PRX A;  5L71 A;  1U3A A;  16GS A;  5F05 A;  1TXX A;  1QFN A;  5DDL A;  2VCX A;  5J5N A;  4DSQ A;  4KCA A;  4OD7 A;  4POL A;  3CTF A;  3L9U A;  3GA4 A;  3TRX A;  4I2U A;  3IDV A;  2WJU A;  2GZY A;  2HRN A;  3PIN A;  4MJC A;  4PX1 A;  4HEA 2;  3V1W A;  2YZU A;  2JAD A;  2FGX A;  1X9W B;  3FW2 A;  4AJ8 A;  4FIW A;  5A4V A;  1GTI A;  3LQ7 A;  3LSZ A;  4YQV A;  2P0G A;  2PGT A;  1K0A A;  4HS1 A;  2R6K A;  5KN3 A;  3QDN A;  2VM2 A;  2C3T A;  4KDY A;  4ZL8 A;  3A5W A;  1K3O A;  2LNT A;  1YF1 A;  3JCM L;  4F03 A;  1R4W A;  2DJJ A;  6GST A;  3G7Y A;  2LNS A;  1TI3 A;  1BYE A;  2XC2 A;  3GRX A;  5JWQ B;  4ZB8 A;  5ELA A;  5KN1 A;  5AN1 A;  3KP9 A;  1FO5 A;  5ECP B;  2FWE A;  3CRU A;  5IOX A;  5J4U A;  1T3B A;  1GLP A;  3TKR A;  4IHU A;  1TRW A;  2WS2 A;  4YH2 A;  1JFU A;  2CA8 A;  5C00 A;  1YY7 A;  1DE2 A;  1Q98 A;  3L9S A;  3H8Q A;  3PH9 A;  4IJ3 A;  2B5X A;  2MYG A;  1GP1 A;  2GTU A;  1X0R A;  4MJA A;  4K9Z A;  5CRG A;  3DWV A;  2L4C A;  1EOG A;  5CP1 A;  2E2M A;  2KUC A;  3US3 A;  4EXJ A;  3KM6 A;  5HR3 A;  1Z7R A;  5G5E A;  4H86 A;  5IMZ A;  3MNG A;  4NV2 A;  4K0G A;  5LD0 A;  3M1G A;  4K7I A;  3HDC A;  1UC7 A;  2V1M A;  1A8L A;  4WR5 A;  2FA8 A;  2IFQ B;  2B5E A;  2F3M A;  1UA5 A;  3WD6 A;  2WRT A;  4L5O A;  19GS A;  4F9Z A;  1OKT A;  1RQM A;  2VIM A;  3WGE A;  2P31 A;  2C0D A;  1VRS D;  4EDZ A;  1Z5Y E;  4OO4 A;  2PVO C;  3ME8 A;  4XRA A;  1F9M A;  1ERU A;  1NM3 A;  1NHO A;  5GST A;  2A2R A;  2DJ1 A;  1MD4 A;  3IK9 A;  1JHB A;  3P90 A;  1M2B A;  2H0I A;  6GSV A;  2C80 A;  5AGY A;  5ENU A;  2GS3 A;  3FYG A;  3GTU B;  3DKS A;  1M2D A;  1Z6M A;  4FYB A;  3P8W A;  4KSM A;  2VD1 A;  2H1G A;  5IMV A;  1TW9 A;  2H66 A;  3VFI A;  3KMN A;  1AW9 A;  4TKY A;  4NAX A;  5LNK e;  1ERV A;  4KND A;  1ZCP A;  2CT6 A;  5KN2 A;  4D73 A;  4ZBD A;  3GNJ A;  2IIY A;  2R37 A;  4GST A;  1KNG A;  2GST A;  4HU9 A;  1THX A;  2CZ3 A;  3HVX A;  4I8B A;  4EE0 A;  3F3R A;  4X0X A;  5ECH B;  2OJL A;  4J2F A;  2PWJ A;  3VPT A;  1B48 A;  3FK8 A;  4TR3 A;  1SK2 A;  3IC4 A;  17GS A;  1MDI A;  2IWT A;  2RM6 A;  4XS4 B;  5EVO A;  2DBC A;  1T00 A;  3BCK A;  4GLT A;  2CAQ A;  2WDU A;  1VF1 A;  2NDO A;  3APS A;  2BJX A;  1GSQ A;  4POK A;  3KCM A;  1YEP A;  4GQF A;  2YWM A;  4ISD A;  3LXT A;  4K6X A;  3FRC A;  14GS A;  3H79 A;  2GDR A;  2ON7 A;  1J9B A;  2V32 A;  3BD2 A;  5GAN D;  5IPG A;  3DXB A;  2FCH A;  1HNB A;  1DSB A;  5D9W A;  1GNW A;  1LJR A;  2HZE A;  3P7X A;  4LMV A;  4J57 E;  3CSH A;  3IV4 A;  3K8N A;  1U88 A;  1PSQ A;  4MP4 A;  5AIV A;  3OR5 A;  4RUV A;  1FOV A;  4DSS A;  3FZA A;  3F4R A;  4TOP A;  5HFK A;  5B7C A;  4O32 A;  2RUF A;  4TXO A;  3LXZ A;  1JLW A;  1UN2 A;  2DML A;  2LRC A;  3H4K A;  3HD5 A;  2HSH A;  3CSJ A;  4TVE A;  4JZQ A;  2H74 A;  4J56 E;  5ABR A;  1GSD A;  3HJP A;  3FZ5 A;  1RW1 A;  4L0U A;  2GGT A;  2C3Q A;  1WJK A;  3C73 A;  2CVB A;  1XXU A;  3GL3 A;  1A24 A;  1UVZ A;  2CVD A;  5A4U A;  5DJL A;  3Q6O A;  4TR1 B;  1FG4 A;  1V9W A;  1J08 A;  1Z3E A;  1GL8 A;  1WRY A;  4KE3 A;  2XBI A;  9GSS A;  4V2M A;  5CRH A;  4LLR A;  2LRT A;  3TKS E;  2IMF A;  4WF4 A;  1G0T A;  1H75 A;  3Q19 A;  2IMD A;  1T7P B;  1XOA A;  5DAK A;  4K7N A;  1EP7 A;  3D5J A;  5E59 A;  3WYW A;  3FKF A;  2VLT A;  3GKK A;  1K0C A;  2ZNM A;  5D96 A;  4ZBA A;  1TI1 A;  4MJE A;  3O3T A;  1G7O A;  5H5R A;  4JBB A;  4IKH A;  3N9J A;  1YZX A;  5EPF A;  2XHF A;  5GSS A;  1BJX A;  1QUW A;  5DCH A;  4MZC A;  4MZB A;  4YQM A;  1DE1 A;  2MMZ A;  1N8J A;  1GSS A;  1OC3 A;  3VI7 A;  2AUV A;  4IJI A;  3ZML A;  2H73 A;  3DML A;  1WMJ A;  3N5O A;  1BX9 A;  3TKS A;  3UVT A;  3I6A A;  3UAR A;  2H76 A;  1THO A;  4V1A g;  5JCU A;  5JWO B;  3ZVJ D;  2VUP A;  3DIE A;  4TXV A;  4WXT A;  3FHK A;  4L8E A;  3D0Z A;  3F3Q A;  1TKD B;  1WP0 A;  1F6M C;  2EIR A;  4JRR A;  3I9V 2;  3C7M A;  2MMA A;  2HRF A;  1T8E B;  1Q4J A;  2H75 A;  2X8H A;  1LU4 A;  3QD9 A;  1K3L A;  1KBN A;  3BOA A;  1HYU A;  3H1N A;  3HCZ A;  3DEX A;  4JU5 A;  3E3E A;  2YV9 A;  4QQ7 A;  4BVX A;  4O92 A;  2PVQ A;  2HYX A;  1SEN A;  5CYY A;  4MF7 A;  3ZL5 A;  3BCI A;  4CDO A;  3FZ9 A;  4K1F A;  1YJ6 A;  5IPH A;  3APO A;  1O6J A;  4NMU A;  2FA4 A;  3F4S A;  4EO3 A;  2K8V A;  3IOS A;  1NSW A;  4ZB6 A;  2FHE A;  4TRX A;  1G6Y A;  1B9X C;  1FHE A;  4YAV A;  1XVW A;  5CRW A;  5D9V A;  1T4Z A;  1TU8 A;  2B6M A;  3FR3 A;  4IQ1 A;  3I69 A;  3KTB A;  4JE1 A;  4N0V A;  1CQG A;  3C71 A;  2GT5 A;  5IIZ A;  4E8H A;  3GUR A;  2AV4 A;  1QMV A;  2LEG A;  1O7U A;  4F82 A;  1SYX A;  4EF0 A;  2H71 A;  3ZIT A;  2REM A;  3APQ A;  5ID2 B;  1C72 A;  4IGJ A;  1LBK A;  2JZR A;  2C0G A;  3UAP A;  2GZP A;  1ZMA A;  4FH8 A;  3TUE A;  2LV3 A;  1OYJ A;  1VF2 A;  4ZBB A;  1OC9 B;  2YPM A;  3BBY A;  3KP8 A;  5IMF A;  4ECI A;  3F0I A;  4ZL9 A;  5GZZ B;  2H6X A;  4WBR D;  4HDE A;  1ZZY A;  4BVY A;  1H4O A;  2YOI A;  13GS A;  1FVK A;  3TJG A;  2E7P A;  2R2J A;  4PUR A;  5IOW A;  2OE1 A;  1B4P A;  4KB3 A;  5EY6 A;  2VD0 A;  4WKW A;  3RAZ A;  3F6F A;  1GH2 A;  1YKC A;  5GAP D;  2QC7 A;  2H30 A;  1GNE A;  1XWC A;  5F07 A;  5FWG A;  1O8W A;  4Q5F A;  2R3X A;  4L0W A;  4LL1 B;  3Q74 A;  3LJR A;  4Q5N A;  1X5D A;  2RUE A;  2CZ2 A;  3EWL A;  3QAG A;  2DJ2 A;  4XS1 A;  3O76 A;  1ZYE A;  3L4N A;  4L5L A;  2O87 A;  3KXO A;  4HQZ A;  2NTO A;  5D73 A;  2V6K A;  1I5G A;  1FB6 A;  2B1K A;  3VWX A;  3WGD A;  1WWJ A;  2KP2 A;  2FLS A;  2OE3 A;  5D9X A;  4ZXG A;  4MLY A;  5IM9 A;  3RPP A;  1SL2 B;  4OWY A;  5JCW A;  1OKD A;  1IYI A;  3WT2 A;  1O81 A;  3DGQ A;  4G2E A;  1U3I A;  5B8B A;  2DMM A;  2PER A;  4GXZ A;  1SJZ A;  1NHY A;  4EKZ A;  1JZO A;  1EEM A;  2HNL A;  3ISO A;  4MH3 A;  2HZF A;  4HUA A;  1GSF A;  1XOB A;  5INY A;  3KH9 A;  5HR1 A;  1GUH A;  3DYR A;  4Q5R A;  4V2N A;  2MZC A;  3ME7 A;  1GTB A;  5IMD A;  3UMA A;  2BTO T;  4KSO A;  2VL2 A;  1TTZ A;  4JR4 A;  3HJO A;  4MA9 A;  2K8S A;  3GYK A;  3BJ5 A;  1SYR A;  5D8I A;  4Z7X A;  4ILF A;  3KD0 A;  5FT3 A;  1K0B A;  4FYC A;  2V6O A;  1AIU A;  4JR6 A;  1JZR A;  3FZ4 A;  1T4Y A;  5DQS A;  3ERG A;  3GIX A;  1IYH A;  1FW1 A;  1XFL A;  1K0O A;  4V1A p;  2Z9S A;  1EEJ A;  1A8Y A;  1R5A A;  1Z9H A;  2JAC A;  1GUK A;  4CHS A;  2VOC A;  1O85 A;  3ERF A;  1A23 A;  3A2X A;  2FD3 A;  1F3B A;  3U6V A;  3S9F A;  1OE7 A;  4OFN A;  2C4J A;  1A2J A;  2H6Y A;  4TR1 A;  4ZIJ A;  4TW5 A;  5AIS A;  3D21 A;  5B8A A;  2B1L A;  4K2D A;  2C0F A;  5CRD A;  3HJM A;  2D2Z A;  1HNA A;  3EMX A;  4I2T A;  3IHQ A;  2LS5 A;  2E0Q A;  4KDU A;  5COH A;  3W8S A;  4MPF A;  3Q18 A;  1XW9 A;  3VPQ A;  2O7K A;  4PQI A;  1TRU A;  4QL9 A;  5IMC A;  4LMW A;  1QXH A;  4PNF A;  5DAL A;  2H0H A;  4N0Z A;  1ACV A;  3J7Y b;  3HZ4 A;  3H93 A;  2P5R A;  2GQK A;  3GV1 A;  1AUC A;  5J9C A;  3GSS A;  2LST A;  1TDI A;  3M9J A;  1YQ1 A;  2JZS A;  4OFT A;  2I3Y A;  2OBI A;  1RK4 A;  1FB0 A;  2H0G A;  2GVP A;  4PQ1 A;  3TJK A;  3RBT A;  1AQW A;  2PN8 A;  1SKR B;  4YQU A;  4DVC A;  2A4V A;  4F0C A;  5HFI A;  2PU9 C;  3I43 A;  3F4T A;  2LTK A;  1ST9 A;  3HKR A;  2G0F A;  2YJH A;  3CTG A;  1AC1 A;  1S3C A;  5KN0 A;  2HLS A;  1HNC A;  3ZMK A;  2LQO A;  4HZ4 A;  3MWH A;  3CBU A;  2DC5 A;  1U87 A;  1DBY A;  3NIV A;  2YCD A;  2L6C A;  3RHB A;  3UEM A;  2JZT A;  1AAZ A;  4KW6 A;  5G31 A;  3L9V A;  4GRF A;  1MDK A;  4FYU A;  4GQC A;  2VLV A;  5HR0 A;  3EC3 A;  2C0E A;  2OA7 A;  2VL3 A;  3EE2 A;  1ABA A;  1MD3 A;  2VL9 A;  3HA9 A;  1URM A;  4KDX A;  4K8M A;  4AJ7 A;  3HXS A;  4AGS A;  4OCF A;  4HU7 A;  1W4V A;  3TRQ A;  2P5Q A;  1PKW A;  2R5G A;  2DJK A;  5JWR B;  3IA1 A;  3VWU A;  4GSN A;  2H19 A;  2DIY A;  5ECK B;  4HZ2 A;  2A2S A;  1MTC A;  1V57 A;  1AXD A;  1GSE A;  6GSU A;  3KTL A;  4NXI A;  3GH6 A;  4RI6 A;  2QSI A;  1Y6E A;  5LCZ A;  2X8G A;  5G5F A;  4AJ6 A;  2OAD A;  3C8E A;  2WGR A;  4GF0 A;  3TKP A;  1TU7 A;  1JZW A;  4XIH A;  2CAI A;  3M8N A;  4G10 A;  3D4T A;  2H72 A;  2H6Z A;  3QPM A;  3GKX A;  1R26 A;  4IP1 A;  1XWG A;  4GTU A;  2H1B A;  2IMI A;  4ZIL A;  3TDG A;  3WGX A;  11GS A;  4K7O A;  2YV7 A;  3HY2 A;  4IW9 A;  2VCW A;  4HI7 A;  3LWA A;  5J3R A;  5JCG A;  2HSY A;  2V41 A;  5HFG A;  1U6T A;  4N11 A;  1ZOF A;  1O73 A;  4HQS A;  4XRD A;  2EC4 A;  5FHI A;  3LGC A;  1GLQ A;  4MH2 A;  1VGL A;  4K0N A;  1I9D A;  4I5Q A;  3RHC A;  2N5A A;  3HZ8 A;  2EIQ A;  3KJY A;  3VUR A;  3KEB A;  1V2A A;  4Q5Q A;  3ZIV A;  4ID0 A;  5H5S A;  5DJM A;  2CX4 A;  3P2A A;  2O8V B;  4ECJ A;  3ZTL A;  2YZH A;  2CX3 A;  4JED A;  2H1A A;  3O6T A;  3QMX A;  2LJR A;  1Z7P A;  5J41 A;  4GWR A;  4MZW A;  2AYT A;  1JLV A;  1XVQ A;  2PPT A;  2F8A A;  3MSZ A;  1SU9 A;  3VK9 A;  3ZYW A;  2K18 A;  4OCE A;  3HVV A;  4NHZ A;  5ECM B;  2I1U A;  2L5L A;  2IME A;  5G2Z A;  1GTU A;  1FVJ A;  2VO4 A;  3EU3 A;  2H01 A;  3F8U A;  1ON4 A;  2JU5 A;  4O5R A;  2TRC P;  4ML1 A;  6GSW A;  2LRN A;  4QL7 A;  1PQN A;  20GS A;  4HJ2 A;  4KA0 A;  4LL4 B;  3TOT A;  1GSY A;  3M3M A; 
#chains in the Genus database with same CATH topology
 5G30 A;  4WF5 A;  5KEJ A;  2HZE B;  4NV5 A;  2FNO A;  3ZZX A;  3ZFL A;  2FY6 A;  1NW2 A;  3A2V A;  3DRN A;  5IO0 A;  3ZFB A;  1XW5 A;  5CO3 A;  1QK8 A;  1OVN A;  3UBL A;  4DSS B;  2DLX A;  2CV4 A;  5H5Q A;  4RQR A;  4TXO B;  1V40 A;  2MBT A;  2HXK A;  2QA2 A;  4KCE A;  2M72 A;  1PD2 1;  2PBJ A;  1GSU A;  1R5P A;  4NHW A;  3W8J A;  3CSI A;  2ALB A;  2AB6 A;  3EYT A;  3IRA A;  4BL7 A;  1K0N A;  1WE0 A;  4KX4 A;  2X64 A;  3FEU A;  4DSR A;  2K6V A;  2J23 A;  3D22 A;  5AIX A;  4EL1 A;  1A2M A;  2VCT A;  4I6X A;  3PPU A;  2IFQ A;  2K9F A;  4IBP A;  4ECB A;  3EUR A;  4YKG A;  1EGR A;  3GH9 A;  2ON5 A;  1DUG A;  2YAN A;  1J0F A;  3QFB C;  1VF4 A;  5G1K A;  3CYN A;  5B6N A;  4OO5 A;  1WIK A;  1ZL9 A;  2RII A;  4BWS A;  2HT9 A;  4HOJ A;  3QCP A;  2AHE A;  2M80 A;  4GSS A;  1OC8 A;  4EC0 A;  1EV9 A;  3KH7 A;  2L5O A;  2GZZ A;  3QR6 A;  5DQY A;  2JSZ A;  5DAK B;  4ZL7 A;  3U5R E;  2IMK A;  1M99 A;  5ECL B;  1KTE A;  4X4J A;  1PKZ A;  2WCI A;  4F0B A;  2C8U A;  1R7H A;  4A5P A;  1XWA A;  3GTU A;  1M9A A;  2KP1 A;  2EIO A;  5BRT A;  3FR6 A;  4NPB A;  2OE0 A;  1TJD A;  1SKS B;  1PL2 A;  2I81 A;  2R4V A;  4TR4 A;  2MMO A;  1EZK A;  2GT6 A;  2VAF A;  2PUK C;  3SWL A;  2X8C A;  3KGK A;  2H8L A;  3GUS A;  3W6G A;  1OE8 A;  2X99 A;  1X9M B;  1AQV A;  1M0U A;  1GUM A;  3LOR A;  6GSX A;  1FAA A;  4PGT A;  1X9S B;  2GQL A;  4TR0 A;  6GSS A;  4IQA A;  1EP8 A;  2N5B A;  2V2G A;  4OMV A;  3LFL A;  1K3Y A;  3NOF A;  4XS4 A;  3FMW A;  1MDJ A;  2ZCT A;  2AJQ B;  4MPG A;  3RPN A;  2HFD A;  1B8X A;  1XIY A;  4ICY A;  4RQX A;  4XTS A;  1K0M A;  4E8E A;  5HR2 A;  2L6D A;  4XS6 A;  2OAC A;  5EL8 A;  4RI7 A;  3EVI A;  3TCO A;  4EUY A;  1WPI A;  4MF6 A;  1YDK A;  4POM A;  3MDK A;  4BVX B;  2OBK A;  2XPD A;  1SL0 B;  1A2L A;  2N5F A;  3DD3 A;  2HI7 A;  1XWK A;  2NPB A;  6GSY A;  3DVX A;  4PQH A;  2O89 A;  5J9B A;  4O5U A;  1SL1 B;  1PX7 A;  2WZ9 A;  2NBS A;  1BQ7 A;  3UL3 A;  3DVW A;  3GMF A;  1BED A;  4CW9 A;  2JSY A;  3IPZ A;  2LKU A;  10GS A;  2E2G A;  3IE3 A;  5ECI B;  4IS0 A;  1M7T A;  2IN3 A;  4N30 A;  2DSA A;  2VM1 A;  1PN9 A;  2PMT A;  3GL5 A;  4IEL A;  4PUF C;  1TK5 B;  4MAB A;  2KOK A;  3EU4 A;  5DVB A;  2O85 A;  3ZIJ A;  3L0H A;  4NWY A;  18GS A;  1K0D A;  3A2W A;  3IXR A;  4AF2 A;  4CY8 A;  1PMT A;  2ES7 A;  3KIJ A;  1Y25 A;  4IVF A;  5D93 A;  5ELG A;  4XHM A;  1TK0 B;  1MEK A;  4MMM A;  2L4Q A;  5F06 A;  1XZO A;  2DIZ A;  3ZRD A;  1V98 A;  4PNG A;  2GSS A;  2NVL A;  2F51 A;  3TKQ A;  4BA7 A;  4MK3 A;  3EPT A;  3G7J A;  4WR4 A;  3EIN A;  3D4M A;  1SKW B;  3M9K A;  3E0U A;  4MDC A;  3KMO A;  1ZGN A;  2GSQ A;  3GX0 A;  3IR4 A;  1F3A A;  1VF3 A;  4BVY B;  2XPE A;  5E4W A;  3EMP A;  1M9B A;  2MMN A;  1GUL A;  1BG5 A;  1PGT A;  1SK0 A;  2IPA A;  1YEX A;  3F63 A;  1M3I A;  1XWB A;  3IBH A;  1B9Y C;  1OAZ A;  3CXG A;  5CRE A;  4BWQ A;  1KEB A;  2B3S A;  5C04 A;  1XW6 A;  2B7J A;  4O7H A;  3GHA A;  5HQP A;  3D6I A;  3IAS 2;  3IC8 A;  1JZD A;  2L59 A;  2YNX A;  2TRX A;  5ECS A;  1SK1 A;  3GST A;  5F8B A;  1SD9 A;  3TB2 A;  3AY8 A;  4PXO A;  1USB A;  5ECO B;  4IP6 A;  1WOU A;  2VLU A;  3KZQ A;  2C1Y A;  2CQ9 A;  1G7E A;  2HRK A;  1TOF A;  3PR8 A;  4WEY A;  3UOM A;  3E9J B;  3GKM A;  2M46 A;  5G1L A;  3TKS C;  3TGZ A;  3VLN A;  4MF5 A;  5CAX A;  2B5Y A;  1F2E A;  2F9S A;  2YWN A;  2I4A A;  7GSS A;  3UVH A;  2MBS A;  2BMX A;  4KAE A;  2FWF A;  1S3A A;  1E6B A;  3HVS A;  4BPY A;  3ZLP A;  1SJ6 A;  3C1R A;  3TJF A;  3VWV A;  3LG6 A;  4HJM A;  4X43 A;  8GSS A;  2L57 A;  5IMA A;  2LJA A;  22GS A;  2OKA A;  5CNW A;  1PX6 A;  3L78 A;  2B7K A;  3HYP A;  4EVM A;  3CRT A;  1YKA A;  2I9H A;  2LJK A;  2LQQ A;  2GQM A;  2GLR A;  1GWC A;  2C3N A;  1ZYQ B;  2GSR A;  2H1D A;  1SJI A;  2FWG A;  1TK8 B;  4TN8 A;  1XPV A;  4YAP A;  3RDW A;  1FOH A;  2G2Q A;  4ULX A;  3M0F A;  4ECC A;  1QGV A;  4F2I A;  4DEJ A;  4I97 A;  1Z6N A;  2JL4 A;  5B6M A;  4IN0 A;  2F8F A;  5KOX A;  2YN1 A;  4ACS A;  1B4Q A;  1XCC A;  3F9U A;  4P3Y B;  3LEF A;  1S3D A;  2YWI A;  5ECQ B;  5ECN B;  3GX8 A;  3VWW A;  5DBQ A;  3VI5 A;  3QOU A;  1GRX A;  2YP6 A;  3QAW A;  5IQY A;  3TJB A;  1TRV A;  2QKE A;  2VCV A;  2DJ3 A;  1SD8 A;  2QGV A;  4X1U A;  1PL1 A;  4OFM A;  4MCU A;  4G9H A;  4N10 A;  5ID2 A;  5IO2 A;  1ML6 A;  3MAK A;  1ERT A;  2YJ7 A;  2YWO A;  1OC9 A;  3ED3 A;  3FY7 A;  3A3T A;  3LYK A;  1GTA A;  1EGO A;  1N2A A;  1F37 A;  1YF0 A;  1X5E A;  3WT1 A;  2QA1 A;  4G19 A;  1XBS A;  2AAW A;  5A5K A;  3LYP A;  1TP9 A;  1CQH A;  4EDY A;  4D73 B;  2A2P A;  2TIR A;  3PGT A;  5DAL B;  3TOU A;  3GFK A;  1HD2 A;  1ILO A;  3G9B A;  1G6W A;  3J7Y k;  2VCZ A;  12GS A;  4POB A;  4KGI A;  2WB9 A;  2VCQ A;  2LUS A;  3UJ1 A;  2RM5 A;  4G0K A;  4WET A;  2CVK A;  4V2L A;  2XBQ A;  3GN3 A;  2RLI A;  1TRS A;  3ZVJ A;  1BAY A;  3G7I A;  5DCG A;  3UIW A;  2KLX A;  3C1S A;  1HQO A;  2FUG 2;  4ML6 A;  4MJB A;  3SBC A;  3ZRE A;  1V58 A;  1T1V A;  5ECR B;  3R2Q A;  2DJ0 A;  1M2A A;  4KUN A;  4WBJ A;  1W89 A;  2ZUP A;  1EV4 A;  2WFC A;  1EWX A;  2IL3 A;  3GKN A;  2KHP A;  3UBK A;  1A0R P;  1E2Y A;  1PA3 A;  3ERW A;  3F6D A;  3TJJ A;  3TRP A;  4K5R A;  2J9H A;  4ZB9 A;  4FO5 A;  2IJY A;  4LA1 A;  5F0G A;  2VL2 C;  1QQ2 A;  3QAV A;  3NZN A;  1AQX A;  5A4W A;  3IAM 2;  4GCI A;  3IK7 A;  4FQU A;  2HE3 A;  1A0F A;  1ERW A;  2H70 A;  4PUA A;  1X5C A;  3QFA C;  1O8X A;  4KH7 A;  3HHV A;  5D9T A;  3CMI A;  4XCS A;  3FR9 A;  1EOH A;  2WUL A;  2FWH A;  1PRX A;  5L71 A;  1U3A A;  16GS A;  5F05 A;  1TXX A;  1QFN A;  5DDL A;  2VCX A;  5J5N A;  4DSQ A;  4KCA A;  4OD7 A;  4POL A;  3CTF A;  3L9U A;  3GA4 A;  3TRX A;  4I2U A;  3IDV A;  2WJU A;  2GZY A;  2HRN A;  3PIN A;  4MJC A;  4PX1 A;  4HEA 2;  3V1W A;  2YZU A;  2JAD A;  2FGX A;  1X9W B;  3FW2 A;  4AJ8 A;  4FIW A;  5A4V A;  5BMU A;  1GTI A;  3LQ7 A;  3LSZ A;  4YQV A;  2P0G A;  2PGT A;  1K0A A;  4Z2U A;  4HS1 A;  2R6K A;  5KN3 A;  3QDN A;  2VM2 A;  2C3T A;  4KDY A;  4ZL8 A;  3A5W A;  1K3O A;  2LNT A;  1YF1 A;  3JCM L;  4F03 A;  1R4W A;  2DJJ A;  6GST A;  3G7Y A;  2LNS A;  1TI3 A;  1BYE A;  2XC2 A;  3GRX A;  5JWQ B;  4ZB8 A;  5ELA A;  5KN1 A;  5AN1 A;  3KP9 A;  1FO5 A;  5ECP B;  2FWE A;  3CRU A;  5IOX A;  5J4U A;  1T3B A;  1GLP A;  3TKR A;  4IHU A;  3A5I A;  4PTS A;  1TRW A;  2WS2 A;  4YH2 A;  1JFU A;  2CA8 A;  5C00 A;  1YY7 A;  1DE2 A;  1Q98 A;  3L9S A;  3H8Q A;  3PH9 A;  4IJ3 A;  2B5X A;  2MYG A;  1GP1 A;  2GTU A;  1X0R A;  4MJA A;  4K9Z A;  5CRG A;  3DWV A;  2L4C A;  1EOG A;  5CP1 A;  2E2M A;  2KUC A;  3US3 A;  4EXJ A;  3KM6 A;  5HR3 A;  1Z7R A;  5G5E A;  4H86 A;  5IMZ A;  4BL7 B;  3MNG A;  4NV2 A;  4K0G A;  5LD0 A;  3M1G A;  4K7I A;  3HDC A;  1UC7 A;  2V1M A;  1A8L A;  4WR5 A;  2FA8 A;  2IFQ B;  2B5E A;  2F3M A;  1UA5 A;  3WD6 A;  1ZYP A;  2WRT A;  4L5O A;  2X49 A;  19GS A;  4F9Z A;  1OKT A;  2R0P A;  1RQM A;  2VIM A;  3WGE A;  2P31 A;  2C0D A;  1VRS D;  4EDZ A;  1Z5Y E;  4OO4 A;  2PVO C;  3ME8 A;  4XRA A;  1F9M A;  1ERU A;  1NM3 A;  1NHO A;  5GST A;  2A2R A;  2DJ1 A;  1MD4 A;  3IK9 A;  1JHB A;  3P90 A;  1M2B A;  2H0I A;  4G0I A;  6GSV A;  2C80 A;  5AGY A;  5ENU A;  2GS3 A;  3FYG A;  3GTU B;  3DKS A;  1M2D A;  1Z6M A;  4FYB A;  4CY6 A;  3P8W A;  4KSM A;  2VD1 A;  2H1G A;  5IMV A;  1TW9 A;  2H66 A;  3VFI A;  3KMN A;  1AW9 A;  4TKY A;  4NAX A;  5LNK e;  1XG8 A;  1ERV A;  4KND A;  1ZCP A;  2CT6 A;  5KN2 A;  4D73 A;  4ZBD A;  3GNJ A;  2IIY A;  1M3J A;  2R37 A;  4GST A;  1KNG A;  2GST A;  4HU9 A;  1THX A;  2CZ3 A;  3HVX A;  4I8B A;  4EE0 A;  3F3R A;  4X0X A;  5ECH B;  2OJL A;  4K2X A;  4J2F A;  2PWJ A;  3VPT A;  1B48 A;  3FK8 A;  4TR3 A;  1SK2 A;  3IC4 A;  17GS A;  1MDI A;  2IWT A;  2RM6 A;  4XS4 B;  5EVO A;  2DBC A;  1T00 A;  3BCK A;  4GLT A;  2CAQ A;  2WDU A;  1VF1 A;  2NDO A;  3APS A;  2BJX A;  1GSQ A;  4POK A;  3KCM A;  1YEP A;  4GQF A;  2YWM A;  4ISD A;  3LXT A;  4K6X A;  3FRC A;  14GS A;  3H79 A;  2GDR A;  2ON7 A;  1J9B A;  2V32 A;  3BD2 A;  5GAN D;  5IPG A;  3DXB A;  2FCH A;  1HNB A;  1DSB A;  5D9W A;  1GNW A;  1LJR A;  2HZE A;  3P7X A;  4LMV A;  4J57 E;  3CSH A;  3IV4 A;  3K8N A;  1U88 A;  1PSQ A;  4MP4 A;  5AIV A;  3OR5 A;  4RUV A;  1FOV A;  4DSS A;  3FZA A;  3F4R A;  4TOP A;  4KF9 A;  5HFK A;  5B7C A;  4O32 A;  2RUF A;  2X4A A;  4TXO A;  3LXZ A;  4BIK A;  1JLW A;  1UN2 A;  2DML A;  2LRC A;  3H4K A;  3HD5 A;  2HSH A;  3CSJ A;  4TVE A;  4JZQ A;  2H74 A;  4J56 E;  5ABR A;  1GSD A;  3HJP A;  3FZ5 A;  1RW1 A;  4L0U A;  2GGT A;  2C3Q A;  1WJK A;  3C73 A;  2CVB A;  1XXU A;  3GL3 A;  1A24 A;  1UVZ A;  2CVD A;  5A4U A;  5DJL A;  3Q6O A;  4TR1 B;  1FG4 A;  1V9W A;  1J08 A;  1Z3E A;  1GL8 A;  1WRY A;  4KE3 A;  2XBI A;  9GSS A;  4V2M A;  5CRH A;  4LLR A;  2LRT A;  3TKS E;  2IMF A;  4WF4 A;  1G0T A;  1H75 A;  3Q19 A;  2IMD A;  1T7P B;  1XOA A;  5DAK A;  4K7N A;  1EP7 A;  3D5J A;  5E59 A;  3WYW A;  3FKF A;  2VLT A;  3GKK A;  3R3E A;  1K0C A;  2ZNM A;  5D96 A;  4ZBA A;  1TI1 A;  4MJE A;  3O3T A;  1G7O A;  5H5R A;  4JBB A;  4IKH A;  3N9J A;  1YZX A;  5EPF A;  2XHF A;  5GSS A;  1BJX A;  1QUW A;  5DCH A;  4MZC A;  4MZB A;  4YQM A;  1DE1 A;  2MMZ A;  1N8J A;  1GSS A;  1OC3 A;  3VI7 A;  2AUV A;  4IJI A;  3ZML A;  2H73 A;  3DML A;  1WMJ A;  3N5O A;  1BX9 A;  3TKS A;  3UVT A;  3I6A A;  3UAR A;  2H76 A;  1THO A;  4V1A g;  5JCU A;  5JWO B;  3ZVJ D;  2VUP A;  3DIE A;  4TXV A;  3IHG A;  4WXT A;  3FHK A;  4L8E A;  3D0Z A;  3F3Q A;  1TKD B;  1WP0 A;  1F6M C;  2EIR A;  4JRR A;  3I9V 2;  3C7M A;  2MMA A;  2HRF A;  1T8E B;  1Q4J A;  2H75 A;  2X8H A;  1LU4 A;  3QD9 A;  1K3L A;  1KBN A;  3BOA A;  1HYU A;  3H1N A;  3HCZ A;  3DEX A;  4JU5 A;  3E3E A;  2YV9 A;  4O5Q A;  4QQ7 A;  4BVX A;  4O92 A;  2PVQ A;  2HYX A;  1SEN A;  5CYY A;  4MF7 A;  3CQF A;  3ZL5 A;  2UZ8 A;  3BCI A;  4CDO A;  3FZ9 A;  4K1F A;  1YJ6 A;  5IPH A;  3APO A;  1O6J A;  4NMU A;  2FA4 A;  3F4S A;  4EO3 A;  2K8V A;  3IOS A;  1NSW A;  4ZB6 A;  2FHE A;  4TRX A;  1G6Y A;  1B9X C;  1FHE A;  4YAV A;  1XVW A;  5CRW A;  5D9V A;  1T4Z A;  1TU8 A;  2B6M A;  3FR3 A;  4IQ1 A;  3I69 A;  3KTB A;  4JE1 A;  4N0V A;  1CQG A;  3C71 A;  2GT5 A;  5IIZ A;  4E8H A;  3GUR A;  2AV4 A;  1QMV A;  2LEG A;  1O7U A;  4F82 A;  1SYX A;  4EF0 A;  2H71 A;  3ZIT A;  2REM A;  3APQ A;  5ID2 B;  1C72 A;  4IGJ A;  1LBK A;  2JZR A;  2C0G A;  3UAP A;  2GZP A;  1ZMA A;  4FH8 A;  3TUE A;  2LV3 A;  1OYJ A;  1VF2 A;  4ZBB A;  1OC9 B;  2YPM A;  3BBY A;  3KP8 A;  5IMF A;  4ECI A;  4EIQ A;  3F0I A;  4ZL9 A;  5GZZ B;  2H6X A;  4WBR D;  4HDE A;  1ZZY A;  4BVY A;  1H4O A;  2YOI A;  13GS A;  1FVK A;  3TJG A;  2E7P A;  2R2J A;  4PUR A;  5IOW A;  2OE1 A;  1B4P A;  4KB3 A;  5EY6 A;  2VD0 A;  4WKW A;  3RAZ A;  3F6F A;  1GH2 A;  1YKC A;  5GAP D;  2QC7 A;  2H30 A;  1GNE A;  1XWC A;  5F07 A;  2HRA A;  5FWG A;  1O8W A;  4Q5F A;  2R3X A;  4L0W A;  4LL1 B;  3Q74 A;  3LJR A;  4Q5N A;  1X5D A;  2RUE A;  2CZ2 A;  3EWL A;  3QAG A;  2DJ2 A;  4XS1 A;  3O76 A;  1ZYE A;  3L4N A;  4L5L A;  2O87 A;  3KXO A;  4HQZ A;  2NTO A;  4MNN A;  5D73 A;  2V6K A;  1I5G A;  1FB6 A;  2B1K A;  3VWX A;  3WGD A;  1WWJ A;  2KP2 A;  2FLS A;  2OE3 A;  5D9X A;  4ZXG A;  4MLY A;  5IM9 A;  3RPP A;  1SL2 B;  4OWY A;  5JCW A;  1OKD A;  1IYI A;  3WT2 A;  1O81 A;  3DGQ A;  4G2E A;  1U3I A;  5B8B A;  2DMM A;  2PER A;  4GXZ A;  1SJZ A;  1NHY A;  4EKZ A;  1JZO A;  1EEM A;  2HNL A;  3ISO A;  4MH3 A;  2HZF A;  4HUA A;  1GSF A;  1XOB A;  5INY A;  3KH9 A;  5HR1 A;  1GUH A;  3DYR A;  4Q5R A;  4V2N A;  2MZC A;  3ME7 A;  1GTB A;  5IMD A;  3UMA A;  2BTO T;  4KSO A;  2VL2 A;  1TTZ A;  4JR4 A;  4USS A;  3HJO A;  4MA9 A;  2K8S A;  3GYK A;  3BJ5 A;  1SYR A;  5D8I A;  4Z7X A;  4ILF A;  3KD0 A;  5FT3 A;  1K0B A;  4FYC A;  2V6O A;  1AIU A;  4JR6 A;  1JZR A;  3FZ4 A;  1T4Y A;  5DQS A;  3ERG A;  3GIX A;  1IYH A;  1FW1 A;  4Z2R A;  1XFL A;  1K0O A;  4V1A p;  2Z9S A;  1EEJ A;  1A8Y A;  1R5A A;  1Z9H A;  2JAC A;  1GUK A;  4CHS A;  2VOC A;  1O85 A;  3ERF A;  1A23 A;  3A2X A;  2FD3 A;  1F3B A;  1PN0 A;  3U6V A;  3S9F A;  1OE7 A;  4OFN A;  2C4J A;  1A2J A;  2H6Y A;  4EIP A;  4TR1 A;  4ZIJ A;  4TW5 A;  5AIS A;  3D21 A;  5B8A A;  2B1L A;  4K2D A;  2C0F A;  5CRD A;  3HJM A;  2D2Z A;  1HNA A;  3EMX A;  4I2T A;  3IHQ A;  2LS5 A;  2E0Q A;  4KDU A;  5COH A;  3W8S A;  4MPF A;  3Q18 A;  1XW9 A;  3VPQ A;  2O7K A;  4PQI A;  1TRU A;  4QL9 A;  5IMC A;  2R0C A;  4LMW A;  1QXH A;  4PNF A;  5DAL A;  2H0H A;  4N0Z A;  1ACV A;  3J7Y b;  3HZ4 A;  3H93 A;  2P5R A;  2GQK A;  3GV1 A;  1AUC A;  5J9C A;  3GSS A;  2LST A;  1TDI A;  3M9J A;  1YQ1 A;  2JZS A;  4OFT A;  2I3Y A;  2OBI A;  1RK4 A;  1PFO A;  1FB0 A;  2H0G A;  2GVP A;  4PQ1 A;  3TJK A;  3RBT A;  1AQW A;  2PN8 A;  1SKR B;  4YQU A;  4DVC A;  2A4V A;  4F0C A;  5HFI A;  3MYD A;  2PU9 C;  3I43 A;  3F4T A;  2LTK A;  4Z2T A;  1ST9 A;  3HKR A;  2G0F A;  2YJH A;  3CTG A;  1AC1 A;  1S3C A;  5KN0 A;  2HLS A;  1HNC A;  3ZMK A;  2LQO A;  4HZ4 A;  3MWH A;  3CBU A;  2DC5 A;  1U87 A;  1DBY A;  3NIV A;  2YCD A;  4YKF A;  2L6C A;  3HVN A;  3RHB A;  3UEM A;  2JZT A;  1AAZ A;  4KW6 A;  5G31 A;  2R0G A;  3L9V A;  4GRF A;  1MDK A;  4FYU A;  4GQC A;  2VLV A;  5HR0 A;  3EC3 A;  5KOW A;  2C0E A;  2OA7 A;  2VL3 A;  3EE2 A;  1ABA A;  1MD3 A;  2VL9 A;  3HA9 A;  1URM A;  4KDX A;  4K8M A;  4AJ7 A;  3HXS A;  4AGS A;  4OCF A;  4HU7 A;  1W4V A;  3TRQ A;  2P5Q A;  1PKW A;  2R5G A;  2DJK A;  5JWR B;  3IA1 A;  3VWU A;  4GSN A;  2H19 A;  2DIY A;  5ECK B;  4HZ2 A;  2A2S A;  1MTC A;  1V57 A;  1AXD A;  1GSE A;  6GSU A;  3KTL A;  4NXI A;  3GH6 A;  4RI6 A;  2QSI A;  1Y6E A;  2HSM A;  5LCZ A;  3MIX A;  2X8G A;  5G5F A;  4AJ6 A;  2OAD A;  3C8E A;  2WGR A;  4GF0 A;  3TKP A;  1S3R A;  1TU7 A;  1JZW A;  4XIH A;  2CAI A;  3M8N A;  4G10 A;  3D4T A;  2H72 A;  2H6Z A;  3QPM A;  3GKX A;  1R26 A;  4IP1 A;  1XWG A;  2DKI A;  4GTU A;  2H1B A;  2IMI A;  4ZIL A;  3TDG A;  3WGX A;  11GS A;  4K7O A;  2YV7 A;  3HY2 A;  4IW9 A;  2VCW A;  4HI7 A;  3LWA A;  5J3R A;  5JCG A;  2HSY A;  2V41 A;  5HFG A;  1U6T A;  4N11 A;  1ZOF A;  2A4H A;  1O73 A;  4HQS A;  4XRD A;  2EC4 A;  5FHI A;  3LGC A;  1GLQ A;  4MH2 A;  1VGL A;  4K0N A;  1I9D A;  4I5Q A;  3RHC A;  2N5A A;  3HZ8 A;  2EIQ A;  3KJY A;  3VUR A;  3KEB A;  1V2A A;  4Q5Q A;  3ZIV A;  4ID0 A;  5H5S A;  5DJM A;  2CX4 A;  3P2A A;  2O8V B;  4ECJ A;  3ZTL A;  4G0L A;  2YZH A;  2CX3 A;  2DKH A;  4JED A;  4K5S A;  2H1A A;  3O6T A;  3QMX A;  2LJR A;  1Z7P A;  5J41 A;  4GWR A;  4MZW A;  2AYT A;  1JLV A;  1XVQ A;  2PPT A;  2F8A A;  3MSZ A;  1SU9 A;  3VK9 A;  3ZYW A;  2K18 A;  4OCE A;  3HVV A;  4NHZ A;  3LW9 A;  5ECM B;  2I1U A;  2L5L A;  2IME A;  5G2Z A;  1GTU A;  1FVJ A;  2VO4 A;  3EU3 A;  2H01 A;  3F8U A;  1ON4 A;  2JU5 A;  4O5R A;  2TRC P;  4ML1 A;  6GSW A;  2LRN A;  4QL7 A;  4KA0 A;  1PQN A;  20GS A;  4HJ2 A;  1ZYN A;  4HSC X;  4LL4 B;  1GSY A;  3M3M A;  3TOT A; 
#chains in the Genus database with same CATH homology
 5G30 A;  4WF5 A;  5KEJ A;  2HZE B;  4NV5 A;  2FNO A;  3ZZX A;  3ZFL A;  2FY6 A;  1NW2 A;  3A2V A;  3DRN A;  5IO0 A;  3ZFB A;  1XW5 A;  5CO3 A;  1QK8 A;  1OVN A;  3UBL A;  4DSS B;  2DLX A;  2CV4 A;  5H5Q A;  4RQR A;  4TXO B;  1V40 A;  2MBT A;  2HXK A;  2QA2 A;  4KCE A;  2M72 A;  1PD2 1;  2PBJ A;  1GSU A;  1R5P A;  4NHW A;  3W8J A;  3CSI A;  2ALB A;  2AB6 A;  3EYT A;  3IRA A;  4BL7 A;  1K0N A;  1WE0 A;  4KX4 A;  2X64 A;  3FEU A;  4DSR A;  2K6V A;  2J23 A;  3D22 A;  5AIX A;  4EL1 A;  1A2M A;  2VCT A;  4I6X A;  3PPU A;  2IFQ A;  2K9F A;  4IBP A;  4ECB A;  3EUR A;  4YKG A;  1EGR A;  3GH9 A;  2ON5 A;  1DUG A;  2YAN A;  1J0F A;  3QFB C;  1VF4 A;  5G1K A;  3CYN A;  5B6N A;  4OO5 A;  1WIK A;  1ZL9 A;  2RII A;  4BWS A;  2HT9 A;  4HOJ A;  3QCP A;  2AHE A;  2M80 A;  4GSS A;  1OC8 A;  4EC0 A;  1EV9 A;  3KH7 A;  2L5O A;  2GZZ A;  3QR6 A;  5DQY A;  2JSZ A;  5DAK B;  4ZL7 A;  3U5R E;  2IMK A;  1M99 A;  5ECL B;  1KTE A;  4X4J A;  1PKZ A;  2WCI A;  4F0B A;  2C8U A;  1R7H A;  4A5P A;  1XWA A;  3GTU A;  1M9A A;  2KP1 A;  2EIO A;  5BRT A;  3FR6 A;  4NPB A;  2OE0 A;  1TJD A;  1SKS B;  1PL2 A;  2I81 A;  2R4V A;  4TR4 A;  2MMO A;  1EZK A;  2GT6 A;  2VAF A;  2PUK C;  3SWL A;  2X8C A;  3KGK A;  2H8L A;  3GUS A;  3W6G A;  1OE8 A;  2X99 A;  1X9M B;  1AQV A;  1M0U A;  1GUM A;  3LOR A;  6GSX A;  1FAA A;  4PGT A;  1X9S B;  2GQL A;  4TR0 A;  6GSS A;  4IQA A;  1EP8 A;  2N5B A;  2V2G A;  4OMV A;  3LFL A;  1K3Y A;  3NOF A;  4XS4 A;  3FMW A;  1MDJ A;  2ZCT A;  2AJQ B;  4MPG A;  3RPN A;  2HFD A;  1B8X A;  1XIY A;  4ICY A;  4RQX A;  4XTS A;  1K0M A;  4E8E A;  5HR2 A;  2L6D A;  4XS6 A;  2OAC A;  5EL8 A;  4RI7 A;  3EVI A;  3TCO A;  4EUY A;  1WPI A;  4MF6 A;  1YDK A;  4POM A;  3MDK A;  4BVX B;  2OBK A;  2XPD A;  1SL0 B;  1A2L A;  2N5F A;  3DD3 A;  2HI7 A;  1XWK A;  2NPB A;  6GSY A;  3DVX A;  4PQH A;  2O89 A;  5J9B A;  4O5U A;  1SL1 B;  1PX7 A;  2WZ9 A;  2NBS A;  1BQ7 A;  3UL3 A;  3DVW A;  3GMF A;  1BED A;  4CW9 A;  2JSY A;  3IPZ A;  2LKU A;  10GS A;  2E2G A;  3IE3 A;  5ECI B;  4IS0 A;  1M7T A;  2IN3 A;  4N30 A;  2DSA A;  2VM1 A;  1PN9 A;  2PMT A;  3GL5 A;  4IEL A;  4PUF C;  1TK5 B;  4MAB A;  2KOK A;  3EU4 A;  5DVB A;  2O85 A;  3ZIJ A;  3L0H A;  4NWY A;  18GS A;  1K0D A;  3A2W A;  3IXR A;  4AF2 A;  4CY8 A;  1PMT A;  2ES7 A;  3KIJ A;  1Y25 A;  4IVF A;  5D93 A;  5ELG A;  4XHM A;  1TK0 B;  1MEK A;  4MMM A;  2L4Q A;  5F06 A;  1XZO A;  2DIZ A;  3ZRD A;  1V98 A;  4PNG A;  2GSS A;  2NVL A;  2F51 A;  3TKQ A;  4BA7 A;  4MK3 A;  3EPT A;  3G7J A;  4WR4 A;  3EIN A;  3D4M A;  1SKW B;  3M9K A;  3E0U A;  4MDC A;  3KMO A;  1ZGN A;  2GSQ A;  3GX0 A;  3IR4 A;  1F3A A;  1VF3 A;  4BVY B;  2XPE A;  5E4W A;  3EMP A;  1M9B A;  2MMN A;  1GUL A;  1BG5 A;  1PGT A;  1SK0 A;  2IPA A;  1YEX A;  3F63 A;  1XWB A;  3IBH A;  1B9Y C;  1OAZ A;  3CXG A;  5CRE A;  4BWQ A;  1KEB A;  2B3S A;  5C04 A;  1XW6 A;  2B7J A;  4O7H A;  3GHA A;  5HQP A;  3D6I A;  3IAS 2;  3IC8 A;  1JZD A;  2L59 A;  2YNX A;  2TRX A;  5ECS A;  1SK1 A;  3GST A;  5F8B A;  1SD9 A;  3TB2 A;  3AY8 A;  4PXO A;  1USB A;  5ECO B;  4IP6 A;  1WOU A;  2VLU A;  3KZQ A;  2C1Y A;  2CQ9 A;  1G7E A;  2HRK A;  1TOF A;  3PR8 A;  4WEY A;  3UOM A;  3E9J B;  3GKM A;  2M46 A;  5G1L A;  3TKS C;  3TGZ A;  3VLN A;  4MF5 A;  5CAX A;  2B5Y A;  1F2E A;  2F9S A;  2YWN A;  2I4A A;  7GSS A;  3UVH A;  2MBS A;  2BMX A;  4KAE A;  2FWF A;  1S3A A;  1E6B A;  3HVS A;  4BPY A;  3ZLP A;  1SJ6 A;  3C1R A;  3TJF A;  3VWV A;  3LG6 A;  4HJM A;  4X43 A;  8GSS A;  2L57 A;  5IMA A;  2LJA A;  22GS A;  2OKA A;  5CNW A;  1PX6 A;  3L78 A;  2B7K A;  3HYP A;  4EVM A;  3CRT A;  1YKA A;  2I9H A;  2LJK A;  2LQQ A;  2GQM A;  2GLR A;  1GWC A;  2C3N A;  1ZYQ B;  2GSR A;  2H1D A;  1SJI A;  2FWG A;  1TK8 B;  4TN8 A;  1XPV A;  4YAP A;  3RDW A;  1FOH A;  2G2Q A;  4ULX A;  3M0F A;  4ECC A;  1QGV A;  4F2I A;  4DEJ A;  4I97 A;  1Z6N A;  2JL4 A;  5B6M A;  4IN0 A;  2F8F A;  5KOX A;  2YN1 A;  4ACS A;  1B4Q A;  1XCC A;  3F9U A;  4P3Y B;  3LEF A;  1S3D A;  2YWI A;  5ECQ B;  5ECN B;  3GX8 A;  3VWW A;  5DBQ A;  3VI5 A;  3QOU A;  1GRX A;  2YP6 A;  3QAW A;  5IQY A;  3TJB A;  1TRV A;  2QKE A;  2VCV A;  2DJ3 A;  1SD8 A;  2QGV A;  4X1U A;  1PL1 A;  4OFM A;  4MCU A;  4G9H A;  4N10 A;  5ID2 A;  5IO2 A;  1ML6 A;  3MAK A;  1ERT A;  2YJ7 A;  2YWO A;  1OC9 A;  3ED3 A;  3FY7 A;  3A3T A;  3LYK A;  1GTA A;  1EGO A;  1N2A A;  1F37 A;  1YF0 A;  1X5E A;  3WT1 A;  2QA1 A;  4G19 A;  1XBS A;  2AAW A;  5A5K A;  3LYP A;  1TP9 A;  1CQH A;  4EDY A;  4D73 B;  2A2P A;  2TIR A;  3PGT A;  5DAL B;  3TOU A;  3GFK A;  1HD2 A;  1ILO A;  3G9B A;  1G6W A;  3J7Y k;  2VCZ A;  12GS A;  4POB A;  4KGI A;  2WB9 A;  2VCQ A;  2LUS A;  3UJ1 A;  2RM5 A;  4G0K A;  4WET A;  2CVK A;  4V2L A;  2XBQ A;  3GN3 A;  2RLI A;  1TRS A;  3ZVJ A;  1BAY A;  3G7I A;  5DCG A;  3UIW A;  2KLX A;  3C1S A;  1HQO A;  2FUG 2;  4ML6 A;  4MJB A;  3SBC A;  3ZRE A;  1V58 A;  1T1V A;  5ECR B;  3R2Q A;  2DJ0 A;  1M2A A;  4KUN A;  4WBJ A;  1W89 A;  2ZUP A;  1EV4 A;  2WFC A;  1EWX A;  2IL3 A;  3GKN A;  2KHP A;  3UBK A;  1A0R P;  1E2Y A;  1PA3 A;  3ERW A;  3F6D A;  3TJJ A;  3TRP A;  4K5R A;  2J9H A;  4ZB9 A;  4FO5 A;  2IJY A;  4LA1 A;  5F0G A;  2VL2 C;  1QQ2 A;  3QAV A;  3NZN A;  1AQX A;  5A4W A;  3IAM 2;  4GCI A;  3IK7 A;  4FQU A;  2HE3 A;  1A0F A;  1ERW A;  2H70 A;  4PUA A;  1X5C A;  3QFA C;  1O8X A;  4KH7 A;  3HHV A;  5D9T A;  3CMI A;  4XCS A;  3FR9 A;  1EOH A;  2WUL A;  2FWH A;  1PRX A;  5L71 A;  1U3A A;  16GS A;  5F05 A;  1TXX A;  1QFN A;  5DDL A;  2VCX A;  5J5N A;  4DSQ A;  4KCA A;  4OD7 A;  4POL A;  3CTF A;  3L9U A;  3GA4 A;  3TRX A;  4I2U A;  3IDV A;  2WJU A;  2GZY A;  2HRN A;  3PIN A;  4MJC A;  4PX1 A;  4HEA 2;  3V1W A;  2YZU A;  2JAD A;  2FGX A;  1X9W B;  3FW2 A;  4AJ8 A;  4FIW A;  5A4V A;  5BMU A;  1GTI A;  3LQ7 A;  3LSZ A;  4YQV A;  2P0G A;  2PGT A;  1K0A A;  4Z2U A;  4HS1 A;  2R6K A;  5KN3 A;  3QDN A;  2VM2 A;  2C3T A;  4KDY A;  4ZL8 A;  3A5W A;  1K3O A;  2LNT A;  1YF1 A;  3JCM L;  4F03 A;  1R4W A;  2DJJ A;  6GST A;  3G7Y A;  2LNS A;  1TI3 A;  1BYE A;  2XC2 A;  3GRX A;  5JWQ B;  4ZB8 A;  5ELA A;  5KN1 A;  5AN1 A;  3KP9 A;  1FO5 A;  5ECP B;  2FWE A;  3CRU A;  5IOX A;  5J4U A;  1T3B A;  1GLP A;  3TKR A;  4IHU A;  3A5I A;  4PTS A;  1TRW A;  2WS2 A;  4YH2 A;  1JFU A;  2CA8 A;  5C00 A;  1YY7 A;  1DE2 A;  1Q98 A;  3L9S A;  3H8Q A;  3PH9 A;  4IJ3 A;  2B5X A;  2MYG A;  1GP1 A;  2GTU A;  1X0R A;  4MJA A;  4K9Z A;  5CRG A;  3DWV A;  2L4C A;  1EOG A;  5CP1 A;  2E2M A;  2KUC A;  3US3 A;  4EXJ A;  3KM6 A;  5HR3 A;  1Z7R A;  5G5E A;  4H86 A;  5IMZ A;  4BL7 B;  3MNG A;  4NV2 A;  4K0G A;  5LD0 A;  3M1G A;  4K7I A;  3HDC A;  1UC7 A;  2V1M A;  1A8L A;  4WR5 A;  2FA8 A;  2IFQ B;  2B5E A;  2F3M A;  1UA5 A;  3WD6 A;  1ZYP A;  2WRT A;  4L5O A;  2X49 A;  19GS A;  4F9Z A;  1OKT A;  2R0P A;  1RQM A;  2VIM A;  3WGE A;  2P31 A;  2C0D A;  1VRS D;  4EDZ A;  1Z5Y E;  4OO4 A;  2PVO C;  3ME8 A;  4XRA A;  1F9M A;  1ERU A;  1NM3 A;  1NHO A;  5GST A;  2A2R A;  2DJ1 A;  1MD4 A;  3IK9 A;  1JHB A;  3P90 A;  1M2B A;  2H0I A;  4G0I A;  6GSV A;  2C80 A;  5AGY A;  5ENU A;  2GS3 A;  3FYG A;  3GTU B;  3DKS A;  1M2D A;  1Z6M A;  4FYB A;  4CY6 A;  3P8W A;  4KSM A;  2VD1 A;  2H1G A;  5IMV A;  1TW9 A;  2H66 A;  3VFI A;  3KMN A;  1AW9 A;  4TKY A;  4NAX A;  5LNK e;  1ERV A;  4KND A;  1ZCP A;  2CT6 A;  5KN2 A;  4D73 A;  4ZBD A;  3GNJ A;  2IIY A;  2R37 A;  4GST A;  1KNG A;  2GST A;  4HU9 A;  1THX A;  2CZ3 A;  3HVX A;  4I8B A;  4EE0 A;  3F3R A;  4X0X A;  5ECH B;  2OJL A;  4K2X A;  4J2F A;  2PWJ A;  3VPT A;  1B48 A;  3FK8 A;  4TR3 A;  1SK2 A;  3IC4 A;  17GS A;  1MDI A;  2IWT A;  2RM6 A;  4XS4 B;  5EVO A;  2DBC A;  1T00 A;  3BCK A;  4GLT A;  2CAQ A;  2WDU A;  1VF1 A;  2NDO A;  3APS A;  2BJX A;  1GSQ A;  4POK A;  3KCM A;  1YEP A;  4GQF A;  2YWM A;  4ISD A;  3LXT A;  4K6X A;  3FRC A;  14GS A;  3H79 A;  2GDR A;  2ON7 A;  1J9B A;  2V32 A;  3BD2 A;  5GAN D;  5IPG A;  3DXB A;  2FCH A;  1HNB A;  1DSB A;  5D9W A;  1GNW A;  1LJR A;  2HZE A;  3P7X A;  4LMV A;  4J57 E;  3CSH A;  3IV4 A;  3K8N A;  1U88 A;  1PSQ A;  4MP4 A;  5AIV A;  3OR5 A;  4RUV A;  1FOV A;  4DSS A;  3FZA A;  3F4R A;  4TOP A;  4KF9 A;  5HFK A;  5B7C A;  4O32 A;  2RUF A;  2X4A A;  4TXO A;  3LXZ A;  1JLW A;  1UN2 A;  2DML A;  2LRC A;  3H4K A;  3HD5 A;  2HSH A;  3CSJ A;  4TVE A;  4JZQ A;  2H74 A;  4J56 E;  5ABR A;  1GSD A;  3HJP A;  3FZ5 A;  1RW1 A;  4L0U A;  2GGT A;  2C3Q A;  1WJK A;  3C73 A;  2CVB A;  1XXU A;  3GL3 A;  1A24 A;  1UVZ A;  2CVD A;  5A4U A;  5DJL A;  3Q6O A;  4TR1 B;  1FG4 A;  1V9W A;  1J08 A;  1Z3E A;  1GL8 A;  1WRY A;  4KE3 A;  2XBI A;  9GSS A;  4V2M A;  5CRH A;  4LLR A;  2LRT A;  3TKS E;  2IMF A;  4WF4 A;  1G0T A;  1H75 A;  3Q19 A;  2IMD A;  1T7P B;  1XOA A;  5DAK A;  4K7N A;  1EP7 A;  3D5J A;  5E59 A;  3WYW A;  3FKF A;  2VLT A;  3GKK A;  3R3E A;  1K0C A;  2ZNM A;  5D96 A;  4ZBA A;  1TI1 A;  4MJE A;  3O3T A;  1G7O A;  5H5R A;  4JBB A;  4IKH A;  3N9J A;  1YZX A;  5EPF A;  2XHF A;  5GSS A;  1BJX A;  1QUW A;  5DCH A;  4MZC A;  4MZB A;  4YQM A;  1DE1 A;  2MMZ A;  1N8J A;  1GSS A;  1OC3 A;  3VI7 A;  2AUV A;  4IJI A;  3ZML A;  2H73 A;  3DML A;  1WMJ A;  3N5O A;  1BX9 A;  3TKS A;  3UVT A;  3I6A A;  3UAR A;  2H76 A;  1THO A;  4V1A g;  5JCU A;  5JWO B;  3ZVJ D;  2VUP A;  3DIE A;  4TXV A;  3IHG A;  4WXT A;  3FHK A;  4L8E A;  3D0Z A;  3F3Q A;  1TKD B;  1WP0 A;  1F6M C;  2EIR A;  4JRR A;  3I9V 2;  3C7M A;  2MMA A;  2HRF A;  1T8E B;  1Q4J A;  2H75 A;  2X8H A;  1LU4 A;  3QD9 A;  1K3L A;  1KBN A;  3BOA A;  1HYU A;  3H1N A;  3HCZ A;  3DEX A;  4JU5 A;  3E3E A;  2YV9 A;  4O5Q A;  4QQ7 A;  4BVX A;  4O92 A;  2PVQ A;  2HYX A;  1SEN A;  5CYY A;  4MF7 A;  3ZL5 A;  2UZ8 A;  3BCI A;  4CDO A;  3FZ9 A;  4K1F A;  1YJ6 A;  5IPH A;  3APO A;  1O6J A;  4NMU A;  2FA4 A;  3F4S A;  4EO3 A;  2K8V A;  3IOS A;  1NSW A;  4ZB6 A;  2FHE A;  4TRX A;  1G6Y A;  1B9X C;  1FHE A;  4YAV A;  1XVW A;  5CRW A;  5D9V A;  1T4Z A;  1TU8 A;  2B6M A;  3FR3 A;  4IQ1 A;  3I69 A;  3KTB A;  4JE1 A;  4N0V A;  1CQG A;  3C71 A;  2GT5 A;  5IIZ A;  4E8H A;  3GUR A;  2AV4 A;  1QMV A;  2LEG A;  1O7U A;  4F82 A;  1SYX A;  4EF0 A;  2H71 A;  3ZIT A;  2REM A;  3APQ A;  5ID2 B;  1C72 A;  4IGJ A;  1LBK A;  2JZR A;  2C0G A;  3UAP A;  2GZP A;  1ZMA A;  4FH8 A;  3TUE A;  2LV3 A;  1OYJ A;  1VF2 A;  4ZBB A;  1OC9 B;  2YPM A;  3BBY A;  3KP8 A;  5IMF A;  4ECI A;  4EIQ A;  3F0I A;  4ZL9 A;  5GZZ B;  2H6X A;  4WBR D;  4HDE A;  1ZZY A;  4BVY A;  1H4O A;  2YOI A;  13GS A;  1FVK A;  3TJG A;  2E7P A;  2R2J A;  4PUR A;  5IOW A;  2OE1 A;  1B4P A;  4KB3 A;  5EY6 A;  2VD0 A;  4WKW A;  3RAZ A;  3F6F A;  1GH2 A;  1YKC A;  5GAP D;  2QC7 A;  2H30 A;  1GNE A;  1XWC A;  5F07 A;  2HRA A;  5FWG A;  1O8W A;  4Q5F A;  2R3X A;  4L0W A;  4LL1 B;  3Q74 A;  3LJR A;  4Q5N A;  1X5D A;  2RUE A;  2CZ2 A;  3EWL A;  3QAG A;  2DJ2 A;  4XS1 A;  3O76 A;  1ZYE A;  3L4N A;  4L5L A;  2O87 A;  3KXO A;  4HQZ A;  2NTO A;  4MNN A;  5D73 A;  2V6K A;  1I5G A;  1FB6 A;  2B1K A;  3VWX A;  3WGD A;  1WWJ A;  2KP2 A;  2FLS A;  2OE3 A;  5D9X A;  4ZXG A;  4MLY A;  5IM9 A;  3RPP A;  1SL2 B;  4OWY A;  5JCW A;  1OKD A;  1IYI A;  3WT2 A;  1O81 A;  3DGQ A;  4G2E A;  1U3I A;  5B8B A;  2DMM A;  2PER A;  4GXZ A;  1SJZ A;  1NHY A;  4EKZ A;  1JZO A;  1EEM A;  2HNL A;  3ISO A;  4MH3 A;  2HZF A;  4HUA A;  1GSF A;  1XOB A;  5INY A;  3KH9 A;  5HR1 A;  1GUH A;  3DYR A;  4Q5R A;  4V2N A;  2MZC A;  3ME7 A;  1GTB A;  5IMD A;  3UMA A;  2BTO T;  4KSO A;  2VL2 A;  1TTZ A;  4JR4 A;  4USS A;  3HJO A;  4MA9 A;  2K8S A;  3GYK A;  3BJ5 A;  1SYR A;  5D8I A;  4Z7X A;  4ILF A;  3KD0 A;  5FT3 A;  1K0B A;  4FYC A;  2V6O A;  1AIU A;  4JR6 A;  1JZR A;  3FZ4 A;  1T4Y A;  5DQS A;  3ERG A;  3GIX A;  1IYH A;  1FW1 A;  4Z2R A;  1XFL A;  1K0O A;  4V1A p;  2Z9S A;  1EEJ A;  1A8Y A;  1R5A A;  1Z9H A;  2JAC A;  1GUK A;  4CHS A;  2VOC A;  1O85 A;  3ERF A;  1A23 A;  3A2X A;  2FD3 A;  1F3B A;  1PN0 A;  3U6V A;  3S9F A;  1OE7 A;  4OFN A;  2C4J A;  1A2J A;  2H6Y A;  4EIP A;  4TR1 A;  4ZIJ A;  4TW5 A;  5AIS A;  3D21 A;  5B8A A;  2B1L A;  4K2D A;  2C0F A;  5CRD A;  3HJM A;  2D2Z A;  1HNA A;  3EMX A;  4I2T A;  3IHQ A;  2LS5 A;  2E0Q A;  4KDU A;  5COH A;  3W8S A;  4MPF A;  3Q18 A;  1XW9 A;  3VPQ A;  2O7K A;  4PQI A;  1TRU A;  4QL9 A;  5IMC A;  2R0C A;  4LMW A;  1QXH A;  4PNF A;  5DAL A;  2H0H A;  4N0Z A;  1ACV A;  3J7Y b;  3HZ4 A;  3H93 A;  2P5R A;  2GQK A;  3GV1 A;  1AUC A;  5J9C A;  3GSS A;  2LST A;  1TDI A;  3M9J A;  1YQ1 A;  2JZS A;  4OFT A;  2I3Y A;  2OBI A;  1RK4 A;  1FB0 A;  2H0G A;  2GVP A;  4PQ1 A;  3TJK A;  3RBT A;  1AQW A;  2PN8 A;  1SKR B;  4YQU A;  4DVC A;  2A4V A;  4F0C A;  5HFI A;  3MYD A;  2PU9 C;  3I43 A;  3F4T A;  2LTK A;  4Z2T A;  1ST9 A;  3HKR A;  2G0F A;  2YJH A;  3CTG A;  1AC1 A;  1S3C A;  5KN0 A;  2HLS A;  1HNC A;  3ZMK A;  2LQO A;  4HZ4 A;  3MWH A;  3CBU A;  2DC5 A;  1U87 A;  1DBY A;  3NIV A;  2YCD A;  4YKF A;  2L6C A;  3RHB A;  3UEM A;  2JZT A;  1AAZ A;  4KW6 A;  5G31 A;  2R0G A;  3L9V A;  4GRF A;  1MDK A;  4FYU A;  4GQC A;  2VLV A;  5HR0 A;  3EC3 A;  5KOW A;  2C0E A;  2OA7 A;  2VL3 A;  3EE2 A;  1ABA A;  1MD3 A;  2VL9 A;  3HA9 A;  1URM A;  4KDX A;  4K8M A;  4AJ7 A;  3HXS A;  4AGS A;  4OCF A;  4HU7 A;  1W4V A;  3TRQ A;  2P5Q A;  1PKW A;  2R5G A;  2DJK A;  5JWR B;  3IA1 A;  3VWU A;  4GSN A;  2H19 A;  2DIY A;  5ECK B;  4HZ2 A;  2A2S A;  1MTC A;  1V57 A;  1AXD A;  1GSE A;  6GSU A;  3KTL A;  4NXI A;  3GH6 A;  4RI6 A;  2QSI A;  1Y6E A;  2HSM A;  5LCZ A;  3MIX A;  2X8G A;  5G5F A;  4AJ6 A;  2OAD A;  3C8E A;  2WGR A;  4GF0 A;  3TKP A;  1TU7 A;  1JZW A;  4XIH A;  2CAI A;  3M8N A;  4G10 A;  3D4T A;  2H72 A;  2H6Z A;  3QPM A;  3GKX A;  1R26 A;  4IP1 A;  1XWG A;  2DKI A;  4GTU A;  2H1B A;  2IMI A;  4ZIL A;  3TDG A;  3WGX A;  11GS A;  4K7O A;  2YV7 A;  3HY2 A;  4IW9 A;  2VCW A;  4HI7 A;  3LWA A;  5J3R A;  5JCG A;  2HSY A;  2V41 A;  5HFG A;  1U6T A;  4N11 A;  1ZOF A;  2A4H A;  1O73 A;  4HQS A;  4XRD A;  2EC4 A;  5FHI A;  3LGC A;  1GLQ A;  4MH2 A;  1VGL A;  4K0N A;  1I9D A;  4I5Q A;  3RHC A;  2N5A A;  3HZ8 A;  2EIQ A;  3KJY A;  3VUR A;  3KEB A;  1V2A A;  4Q5Q A;  3ZIV A;  4ID0 A;  5H5S A;  5DJM A;  2CX4 A;  3P2A A;  2O8V B;  4ECJ A;  3ZTL A;  4G0L A;  2YZH A;  2CX3 A;  2DKH A;  4JED A;  4K5S A;  2H1A A;  3O6T A;  3QMX A;  2LJR A;  1Z7P A;  5J41 A;  4GWR A;  4MZW A;  2AYT A;  1JLV A;  1XVQ A;  2PPT A;  2F8A A;  3MSZ A;  1SU9 A;  3VK9 A;  3ZYW A;  2K18 A;  4OCE A;  3HVV A;  4NHZ A;  3LW9 A;  5ECM B;  2I1U A;  2L5L A;  2IME A;  5G2Z A;  1GTU A;  1FVJ A;  2VO4 A;  3EU3 A;  2H01 A;  3F8U A;  1ON4 A;  2JU5 A;  4O5R A;  2TRC P;  4ML1 A;  6GSW A;  2LRN A;  4QL7 A;  1PQN A;  20GS A;  4HJ2 A;  4KA0 A;  1ZYN A;  4LL4 B;  3TOT A;  1GSY A;  3M3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...