2VOCA

Thioredoxin a active site mutants form mixed disulfide dimers that resemble enzyme-substrate reaction intermediate
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
AIVKATDQSFSAETSEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHLLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Thioredoxin A active-site mutants form mixed disulfide dimers that resemble enzyme-substrate reaction intermediates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Electron transport
total genus 29
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vocA00
3HXSA 4QL7A 3PINA 3KMNA 4Q5FA 3UAPA 2NTOA 2C1YA 1O8XA 3TKPA 1XXUA 4WBJA 2B7KA 1YKCA 4JRRA 5A4UA 4Q5NA 3D21A 2HFDA 1T4YA 2FWEA 4I2UA 5GAPD 2H1AA 4G9HA 2O8VB 4K9ZA 1F9MA 4CW9A 3TOTA 3GL5A 3DGQA 4HJMA 1F37A 3ZMLA 1M0UA 4WEYA 3D22A 3VI7A 2L4QA 2R2JA 2OE1A 1SL0B 1UC7A 4K7NA 4V2LA 3GTUA 1GH2A 4TRXA 1OKDA 4QQ7A 3FZ5A 3FZAA 4YQMA 4AJ6A 3NIVA 3TCOA 3UARA 5IO2A 3GNJA 2LNTA 2JSZA 2X8CA 4PGTA 2MMAA 4FH8A 3QAVA 2H6ZA 2H6XA 4QL9A 2B6MA 3LSZA 3RDWA 1Y25A 4O92A 2TIRA 2YNXA 4XS4B 2DMMA 4K1FA 1TJDA 4ZBBA 3HVVA 5E59A 4BWSA 2IMKA 1X5DA 4X43A 3WYWA 1T7PB 4X1UA 1O6JA 2YWMA 2P0GA 3DWVA 13GSA 2FWHA 2EIRA 3KH7A 3WT2A 5IMFA 2KOKA 3SBCA 3F4SA 4L8EA 2FWGA 5AN1A 1PA3A 6GSSA 4MH2A 3TKRA 5ECRB 1A24A 4MF6A 4E8HA 4MA9A 4MZCA 2OACA 4D73B 1X0RA 4MK3A 4JR4A 3A5WA 3J7Yk 2PMTA 3K8NA 3UVHA 3ZLPA 3ZVJA 2WDUA 3BJ5A 4MCUA 1B4PA 1K3OA 3JCML 1QFNA 2PVOC 3Q18A 3ZMKA 1WRYA 3M1GA 2JZSA 2V2GA 1BJXA 4TXOA 4IJIA 3KM6A 4ZBAA 1VF4A 3HHVA 2N5FA 5DQYA 3VK9A 1EV4A 3CRUA 2A2SA 1QGVA 2DJ0A 1M9BA 2NVLA 1XFLA 4XRDA 1V58A 1X9SB 3CSHA 4OMVA 2J23A 5J41A 5CRDA 2R6KA 2HRNA 3QMXA 1GSEA 4KE3A 1MEKA 5J5NA 3E0UA 3HKRA 1I9DA 1A2JA 1TXXA 1EWXA 2CZ2A 2O85A 3EMPA 2F8FA 1GUKA 1GTAA 1YY7A 2LUSA 1THOA 3H79A 3N9JA 4NV5A 2KHPA 2B1KA 2AUVA 4ZXGA 2FCHA 3ZREA 4HQZA 4OFNA 3ZITA 2K9FA 3V1WA 4V2MA 3O3TA 4F0BA 1U87A 2HI7A 4LA1A 2PGTA 3HJPA 2PBJA 3TJJA 2HZEB 3US3A 2ZCTA 4HOJA 4WETA 1AQWA 3DIEA 1B9YC 1JHBA 2LKUA 1YKAA 5G1LA 1UA5A 3IV4A 2M46A 1EEMA 4Q5RA 1F3AA 2GZPA 5HFKA 2L4CA 1E6BA 4JZQA 2LQQA 1ACVA 3C1RA 2CVDA 1HNBA 3GUSA 1BX9A 1TK5B 3LXZA 1EOGA 2C0EA 6GSXA 2YZUA 2GQLA 4NHWA 3GKMA 4V2NA 3KEBA 3QFBC 3H4KA 5B8AA 2H70A 3VWXA 2AHEA 3HD5A 3PH9A 2K18A 4HZ4A 1S3DA 3KJYA 3VPTA 2B3SA 2VD1A 2DJKA 2JACA 3GN3A 4RUVA 4OO4A 2QC7A 1SKSB 4XS4A 5ELAA 2VO4A 1SKRB 2GLRA 3MNGA 4MJAA 4PUAA 5IPHA 4EXJA 4KDYA 4ZBDA 2YCDA 1Z3EA 5DALB 2B7JA 3CTGA 4MZWA 3KP9A 2FNOA 3F6DA 1TKDB 4I97A 3VWVA 4GQFA 1SKWB 4KW6A 1XOAA 2CV4A 2HXKA 3QAWA 4I5QA 3RPPA 1A8LA 2X8GA 4ZL8A 1X5EA 5DVBA 3Q19A 1XOBA 2AAWA 1U3AA 3ZYWA 3TJGA 4K6XA 4D73A 3TB2A 4HU9A 1JLVA 3KTLA 3L78A 1TI3A 2DC5A 1PMTA 3IA1A 2E0QA 2DJ2A 2DIZA 1YF1A 1FOVA 2CX3A 1GWCA 1GSDA 1WJKA 5C00A 3HJMA 5JCGA 3IXRA 2F51A 1GLPA 2AB6A 5A4VA 2VM1A 3C73A 1PN9A 2YPMA 3LYPA 3EVIA 3GV1A 2GSRA 1V98A 4F03A 1BQ7A 4DSQA 4EDYA 2CT6A 4HI7A 3UOMA 2D2ZA 2K6VA 5CO3A 3I6AA 1OKTA 2VCXA 3MAKA 5F0GA 3APOA 5ECNB 3G7IA 1AW9A 3LWAA 1Z7PA 1J08A 1B4QA 4EKZA 5AGYA 2LEGA 1IYHA 1NSWA 3UJ1A 4J2FA 5CNWA 1V57A 5D9XA 5EY6A 2IMEA 3QOUA 4N0ZA 2OADA 5DJMA 3ZVJD 1TTZA 5A5KA 1OC3A 5HFIA 2YJ7A 1VGLA 1UVZA 5JCUA 1PGTA 2YN1A 1J9BA 3TJFA 4ULXA 1GSFA 1NHYA 1WIKA 3UBLA 1A8YA 3M9JA 5J3RA 3ZZXA 2P5RA 4KB3A 3CXGA 4EL1A 5ECHB 1N8JA 4TXOB 1CQGA 4DEJA 1KEBA 3QD9A 4HEA2 3DVXA 3LQ7A 1Z6MA 1T4ZA 2PVQA 2R5GA 3CBUA 2YP6A 2M80A 2KP2A 3HZ4A 2OKAA 1GSYA 2PERA 2ON7A 1V40A 2XC2A 4GWRA 1SD8A 2DJ3A 2AV4A 2WRTA 4YQVA 4IVFA 3A2VA 4MLYA 3E3EA 1YQ1A 3U5RE 2GSTA 2XBQA 1UN2A 2FLSA 4K7IA 4OFMA 2CAQA 4K8MA 2GT5A 1Z9HA 1K0NA 5GAND 2IL3A 4IN0A 4GXZA 1M9AA 4ECBA 3HJOA 4NHZA 5IQYA 2WFCA 3FYGA 2BMXA 1EZKA 4OFTA 1DSBA 1KBNA 1QQ2A 1S3AA 3MSZA 2AYTA 3DD3A 1PKZA 2G0FA 2LTKA 1V9WA 1MDJA 4CDOA 2DJJA 2LJKA 2O87A 4TR4A 5DALA 2L5OA 2LRCA 2FWFA 2VOCA 2JU5A 5G31A 1XW5A 2LJRA 2JADA 1ILOA 4KA0A 1GLQA 5B7CA 2HLSA 2PWJA 3ERFA 3A2WA 2HSHA 3TUEA 2C0DA 2TRCP 1GTIA 3L9UA 4DSRA 1GUHA 2WCIA 2H66A 1V2AA 2KUCA 1X9WB 3F63A 4GSSA 5ECIB 2H19A 5B6NA 4ILFA 3F8UA 1C72A 1FVKA 1Z6NA 4FYUA 3IAM2 1HD2A 3F9UA 5J9BA 3D6IA 3QDNA 1TU7A 4BPYA 3IAS2 4NXIA 3RAZA 3UVTA 1GNEA 2YWOA 2VD0A 2DIYA 3A3TA 2ALBA 4I6XA 3M9KA 4G19A 1EGRA 4RQXA 4NPBA 2V1MA 3M8NA 5IMAA 2LQOA 2BTOT 1TRUA 4L0UA 4L0WA 1WPIA 1VF2A 2WB9A 5F8BA 2YANA 1U88A 6GSUA 3GHAA 5LD0A 3UEMA 4MMMA 3W8SA 4POKA 2GTUA 4ID0A 1SK1A 5KN3A 5FWGA 3C7MA 2VCWA 1TDIA 2X64A 1SJZA 5ECOB 9GSSA 1TRVA 5DBQA 3VURA 1TW9A 1B9XC 2C8UA 1XWCA 5D96A 2H30A 2OBKA 3QAGA 3TOUA 2PPTA 5A4WA 3SWLA 3RHCA 1LU4A 1OVNA 3DYRA 3L9VA 3EC3A 4TR1B 4XS6A 3H93A 3KZQA 4PNGA 2HNLA 4ECJA 5G2ZA 3D4TA 1MD3A 5DQSA 5IOXA 5D8IA 1ABAA 4MJBA 2GQMA 4I8BA 2V6KA 2DLXA 3A2XA 4E8EA 2NPBA 2C80A 1M7TA 3GSSA 2R3XA 3ZTLA 1RQMA 2LNSA 4IS0A 4EVMA 2IMDA 3TJKA 1R26A 4Q5QA 3TJBA 6GSYA 1ZCPA 3EURA 1TK8B 1Z7RA 1ERTA 2RUEA 4MABA 2C0GA 3TRPA 2RIIA 5KN1A 1GL8A 3RBTA 3G7YA 1HYUA 1Q98A 1AIUA 4OO5A 3F6FA 4BVXA 1AAZA 5LNKe 3J7Yb 2JSYA 2C4JA 1THXA 4WF4A 4J57E 4KNDA 5G1KA 3F4TA 4OCEA 1TI1A 1O73A 3IE3A 3DEXA 1O7UA 2OE3A 4TN8A 2IIYA 1GTUA 5G5FA 4EUYA 3I9V2 4XRAA 3DRNA 3FKFA 1X9MB 2IN3A 2H6YA 2L6DA 2HT9A 2XPDA 4LL4B 2L59A 1AXDA 2H01A 3KIJA 1G6YA 2H0GA 3NZNA 1XW9A 2FA8A 2H75A 4NMUA 4ZB8A 3LGCA 4F82A 2RLIA 5CRGA 3W6GA 6GSWA 5EPFA 4MP4A 4GCIA 1HNAA 1GNWA 5ENUA 1XWGA 3PR8A 4PNFA 1U3IA 6GSVA 2GQKA 4IP1A 3QR6A 1SYRA 3WD6A 1JLWA 2H1DA 5JWOB 5C04A 4DVCA 5H5SA 3FY7A 1J0FA 4HDEA 1VF1A 4PX1A 5G30A 3CMIA 3FR6A 4RQRA 2EIOA 4XIHA 2I4AA 5ABRA 5D9VA 2MYGA 1G7OA 1W4VA 3LORA 4POMA 4BVYA 2I9HA 5IMZA 1TU8A 2IPAA 5ECQB 5DAKA 1EP7A 3GRXA 3GKKA 4GF0A 1OC8A 1ERWA 1XWAA 3KCMA 5CP1A 3TKSA 1PKWA 1NHOA 5HR2A 2E2MA 2H1GA 2QGVA 4BL7A 4X0XA 1ZZYA 3I43A 4NV2A 3CYNA 4WXTA 3IK9A 1GP1A 4GTUA 2MBTA 5ECKB 3M0FA 1XWKA 2VM2A 1O85A 1WP0A 2C3TA 2IJYA 4FIWA 1ON4A 2H71A 5HR3A 1GRXA 3S9FA 3VWWA 1A2MA 4MPGA 4PQIA 2P5QA 4TR1A 1E2YA 3G9BA 4XTSA 4YAPA 1W89A 4WKWA 3TKQA 2MMNA 4ZIJA 2REMA 2FY6A 2F9SA 2K8VA 5D73A 4IW9A 5CAXA 1T00A 1F6MC 1QUWA 2YZHA 4TW5A 5D9WA 1MTCA 4EE0A 5EVOA 3FW2A 4HS1A 3F0IA 2VL3A 4PURA 2FUG2 1JZWA 2CA8A 4IP6A 5IMCA 1XBSA 3O76A 2OJLA 2RUFA 1YDKA 2GDRA 1GULA 4WR4A 3FEUA 4GQCA 2MMOA 3U6VA 5D93A 2N5BA 2WULA 3CSJA 1SENA 2NDOA 3C1SA 3GH6A 1H75A 1AUCA 2H8LA 2RM6A 4RI6A 5ID2B 2H1BA 4ZILA 10GSA 1ST9A 1AC1A 3KXOA 2P31A 3ISOA 5H5RA 1F3BA 1DE2A 3EU4A 4KGIA 3GL3A 3TDGA 3ED3A 4MDCA 3AY8A 1HNCA 5ECMB 2RM5A 2YWIA 1K0AA 4TKYA 5INYA 2FA4A 1VRSD 2HZFA 19GSA 3P90A 1M2DA 4J56E 3F3RA 1WOUA 3LJRA 1FHEA 1WE0A 1A0RP 4EDZA 4HQSA 1TRWA 12GSA 1ML6A 2NBSA 2EIQA 4IJ3A 4MJCA 2X99A 3ZFBA 1ZGNA 4EO3A 1OC9A 1FVJA 1ZMAA 2B1LA 2I81A 4LMWA 4IKHA 2CX4A 3HZ8A 3P8WA 4G2EA 4K7OA 2YOIA 1K0MA 2V41A 2F3MA 2GT6A 1FO5A 3L4NA 3OR5A 5GSSA 4MF5A 18GSA 2B5YA 3P2AA 2VAFA 2VLUA 1FAAA 2B5EA 4ML1A 2VCZA 1BYEA 1Q4JA 3UL3A 1JZRA 1FW1A 3HVSA 4XS1A 3I69A 4L5LA 1MD4A 4V1Ap 1MDIA 4HUAA 3HY2A 4WR5A 3D4MA 2O89A 2MZCA 1HQOA 1XCCA 4MZBA 1M2AA 2VCTA 1EOHA 3L0HA 3DKSA 5LCZA 3ZIVA 3O6TA 4XHMA 3EYTA 3NOFA 4MF7A 3GKXA 5ECLB 3VWUA 2R4VA 2JZRA 3GIXA 1XIYA 7GSSA 5E4WA 1N2AA 3BCKA 3L9SA 4GLTA 2CQ9A 5CRWA 4ACSA 4CHSA 1O81A 2ZNMA 1KNGA 1CQHA 5CRHA 1G7EA 4ZL7A 4POLA 1OE8A 1BAYA 1ZOFA 4AJ7A 2FD3A 4O32A 3WT1A 2L57A 4BWQA 1SYXA 2H73A 4NWYA 1R4WA 1O8WA 2K8SA 3PGTA 4GSNA 5JWQB 1YF0A 4PQHA 2VLTA 5F07A 2PU9C 4DSSB 3EINA 3EWLA 5F05A 1ZYQB 4ZL9A 5DAKB 4KDXA 1H4OA 2R37A 5IOWA 1U6TA 2XBIA 1XWBA 4F2IA 14GSA 4HU7A 5DJLA 16GSA 4KCAA 3IR4A 3KP8A 3LG6A 2TRXA 1YEPA 3H8QA 4N0VA 1PD21 2HSYA 3VLNA 1G6WA 4XCSA 1K0DA 1DUGA 1PL2A 2CAIA 4IHUA 5ID2A 3GMFA 5B8BA 2HE3A 3CTFA 1IYIA 2H0IA 3VPQA 22GSA 4N30A 1FG4A 3APQA 4N11A 2VIMA 1USBA 3TRQA 2DSAA 2WJUA 5AISA 2ON5A 4KH7A 4P3YB 4LMVA 3N5OA 3UIWA 1QXHA 2GZZA 3IOSA 3VFIA 3FHKA 3KTBA 1R5AA 2C0FA 3GKNA 4JBBA 3BOAA 1AQXA 3MWHA 2WS2A 4POBA 2XHFA 5IIZA 1TOFA 5EL8A 4FYCA 1LJRA 1S3CA 1WWJA 1T1VA 5GSTA 4PUFC 3ME7A 5CYYA 1QK8A 3KH9A 3KMOA 4FYBA 3ZIJA 2V32A 3E9JB 5J4UA 1EV9A 1RW1A 2VUPA 1GSQA 2GSQA 3KD0A 3GH9A 3Q6OA 5HQPA 5FHIA 3FZ9A 2WZ9A 1XPVA 2WGRA 3C8EA 3D0ZA 5HR1A 1WMJA 5ECPB 4KSOA 3C71A 1ERUA 1URMA 2A2RA 1EGOA 2F8AA 2L6CA 3VI5A 3ZL5A 1JZOA 3WGDA 1I5GA 3IHQA 2ZUPA 2DJ1A 1A0FA 2A4VA 2C3QA 3HYPA 4IBPA 4K2DA 1XVWA 2OE0A 4MPFA 3TKSC 4FO5A 2YJHA 3QCPA 1KTEA 4LL1B 3HCZA 2CVKA 2IWTA 1MDKA 5D9TA 4NAXA 4ECIA 5KN2A 1PL1A 2E2GA 5F06A 3LXTA 5J9CA 1PQNA 2IFQB 2VL2C 3BD2A 2HRFA 3EMXA 4IGJA 3W8JA 1SK2A 1JZDA 4KDUA 4TR3A 2PN8A 3Q74A 4OD7A 4AJ8A 3KGKA 2QSIA 1XW6A 1SL1B 3DXBA 3D5JA 2H0HA 2J9HA 1PX7A 1ERVA 1OC9B 17GSA 4BA7A 3IDVA 1SU9A 3CSIA 4V1Ag 2GZYA 4TXVA 1SD9A 3DVWA 3IBHA 3G7JA 4YAVA 1YJ6A 3HVXA 5KEJA 3M3MA 1M2BA 3FRCA 3GX0A 3TRXA 3ERGA 4KX4A 1LBKA 3TGZA 2YV7A 2IMFA 5HR0A 1GUMA 1JFUA 3FR9A 3HDCA 4DSSA 3APSA 4TVEA 2OBIA 4JU5A 4IQ1A 5ECSA 2CZ3A 3QFAC 4GSTA 4LLRA 2VCQA 2H74A 2ES7A 1EP8A 2VL9A 1FB0A 3RHBA 1DE1A 3H1NA 5COHA 2EC4A 4KUNA 5B6MA 1Y6EA 4KSMA 1R7HA 1BG5A 4AGSA 2VLVA 1GSUA 1PRXA 5IM9A 3IRAA 2AJQB 1DBYA 1X5CA 1SJIA 3ME8A 2VL2A 5JWRB 1VF3A 2V6OA 2MMZA 3MDKA 1K0BA 1A2LA 2Z9SA 3TKSE 2YV9A 3QPMA 11GSA 2M72A 4MH3A 1PSQA 2C3NA 4N10A 2QKEA 5CREA 1YZXA 2GGTA 4YH2A 5ELGA 4EC0A 2DMLA 4HJ2A 1Z5YE 2X8HA 3IPZA 2CVBA 5DDLA 1EEJA 3ZRDA 4WBRD 4OCFA 2JL4A 2I1UA 5H5QA 1GSSA 2GVPA 4ECCA 4PXOA 2LRNA 2OA7A 1B48A 5JCWA 2I3YA 4OWYA 5IMDA 1F2EA 3GTUB 3GYKA 1TRSA 2GS3A 2FGXA 3CRTA 3IC4A 3P7XA 1M99A 3GSTA 1K3LA 2O7KA 5DCHA 5KN0A 3F3QA 2G2QA 1BEDA 1YEXA 5G5EA 4KAEA 20GSA 4F9ZA 3LYKA 1T3BA 3WGXA 1OYJA 4IQAA 4K0NA 2XPEA 1SK0A 4O5RA 1GTBA 3FZ4A 1TK0B 5IMVA 5DCGA 1K0CA 2DBCA 5HFGA 1T8EB 1K0OA 4AF2A 1QMVA 2JZTA 1SL2B 2L5LA 3EE2A 4HZ2A 4L5OA 4H86A 6GSTA 2PUKC 3FK8A 2IFQA 3LFLA 2BJXA 3BBYA 1K3YA 5L71A 4WF5A 1A23A 4IELA 2LSTA 1NM3A 2GSSA 4GRFA 2LJAA 3GURA 2B5XA 2VCVA 4KCEA 4I2TA 5FT3A 3EU3A 4ISDA 2YWNA 4O7HA 4TR0A 3GA4A 2HZEA 2LRTA 5AIVA 3WGEA 1FB6A 3GFKA 1TP9A 3UBKA 1ZL9A 3IK7A 4TOPA 2KP1A 1XVQA 2LS5A 3RPNA 4YQUA 4G10A 4ML6A 2E7PA 2KLXA 1NW2A 1XZOA 4F0CA 4JE1A 1RK4A 4EF0A 4Z7XA 4MJEA 1B8XA 2MBSA 2HYXA 3BCIA 2FHEA 4ZB6A 3R2QA 4JR6A 3ZFLA 5AIXA 3F4RA 1ZYEA 5IPGA 2H72A 1SJ6A 4K0GA 3DMLA 3HA9A 8GSSA 1OE7A 1OAZA 2LV3A 5IO0A 3LEFA 3FR3A 1R5PA 4RI7A 2N5AA 3UMAA 5GZZB 3GX8A 2IMIA 3ERWA 1PX6A 4PQ1A 1G0TA 1AQVA 4ZB9A 4JEDA 2H76A
chains in the Genus database with same CATH superfamily
3HXSA 4QL7A 3PINA 3KMNA 4Q5FA 3UAPA 2NTOA 2C1YA 1O8XA 2UZ8A 3TKPA 1XXUA 4WBJA 2B7KA 1YKCA 4JRRA 5A4UA 4Q5NA 3D21A 2HFDA 1T4YA 2FWEA 4I2UA 5GAPD 2H1AA 4G9HA 2O8VB 4K9ZA 1F9MA 4CW9A 3TOTA 3GL5A 3DGQA 4HJMA 1F37A 3ZMLA 1M0UA 4WEYA 3D22A 3VI7A 2L4QA 2R2JA 2OE1A 1SL0B 1UC7A 4K7NA 4V2LA 3GTUA 1GH2A 4TRXA 1OKDA 4QQ7A 3FZ5A 3FZAA 4YQMA 4K5SA 4AJ6A 3NIVA 4A5PA 3TCOA 3UARA 5IO2A 3GNJA 2LNTA 2JSZA 2X8CA 4PGTA 2MMAA 4FH8A 3QAVA 2H6ZA 2H6XA 4QL9A 2B6MA 3LSZA 3RDWA 1Y25A 4O92A 2TIRA 2YNXA 4XS4B 2DMMA 4K1FA 1TJDA 4ZBBA 3HVVA 5E59A 4BWSA 2IMKA 1X5DA 4X43A 3WYWA 1T7PB 4X1UA 1O6JA 2YWMA 2P0GA 1M3IA 3DWVA 13GSA 2FWHA 2X4AA 2EIRA 3KH7A 3WT2A 5IMFA 2KOKA 3SBCA 3F4SA 4L8EA 2FWGA 5AN1A 1PA3A 6GSSA 4MH2A 3TKRA 5ECRB 1A24A 4MF6A 4E8HA 4MA9A 4MZCA 2OACA 4D73B 1X0RA 4MK3A 4JR4A 4ICYA 5BRTA 3A5WA 3J7Yk 2PMTA 3K8NA 3UVHA 3ZLPA 3ZVJA 2WDUA 3BJ5A 4MCUA 1B4PA 1K3OA 3JCML 1QFNA 2PVOC 3A5IA 4USSA 3Q18A 3ZMKA 1WRYA 3M1GA 2JZSA 2V2GA 1BJXA 4TXOA 4IJIA 3KM6A 4ZBAA 1VF4A 3HHVA 2N5FA 5DQYA 3VK9A 1EV4A 3CRUA 2A2SA 1QGVA 2DJ0A 1M9BA 2NVLA 1XFLA 4XRDA 1V58A 2QA2A 1X9SB 3CSHA 4OMVA 2J23A 5J41A 5CRDA 2R6KA 2HRNA 2HRKA 3QMXA 1GSEA 4KE3A 1MEKA 5J5NA 3E0UA 3HKRA 1I9DA 1A2JA 1TXXA 1EWXA 2CZ2A 2O85A 3EMPA 2F8FA 1GUKA 1GTAA 1YY7A 2LUSA 1THOA 3H79A 3N9JA 4NV5A 2KHPA 2B1KA 2AUVA 4ZXGA 2FCHA 3ZREA 4HQZA 4OFNA 3ZITA 2K9FA 3V1WA 4V2MA 3O3TA 4F0BA 1U87A 2HI7A 4LA1A 2PGTA 3HJPA 2PBJA 3TJJA 2HZEB 3US3A 2ZCTA 4HOJA 3FMWA 3IC8A 4WETA 1AQWA 3DIEA 1B9YC 4K2XA 1JHBA 2LKUA 1YKAA 5G1LA 1UA5A 3IV4A 2M46A 1EEMA 4Q5RA 1F3AA 2GZPA 5HFKA 2L4CA 1E6BA 4JZQA 2LQQA 1ACVA 3C1RA 2CVDA 1HNBA 3GUSA 1BX9A 1TK5B 3LXZA 1EOGA 2C0EA 6GSXA 2YZUA 2GQLA 4NHWA 3GKMA 4V2NA 3KEBA 3QFBC 3H4KA 5B8AA 2H70A 3VWXA 2AHEA 3HD5A 3PH9A 2K18A 4HZ4A 4Z2TA 1S3DA 3KJYA 3VPTA 2B3SA 2VD1A 2DJKA 3LW9A 2JACA 3GN3A 4RUVA 4OO4A 2QC7A 4CY6A 1SKSB 4XS4A 5ELAA 2VO4A 1PFOA 1SKRB 2GLRA 3MNGA 4MJAA 4PUAA 5IPHA 4EXJA 4KDYA 4ZBDA 2YCDA 1Z3EA 5DALB 2B7JA 3CTGA 2DKIA 4MZWA 3KP9A 2FNOA 3F6DA 1TKDB 4I97A 3VWVA 4GQFA 1SKWB 1S3RA 4KW6A 1XOAA 2CV4A 2HXKA 4YKGA 3QAWA 4I5QA 3RPPA 1A8LA 2X8GA 4ZL8A 1X5EA 5DVBA 3Q19A 1XOBA 2AAWA 1U3AA 3HVNA 3ZYWA 3TJGA 4K6XA 4D73A 3TB2A 4HU9A 1JLVA 3KTLA 3L78A 1TI3A 2DC5A 1PMTA 3IA1A 2E0QA 2DJ2A 2DIZA 1YF1A 1FOVA 2CX3A 1GWCA 1GSDA 1WJKA 5C00A 3HJMA 5JCGA 3IXRA 2F51A 1GLPA 2AB6A 5A4VA 2VM1A 3C73A 1PN9A 2YPMA 3LYPA 3EVIA 3GV1A 2GSRA 1V98A 4F03A 1BQ7A 4DSQA 4EDYA 4G0LA 2CT6A 4HI7A 3UOMA 2D2ZA 2K6VA 5CO3A 3I6AA 1OKTA 2VCXA 3MAKA 5F0GA 3APOA 5ECNB 3G7IA 1AW9A 3LWAA 1Z7PA 1J08A 1B4QA 4EKZA 5AGYA 2LEGA 1IYHA 1NSWA 3UJ1A 4J2FA 5CNWA 4HSCX 1V57A 5D9XA 5EY6A 2IMEA 3QOUA 4N0ZA 2OADA 5DJMA 3ZVJD 1TTZA 5A5KA 1OC3A 5HFIA 2YJ7A 1VGLA 1UVZA 5JCUA 1PGTA 2YN1A 1J9BA 3TJFA 4ULXA 1GSFA 1NHYA 1WIKA 3UBLA 1A8YA 3M9JA 5J3RA 3ZZXA 2P5RA 4KB3A 3CXGA 4EL1A 5ECHB 1N8JA 4TXOB 1CQGA 4DEJA 1KEBA 3QD9A 4HEA2 3DVXA 3LQ7A 1Z6MA 1T4ZA 2PVQA 2R5GA 3CBUA 2YP6A 2M80A 2KP2A 3HZ4A 2OKAA 1GSYA 2PERA 2ON7A 1V40A 2XC2A 4GWRA 1SD8A 2DJ3A 2AV4A 2WRTA 4YQVA 4IVFA 4BVXB 3A2VA 4MLYA 3E3EA 1YQ1A 3U5RE 2GSTA 2XBQA 1UN2A 2FLSA 4K7IA 4OFMA 2CAQA 4K8MA 2GT5A 1Z9HA 1K0NA 5GAND 2IL3A 4IN0A 4GXZA 1M9AA 4ECBA 3HJOA 4NHZA 5IQYA 2WFCA 3FYGA 2BMXA 1EZKA 4OFTA 1DSBA 3IHGA 1KBNA 1QQ2A 1S3AA 3MSZA 2AYTA 3DD3A 1PKZA 2G0FA 2LTKA 1V9WA 1MDJA 4CDOA 2DJJA 2LJKA 2O87A 4TR4A 5DALA 2L5OA 2LRCA 2FWFA 2VOCA 2JU5A 5G31A 1XW5A 2LJRA 2JADA 1ILOA 4KA0A 1GLQA 5B7CA 2HLSA 2PWJA 3ERFA 3A2WA 2HSHA 3TUEA 3MYDA 2C0DA 2TRCP 1GTIA 3L9UA 4DSRA 1GUHA 2WCIA 2H66A 1V2AA 2KUCA 1X9WB 3F63A 4GSSA 5ECIB 2H19A 5B6NA 4ILFA 3F8UA 1C72A 1FVKA 1Z6NA 4FYUA 3IAM2 1HD2A 3F9UA 5J9BA 3D6IA 3QDNA 1TU7A 4BPYA 3IAS2 4NXIA 3RAZA 3UVTA 1GNEA 2YWOA 2VD0A 2DIYA 3A3TA 2ALBA 4I6XA 3M9KA 4G19A 4X4JA 1EGRA 4RQXA 4NPBA 2V1MA 3M8NA 5IMAA 2LQOA 2BTOT 1TRUA 4L0UA 4L0WA 1WPIA 1VF2A 4BL7B 2WB9A 5F8BA 2YANA 1U88A 6GSUA 3GHAA 5LD0A 3UEMA 4MMMA 3W8SA 4POKA 2GTUA 4ID0A 1SK1A 5KN3A 5FWGA 3C7MA 2VCWA 1TDIA 2X64A 1SJZA 5ECOB 9GSSA 1TRVA 5DBQA 3VURA 1TW9A 1B9XC 2C8UA 1XWCA 5D96A 2H30A 2OBKA 5BMUA 3QAGA 3TOUA 2PPTA 5A4WA 3SWLA 3RHCA 1LU4A 1OVNA 3DYRA 3L9VA 3EC3A 4TR1B 4XS6A 3H93A 3KZQA 4PNGA 2HNLA 4ECJA 5G2ZA 3D4TA 1MD3A 5DQSA 5IOXA 5D8IA 1ABAA 4MJBA 2GQMA 4I8BA 2V6KA 2DLXA 3A2XA 4E8EA 2NPBA 2C80A 1M7TA 3GSSA 2R3XA 3ZTLA 1RQMA 2LNSA 4IS0A 4EVMA 2IMDA 3TJKA 1R26A 4Q5QA 3TJBA 6GSYA 1ZCPA 3EURA 1TK8B 1Z7RA 2R0PA 1ERTA 2RUEA 4MABA 2C0GA 3TRPA 2RIIA 5KN1A 1GL8A 3RBTA 3G7YA 1HYUA 1Q98A 1AIUA 4OO5A 4EIQA 3F6FA 4BVXA 1AAZA 5LNKe 3J7Yb 2JSYA 2C4JA 1THXA 4WF4A 4J57E 4KNDA 5G1KA 3F4TA 4OCEA 1TI1A 1O73A 3IE3A 3DEXA 1O7UA 2OE3A 4TN8A 2IIYA 1GTUA 4G0KA 5G5FA 2X49A 4EUYA 3I9V2 4XRAA 3DRNA 3FKFA 1X9MB 2IN3A 4G0IA 2H6YA 2L6DA 2HT9A 2XPDA 4LL4B 2L59A 1AXDA 2H01A 3KIJA 1G6YA 2H0GA 3NZNA 1XW9A 2FA8A 2H75A 4NMUA 4ZB8A 3LGCA 4F82A 2RLIA 5CRGA 3W6GA 6GSWA 5EPFA 4MP4A 4GCIA 1HNAA 3CQFA 1GNWA 5ENUA 1XWGA 3PR8A 4PNFA 1U3IA 6GSVA 2GQKA 4IP1A 3QR6A 1SYRA 3WD6A 1JLWA 2H1DA 5JWOB 5C04A 4DVCA 5H5SA 3FY7A 1J0FA 1PN0A 4HDEA 1VF1A 4PX1A 5G30A 3CMIA 3FR6A 4RQRA 2EIOA 4XIHA 2I4AA 5ABRA 5D9VA 2MYGA 1G7OA 1W4VA 3LORA 4POMA 4BVYA 2I9HA 5IMZA 1TU8A 2IPAA 5ECQB 5DAKA 1EP7A 3GRXA 1M3JA 3GKKA 4GF0A 1OC8A 1ERWA 1XWAA 3KCMA 5CP1A 3TKSA 1PKWA 1NHOA 5HR2A 2E2MA 2H1GA 2QGVA 4BL7A 4X0XA 1ZZYA 3I43A 4NV2A 3CYNA 4WXTA 3IK9A 1GP1A 4GTUA 2MBTA 3PPUA 5ECKB 3M0FA 1XWKA 2DKHA 2VM2A 1O85A 1WP0A 2C3TA 2IJYA 4FIWA 1ON4A 2H71A 5HR3A 1GRXA 3S9FA 3VWWA 1A2MA 4O5QA 4MPGA 4PQIA 2P5QA 4TR1A 1E2YA 2A4HA 3G9BA 4XTSA 4YAPA 1W89A 4WKWA 3TKQA 2MMNA 4ZIJA 2REMA 2FY6A 2F9SA 2K8VA 5D73A 4IW9A 5CAXA 1T00A 1F6MC 1QUWA 2YZHA 4TW5A 5D9WA 1MTCA 4EE0A 5EVOA 3FW2A 4HS1A 3F0IA 2VL3A 4PURA 2FUG2 1JZWA 2CA8A 4IP6A 5IMCA 1XBSA 3O76A 2OJLA 2RUFA 1YDKA 2GDRA 1GULA 4WR4A 3FEUA 4GQCA 2MMOA 3U6VA 5D93A 2N5BA 2WULA 3CSJA 1SENA 2NDOA 3C1SA 3GH6A 1H75A 1AUCA 2H8LA 2RM6A 4RI6A 5ID2B 2H1BA 4ZILA 10GSA 1ST9A 1AC1A 3KXOA 2P31A 3ISOA 5H5RA 1F3BA 1DE2A 3EU4A 4KGIA 3GL3A 3TDGA 3ED3A 4MDCA 3AY8A 1HNCA 5ECMB 4FQUA 2RM5A 2YWIA 1K0AA 4K5RA 4TKYA 5INYA 2FA4A 1VRSD 2HZFA 19GSA 3P90A 1M2DA 4J56E 3F3RA 1WOUA 3LJRA 1FHEA 1WE0A 1A0RP 2R0GA 4EDZA 4HQSA 1TRWA 12GSA 1ML6A 2NBSA 2EIQA 4IJ3A 4MJCA 2X99A 3ZFBA 1ZGNA 4EO3A 1OC9A 1FVJA 1ZMAA 2B1LA 2I81A 4LMWA 4IKHA 2CX4A 3HZ8A 3P8WA 4G2EA 4K7OA 2YOIA 1K0MA 2V41A 2F3MA 2GT6A 1FO5A 3L4NA 3OR5A 5GSSA 4MF5A 18GSA 2B5YA 3P2AA 2VAFA 2VLUA 1FAAA 2B5EA 4ML1A 2VCZA 1BYEA 1Q4JA 3UL3A 1JZRA 4O5UA 1FW1A 4BIKA 3HVSA 4XS1A 3I69A 4L5LA 1MD4A 4V1Ap 1MDIA 4HUAA 3HY2A 4WR5A 3D4MA 2O89A 2MZCA 1HQOA 5KOWA 1XCCA 4MZBA 1M2AA 2VCTA 1EOHA 3L0HA 3DKSA 1ZYPA 5LCZA 3ZIVA 3O6TA 4XHMA 3EYTA 3NOFA 4MF7A 3GKXA 5ECLB 3VWUA 2R4VA 2JZRA 3EPTA 3GIXA 1XIYA 7GSSA 5E4WA 1N2AA 3BCKA 3L9SA 4GLTA 2CQ9A 5CRWA 4ACSA 4CHSA 1O81A 2ZNMA 1KNGA 1CQHA 5CRHA 1G7EA 4ZL7A 4POLA 1OE8A 1BAYA 1ZOFA 4AJ7A 2FD3A 4O32A 3WT1A 2L57A 4BWQA 1SYXA 2H73A 4NWYA 1R4WA 1O8WA 2K8SA 3PGTA 3R3EA 4GSNA 5JWQB 1YF0A 4PQHA 2VLTA 5F07A 2PU9C 4DSSB 4BVYB 3EINA 3EWLA 5F05A 1ZYQB 4ZL9A 5DAKB 4KDXA 1H4OA 2R37A 5IOWA 1U6TA 2XBIA 1XWBA 4F2IA 14GSA 4HU7A 5DJLA 16GSA 4KCAA 3IR4A 3KP8A 3LG6A 2TRXA 1YEPA 3H8QA 4N0VA 1ZYNA 1PD21 2HSYA 3VLNA 2A2PA 1G6WA 4XCSA 1K0DA 1DUGA 1PL2A 2CAIA 4IHUA 5ID2A 3GMFA 5B8BA 2HE3A 3CTFA 1IYIA 2H0IA 3VPQA 22GSA 4N30A 1FG4A 3APQA 4N11A 2VIMA 1USBA 3TRQA 2DSAA 2WJUA 5AISA 2ON5A 4KH7A 4P3YB 4LMVA 3N5OA 3UIWA 1QXHA 2GZZA 3IOSA 3VFIA 3FHKA 3KTBA 1R5AA 2C0FA 3GKNA 4JBBA 3BOAA 1AQXA 3MWHA 2WS2A 4POBA 2XHFA 5IIZA 1TOFA 5EL8A 4FYCA 1LJRA 1S3CA 1WWJA 1T1VA 5GSTA 4PUFC 3ME7A 5CYYA 1QK8A 3KH9A 3KMOA 4FYBA 3ZIJA 2V32A 3E9JB 5J4UA 1EV9A 1RW1A 2VUPA 1GSQA 2GSQA 3KD0A 3GH9A 3Q6OA 5HQPA 5FHIA 3FZ9A 2WZ9A 1XPVA 2WGRA 3C8EA 3D0ZA 5HR1A 1WMJA 5ECPB 4KSOA 3C71A 1ERUA 1URMA 2A2RA 1EGOA 2F8AA 2L6CA 3VI5A 3ZL5A 1JZOA 3WGDA 1I5GA 3IHQA 2ZUPA 2DJ1A 1A0FA 2A4VA 2C3QA 3HYPA 4IBPA 4K2DA 1XVWA 2OE0A 4MPFA 3TKSC 3MIXA 4FO5A 2YJHA 3QCPA 1KTEA 4LL1B 2R0CA 3HCZA 2CVKA 2IWTA 1MDKA 5D9TA 4NAXA 4ECIA 5KN2A 1PL1A 2E2GA 5F06A 3LXTA 5J9CA 1PQNA 2IFQB 4KF9A 2VL2C 3BD2A 2HRFA 3EMXA 4IGJA 3W8JA 1SK2A 1JZDA 4KDUA 2HSMA 4TR3A 2PN8A 3Q74A 4OD7A 4EIPA 4AJ8A 3KGKA 2QSIA 2HRAA 1XW6A 1SL1B 3DXBA 3D5JA 2H0HA 2J9HA 1PX7A 1ERVA 1OC9B 17GSA 4BA7A 3IDVA 1SU9A 3CSIA 4V1Ag 2GZYA 4TXVA 1SD9A 3DVWA 3IBHA 3G7JA 4YAVA 2QA1A 1YJ6A 3HVXA 5KEJA 3M3MA 1M2BA 3FRCA 3GX0A 3TRXA 3ERGA 4KX4A 1LBKA 3TGZA 2YV7A 2IMFA 5HR0A 1GUMA 1JFUA 3FR9A 3HDCA 4DSSA 3APSA 4TVEA 2OBIA 4JU5A 4Z2UA 4IQ1A 5ECSA 2CZ3A 3QFAC 4GSTA 4LLRA 2VCQA 2H74A 2ES7A 1EP8A 2VL9A 1FB0A 3RHBA 1DE1A 3H1NA 5COHA 2EC4A 4KUNA 5B6MA 1Y6EA 4KSMA 1R7HA 1BG5A 4AGSA 1FOHA 1GSUA 2VLVA 1PRXA 5IM9A 3IRAA 2AJQB 1DBYA 1X5CA 1SJIA 3ME8A 2VL2A 5JWRB 4CY8A 1VF3A 2V6OA 2MMZA 3MDKA 1K0BA 1A2LA 2Z9SA 3TKSE 2YV9A 3QPMA 11GSA 2M72A 4MH3A 1PSQA 2C3NA 4N10A 2QKEA 5CREA 1YZXA 2GGTA 4YH2A 5ELGA 4EC0A 5KOXA 2DMLA 4HJ2A 1Z5YE 2X8HA 3IPZA 2CVBA 5DDLA 1EEJA 3ZRDA 4WBRD 4OCFA 2JL4A 2I1UA 5H5QA 1GSSA 2GVPA 4ECCA 4PXOA 2LRNA 2OA7A 1B48A 5JCWA 2I3YA 4OWYA 5IMDA 1F2EA 3GTUB 3GYKA 1TRSA 2GS3A 2FGXA 3CRTA 3IC4A 3P7XA 4YKFA 1M99A 3GSTA 4MNNA 1K3LA 2O7KA 5DCHA 5KN0A 3F3QA 2G2QA 1BEDA 1YEXA 5G5EA 4KAEA 20GSA 4F9ZA 3LYKA 1T3BA 3WGXA 1OYJA 4IQAA 4K0NA 2XPEA 1SK0A 4O5RA 1GTBA 3FZ4A 1TK0B 5IMVA 5DCGA 1K0CA 2DBCA 5HFGA 1T8EB 1K0OA 4AF2A 1QMVA 2JZTA 1SL2B 2L5LA 3EE2A 4HZ2A 4L5OA 4H86A 6GSTA 2PUKC 3FK8A 2IFQA 3LFLA 2BJXA 4Z2RA 3BBYA 1K3YA 5L71A 4WF5A 1A23A 4PTSA 4IELA 2LSTA 1NM3A 2GSSA 4GRFA 2LJAA 3GURA 2B5XA 2VCVA 4KCEA 4I2TA 5FT3A 3EU3A 4ISDA 2YWNA 4O7HA 4TR0A 3GA4A 2HZEA 2LRTA 5AIVA 3WGEA 1FB6A 3GFKA 1TP9A 3UBKA 1ZL9A 3IK7A 4TOPA 2KP1A 1XVQA 2LS5A 3RPNA 4YQUA 4G10A 4ML6A 2E7PA 1XG8A 2KLXA 1NW2A 1XZOA 4F0CA 4JE1A 1RK4A 4EF0A 4Z7XA 4MJEA 1B8XA 2MBSA 2HYXA 3BCIA 2FHEA 4ZB6A 3R2QA 4JR6A 3ZFLA 5AIXA 3F4RA 1ZYEA 5IPGA 2H72A 1SJ6A 4K0GA 3DMLA 3HA9A 8GSSA 1OE7A 1OAZA 2LV3A 5IO0A 3LEFA 3FR3A 1R5PA 4RI7A 2N5AA 3UMAA 5GZZB 3GX8A 2IMIA 3ERWA 1PX6A 4PQ1A 1G0TA 1AQVA 4ZB9A 4JEDA 2H76A
chains in the Genus database with same CATH topology
3HXSA 4QL7A 3PINA 3KMNA 4Q5FA 3UAPA 2NTOA 2C1YA 1O8XA 2UZ8A 3TKPA 1XXUA 4WBJA 2B7KA 1YKCA 4JRRA 5A4UA 4Q5NA 3D21A 2HFDA 1T4YA 2FWEA 4I2UA 5GAPD 2H1AA 4G9HA 2O8VB 4K9ZA 1F9MA 4CW9A 3TOTA 3GL5A 3DGQA 4HJMA 1F37A 3ZMLA 1M0UA 4WEYA 3D22A 3VI7A 2L4QA 2R2JA 2OE1A 1SL0B 1UC7A 4K7NA 4V2LA 3GTUA 1GH2A 4TRXA 1OKDA 4QQ7A 3FZ5A 3FZAA 4YQMA 4K5SA 4AJ6A 3NIVA 4A5PA 3TCOA 3UARA 5IO2A 3GNJA 2LNTA 2JSZA 2X8CA 4PGTA 2MMAA 4FH8A 3QAVA 2H6ZA 2H6XA 4QL9A 2B6MA 3LSZA 3RDWA 1Y25A 4O92A 2TIRA 2YNXA 4XS4B 2DMMA 4K1FA 1TJDA 4ZBBA 3HVVA 5E59A 4BWSA 2IMKA 1X5DA 4X43A 3WYWA 1T7PB 4X1UA 1O6JA 2YWMA 2P0GA 3DWVA 13GSA 2FWHA 2X4AA 2EIRA 3KH7A 3WT2A 5IMFA 2KOKA 3SBCA 3F4SA 4L8EA 2FWGA 5AN1A 1PA3A 6GSSA 4MH2A 3TKRA 5ECRB 1A24A 4MF6A 4E8HA 4MA9A 4MZCA 2OACA 4D73B 1X0RA 4MK3A 4JR4A 4ICYA 5BRTA 3A5WA 3J7Yk 2PMTA 3K8NA 3UVHA 3ZLPA 3ZVJA 2WDUA 3BJ5A 4MCUA 1B4PA 1K3OA 3JCML 1QFNA 2PVOC 3A5IA 4USSA 3Q18A 3ZMKA 1WRYA 3M1GA 2JZSA 2V2GA 1BJXA 4TXOA 4IJIA 3KM6A 4ZBAA 1VF4A 3HHVA 2N5FA 5DQYA 3VK9A 1EV4A 3CRUA 2A2SA 1QGVA 2DJ0A 1M9BA 2NVLA 1XFLA 4XRDA 1V58A 2QA2A 1X9SB 3CSHA 4OMVA 2J23A 5J41A 5CRDA 2R6KA 2HRNA 2HRKA 3QMXA 1GSEA 4KE3A 1MEKA 5J5NA 3E0UA 3HKRA 1I9DA 1A2JA 1TXXA 1EWXA 2CZ2A 2O85A 3EMPA 2F8FA 1GUKA 1GTAA 1YY7A 2LUSA 1THOA 3H79A 3N9JA 4NV5A 2KHPA 2B1KA 2AUVA 4ZXGA 2FCHA 3ZREA 4HQZA 4OFNA 3ZITA 2K9FA 3V1WA 4V2MA 3O3TA 4F0BA 1U87A 2HI7A 4LA1A 2PGTA 3HJPA 2PBJA 3TJJA 2HZEB 3US3A 2ZCTA 4HOJA 3FMWA 3IC8A 4WETA 1AQWA 3DIEA 1B9YC 4K2XA 1JHBA 2LKUA 1YKAA 5G1LA 1UA5A 3IV4A 2M46A 1EEMA 4Q5RA 1F3AA 2GZPA 5HFKA 2L4CA 1E6BA 4JZQA 2LQQA 1ACVA 3C1RA 2CVDA 1HNBA 3GUSA 1BX9A 1TK5B 3LXZA 1EOGA 2C0EA 6GSXA 2YZUA 2GQLA 4NHWA 3GKMA 4V2NA 3KEBA 3QFBC 3H4KA 5B8AA 2H70A 3VWXA 2AHEA 3HD5A 3PH9A 2K18A 4HZ4A 4Z2TA 1S3DA 3KJYA 3VPTA 2B3SA 2VD1A 2DJKA 3LW9A 2JACA 3GN3A 4RUVA 4OO4A 2QC7A 4CY6A 1SKSB 4XS4A 5ELAA 2VO4A 1SKRB 2GLRA 3MNGA 4MJAA 4PUAA 5IPHA 4EXJA 4KDYA 4ZBDA 2YCDA 1Z3EA 5DALB 2B7JA 3CTGA 2DKIA 4MZWA 3KP9A 2FNOA 3F6DA 1TKDB 4I97A 3VWVA 4GQFA 1SKWB 4KW6A 1XOAA 2CV4A 2HXKA 4YKGA 3QAWA 4I5QA 3RPPA 1A8LA 2X8GA 4ZL8A 1X5EA 5DVBA 3Q19A 1XOBA 2AAWA 1U3AA 3ZYWA 3TJGA 4K6XA 4D73A 3TB2A 4HU9A 1JLVA 3KTLA 3L78A 1TI3A 2DC5A 1PMTA 3IA1A 2E0QA 2DJ2A 2DIZA 1YF1A 1FOVA 2CX3A 1GWCA 1GSDA 1WJKA 5C00A 3HJMA 5JCGA 3IXRA 2F51A 1GLPA 2AB6A 5A4VA 2VM1A 3C73A 1PN9A 2YPMA 3LYPA 3EVIA 3GV1A 2GSRA 1V98A 4F03A 1BQ7A 4DSQA 4EDYA 4G0LA 2CT6A 4HI7A 3UOMA 2D2ZA 2K6VA 5CO3A 3I6AA 1OKTA 2VCXA 3MAKA 5F0GA 3APOA 5ECNB 3G7IA 1AW9A 3LWAA 1Z7PA 1J08A 1B4QA 4EKZA 5AGYA 2LEGA 1IYHA 1NSWA 3UJ1A 4J2FA 5CNWA 1V57A 5D9XA 5EY6A 2IMEA 3QOUA 4N0ZA 2OADA 5DJMA 3ZVJD 1TTZA 5A5KA 1OC3A 5HFIA 2YJ7A 1VGLA 1UVZA 5JCUA 1PGTA 2YN1A 1J9BA 3TJFA 4ULXA 1GSFA 1NHYA 1WIKA 3UBLA 1A8YA 3M9JA 5J3RA 3ZZXA 2P5RA 4KB3A 3CXGA 4EL1A 5ECHB 1N8JA 4TXOB 1CQGA 4DEJA 1KEBA 3QD9A 4HEA2 3DVXA 3LQ7A 1Z6MA 1T4ZA 2PVQA 2R5GA 3CBUA 2YP6A 2M80A 2KP2A 3HZ4A 2OKAA 1GSYA 2PERA 2ON7A 1V40A 2XC2A 4GWRA 1SD8A 2DJ3A 2AV4A 2WRTA 4YQVA 4IVFA 4BVXB 3A2VA 4MLYA 3E3EA 1YQ1A 3U5RE 2GSTA 2XBQA 1UN2A 2FLSA 4K7IA 4OFMA 2CAQA 4K8MA 2GT5A 1Z9HA 1K0NA 5GAND 2IL3A 4IN0A 4GXZA 1M9AA 4ECBA 3HJOA 4NHZA 5IQYA 2WFCA 3FYGA 2BMXA 1EZKA 4OFTA 1DSBA 3IHGA 1KBNA 1QQ2A 1S3AA 3MSZA 2AYTA 3DD3A 1PKZA 2G0FA 2LTKA 1V9WA 1MDJA 4CDOA 2DJJA 2LJKA 2O87A 4TR4A 5DALA 2L5OA 2LRCA 2FWFA 2VOCA 2JU5A 5G31A 1XW5A 2LJRA 2JADA 1ILOA 4KA0A 1GLQA 5B7CA 2HLSA 2PWJA 3ERFA 3A2WA 2HSHA 3TUEA 3MYDA 2C0DA 2TRCP 1GTIA 3L9UA 4DSRA 1GUHA 2WCIA 2H66A 1V2AA 2KUCA 1X9WB 3F63A 4GSSA 5ECIB 2H19A 5B6NA 4ILFA 3F8UA 1C72A 1FVKA 1Z6NA 4FYUA 3IAM2 1HD2A 3F9UA 5J9BA 3D6IA 3QDNA 1TU7A 4BPYA 3IAS2 4NXIA 3RAZA 3UVTA 1GNEA 2YWOA 2VD0A 2DIYA 3A3TA 2ALBA 4I6XA 3M9KA 4G19A 4X4JA 1EGRA 4RQXA 4NPBA 2V1MA 3M8NA 5IMAA 2LQOA 2BTOT 1TRUA 4L0UA 4L0WA 1WPIA 1VF2A 4BL7B 2WB9A 5F8BA 2YANA 1U88A 6GSUA 3GHAA 5LD0A 3UEMA 4MMMA 3W8SA 4POKA 2GTUA 4ID0A 1SK1A 5KN3A 5FWGA 3C7MA 2VCWA 1TDIA 2X64A 1SJZA 5ECOB 9GSSA 1TRVA 5DBQA 3VURA 1TW9A 1B9XC 2C8UA 1XWCA 5D96A 2H30A 2OBKA 5BMUA 3QAGA 3TOUA 2PPTA 5A4WA 3SWLA 3RHCA 1LU4A 1OVNA 3DYRA 3L9VA 3EC3A 4TR1B 4XS6A 3H93A 3KZQA 4PNGA 2HNLA 4ECJA 5G2ZA 3D4TA 1MD3A 5DQSA 5IOXA 5D8IA 1ABAA 4MJBA 2GQMA 4I8BA 2V6KA 2DLXA 3A2XA 4E8EA 2NPBA 2C80A 1M7TA 3GSSA 2R3XA 3ZTLA 1RQMA 2LNSA 4IS0A 4EVMA 2IMDA 3TJKA 1R26A 4Q5QA 3TJBA 6GSYA 1ZCPA 3EURA 1TK8B 1Z7RA 2R0PA 1ERTA 2RUEA 4MABA 2C0GA 3TRPA 2RIIA 5KN1A 1GL8A 3RBTA 3G7YA 1HYUA 1Q98A 1AIUA 4OO5A 4EIQA 3F6FA 4BVXA 1AAZA 5LNKe 3J7Yb 2JSYA 2C4JA 1THXA 4WF4A 4J57E 4KNDA 5G1KA 3F4TA 4OCEA 1TI1A 1O73A 3IE3A 3DEXA 1O7UA 2OE3A 4TN8A 2IIYA 1GTUA 4G0KA 5G5FA 2X49A 4EUYA 3I9V2 4XRAA 3DRNA 3FKFA 1X9MB 2IN3A 4G0IA 2H6YA 2L6DA 2HT9A 2XPDA 4LL4B 2L59A 1AXDA 2H01A 3KIJA 1G6YA 2H0GA 3NZNA 1XW9A 2FA8A 2H75A 4NMUA 4ZB8A 3LGCA 4F82A 2RLIA 5CRGA 3W6GA 6GSWA 5EPFA 4MP4A 4GCIA 1HNAA 1GNWA 5ENUA 1XWGA 3PR8A 4PNFA 1U3IA 6GSVA 2GQKA 4IP1A 3QR6A 1SYRA 3WD6A 1JLWA 2H1DA 5JWOB 5C04A 4DVCA 5H5SA 3FY7A 1J0FA 1PN0A 4HDEA 1VF1A 4PX1A 5G30A 3CMIA 3FR6A 4RQRA 2EIOA 4XIHA 2I4AA 5ABRA 5D9VA 2MYGA 1G7OA 1W4VA 3LORA 4POMA 4BVYA 2I9HA 5IMZA 1TU8A 2IPAA 5ECQB 5DAKA 1EP7A 3GRXA 3GKKA 4GF0A 1OC8A 1ERWA 1XWAA 3KCMA 5CP1A 3TKSA 1PKWA 1NHOA 5HR2A 2E2MA 2H1GA 2QGVA 4BL7A 4X0XA 1ZZYA 3I43A 4NV2A 3CYNA 4WXTA 3IK9A 1GP1A 4GTUA 2MBTA 3PPUA 5ECKB 3M0FA 1XWKA 2DKHA 2VM2A 1O85A 1WP0A 2C3TA 2IJYA 4FIWA 1ON4A 2H71A 5HR3A 1GRXA 3S9FA 3VWWA 1A2MA 4O5QA 4MPGA 4PQIA 2P5QA 4TR1A 1E2YA 2A4HA 3G9BA 4XTSA 4YAPA 1W89A 4WKWA 3TKQA 2MMNA 4ZIJA 2REMA 2FY6A 2F9SA 2K8VA 5D73A 4IW9A 5CAXA 1T00A 1F6MC 1QUWA 2YZHA 4TW5A 5D9WA 1MTCA 4EE0A 5EVOA 3FW2A 4HS1A 3F0IA 2VL3A 4PURA 2FUG2 1JZWA 2CA8A 4IP6A 5IMCA 1XBSA 3O76A 2OJLA 2RUFA 1YDKA 2GDRA 1GULA 4WR4A 3FEUA 4GQCA 2MMOA 3U6VA 5D93A 2N5BA 2WULA 3CSJA 1SENA 2NDOA 3C1SA 3GH6A 1H75A 1AUCA 2H8LA 2RM6A 4RI6A 5ID2B 2H1BA 4ZILA 10GSA 1ST9A 1AC1A 3KXOA 2P31A 3ISOA 5H5RA 1F3BA 1DE2A 3EU4A 4KGIA 3GL3A 3TDGA 3ED3A 4MDCA 3AY8A 1HNCA 5ECMB 4FQUA 2RM5A 2YWIA 1K0AA 4K5RA 4TKYA 5INYA 2FA4A 1VRSD 2HZFA 19GSA 3P90A 1M2DA 4J56E 3F3RA 1WOUA 3LJRA 1FHEA 1WE0A 1A0RP 2R0GA 4EDZA 4HQSA 1TRWA 12GSA 1ML6A 2NBSA 2EIQA 4IJ3A 4MJCA 2X99A 3ZFBA 1ZGNA 4EO3A 1OC9A 1FVJA 1ZMAA 2B1LA 2I81A 4LMWA 4IKHA 2CX4A 3HZ8A 3P8WA 4G2EA 4K7OA 2YOIA 1K0MA 2V41A 2F3MA 2GT6A 1FO5A 3L4NA 3OR5A 5GSSA 4MF5A 18GSA 2B5YA 3P2AA 2VAFA 2VLUA 1FAAA 2B5EA 4ML1A 2VCZA 1BYEA 1Q4JA 3UL3A 1JZRA 4O5UA 1FW1A 3HVSA 4XS1A 3I69A 4L5LA 1MD4A 4V1Ap 1MDIA 4HUAA 3HY2A 4WR5A 3D4MA 2O89A 2MZCA 1HQOA 5KOWA 1XCCA 4MZBA 1M2AA 2VCTA 1EOHA 3L0HA 3DKSA 1ZYPA 5LCZA 3ZIVA 3O6TA 4XHMA 3EYTA 3NOFA 4MF7A 3GKXA 5ECLB 3VWUA 2R4VA 2JZRA 3EPTA 3GIXA 1XIYA 7GSSA 5E4WA 1N2AA 3BCKA 3L9SA 4GLTA 2CQ9A 5CRWA 4ACSA 4CHSA 1O81A 2ZNMA 1KNGA 1CQHA 5CRHA 1G7EA 4ZL7A 4POLA 1OE8A 1BAYA 1ZOFA 4AJ7A 2FD3A 4O32A 3WT1A 2L57A 4BWQA 1SYXA 2H73A 4NWYA 1R4WA 1O8WA 2K8SA 3PGTA 3R3EA 4GSNA 5JWQB 1YF0A 4PQHA 2VLTA 5F07A 2PU9C 4DSSB 4BVYB 3EINA 3EWLA 5F05A 1ZYQB 4ZL9A 5DAKB 4KDXA 1H4OA 2R37A 5IOWA 1U6TA 2XBIA 1XWBA 4F2IA 14GSA 4HU7A 5DJLA 16GSA 4KCAA 3IR4A 3KP8A 3LG6A 2TRXA 1YEPA 3H8QA 4N0VA 1ZYNA 1PD21 2HSYA 3VLNA 2A2PA 1G6WA 4XCSA 1K0DA 1DUGA 1PL2A 2CAIA 4IHUA 5ID2A 3GMFA 5B8BA 2HE3A 3CTFA 1IYIA 2H0IA 3VPQA 22GSA 4N30A 1FG4A 3APQA 4N11A 2VIMA 1USBA 3TRQA 2DSAA 2WJUA 5AISA 2ON5A 4KH7A 4P3YB 4LMVA 3N5OA 3UIWA 1QXHA 2GZZA 3IOSA 3VFIA 3FHKA 3KTBA 1R5AA 2C0FA 3GKNA 4JBBA 3BOAA 1AQXA 3MWHA 2WS2A 4POBA 2XHFA 5IIZA 1TOFA 5EL8A 4FYCA 1LJRA 1S3CA 1WWJA 1T1VA 5GSTA 4PUFC 3ME7A 5CYYA 1QK8A 3KH9A 3KMOA 4FYBA 3ZIJA 2V32A 3E9JB 5J4UA 1EV9A 1RW1A 2VUPA 1GSQA 2GSQA 3KD0A 3GH9A 3Q6OA 5HQPA 5FHIA 3FZ9A 2WZ9A 1XPVA 2WGRA 3C8EA 3D0ZA 5HR1A 1WMJA 5ECPB 4KSOA 3C71A 1ERUA 1URMA 2A2RA 1EGOA 2F8AA 2L6CA 3VI5A 3ZL5A 1JZOA 3WGDA 1I5GA 3IHQA 2ZUPA 2DJ1A 1A0FA 2A4VA 2C3QA 3HYPA 4IBPA 4K2DA 1XVWA 2OE0A 4MPFA 3TKSC 3MIXA 4FO5A 2YJHA 3QCPA 1KTEA 4LL1B 2R0CA 3HCZA 2CVKA 2IWTA 1MDKA 5D9TA 4NAXA 4ECIA 5KN2A 1PL1A 2E2GA 5F06A 3LXTA 5J9CA 1PQNA 2IFQB 4KF9A 2VL2C 3BD2A 2HRFA 3EMXA 4IGJA 3W8JA 1SK2A 1JZDA 4KDUA 2HSMA 4TR3A 2PN8A 3Q74A 4OD7A 4EIPA 4AJ8A 3KGKA 2QSIA 2HRAA 1XW6A 1SL1B 3DXBA 3D5JA 2H0HA 2J9HA 1PX7A 1ERVA 1OC9B 17GSA 4BA7A 3IDVA 1SU9A 3CSIA 4V1Ag 2GZYA 4TXVA 1SD9A 3DVWA 3IBHA 3G7JA 4YAVA 2QA1A 1YJ6A 3HVXA 5KEJA 3M3MA 1M2BA 3FRCA 3GX0A 3TRXA 3ERGA 4KX4A 1LBKA 3TGZA 2YV7A 2IMFA 5HR0A 1GUMA 1JFUA 3FR9A 3HDCA 4DSSA 3APSA 4TVEA 2OBIA 4JU5A 4Z2UA 4IQ1A 5ECSA 2CZ3A 3QFAC 4GSTA 4LLRA 2VCQA 2H74A 2ES7A 1EP8A 2VL9A 1FB0A 3RHBA 1DE1A 3H1NA 5COHA 2EC4A 4KUNA 5B6MA 1Y6EA 4KSMA 1R7HA 1BG5A 4AGSA 1FOHA 1GSUA 2VLVA 1PRXA 5IM9A 3IRAA 2AJQB 1DBYA 1X5CA 1SJIA 3ME8A 2VL2A 5JWRB 4CY8A 1VF3A 2V6OA 2MMZA 3MDKA 1K0BA 1A2LA 2Z9SA 3TKSE 2YV9A 3QPMA 11GSA 2M72A 4MH3A 1PSQA 2C3NA 4N10A 2QKEA 5CREA 1YZXA 2GGTA 4YH2A 5ELGA 4EC0A 5KOXA 2DMLA 4HJ2A 1Z5YE 2X8HA 3IPZA 2CVBA 5DDLA 1EEJA 3ZRDA 4WBRD 4OCFA 2JL4A 2I1UA 5H5QA 1GSSA 2GVPA 4ECCA 4PXOA 2LRNA 2OA7A 1B48A 5JCWA 2I3YA 4OWYA 5IMDA 1F2EA 3GTUB 3GYKA 1TRSA 2GS3A 2FGXA 3CRTA 3IC4A 3P7XA 4YKFA 1M99A 3GSTA 4MNNA 1K3LA 2O7KA 5DCHA 5KN0A 3F3QA 2G2QA 1BEDA 1YEXA 5G5EA 4KAEA 20GSA 4F9ZA 3LYKA 1T3BA 3WGXA 1OYJA 4IQAA 4K0NA 2XPEA 1SK0A 4O5RA 1GTBA 3FZ4A 1TK0B 5IMVA 5DCGA 1K0CA 2DBCA 5HFGA 1T8EB 1K0OA 4AF2A 1QMVA 2JZTA 1SL2B 2L5LA 3EE2A 4HZ2A 4L5OA 4H86A 6GSTA 2PUKC 3FK8A 2IFQA 3LFLA 2BJXA 4Z2RA 3BBYA 1K3YA 5L71A 4WF5A 1A23A 4PTSA 4IELA 2LSTA 1NM3A 2GSSA 4GRFA 2LJAA 3GURA 2B5XA 2VCVA 4KCEA 4I2TA 5FT3A 3EU3A 4ISDA 2YWNA 4O7HA 4TR0A 3GA4A 2HZEA 2LRTA 5AIVA 3WGEA 1FB6A 3GFKA 1TP9A 3UBKA 1ZL9A 3IK7A 4TOPA 2KP1A 1XVQA 2LS5A 3RPNA 4YQUA 4G10A 4ML6A 2E7PA 2KLXA 1NW2A 1XZOA 4F0CA 4JE1A 1RK4A 4EF0A 4Z7XA 4MJEA 1B8XA 2MBSA 2HYXA 3BCIA 2FHEA 4ZB6A 3R2QA 4JR6A 3ZFLA 5AIXA 3F4RA 1ZYEA 5IPGA 2H72A 1SJ6A 4K0GA 3DMLA 3HA9A 8GSSA 1OE7A 1OAZA 2LV3A 5IO0A 3LEFA 3FR3A 1R5PA 4RI7A 2N5AA 3UMAA 5GZZB 3GX8A 2IMIA 3ERWA 1PX6A 4PQ1A 1G0TA 1AQVA 4ZB9A 4JEDA 2H76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXS A;  4QL7 A;  3PIN A;  3KMN A;  4Q5F A;  3UAP A;  2NTO A;  2C1Y A;  1O8X A;  3TKP A;  1XXU A;  4WBJ A;  2B7K A;  1YKC A;  4JRR A;  5A4U A;  4Q5N A;  3D21 A;  2HFD A;  1T4Y A;  2FWE A;  4I2U A;  5GAP D;  2H1A A;  4G9H A;  2O8V B;  4K9Z A;  1F9M A;  4CW9 A;  3TOT A;  3GL5 A;  3DGQ A;  4HJM A;  1F37 A;  3ZML A;  1M0U A;  4WEY A;  3D22 A;  3VI7 A;  2L4Q A;  2R2J A;  2OE1 A;  1SL0 B;  1UC7 A;  4K7N A;  4V2L A;  3GTU A;  1GH2 A;  4TRX A;  1OKD A;  4QQ7 A;  3FZ5 A;  3FZA A;  4YQM A;  4AJ6 A;  3NIV A;  3TCO A;  3UAR A;  5IO2 A;  3GNJ A;  2LNT A;  2JSZ A;  2X8C A;  4PGT A;  2MMA A;  4FH8 A;  3QAV A;  2H6Z A;  2H6X A;  4QL9 A;  2B6M A;  3LSZ A;  3RDW A;  1Y25 A;  4O92 A;  2TIR A;  2YNX A;  4XS4 B;  2DMM A;  4K1F A;  1TJD A;  4ZBB A;  3HVV A;  5E59 A;  4BWS A;  2IMK A;  1X5D A;  4X43 A;  3WYW A;  1T7P B;  4X1U A;  1O6J A;  2YWM A;  2P0G A;  3DWV A;  13GS A;  2FWH A;  2EIR A;  3KH7 A;  3WT2 A;  5IMF A;  2KOK A;  3SBC A;  3F4S A;  4L8E A;  2FWG A;  5AN1 A;  1PA3 A;  6GSS A;  4MH2 A;  3TKR A;  5ECR B;  1A24 A;  4MF6 A;  4E8H A;  4MA9 A;  4MZC A;  2OAC A;  4D73 B;  1X0R A;  4MK3 A;  4JR4 A;  3A5W A;  3J7Y k;  2PMT A;  3K8N A;  3UVH A;  3ZLP A;  3ZVJ A;  2WDU A;  3BJ5 A;  4MCU A;  1B4P A;  1K3O A;  3JCM L;  1QFN A;  2PVO C;  3Q18 A;  3ZMK A;  1WRY A;  3M1G A;  2JZS A;  2V2G A;  1BJX A;  4TXO A;  4IJI A;  3KM6 A;  4ZBA A;  1VF4 A;  3HHV A;  2N5F A;  5DQY A;  3VK9 A;  1EV4 A;  3CRU A;  2A2S A;  1QGV A;  2DJ0 A;  1M9B A;  2NVL A;  1XFL A;  4XRD A;  1V58 A;  1X9S B;  3CSH A;  4OMV A;  2J23 A;  5J41 A;  5CRD A;  2R6K A;  2HRN A;  3QMX A;  1GSE A;  4KE3 A;  1MEK A;  5J5N A;  3E0U A;  3HKR A;  1I9D A;  1A2J A;  1TXX A;  1EWX A;  2CZ2 A;  2O85 A;  3EMP A;  2F8F A;  1GUK A;  1GTA A;  1YY7 A;  2LUS A;  1THO A;  3H79 A;  3N9J A;  4NV5 A;  2KHP A;  2B1K A;  2AUV A;  4ZXG A;  2FCH A;  3ZRE A;  4HQZ A;  4OFN A;  3ZIT A;  2K9F A;  3V1W A;  4V2M A;  3O3T A;  4F0B A;  1U87 A;  2HI7 A;  4LA1 A;  2PGT A;  3HJP A;  2PBJ A;  3TJJ A;  2HZE B;  3US3 A;  2ZCT A;  4HOJ A;  4WET A;  1AQW A;  3DIE A;  1B9Y C;  1JHB A;  2LKU A;  1YKA A;  5G1L A;  1UA5 A;  3IV4 A;  2M46 A;  1EEM A;  4Q5R A;  1F3A A;  2GZP A;  5HFK A;  2L4C A;  1E6B A;  4JZQ A;  2LQQ A;  1ACV A;  3C1R A;  2CVD A;  1HNB A;  3GUS A;  1BX9 A;  1TK5 B;  3LXZ A;  1EOG A;  2C0E A;  6GSX A;  2YZU A;  2GQL A;  4NHW A;  3GKM A;  4V2N A;  3KEB A;  3QFB C;  3H4K A;  5B8A A;  2H70 A;  3VWX A;  2AHE A;  3HD5 A;  3PH9 A;  2K18 A;  4HZ4 A;  1S3D A;  3KJY A;  3VPT A;  2B3S A;  2VD1 A;  2DJK A;  2JAC A;  3GN3 A;  4RUV A;  4OO4 A;  2QC7 A;  1SKS B;  4XS4 A;  5ELA A;  2VO4 A;  1SKR B;  2GLR A;  3MNG A;  4MJA A;  4PUA A;  5IPH A;  4EXJ A;  4KDY A;  4ZBD A;  2YCD A;  1Z3E A;  5DAL B;  2B7J A;  3CTG A;  4MZW A;  3KP9 A;  2FNO A;  3F6D A;  1TKD B;  4I97 A;  3VWV A;  4GQF A;  1SKW B;  4KW6 A;  1XOA A;  2CV4 A;  2HXK A;  3QAW A;  4I5Q A;  3RPP A;  1A8L A;  2X8G A;  4ZL8 A;  1X5E A;  5DVB A;  3Q19 A;  1XOB A;  2AAW A;  1U3A A;  3ZYW A;  3TJG A;  4K6X A;  4D73 A;  3TB2 A;  4HU9 A;  1JLV A;  3KTL A;  3L78 A;  1TI3 A;  2DC5 A;  1PMT A;  3IA1 A;  2E0Q A;  2DJ2 A;  2DIZ A;  1YF1 A;  1FOV A;  2CX3 A;  1GWC A;  1GSD A;  1WJK A;  5C00 A;  3HJM A;  5JCG A;  3IXR A;  2F51 A;  1GLP A;  2AB6 A;  5A4V A;  2VM1 A;  3C73 A;  1PN9 A;  2YPM A;  3LYP A;  3EVI A;  3GV1 A;  2GSR A;  1V98 A;  4F03 A;  1BQ7 A;  4DSQ A;  4EDY A;  2CT6 A;  4HI7 A;  3UOM A;  2D2Z A;  2K6V A;  5CO3 A;  3I6A A;  1OKT A;  2VCX A;  3MAK A;  5F0G A;  3APO A;  5ECN B;  3G7I A;  1AW9 A;  3LWA A;  1Z7P A;  1J08 A;  1B4Q A;  4EKZ A;  5AGY A;  2LEG A;  1IYH A;  1NSW A;  3UJ1 A;  4J2F A;  5CNW A;  1V57 A;  5D9X A;  5EY6 A;  2IME A;  3QOU A;  4N0Z A;  2OAD A;  5DJM A;  3ZVJ D;  1TTZ A;  5A5K A;  1OC3 A;  5HFI A;  2YJ7 A;  1VGL A;  1UVZ A;  5JCU A;  1PGT A;  2YN1 A;  1J9B A;  3TJF A;  4ULX A;  1GSF A;  1NHY A;  1WIK A;  3UBL A;  1A8Y A;  3M9J A;  5J3R A;  3ZZX A;  2P5R A;  4KB3 A;  3CXG A;  4EL1 A;  5ECH B;  1N8J A;  4TXO B;  1CQG A;  4DEJ A;  1KEB A;  3QD9 A;  4HEA 2;  3DVX A;  3LQ7 A;  1Z6M A;  1T4Z A;  2PVQ A;  2R5G A;  3CBU A;  2YP6 A;  2M80 A;  2KP2 A;  3HZ4 A;  2OKA A;  1GSY A;  2PER A;  2ON7 A;  1V40 A;  2XC2 A;  4GWR A;  1SD8 A;  2DJ3 A;  2AV4 A;  2WRT A;  4YQV A;  4IVF A;  3A2V A;  4MLY A;  3E3E A;  1YQ1 A;  3U5R E;  2GST A;  2XBQ A;  1UN2 A;  2FLS A;  4K7I A;  4OFM A;  2CAQ A;  4K8M A;  2GT5 A;  1Z9H A;  1K0N A;  5GAN D;  2IL3 A;  4IN0 A;  4GXZ A;  1M9A A;  4ECB A;  3HJO A;  4NHZ A;  5IQY A;  2WFC A;  3FYG A;  2BMX A;  1EZK A;  4OFT A;  1DSB A;  1KBN A;  1QQ2 A;  1S3A A;  3MSZ A;  2AYT A;  3DD3 A;  1PKZ A;  2G0F A;  2LTK A;  1V9W A;  1MDJ A;  4CDO A;  2DJJ A;  2LJK A;  2O87 A;  4TR4 A;  5DAL A;  2L5O A;  2LRC A;  2FWF A;  2VOC A;  2JU5 A;  5G31 A;  1XW5 A;  2LJR A;  2JAD A;  1ILO A;  4KA0 A;  1GLQ A;  5B7C A;  2HLS A;  2PWJ A;  3ERF A;  3A2W A;  2HSH A;  3TUE A;  2C0D A;  2TRC P;  1GTI A;  3L9U A;  4DSR A;  1GUH A;  2WCI A;  2H66 A;  1V2A A;  2KUC A;  1X9W B;  3F63 A;  4GSS A;  5ECI B;  2H19 A;  5B6N A;  4ILF A;  3F8U A;  1C72 A;  1FVK A;  1Z6N A;  4FYU A;  3IAM 2;  1HD2 A;  3F9U A;  5J9B A;  3D6I A;  3QDN A;  1TU7 A;  4BPY A;  3IAS 2;  4NXI A;  3RAZ A;  3UVT A;  1GNE A;  2YWO A;  2VD0 A;  2DIY A;  3A3T A;  2ALB A;  4I6X A;  3M9K A;  4G19 A;  1EGR A;  4RQX A;  4NPB A;  2V1M A;  3M8N A;  5IMA A;  2LQO A;  2BTO T;  1TRU A;  4L0U A;  4L0W A;  1WPI A;  1VF2 A;  2WB9 A;  5F8B A;  2YAN A;  1U88 A;  6GSU A;  3GHA A;  5LD0 A;  3UEM A;  4MMM A;  3W8S A;  4POK A;  2GTU A;  4ID0 A;  1SK1 A;  5KN3 A;  5FWG A;  3C7M A;  2VCW A;  1TDI A;  2X64 A;  1SJZ A;  5ECO B;  9GSS A;  1TRV A;  5DBQ A;  3VUR A;  1TW9 A;  1B9X C;  2C8U A;  1XWC A;  5D96 A;  2H30 A;  2OBK A;  3QAG A;  3TOU A;  2PPT A;  5A4W A;  3SWL A;  3RHC A;  1LU4 A;  1OVN A;  3DYR A;  3L9V A;  3EC3 A;  4TR1 B;  4XS6 A;  3H93 A;  3KZQ A;  4PNG A;  2HNL A;  4ECJ A;  5G2Z A;  3D4T A;  1MD3 A;  5DQS A;  5IOX A;  5D8I A;  1ABA A;  4MJB A;  2GQM A;  4I8B A;  2V6K A;  2DLX A;  3A2X A;  4E8E A;  2NPB A;  2C80 A;  1M7T A;  3GSS A;  2R3X A;  3ZTL A;  1RQM A;  2LNS A;  4IS0 A;  4EVM A;  2IMD A;  3TJK A;  1R26 A;  4Q5Q A;  3TJB A;  6GSY A;  1ZCP A;  3EUR A;  1TK8 B;  1Z7R A;  1ERT A;  2RUE A;  4MAB A;  2C0G A;  3TRP A;  2RII A;  5KN1 A;  1GL8 A;  3RBT A;  3G7Y A;  1HYU A;  1Q98 A;  1AIU A;  4OO5 A;  3F6F A;  4BVX A;  1AAZ A;  5LNK e;  3J7Y b;  2JSY A;  2C4J A;  1THX A;  4WF4 A;  4J57 E;  4KND A;  5G1K A;  3F4T A;  4OCE A;  1TI1 A;  1O73 A;  3IE3 A;  3DEX A;  1O7U A;  2OE3 A;  4TN8 A;  2IIY A;  1GTU A;  5G5F A;  4EUY A;  3I9V 2;  4XRA A;  3DRN A;  3FKF A;  1X9M B;  2IN3 A;  2H6Y A;  2L6D A;  2HT9 A;  2XPD A;  4LL4 B;  2L59 A;  1AXD A;  2H01 A;  3KIJ A;  1G6Y A;  2H0G A;  3NZN A;  1XW9 A;  2FA8 A;  2H75 A;  4NMU A;  4ZB8 A;  3LGC A;  4F82 A;  2RLI A;  5CRG A;  3W6G A;  6GSW A;  5EPF A;  4MP4 A;  4GCI A;  1HNA A;  1GNW A;  5ENU A;  1XWG A;  3PR8 A;  4PNF A;  1U3I A;  6GSV A;  2GQK A;  4IP1 A;  3QR6 A;  1SYR A;  3WD6 A;  1JLW A;  2H1D A;  5JWO B;  5C04 A;  4DVC A;  5H5S A;  3FY7 A;  1J0F A;  4HDE A;  1VF1 A;  4PX1 A;  5G30 A;  3CMI A;  3FR6 A;  4RQR A;  2EIO A;  4XIH A;  2I4A A;  5ABR A;  5D9V A;  2MYG A;  1G7O A;  1W4V A;  3LOR A;  4POM A;  4BVY A;  2I9H A;  5IMZ A;  1TU8 A;  2IPA A;  5ECQ B;  5DAK A;  1EP7 A;  3GRX A;  3GKK A;  4GF0 A;  1OC8 A;  1ERW A;  1XWA A;  3KCM A;  5CP1 A;  3TKS A;  1PKW A;  1NHO A;  5HR2 A;  2E2M A;  2H1G A;  2QGV A;  4BL7 A;  4X0X A;  1ZZY A;  3I43 A;  4NV2 A;  3CYN A;  4WXT A;  3IK9 A;  1GP1 A;  4GTU A;  2MBT A;  5ECK B;  3M0F A;  1XWK A;  2VM2 A;  1O85 A;  1WP0 A;  2C3T A;  2IJY A;  4FIW A;  1ON4 A;  2H71 A;  5HR3 A;  1GRX A;  3S9F A;  3VWW A;  1A2M A;  4MPG A;  4PQI A;  2P5Q A;  4TR1 A;  1E2Y A;  3G9B A;  4XTS A;  4YAP A;  1W89 A;  4WKW A;  3TKQ A;  2MMN A;  4ZIJ A;  2REM A;  2FY6 A;  2F9S A;  2K8V A;  5D73 A;  4IW9 A;  5CAX A;  1T00 A;  1F6M C;  1QUW A;  2YZH A;  4TW5 A;  5D9W A;  1MTC A;  4EE0 A;  5EVO A;  3FW2 A;  4HS1 A;  3F0I A;  2VL3 A;  4PUR A;  2FUG 2;  1JZW A;  2CA8 A;  4IP6 A;  5IMC A;  1XBS A;  3O76 A;  2OJL A;  2RUF A;  1YDK A;  2GDR A;  1GUL A;  4WR4 A;  3FEU A;  4GQC A;  2MMO A;  3U6V A;  5D93 A;  2N5B A;  2WUL A;  3CSJ A;  1SEN A;  2NDO A;  3C1S A;  3GH6 A;  1H75 A;  1AUC A;  2H8L A;  2RM6 A;  4RI6 A;  5ID2 B;  2H1B A;  4ZIL A;  10GS A;  1ST9 A;  1AC1 A;  3KXO A;  2P31 A;  3ISO A;  5H5R A;  1F3B A;  1DE2 A;  3EU4 A;  4KGI A;  3GL3 A;  3TDG A;  3ED3 A;  4MDC A;  3AY8 A;  1HNC A;  5ECM B;  2RM5 A;  2YWI A;  1K0A A;  4TKY A;  5INY A;  2FA4 A;  1VRS D;  2HZF A;  19GS A;  3P90 A;  1M2D A;  4J56 E;  3F3R A;  1WOU A;  3LJR A;  1FHE A;  1WE0 A;  1A0R P;  4EDZ A;  4HQS A;  1TRW A;  12GS A;  1ML6 A;  2NBS A;  2EIQ A;  4IJ3 A;  4MJC A;  2X99 A;  3ZFB A;  1ZGN A;  4EO3 A;  1OC9 A;  1FVJ A;  1ZMA A;  2B1L A;  2I81 A;  4LMW A;  4IKH A;  2CX4 A;  3HZ8 A;  3P8W A;  4G2E A;  4K7O A;  2YOI A;  1K0M A;  2V41 A;  2F3M A;  2GT6 A;  1FO5 A;  3L4N A;  3OR5 A;  5GSS A;  4MF5 A;  18GS A;  2B5Y A;  3P2A A;  2VAF A;  2VLU A;  1FAA A;  2B5E A;  4ML1 A;  2VCZ A;  1BYE A;  1Q4J A;  3UL3 A;  1JZR A;  1FW1 A;  3HVS A;  4XS1 A;  3I69 A;  4L5L A;  1MD4 A;  4V1A p;  1MDI A;  4HUA A;  3HY2 A;  4WR5 A;  3D4M A;  2O89 A;  2MZC A;  1HQO A;  1XCC A;  4MZB A;  1M2A A;  2VCT A;  1EOH A;  3L0H A;  3DKS A;  5LCZ A;  3ZIV A;  3O6T A;  4XHM A;  3EYT A;  3NOF A;  4MF7 A;  3GKX A;  5ECL B;  3VWU A;  2R4V A;  2JZR A;  3GIX A;  1XIY A;  7GSS A;  5E4W A;  1N2A A;  3BCK A;  3L9S A;  4GLT A;  2CQ9 A;  5CRW A;  4ACS A;  4CHS A;  1O81 A;  2ZNM A;  1KNG A;  1CQH A;  5CRH A;  1G7E A;  4ZL7 A;  4POL A;  1OE8 A;  1BAY A;  1ZOF A;  4AJ7 A;  2FD3 A;  4O32 A;  3WT1 A;  2L57 A;  4BWQ A;  1SYX A;  2H73 A;  4NWY A;  1R4W A;  1O8W A;  2K8S A;  3PGT A;  4GSN A;  5JWQ B;  1YF0 A;  4PQH A;  2VLT A;  5F07 A;  2PU9 C;  4DSS B;  3EIN A;  3EWL A;  5F05 A;  1ZYQ B;  4ZL9 A;  5DAK B;  4KDX A;  1H4O A;  2R37 A;  5IOW A;  1U6T A;  2XBI A;  1XWB A;  4F2I A;  14GS A;  4HU7 A;  5DJL A;  16GS A;  4KCA A;  3IR4 A;  3KP8 A;  3LG6 A;  2TRX A;  1YEP A;  3H8Q A;  4N0V A;  1PD2 1;  2HSY A;  3VLN A;  1G6W A;  4XCS A;  1K0D A;  1DUG A;  1PL2 A;  2CAI A;  4IHU A;  5ID2 A;  3GMF A;  5B8B A;  2HE3 A;  3CTF A;  1IYI A;  2H0I A;  3VPQ A;  22GS A;  4N30 A;  1FG4 A;  3APQ A;  4N11 A;  2VIM A;  1USB A;  3TRQ A;  2DSA A;  2WJU A;  5AIS A;  2ON5 A;  4KH7 A;  4P3Y B;  4LMV A;  3N5O A;  3UIW A;  1QXH A;  2GZZ A;  3IOS A;  3VFI A;  3FHK A;  3KTB A;  1R5A A;  2C0F A;  3GKN A;  4JBB A;  3BOA A;  1AQX A;  3MWH A;  2WS2 A;  4POB A;  2XHF A;  5IIZ A;  1TOF A;  5EL8 A;  4FYC A;  1LJR A;  1S3C A;  1WWJ A;  1T1V A;  5GST A;  4PUF C;  3ME7 A;  5CYY A;  1QK8 A;  3KH9 A;  3KMO A;  4FYB A;  3ZIJ A;  2V32 A;  3E9J B;  5J4U A;  1EV9 A;  1RW1 A;  2VUP A;  1GSQ A;  2GSQ A;  3KD0 A;  3GH9 A;  3Q6O A;  5HQP A;  5FHI A;  3FZ9 A;  2WZ9 A;  1XPV A;  2WGR A;  3C8E A;  3D0Z A;  5HR1 A;  1WMJ A;  5ECP B;  4KSO A;  3C71 A;  1ERU A;  1URM A;  2A2R A;  1EGO A;  2F8A A;  2L6C A;  3VI5 A;  3ZL5 A;  1JZO A;  3WGD A;  1I5G A;  3IHQ A;  2ZUP A;  2DJ1 A;  1A0F A;  2A4V A;  2C3Q A;  3HYP A;  4IBP A;  4K2D A;  1XVW A;  2OE0 A;  4MPF A;  3TKS C;  4FO5 A;  2YJH A;  3QCP A;  1KTE A;  4LL1 B;  3HCZ A;  2CVK A;  2IWT A;  1MDK A;  5D9T A;  4NAX A;  4ECI A;  5KN2 A;  1PL1 A;  2E2G A;  5F06 A;  3LXT A;  5J9C A;  1PQN A;  2IFQ B;  2VL2 C;  3BD2 A;  2HRF A;  3EMX A;  4IGJ A;  3W8J A;  1SK2 A;  1JZD A;  4KDU A;  4TR3 A;  2PN8 A;  3Q74 A;  4OD7 A;  4AJ8 A;  3KGK A;  2QSI A;  1XW6 A;  1SL1 B;  3DXB A;  3D5J A;  2H0H A;  2J9H A;  1PX7 A;  1ERV A;  1OC9 B;  17GS A;  4BA7 A;  3IDV A;  1SU9 A;  3CSI A;  4V1A g;  2GZY A;  4TXV A;  1SD9 A;  3DVW A;  3IBH A;  3G7J A;  4YAV A;  1YJ6 A;  3HVX A;  5KEJ A;  3M3M A;  1M2B A;  3FRC A;  3GX0 A;  3TRX A;  3ERG A;  4KX4 A;  1LBK A;  3TGZ A;  2YV7 A;  2IMF A;  5HR0 A;  1GUM A;  1JFU A;  3FR9 A;  3HDC A;  4DSS A;  3APS A;  4TVE A;  2OBI A;  4JU5 A;  4IQ1 A;  5ECS A;  2CZ3 A;  3QFA C;  4GST A;  4LLR A;  2VCQ A;  2H74 A;  2ES7 A;  1EP8 A;  2VL9 A;  1FB0 A;  3RHB A;  1DE1 A;  3H1N A;  5COH A;  2EC4 A;  4KUN A;  5B6M A;  1Y6E A;  4KSM A;  1R7H A;  1BG5 A;  4AGS A;  2VLV A;  1GSU A;  1PRX A;  5IM9 A;  3IRA A;  2AJQ B;  1DBY A;  1X5C A;  1SJI A;  3ME8 A;  2VL2 A;  5JWR B;  1VF3 A;  2V6O A;  2MMZ A;  3MDK A;  1K0B A;  1A2L A;  2Z9S A;  3TKS E;  2YV9 A;  3QPM A;  11GS A;  2M72 A;  4MH3 A;  1PSQ A;  2C3N A;  4N10 A;  2QKE A;  5CRE A;  1YZX A;  2GGT A;  4YH2 A;  5ELG A;  4EC0 A;  2DML A;  4HJ2 A;  1Z5Y E;  2X8H A;  3IPZ A;  2CVB A;  5DDL A;  1EEJ A;  3ZRD A;  4WBR D;  4OCF A;  2JL4 A;  2I1U A;  5H5Q A;  1GSS A;  2GVP A;  4ECC A;  4PXO A;  2LRN A;  2OA7 A;  1B48 A;  5JCW A;  2I3Y A;  4OWY A;  5IMD A;  1F2E A;  3GTU B;  3GYK A;  1TRS A;  2GS3 A;  2FGX A;  3CRT A;  3IC4 A;  3P7X A;  1M99 A;  3GST A;  1K3L A;  2O7K A;  5DCH A;  5KN0 A;  3F3Q A;  2G2Q A;  1BED A;  1YEX A;  5G5E A;  4KAE A;  20GS A;  4F9Z A;  3LYK A;  1T3B A;  3WGX A;  1OYJ A;  4IQA A;  4K0N A;  2XPE A;  1SK0 A;  4O5R A;  1GTB A;  3FZ4 A;  1TK0 B;  5IMV A;  5DCG A;  1K0C A;  2DBC A;  5HFG A;  1T8E B;  1K0O A;  4AF2 A;  1QMV A;  2JZT A;  1SL2 B;  2L5L A;  3EE2 A;  4HZ2 A;  4L5O A;  4H86 A;  6GST A;  2PUK C;  3FK8 A;  2IFQ A;  3LFL A;  2BJX A;  3BBY A;  1K3Y A;  5L71 A;  4WF5 A;  1A23 A;  4IEL A;  2LST A;  1NM3 A;  2GSS A;  4GRF A;  2LJA A;  3GUR A;  2B5X A;  2VCV A;  4KCE A;  4I2T A;  5FT3 A;  3EU3 A;  4ISD A;  2YWN A;  4O7H A;  4TR0 A;  3GA4 A;  2HZE A;  2LRT A;  5AIV A;  3WGE A;  1FB6 A;  3GFK A;  1TP9 A;  3UBK A;  1ZL9 A;  3IK7 A;  4TOP A;  2KP1 A;  1XVQ A;  2LS5 A;  3RPN A;  4YQU A;  4G10 A;  4ML6 A;  2E7P A;  2KLX A;  1NW2 A;  1XZO A;  4F0C A;  4JE1 A;  1RK4 A;  4EF0 A;  4Z7X A;  4MJE A;  1B8X A;  2MBS A;  2HYX A;  3BCI A;  2FHE A;  4ZB6 A;  3R2Q A;  4JR6 A;  3ZFL A;  5AIX A;  3F4R A;  1ZYE A;  5IPG A;  2H72 A;  1SJ6 A;  4K0G A;  3DML A;  3HA9 A;  8GSS A;  1OE7 A;  1OAZ A;  2LV3 A;  5IO0 A;  3LEF A;  3FR3 A;  1R5P A;  4RI7 A;  2N5A A;  3UMA A;  5GZZ B;  3GX8 A;  2IMI A;  3ERW A;  1PX6 A;  4PQ1 A;  1G0T A;  1AQV A;  4ZB9 A;  4JED A;  2H76 A; 
#chains in the Genus database with same CATH topology
 3HXS A;  4QL7 A;  3PIN A;  3KMN A;  4Q5F A;  3UAP A;  2NTO A;  2C1Y A;  1O8X A;  2UZ8 A;  3TKP A;  1XXU A;  4WBJ A;  2B7K A;  1YKC A;  4JRR A;  5A4U A;  4Q5N A;  3D21 A;  2HFD A;  1T4Y A;  2FWE A;  4I2U A;  5GAP D;  2H1A A;  4G9H A;  2O8V B;  4K9Z A;  1F9M A;  4CW9 A;  3TOT A;  3GL5 A;  3DGQ A;  4HJM A;  1F37 A;  3ZML A;  1M0U A;  4WEY A;  3D22 A;  3VI7 A;  2L4Q A;  2R2J A;  2OE1 A;  1SL0 B;  1UC7 A;  4K7N A;  4V2L A;  3GTU A;  1GH2 A;  4TRX A;  1OKD A;  4QQ7 A;  3FZ5 A;  3FZA A;  4YQM A;  4K5S A;  4AJ6 A;  3NIV A;  4A5P A;  3TCO A;  3UAR A;  5IO2 A;  3GNJ A;  2LNT A;  2JSZ A;  2X8C A;  4PGT A;  2MMA A;  4FH8 A;  3QAV A;  2H6Z A;  2H6X A;  4QL9 A;  2B6M A;  3LSZ A;  3RDW A;  1Y25 A;  4O92 A;  2TIR A;  2YNX A;  4XS4 B;  2DMM A;  4K1F A;  1TJD A;  4ZBB A;  3HVV A;  5E59 A;  4BWS A;  2IMK A;  1X5D A;  4X43 A;  3WYW A;  1T7P B;  4X1U A;  1O6J A;  2YWM A;  2P0G A;  1M3I A;  3DWV A;  13GS A;  2FWH A;  2X4A A;  2EIR A;  3KH7 A;  3WT2 A;  5IMF A;  2KOK A;  3SBC A;  3F4S A;  4L8E A;  2FWG A;  5AN1 A;  1PA3 A;  6GSS A;  4MH2 A;  3TKR A;  5ECR B;  1A24 A;  4MF6 A;  4E8H A;  4MA9 A;  4MZC A;  2OAC A;  4D73 B;  1X0R A;  4MK3 A;  4JR4 A;  4ICY A;  5BRT A;  3A5W A;  3J7Y k;  2PMT A;  3K8N A;  3UVH A;  3ZLP A;  3ZVJ A;  2WDU A;  3BJ5 A;  4MCU A;  1B4P A;  1K3O A;  3JCM L;  1QFN A;  2PVO C;  3A5I A;  4USS A;  3Q18 A;  3ZMK A;  1WRY A;  3M1G A;  2JZS A;  2V2G A;  1BJX A;  4TXO A;  4IJI A;  3KM6 A;  4ZBA A;  1VF4 A;  3HHV A;  2N5F A;  5DQY A;  3VK9 A;  1EV4 A;  3CRU A;  2A2S A;  1QGV A;  2DJ0 A;  1M9B A;  2NVL A;  1XFL A;  4XRD A;  1V58 A;  2QA2 A;  1X9S B;  3CSH A;  4OMV A;  2J23 A;  5J41 A;  5CRD A;  2R6K A;  2HRN A;  2HRK A;  3QMX A;  1GSE A;  4KE3 A;  1MEK A;  5J5N A;  3E0U A;  3HKR A;  1I9D A;  1A2J A;  1TXX A;  1EWX A;  2CZ2 A;  2O85 A;  3EMP A;  2F8F A;  1GUK A;  1GTA A;  1YY7 A;  2LUS A;  1THO A;  3H79 A;  3N9J A;  4NV5 A;  2KHP A;  2B1K A;  2AUV A;  4ZXG A;  2FCH A;  3ZRE A;  4HQZ A;  4OFN A;  3ZIT A;  2K9F A;  3V1W A;  4V2M A;  3O3T A;  4F0B A;  1U87 A;  2HI7 A;  4LA1 A;  2PGT A;  3HJP A;  2PBJ A;  3TJJ A;  2HZE B;  3US3 A;  2ZCT A;  4HOJ A;  3FMW A;  3IC8 A;  4WET A;  1AQW A;  3DIE A;  1B9Y C;  4K2X A;  1JHB A;  2LKU A;  1YKA A;  5G1L A;  1UA5 A;  3IV4 A;  2M46 A;  1EEM A;  4Q5R A;  1F3A A;  2GZP A;  5HFK A;  2L4C A;  1E6B A;  4JZQ A;  2LQQ A;  1ACV A;  3C1R A;  2CVD A;  1HNB A;  3GUS A;  1BX9 A;  1TK5 B;  3LXZ A;  1EOG A;  2C0E A;  6GSX A;  2YZU A;  2GQL A;  4NHW A;  3GKM A;  4V2N A;  3KEB A;  3QFB C;  3H4K A;  5B8A A;  2H70 A;  3VWX A;  2AHE A;  3HD5 A;  3PH9 A;  2K18 A;  4HZ4 A;  4Z2T A;  1S3D A;  3KJY A;  3VPT A;  2B3S A;  2VD1 A;  2DJK A;  3LW9 A;  2JAC A;  3GN3 A;  4RUV A;  4OO4 A;  2QC7 A;  4CY6 A;  1SKS B;  4XS4 A;  5ELA A;  2VO4 A;  1PFO A;  1SKR B;  2GLR A;  3MNG A;  4MJA A;  4PUA A;  5IPH A;  4EXJ A;  4KDY A;  4ZBD A;  2YCD A;  1Z3E A;  5DAL B;  2B7J A;  3CTG A;  2DKI A;  4MZW A;  3KP9 A;  2FNO A;  3F6D A;  1TKD B;  4I97 A;  3VWV A;  4GQF A;  1SKW B;  1S3R A;  4KW6 A;  1XOA A;  2CV4 A;  2HXK A;  4YKG A;  3QAW A;  4I5Q A;  3RPP A;  1A8L A;  2X8G A;  4ZL8 A;  1X5E A;  5DVB A;  3Q19 A;  1XOB A;  2AAW A;  1U3A A;  3HVN A;  3ZYW A;  3TJG A;  4K6X A;  4D73 A;  3TB2 A;  4HU9 A;  1JLV A;  3KTL A;  3L78 A;  1TI3 A;  2DC5 A;  1PMT A;  3IA1 A;  2E0Q A;  2DJ2 A;  2DIZ A;  1YF1 A;  1FOV A;  2CX3 A;  1GWC A;  1GSD A;  1WJK A;  5C00 A;  3HJM A;  5JCG A;  3IXR A;  2F51 A;  1GLP A;  2AB6 A;  5A4V A;  2VM1 A;  3C73 A;  1PN9 A;  2YPM A;  3LYP A;  3EVI A;  3GV1 A;  2GSR A;  1V98 A;  4F03 A;  1BQ7 A;  4DSQ A;  4EDY A;  4G0L A;  2CT6 A;  4HI7 A;  3UOM A;  2D2Z A;  2K6V A;  5CO3 A;  3I6A A;  1OKT A;  2VCX A;  3MAK A;  5F0G A;  3APO A;  5ECN B;  3G7I A;  1AW9 A;  3LWA A;  1Z7P A;  1J08 A;  1B4Q A;  4EKZ A;  5AGY A;  2LEG A;  1IYH A;  1NSW A;  3UJ1 A;  4J2F A;  5CNW A;  4HSC X;  1V57 A;  5D9X A;  5EY6 A;  2IME A;  3QOU A;  4N0Z A;  2OAD A;  5DJM A;  3ZVJ D;  1TTZ A;  5A5K A;  1OC3 A;  5HFI A;  2YJ7 A;  1VGL A;  1UVZ A;  5JCU A;  1PGT A;  2YN1 A;  1J9B A;  3TJF A;  4ULX A;  1GSF A;  1NHY A;  1WIK A;  3UBL A;  1A8Y A;  3M9J A;  5J3R A;  3ZZX A;  2P5R A;  4KB3 A;  3CXG A;  4EL1 A;  5ECH B;  1N8J A;  4TXO B;  1CQG A;  4DEJ A;  1KEB A;  3QD9 A;  4HEA 2;  3DVX A;  3LQ7 A;  1Z6M A;  1T4Z A;  2PVQ A;  2R5G A;  3CBU A;  2YP6 A;  2M80 A;  2KP2 A;  3HZ4 A;  2OKA A;  1GSY A;  2PER A;  2ON7 A;  1V40 A;  2XC2 A;  4GWR A;  1SD8 A;  2DJ3 A;  2AV4 A;  2WRT A;  4YQV A;  4IVF A;  4BVX B;  3A2V A;  4MLY A;  3E3E A;  1YQ1 A;  3U5R E;  2GST A;  2XBQ A;  1UN2 A;  2FLS A;  4K7I A;  4OFM A;  2CAQ A;  4K8M A;  2GT5 A;  1Z9H A;  1K0N A;  5GAN D;  2IL3 A;  4IN0 A;  4GXZ A;  1M9A A;  4ECB A;  3HJO A;  4NHZ A;  5IQY A;  2WFC A;  3FYG A;  2BMX A;  1EZK A;  4OFT A;  1DSB A;  3IHG A;  1KBN A;  1QQ2 A;  1S3A A;  3MSZ A;  2AYT A;  3DD3 A;  1PKZ A;  2G0F A;  2LTK A;  1V9W A;  1MDJ A;  4CDO A;  2DJJ A;  2LJK A;  2O87 A;  4TR4 A;  5DAL A;  2L5O A;  2LRC A;  2FWF A;  2VOC A;  2JU5 A;  5G31 A;  1XW5 A;  2LJR A;  2JAD A;  1ILO A;  4KA0 A;  1GLQ A;  5B7C A;  2HLS A;  2PWJ A;  3ERF A;  3A2W A;  2HSH A;  3TUE A;  3MYD A;  2C0D A;  2TRC P;  1GTI A;  3L9U A;  4DSR A;  1GUH A;  2WCI A;  2H66 A;  1V2A A;  2KUC A;  1X9W B;  3F63 A;  4GSS A;  5ECI B;  2H19 A;  5B6N A;  4ILF A;  3F8U A;  1C72 A;  1FVK A;  1Z6N A;  4FYU A;  3IAM 2;  1HD2 A;  3F9U A;  5J9B A;  3D6I A;  3QDN A;  1TU7 A;  4BPY A;  3IAS 2;  4NXI A;  3RAZ A;  3UVT A;  1GNE A;  2YWO A;  2VD0 A;  2DIY A;  3A3T A;  2ALB A;  4I6X A;  3M9K A;  4G19 A;  4X4J A;  1EGR A;  4RQX A;  4NPB A;  2V1M A;  3M8N A;  5IMA A;  2LQO A;  2BTO T;  1TRU A;  4L0U A;  4L0W A;  1WPI A;  1VF2 A;  4BL7 B;  2WB9 A;  5F8B A;  2YAN A;  1U88 A;  6GSU A;  3GHA A;  5LD0 A;  3UEM A;  4MMM A;  3W8S A;  4POK A;  2GTU A;  4ID0 A;  1SK1 A;  5KN3 A;  5FWG A;  3C7M A;  2VCW A;  1TDI A;  2X64 A;  1SJZ A;  5ECO B;  9GSS A;  1TRV A;  5DBQ A;  3VUR A;  1TW9 A;  1B9X C;  2C8U A;  1XWC A;  5D96 A;  2H30 A;  2OBK A;  5BMU A;  3QAG A;  3TOU A;  2PPT A;  5A4W A;  3SWL A;  3RHC A;  1LU4 A;  1OVN A;  3DYR A;  3L9V A;  3EC3 A;  4TR1 B;  4XS6 A;  3H93 A;  3KZQ A;  4PNG A;  2HNL A;  4ECJ A;  5G2Z A;  3D4T A;  1MD3 A;  5DQS A;  5IOX A;  5D8I A;  1ABA A;  4MJB A;  2GQM A;  4I8B A;  2V6K A;  2DLX A;  3A2X A;  4E8E A;  2NPB A;  2C80 A;  1M7T A;  3GSS A;  2R3X A;  3ZTL A;  1RQM A;  2LNS A;  4IS0 A;  4EVM A;  2IMD A;  3TJK A;  1R26 A;  4Q5Q A;  3TJB A;  6GSY A;  1ZCP A;  3EUR A;  1TK8 B;  1Z7R A;  2R0P A;  1ERT A;  2RUE A;  4MAB A;  2C0G A;  3TRP A;  2RII A;  5KN1 A;  1GL8 A;  3RBT A;  3G7Y A;  1HYU A;  1Q98 A;  1AIU A;  4OO5 A;  4EIQ A;  3F6F A;  4BVX A;  1AAZ A;  5LNK e;  3J7Y b;  2JSY A;  2C4J A;  1THX A;  4WF4 A;  4J57 E;  4KND A;  5G1K A;  3F4T A;  4OCE A;  1TI1 A;  1O73 A;  3IE3 A;  3DEX A;  1O7U A;  2OE3 A;  4TN8 A;  2IIY A;  1GTU A;  4G0K A;  5G5F A;  2X49 A;  4EUY A;  3I9V 2;  4XRA A;  3DRN A;  3FKF A;  1X9M B;  2IN3 A;  4G0I A;  2H6Y A;  2L6D A;  2HT9 A;  2XPD A;  4LL4 B;  2L59 A;  1AXD A;  2H01 A;  3KIJ A;  1G6Y A;  2H0G A;  3NZN A;  1XW9 A;  2FA8 A;  2H75 A;  4NMU A;  4ZB8 A;  3LGC A;  4F82 A;  2RLI A;  5CRG A;  3W6G A;  6GSW A;  5EPF A;  4MP4 A;  4GCI A;  1HNA A;  3CQF A;  1GNW A;  5ENU A;  1XWG A;  3PR8 A;  4PNF A;  1U3I A;  6GSV A;  2GQK A;  4IP1 A;  3QR6 A;  1SYR A;  3WD6 A;  1JLW A;  2H1D A;  5JWO B;  5C04 A;  4DVC A;  5H5S A;  3FY7 A;  1J0F A;  1PN0 A;  4HDE A;  1VF1 A;  4PX1 A;  5G30 A;  3CMI A;  3FR6 A;  4RQR A;  2EIO A;  4XIH A;  2I4A A;  5ABR A;  5D9V A;  2MYG A;  1G7O A;  1W4V A;  3LOR A;  4POM A;  4BVY A;  2I9H A;  5IMZ A;  1TU8 A;  2IPA A;  5ECQ B;  5DAK A;  1EP7 A;  3GRX A;  1M3J A;  3GKK A;  4GF0 A;  1OC8 A;  1ERW A;  1XWA A;  3KCM A;  5CP1 A;  3TKS A;  1PKW A;  1NHO A;  5HR2 A;  2E2M A;  2H1G A;  2QGV A;  4BL7 A;  4X0X A;  1ZZY A;  3I43 A;  4NV2 A;  3CYN A;  4WXT A;  3IK9 A;  1GP1 A;  4GTU A;  2MBT A;  3PPU A;  5ECK B;  3M0F A;  1XWK A;  2DKH A;  2VM2 A;  1O85 A;  1WP0 A;  2C3T A;  2IJY A;  4FIW A;  1ON4 A;  2H71 A;  5HR3 A;  1GRX A;  3S9F A;  3VWW A;  1A2M A;  4O5Q A;  4MPG A;  4PQI A;  2P5Q A;  4TR1 A;  1E2Y A;  2A4H A;  3G9B A;  4XTS A;  4YAP A;  1W89 A;  4WKW A;  3TKQ A;  2MMN A;  4ZIJ A;  2REM A;  2FY6 A;  2F9S A;  2K8V A;  5D73 A;  4IW9 A;  5CAX A;  1T00 A;  1F6M C;  1QUW A;  2YZH A;  4TW5 A;  5D9W A;  1MTC A;  4EE0 A;  5EVO A;  3FW2 A;  4HS1 A;  3F0I A;  2VL3 A;  4PUR A;  2FUG 2;  1JZW A;  2CA8 A;  4IP6 A;  5IMC A;  1XBS A;  3O76 A;  2OJL A;  2RUF A;  1YDK A;  2GDR A;  1GUL A;  4WR4 A;  3FEU A;  4GQC A;  2MMO A;  3U6V A;  5D93 A;  2N5B A;  2WUL A;  3CSJ A;  1SEN A;  2NDO A;  3C1S A;  3GH6 A;  1H75 A;  1AUC A;  2H8L A;  2RM6 A;  4RI6 A;  5ID2 B;  2H1B A;  4ZIL A;  10GS A;  1ST9 A;  1AC1 A;  3KXO A;  2P31 A;  3ISO A;  5H5R A;  1F3B A;  1DE2 A;  3EU4 A;  4KGI A;  3GL3 A;  3TDG A;  3ED3 A;  4MDC A;  3AY8 A;  1HNC A;  5ECM B;  4FQU A;  2RM5 A;  2YWI A;  1K0A A;  4K5R A;  4TKY A;  5INY A;  2FA4 A;  1VRS D;  2HZF A;  19GS A;  3P90 A;  1M2D A;  4J56 E;  3F3R A;  1WOU A;  3LJR A;  1FHE A;  1WE0 A;  1A0R P;  2R0G A;  4EDZ A;  4HQS A;  1TRW A;  12GS A;  1ML6 A;  2NBS A;  2EIQ A;  4IJ3 A;  4MJC A;  2X99 A;  3ZFB A;  1ZGN A;  4EO3 A;  1OC9 A;  1FVJ A;  1ZMA A;  2B1L A;  2I81 A;  4LMW A;  4IKH A;  2CX4 A;  3HZ8 A;  3P8W A;  4G2E A;  4K7O A;  2YOI A;  1K0M A;  2V41 A;  2F3M A;  2GT6 A;  1FO5 A;  3L4N A;  3OR5 A;  5GSS A;  4MF5 A;  18GS A;  2B5Y A;  3P2A A;  2VAF A;  2VLU A;  1FAA A;  2B5E A;  4ML1 A;  2VCZ A;  1BYE A;  1Q4J A;  3UL3 A;  1JZR A;  4O5U A;  1FW1 A;  4BIK A;  3HVS A;  4XS1 A;  3I69 A;  4L5L A;  1MD4 A;  4V1A p;  1MDI A;  4HUA A;  3HY2 A;  4WR5 A;  3D4M A;  2O89 A;  2MZC A;  1HQO A;  5KOW A;  1XCC A;  4MZB A;  1M2A A;  2VCT A;  1EOH A;  3L0H A;  3DKS A;  1ZYP A;  5LCZ A;  3ZIV A;  3O6T A;  4XHM A;  3EYT A;  3NOF A;  4MF7 A;  3GKX A;  5ECL B;  3VWU A;  2R4V A;  2JZR A;  3EPT A;  3GIX A;  1XIY A;  7GSS A;  5E4W A;  1N2A A;  3BCK A;  3L9S A;  4GLT A;  2CQ9 A;  5CRW A;  4ACS A;  4CHS A;  1O81 A;  2ZNM A;  1KNG A;  1CQH A;  5CRH A;  1G7E A;  4ZL7 A;  4POL A;  1OE8 A;  1BAY A;  1ZOF A;  4AJ7 A;  2FD3 A;  4O32 A;  3WT1 A;  2L57 A;  4BWQ A;  1SYX A;  2H73 A;  4NWY A;  1R4W A;  1O8W A;  2K8S A;  3PGT A;  3R3E A;  4GSN A;  5JWQ B;  1YF0 A;  4PQH A;  2VLT A;  5F07 A;  2PU9 C;  4DSS B;  4BVY B;  3EIN A;  3EWL A;  5F05 A;  1ZYQ B;  4ZL9 A;  5DAK B;  4KDX A;  1H4O A;  2R37 A;  5IOW A;  1U6T A;  2XBI A;  1XWB A;  4F2I A;  14GS A;  4HU7 A;  5DJL A;  16GS A;  4KCA A;  3IR4 A;  3KP8 A;  3LG6 A;  2TRX A;  1YEP A;  3H8Q A;  4N0V A;  1ZYN A;  1PD2 1;  2HSY A;  3VLN A;  2A2P A;  1G6W A;  4XCS A;  1K0D A;  1DUG A;  1PL2 A;  2CAI A;  4IHU A;  5ID2 A;  3GMF A;  5B8B A;  2HE3 A;  3CTF A;  1IYI A;  2H0I A;  3VPQ A;  22GS A;  4N30 A;  1FG4 A;  3APQ A;  4N11 A;  2VIM A;  1USB A;  3TRQ A;  2DSA A;  2WJU A;  5AIS A;  2ON5 A;  4KH7 A;  4P3Y B;  4LMV A;  3N5O A;  3UIW A;  1QXH A;  2GZZ A;  3IOS A;  3VFI A;  3FHK A;  3KTB A;  1R5A A;  2C0F A;  3GKN A;  4JBB A;  3BOA A;  1AQX A;  3MWH A;  2WS2 A;  4POB A;  2XHF A;  5IIZ A;  1TOF A;  5EL8 A;  4FYC A;  1LJR A;  1S3C A;  1WWJ A;  1T1V A;  5GST A;  4PUF C;  3ME7 A;  5CYY A;  1QK8 A;  3KH9 A;  3KMO A;  4FYB A;  3ZIJ A;  2V32 A;  3E9J B;  5J4U A;  1EV9 A;  1RW1 A;  2VUP A;  1GSQ A;  2GSQ A;  3KD0 A;  3GH9 A;  3Q6O A;  5HQP A;  5FHI A;  3FZ9 A;  2WZ9 A;  1XPV A;  2WGR A;  3C8E A;  3D0Z A;  5HR1 A;  1WMJ A;  5ECP B;  4KSO A;  3C71 A;  1ERU A;  1URM A;  2A2R A;  1EGO A;  2F8A A;  2L6C A;  3VI5 A;  3ZL5 A;  1JZO A;  3WGD A;  1I5G A;  3IHQ A;  2ZUP A;  2DJ1 A;  1A0F A;  2A4V A;  2C3Q A;  3HYP A;  4IBP A;  4K2D A;  1XVW A;  2OE0 A;  4MPF A;  3TKS C;  3MIX A;  4FO5 A;  2YJH A;  3QCP A;  1KTE A;  4LL1 B;  2R0C A;  3HCZ A;  2CVK A;  2IWT A;  1MDK A;  5D9T A;  4NAX A;  4ECI A;  5KN2 A;  1PL1 A;  2E2G A;  5F06 A;  3LXT A;  5J9C A;  1PQN A;  2IFQ B;  4KF9 A;  2VL2 C;  3BD2 A;  2HRF A;  3EMX A;  4IGJ A;  3W8J A;  1SK2 A;  1JZD A;  4KDU A;  2HSM A;  4TR3 A;  2PN8 A;  3Q74 A;  4OD7 A;  4EIP A;  4AJ8 A;  3KGK A;  2QSI A;  2HRA A;  1XW6 A;  1SL1 B;  3DXB A;  3D5J A;  2H0H A;  2J9H A;  1PX7 A;  1ERV A;  1OC9 B;  17GS A;  4BA7 A;  3IDV A;  1SU9 A;  3CSI A;  4V1A g;  2GZY A;  4TXV A;  1SD9 A;  3DVW A;  3IBH A;  3G7J A;  4YAV A;  2QA1 A;  1YJ6 A;  3HVX A;  5KEJ A;  3M3M A;  1M2B A;  3FRC A;  3GX0 A;  3TRX A;  3ERG A;  4KX4 A;  1LBK A;  3TGZ A;  2YV7 A;  2IMF A;  5HR0 A;  1GUM A;  1JFU A;  3FR9 A;  3HDC A;  4DSS A;  3APS A;  4TVE A;  2OBI A;  4JU5 A;  4Z2U A;  4IQ1 A;  5ECS A;  2CZ3 A;  3QFA C;  4GST A;  4LLR A;  2VCQ A;  2H74 A;  2ES7 A;  1EP8 A;  2VL9 A;  1FB0 A;  3RHB A;  1DE1 A;  3H1N A;  5COH A;  2EC4 A;  4KUN A;  5B6M A;  1Y6E A;  4KSM A;  1R7H A;  1BG5 A;  4AGS A;  1FOH A;  1GSU A;  2VLV A;  1PRX A;  5IM9 A;  3IRA A;  2AJQ B;  1DBY A;  1X5C A;  1SJI A;  3ME8 A;  2VL2 A;  5JWR B;  4CY8 A;  1VF3 A;  2V6O A;  2MMZ A;  3MDK A;  1K0B A;  1A2L A;  2Z9S A;  3TKS E;  2YV9 A;  3QPM A;  11GS A;  2M72 A;  4MH3 A;  1PSQ A;  2C3N A;  4N10 A;  2QKE A;  5CRE A;  1YZX A;  2GGT A;  4YH2 A;  5ELG A;  4EC0 A;  5KOX A;  2DML A;  4HJ2 A;  1Z5Y E;  2X8H A;  3IPZ A;  2CVB A;  5DDL A;  1EEJ A;  3ZRD A;  4WBR D;  4OCF A;  2JL4 A;  2I1U A;  5H5Q A;  1GSS A;  2GVP A;  4ECC A;  4PXO A;  2LRN A;  2OA7 A;  1B48 A;  5JCW A;  2I3Y A;  4OWY A;  5IMD A;  1F2E A;  3GTU B;  3GYK A;  1TRS A;  2GS3 A;  2FGX A;  3CRT A;  3IC4 A;  3P7X A;  4YKF A;  1M99 A;  3GST A;  4MNN A;  1K3L A;  2O7K A;  5DCH A;  5KN0 A;  3F3Q A;  2G2Q A;  1BED A;  1YEX A;  5G5E A;  4KAE A;  20GS A;  4F9Z A;  3LYK A;  1T3B A;  3WGX A;  1OYJ A;  4IQA A;  4K0N A;  2XPE A;  1SK0 A;  4O5R A;  1GTB A;  3FZ4 A;  1TK0 B;  5IMV A;  5DCG A;  1K0C A;  2DBC A;  5HFG A;  1T8E B;  1K0O A;  4AF2 A;  1QMV A;  2JZT A;  1SL2 B;  2L5L A;  3EE2 A;  4HZ2 A;  4L5O A;  4H86 A;  6GST A;  2PUK C;  3FK8 A;  2IFQ A;  3LFL A;  2BJX A;  4Z2R A;  3BBY A;  1K3Y A;  5L71 A;  4WF5 A;  1A23 A;  4PTS A;  4IEL A;  2LST A;  1NM3 A;  2GSS A;  4GRF A;  2LJA A;  3GUR A;  2B5X A;  2VCV A;  4KCE A;  4I2T A;  5FT3 A;  3EU3 A;  4ISD A;  2YWN A;  4O7H A;  4TR0 A;  3GA4 A;  2HZE A;  2LRT A;  5AIV A;  3WGE A;  1FB6 A;  3GFK A;  1TP9 A;  3UBK A;  1ZL9 A;  3IK7 A;  4TOP A;  2KP1 A;  1XVQ A;  2LS5 A;  3RPN A;  4YQU A;  4G10 A;  4ML6 A;  2E7P A;  1XG8 A;  2KLX A;  1NW2 A;  1XZO A;  4F0C A;  4JE1 A;  1RK4 A;  4EF0 A;  4Z7X A;  4MJE A;  1B8X A;  2MBS A;  2HYX A;  3BCI A;  2FHE A;  4ZB6 A;  3R2Q A;  4JR6 A;  3ZFL A;  5AIX A;  3F4R A;  1ZYE A;  5IPG A;  2H72 A;  1SJ6 A;  4K0G A;  3DML A;  3HA9 A;  8GSS A;  1OE7 A;  1OAZ A;  2LV3 A;  5IO0 A;  3LEF A;  3FR3 A;  1R5P A;  4RI7 A;  2N5A A;  3UMA A;  5GZZ B;  3GX8 A;  2IMI A;  3ERW A;  1PX6 A;  4PQ1 A;  1G0T A;  1AQV A;  4ZB9 A;  4JED A;  2H76 A; 
#chains in the Genus database with same CATH homology
 3HXS A;  4QL7 A;  3PIN A;  3KMN A;  4Q5F A;  3UAP A;  2NTO A;  2C1Y A;  1O8X A;  2UZ8 A;  3TKP A;  1XXU A;  4WBJ A;  2B7K A;  1YKC A;  4JRR A;  5A4U A;  4Q5N A;  3D21 A;  2HFD A;  1T4Y A;  2FWE A;  4I2U A;  5GAP D;  2H1A A;  4G9H A;  2O8V B;  4K9Z A;  1F9M A;  4CW9 A;  3TOT A;  3GL5 A;  3DGQ A;  4HJM A;  1F37 A;  3ZML A;  1M0U A;  4WEY A;  3D22 A;  3VI7 A;  2L4Q A;  2R2J A;  2OE1 A;  1SL0 B;  1UC7 A;  4K7N A;  4V2L A;  3GTU A;  1GH2 A;  4TRX A;  1OKD A;  4QQ7 A;  3FZ5 A;  3FZA A;  4YQM A;  4K5S A;  4AJ6 A;  3NIV A;  4A5P A;  3TCO A;  3UAR A;  5IO2 A;  3GNJ A;  2LNT A;  2JSZ A;  2X8C A;  4PGT A;  2MMA A;  4FH8 A;  3QAV A;  2H6Z A;  2H6X A;  4QL9 A;  2B6M A;  3LSZ A;  3RDW A;  1Y25 A;  4O92 A;  2TIR A;  2YNX A;  4XS4 B;  2DMM A;  4K1F A;  1TJD A;  4ZBB A;  3HVV A;  5E59 A;  4BWS A;  2IMK A;  1X5D A;  4X43 A;  3WYW A;  1T7P B;  4X1U A;  1O6J A;  2YWM A;  2P0G A;  3DWV A;  13GS A;  2FWH A;  2X4A A;  2EIR A;  3KH7 A;  3WT2 A;  5IMF A;  2KOK A;  3SBC A;  3F4S A;  4L8E A;  2FWG A;  5AN1 A;  1PA3 A;  6GSS A;  4MH2 A;  3TKR A;  5ECR B;  1A24 A;  4MF6 A;  4E8H A;  4MA9 A;  4MZC A;  2OAC A;  4D73 B;  1X0R A;  4MK3 A;  4JR4 A;  4ICY A;  5BRT A;  3A5W A;  3J7Y k;  2PMT A;  3K8N A;  3UVH A;  3ZLP A;  3ZVJ A;  2WDU A;  3BJ5 A;  4MCU A;  1B4P A;  1K3O A;  3JCM L;  1QFN A;  2PVO C;  3A5I A;  4USS A;  3Q18 A;  3ZMK A;  1WRY A;  3M1G A;  2JZS A;  2V2G A;  1BJX A;  4TXO A;  4IJI A;  3KM6 A;  4ZBA A;  1VF4 A;  3HHV A;  2N5F A;  5DQY A;  3VK9 A;  1EV4 A;  3CRU A;  2A2S A;  1QGV A;  2DJ0 A;  1M9B A;  2NVL A;  1XFL A;  4XRD A;  1V58 A;  2QA2 A;  1X9S B;  3CSH A;  4OMV A;  2J23 A;  5J41 A;  5CRD A;  2R6K A;  2HRN A;  2HRK A;  3QMX A;  1GSE A;  4KE3 A;  1MEK A;  5J5N A;  3E0U A;  3HKR A;  1I9D A;  1A2J A;  1TXX A;  1EWX A;  2CZ2 A;  2O85 A;  3EMP A;  2F8F A;  1GUK A;  1GTA A;  1YY7 A;  2LUS A;  1THO A;  3H79 A;  3N9J A;  4NV5 A;  2KHP A;  2B1K A;  2AUV A;  4ZXG A;  2FCH A;  3ZRE A;  4HQZ A;  4OFN A;  3ZIT A;  2K9F A;  3V1W A;  4V2M A;  3O3T A;  4F0B A;  1U87 A;  2HI7 A;  4LA1 A;  2PGT A;  3HJP A;  2PBJ A;  3TJJ A;  2HZE B;  3US3 A;  2ZCT A;  4HOJ A;  3FMW A;  3IC8 A;  4WET A;  1AQW A;  3DIE A;  1B9Y C;  4K2X A;  1JHB A;  2LKU A;  1YKA A;  5G1L A;  1UA5 A;  3IV4 A;  2M46 A;  1EEM A;  4Q5R A;  1F3A A;  2GZP A;  5HFK A;  2L4C A;  1E6B A;  4JZQ A;  2LQQ A;  1ACV A;  3C1R A;  2CVD A;  1HNB A;  3GUS A;  1BX9 A;  1TK5 B;  3LXZ A;  1EOG A;  2C0E A;  6GSX A;  2YZU A;  2GQL A;  4NHW A;  3GKM A;  4V2N A;  3KEB A;  3QFB C;  3H4K A;  5B8A A;  2H70 A;  3VWX A;  2AHE A;  3HD5 A;  3PH9 A;  2K18 A;  4HZ4 A;  4Z2T A;  1S3D A;  3KJY A;  3VPT A;  2B3S A;  2VD1 A;  2DJK A;  3LW9 A;  2JAC A;  3GN3 A;  4RUV A;  4OO4 A;  2QC7 A;  4CY6 A;  1SKS B;  4XS4 A;  5ELA A;  2VO4 A;  1SKR B;  2GLR A;  3MNG A;  4MJA A;  4PUA A;  5IPH A;  4EXJ A;  4KDY A;  4ZBD A;  2YCD A;  1Z3E A;  5DAL B;  2B7J A;  3CTG A;  2DKI A;  4MZW A;  3KP9 A;  2FNO A;  3F6D A;  1TKD B;  4I97 A;  3VWV A;  4GQF A;  1SKW B;  4KW6 A;  1XOA A;  2CV4 A;  2HXK A;  4YKG A;  3QAW A;  4I5Q A;  3RPP A;  1A8L A;  2X8G A;  4ZL8 A;  1X5E A;  5DVB A;  3Q19 A;  1XOB A;  2AAW A;  1U3A A;  3ZYW A;  3TJG A;  4K6X A;  4D73 A;  3TB2 A;  4HU9 A;  1JLV A;  3KTL A;  3L78 A;  1TI3 A;  2DC5 A;  1PMT A;  3IA1 A;  2E0Q A;  2DJ2 A;  2DIZ A;  1YF1 A;  1FOV A;  2CX3 A;  1GWC A;  1GSD A;  1WJK A;  5C00 A;  3HJM A;  5JCG A;  3IXR A;  2F51 A;  1GLP A;  2AB6 A;  5A4V A;  2VM1 A;  3C73 A;  1PN9 A;  2YPM A;  3LYP A;  3EVI A;  3GV1 A;  2GSR A;  1V98 A;  4F03 A;  1BQ7 A;  4DSQ A;  4EDY A;  4G0L A;  2CT6 A;  4HI7 A;  3UOM A;  2D2Z A;  2K6V A;  5CO3 A;  3I6A A;  1OKT A;  2VCX A;  3MAK A;  5F0G A;  3APO A;  5ECN B;  3G7I A;  1AW9 A;  3LWA A;  1Z7P A;  1J08 A;  1B4Q A;  4EKZ A;  5AGY A;  2LEG A;  1IYH A;  1NSW A;  3UJ1 A;  4J2F A;  5CNW A;  1V57 A;  5D9X A;  5EY6 A;  2IME A;  3QOU A;  4N0Z A;  2OAD A;  5DJM A;  3ZVJ D;  1TTZ A;  5A5K A;  1OC3 A;  5HFI A;  2YJ7 A;  1VGL A;  1UVZ A;  5JCU A;  1PGT A;  2YN1 A;  1J9B A;  3TJF A;  4ULX A;  1GSF A;  1NHY A;  1WIK A;  3UBL A;  1A8Y A;  3M9J A;  5J3R A;  3ZZX A;  2P5R A;  4KB3 A;  3CXG A;  4EL1 A;  5ECH B;  1N8J A;  4TXO B;  1CQG A;  4DEJ A;  1KEB A;  3QD9 A;  4HEA 2;  3DVX A;  3LQ7 A;  1Z6M A;  1T4Z A;  2PVQ A;  2R5G A;  3CBU A;  2YP6 A;  2M80 A;  2KP2 A;  3HZ4 A;  2OKA A;  1GSY A;  2PER A;  2ON7 A;  1V40 A;  2XC2 A;  4GWR A;  1SD8 A;  2DJ3 A;  2AV4 A;  2WRT A;  4YQV A;  4IVF A;  4BVX B;  3A2V A;  4MLY A;  3E3E A;  1YQ1 A;  3U5R E;  2GST A;  2XBQ A;  1UN2 A;  2FLS A;  4K7I A;  4OFM A;  2CAQ A;  4K8M A;  2GT5 A;  1Z9H A;  1K0N A;  5GAN D;  2IL3 A;  4IN0 A;  4GXZ A;  1M9A A;  4ECB A;  3HJO A;  4NHZ A;  5IQY A;  2WFC A;  3FYG A;  2BMX A;  1EZK A;  4OFT A;  1DSB A;  3IHG A;  1KBN A;  1QQ2 A;  1S3A A;  3MSZ A;  2AYT A;  3DD3 A;  1PKZ A;  2G0F A;  2LTK A;  1V9W A;  1MDJ A;  4CDO A;  2DJJ A;  2LJK A;  2O87 A;  4TR4 A;  5DAL A;  2L5O A;  2LRC A;  2FWF A;  2VOC A;  2JU5 A;  5G31 A;  1XW5 A;  2LJR A;  2JAD A;  1ILO A;  4KA0 A;  1GLQ A;  5B7C A;  2HLS A;  2PWJ A;  3ERF A;  3A2W A;  2HSH A;  3TUE A;  3MYD A;  2C0D A;  2TRC P;  1GTI A;  3L9U A;  4DSR A;  1GUH A;  2WCI A;  2H66 A;  1V2A A;  2KUC A;  1X9W B;  3F63 A;  4GSS A;  5ECI B;  2H19 A;  5B6N A;  4ILF A;  3F8U A;  1C72 A;  1FVK A;  1Z6N A;  4FYU A;  3IAM 2;  1HD2 A;  3F9U A;  5J9B A;  3D6I A;  3QDN A;  1TU7 A;  4BPY A;  3IAS 2;  4NXI A;  3RAZ A;  3UVT A;  1GNE A;  2YWO A;  2VD0 A;  2DIY A;  3A3T A;  2ALB A;  4I6X A;  3M9K A;  4G19 A;  4X4J A;  1EGR A;  4RQX A;  4NPB A;  2V1M A;  3M8N A;  5IMA A;  2LQO A;  2BTO T;  1TRU A;  4L0U A;  4L0W A;  1WPI A;  1VF2 A;  4BL7 B;  2WB9 A;  5F8B A;  2YAN A;  1U88 A;  6GSU A;  3GHA A;  5LD0 A;  3UEM A;  4MMM A;  3W8S A;  4POK A;  2GTU A;  4ID0 A;  1SK1 A;  5KN3 A;  5FWG A;  3C7M A;  2VCW A;  1TDI A;  2X64 A;  1SJZ A;  5ECO B;  9GSS A;  1TRV A;  5DBQ A;  3VUR A;  1TW9 A;  1B9X C;  2C8U A;  1XWC A;  5D96 A;  2H30 A;  2OBK A;  5BMU A;  3QAG A;  3TOU A;  2PPT A;  5A4W A;  3SWL A;  3RHC A;  1LU4 A;  1OVN A;  3DYR A;  3L9V A;  3EC3 A;  4TR1 B;  4XS6 A;  3H93 A;  3KZQ A;  4PNG A;  2HNL A;  4ECJ A;  5G2Z A;  3D4T A;  1MD3 A;  5DQS A;  5IOX A;  5D8I A;  1ABA A;  4MJB A;  2GQM A;  4I8B A;  2V6K A;  2DLX A;  3A2X A;  4E8E A;  2NPB A;  2C80 A;  1M7T A;  3GSS A;  2R3X A;  3ZTL A;  1RQM A;  2LNS A;  4IS0 A;  4EVM A;  2IMD A;  3TJK A;  1R26 A;  4Q5Q A;  3TJB A;  6GSY A;  1ZCP A;  3EUR A;  1TK8 B;  1Z7R A;  2R0P A;  1ERT A;  2RUE A;  4MAB A;  2C0G A;  3TRP A;  2RII A;  5KN1 A;  1GL8 A;  3RBT A;  3G7Y A;  1HYU A;  1Q98 A;  1AIU A;  4OO5 A;  4EIQ A;  3F6F A;  4BVX A;  1AAZ A;  5LNK e;  3J7Y b;  2JSY A;  2C4J A;  1THX A;  4WF4 A;  4J57 E;  4KND A;  5G1K A;  3F4T A;  4OCE A;  1TI1 A;  1O73 A;  3IE3 A;  3DEX A;  1O7U A;  2OE3 A;  4TN8 A;  2IIY A;  1GTU A;  4G0K A;  5G5F A;  2X49 A;  4EUY A;  3I9V 2;  4XRA A;  3DRN A;  3FKF A;  1X9M B;  2IN3 A;  4G0I A;  2H6Y A;  2L6D A;  2HT9 A;  2XPD A;  4LL4 B;  2L59 A;  1AXD A;  2H01 A;  3KIJ A;  1G6Y A;  2H0G A;  3NZN A;  1XW9 A;  2FA8 A;  2H75 A;  4NMU A;  4ZB8 A;  3LGC A;  4F82 A;  2RLI A;  5CRG A;  3W6G A;  6GSW A;  5EPF A;  4MP4 A;  4GCI A;  1HNA A;  1GNW A;  5ENU A;  1XWG A;  3PR8 A;  4PNF A;  1U3I A;  6GSV A;  2GQK A;  4IP1 A;  3QR6 A;  1SYR A;  3WD6 A;  1JLW A;  2H1D A;  5JWO B;  5C04 A;  4DVC A;  5H5S A;  3FY7 A;  1J0F A;  1PN0 A;  4HDE A;  1VF1 A;  4PX1 A;  5G30 A;  3CMI A;  3FR6 A;  4RQR A;  2EIO A;  4XIH A;  2I4A A;  5ABR A;  5D9V A;  2MYG A;  1G7O A;  1W4V A;  3LOR A;  4POM A;  4BVY A;  2I9H A;  5IMZ A;  1TU8 A;  2IPA A;  5ECQ B;  5DAK A;  1EP7 A;  3GRX A;  3GKK A;  4GF0 A;  1OC8 A;  1ERW A;  1XWA A;  3KCM A;  5CP1 A;  3TKS A;  1PKW A;  1NHO A;  5HR2 A;  2E2M A;  2H1G A;  2QGV A;  4BL7 A;  4X0X A;  1ZZY A;  3I43 A;  4NV2 A;  3CYN A;  4WXT A;  3IK9 A;  1GP1 A;  4GTU A;  2MBT A;  3PPU A;  5ECK B;  3M0F A;  1XWK A;  2DKH A;  2VM2 A;  1O85 A;  1WP0 A;  2C3T A;  2IJY A;  4FIW A;  1ON4 A;  2H71 A;  5HR3 A;  1GRX A;  3S9F A;  3VWW A;  1A2M A;  4O5Q A;  4MPG A;  4PQI A;  2P5Q A;  4TR1 A;  1E2Y A;  2A4H A;  3G9B A;  4XTS A;  4YAP A;  1W89 A;  4WKW A;  3TKQ A;  2MMN A;  4ZIJ A;  2REM A;  2FY6 A;  2F9S A;  2K8V A;  5D73 A;  4IW9 A;  5CAX A;  1T00 A;  1F6M C;  1QUW A;  2YZH A;  4TW5 A;  5D9W A;  1MTC A;  4EE0 A;  5EVO A;  3FW2 A;  4HS1 A;  3F0I A;  2VL3 A;  4PUR A;  2FUG 2;  1JZW A;  2CA8 A;  4IP6 A;  5IMC A;  1XBS A;  3O76 A;  2OJL A;  2RUF A;  1YDK A;  2GDR A;  1GUL A;  4WR4 A;  3FEU A;  4GQC A;  2MMO A;  3U6V A;  5D93 A;  2N5B A;  2WUL A;  3CSJ A;  1SEN A;  2NDO A;  3C1S A;  3GH6 A;  1H75 A;  1AUC A;  2H8L A;  2RM6 A;  4RI6 A;  5ID2 B;  2H1B A;  4ZIL A;  10GS A;  1ST9 A;  1AC1 A;  3KXO A;  2P31 A;  3ISO A;  5H5R A;  1F3B A;  1DE2 A;  3EU4 A;  4KGI A;  3GL3 A;  3TDG A;  3ED3 A;  4MDC A;  3AY8 A;  1HNC A;  5ECM B;  4FQU A;  2RM5 A;  2YWI A;  1K0A A;  4K5R A;  4TKY A;  5INY A;  2FA4 A;  1VRS D;  2HZF A;  19GS A;  3P90 A;  1M2D A;  4J56 E;  3F3R A;  1WOU A;  3LJR A;  1FHE A;  1WE0 A;  1A0R P;  2R0G A;  4EDZ A;  4HQS A;  1TRW A;  12GS A;  1ML6 A;  2NBS A;  2EIQ A;  4IJ3 A;  4MJC A;  2X99 A;  3ZFB A;  1ZGN A;  4EO3 A;  1OC9 A;  1FVJ A;  1ZMA A;  2B1L A;  2I81 A;  4LMW A;  4IKH A;  2CX4 A;  3HZ8 A;  3P8W A;  4G2E A;  4K7O A;  2YOI A;  1K0M A;  2V41 A;  2F3M A;  2GT6 A;  1FO5 A;  3L4N A;  3OR5 A;  5GSS A;  4MF5 A;  18GS A;  2B5Y A;  3P2A A;  2VAF A;  2VLU A;  1FAA A;  2B5E A;  4ML1 A;  2VCZ A;  1BYE A;  1Q4J A;  3UL3 A;  1JZR A;  4O5U A;  1FW1 A;  3HVS A;  4XS1 A;  3I69 A;  4L5L A;  1MD4 A;  4V1A p;  1MDI A;  4HUA A;  3HY2 A;  4WR5 A;  3D4M A;  2O89 A;  2MZC A;  1HQO A;  5KOW A;  1XCC A;  4MZB A;  1M2A A;  2VCT A;  1EOH A;  3L0H A;  3DKS A;  1ZYP A;  5LCZ A;  3ZIV A;  3O6T A;  4XHM A;  3EYT A;  3NOF A;  4MF7 A;  3GKX A;  5ECL B;  3VWU A;  2R4V A;  2JZR A;  3EPT A;  3GIX A;  1XIY A;  7GSS A;  5E4W A;  1N2A A;  3BCK A;  3L9S A;  4GLT A;  2CQ9 A;  5CRW A;  4ACS A;  4CHS A;  1O81 A;  2ZNM A;  1KNG A;  1CQH A;  5CRH A;  1G7E A;  4ZL7 A;  4POL A;  1OE8 A;  1BAY A;  1ZOF A;  4AJ7 A;  2FD3 A;  4O32 A;  3WT1 A;  2L57 A;  4BWQ A;  1SYX A;  2H73 A;  4NWY A;  1R4W A;  1O8W A;  2K8S A;  3PGT A;  3R3E A;  4GSN A;  5JWQ B;  1YF0 A;  4PQH A;  2VLT A;  5F07 A;  2PU9 C;  4DSS B;  4BVY B;  3EIN A;  3EWL A;  5F05 A;  1ZYQ B;  4ZL9 A;  5DAK B;  4KDX A;  1H4O A;  2R37 A;  5IOW A;  1U6T A;  2XBI A;  1XWB A;  4F2I A;  14GS A;  4HU7 A;  5DJL A;  16GS A;  4KCA A;  3IR4 A;  3KP8 A;  3LG6 A;  2TRX A;  1YEP A;  3H8Q A;  4N0V A;  1ZYN A;  1PD2 1;  2HSY A;  3VLN A;  2A2P A;  1G6W A;  4XCS A;  1K0D A;  1DUG A;  1PL2 A;  2CAI A;  4IHU A;  5ID2 A;  3GMF A;  5B8B A;  2HE3 A;  3CTF A;  1IYI A;  2H0I A;  3VPQ A;  22GS A;  4N30 A;  1FG4 A;  3APQ A;  4N11 A;  2VIM A;  1USB A;  3TRQ A;  2DSA A;  2WJU A;  5AIS A;  2ON5 A;  4KH7 A;  4P3Y B;  4LMV A;  3N5O A;  3UIW A;  1QXH A;  2GZZ A;  3IOS A;  3VFI A;  3FHK A;  3KTB A;  1R5A A;  2C0F A;  3GKN A;  4JBB A;  3BOA A;  1AQX A;  3MWH A;  2WS2 A;  4POB A;  2XHF A;  5IIZ A;  1TOF A;  5EL8 A;  4FYC A;  1LJR A;  1S3C A;  1WWJ A;  1T1V A;  5GST A;  4PUF C;  3ME7 A;  5CYY A;  1QK8 A;  3KH9 A;  3KMO A;  4FYB A;  3ZIJ A;  2V32 A;  3E9J B;  5J4U A;  1EV9 A;  1RW1 A;  2VUP A;  1GSQ A;  2GSQ A;  3KD0 A;  3GH9 A;  3Q6O A;  5HQP A;  5FHI A;  3FZ9 A;  2WZ9 A;  1XPV A;  2WGR A;  3C8E A;  3D0Z A;  5HR1 A;  1WMJ A;  5ECP B;  4KSO A;  3C71 A;  1ERU A;  1URM A;  2A2R A;  1EGO A;  2F8A A;  2L6C A;  3VI5 A;  3ZL5 A;  1JZO A;  3WGD A;  1I5G A;  3IHQ A;  2ZUP A;  2DJ1 A;  1A0F A;  2A4V A;  2C3Q A;  3HYP A;  4IBP A;  4K2D A;  1XVW A;  2OE0 A;  4MPF A;  3TKS C;  3MIX A;  4FO5 A;  2YJH A;  3QCP A;  1KTE A;  4LL1 B;  2R0C A;  3HCZ A;  2CVK A;  2IWT A;  1MDK A;  5D9T A;  4NAX A;  4ECI A;  5KN2 A;  1PL1 A;  2E2G A;  5F06 A;  3LXT A;  5J9C A;  1PQN A;  2IFQ B;  4KF9 A;  2VL2 C;  3BD2 A;  2HRF A;  3EMX A;  4IGJ A;  3W8J A;  1SK2 A;  1JZD A;  4KDU A;  2HSM A;  4TR3 A;  2PN8 A;  3Q74 A;  4OD7 A;  4EIP A;  4AJ8 A;  3KGK A;  2QSI A;  2HRA A;  1XW6 A;  1SL1 B;  3DXB A;  3D5J A;  2H0H A;  2J9H A;  1PX7 A;  1ERV A;  1OC9 B;  17GS A;  4BA7 A;  3IDV A;  1SU9 A;  3CSI A;  4V1A g;  2GZY A;  4TXV A;  1SD9 A;  3DVW A;  3IBH A;  3G7J A;  4YAV A;  2QA1 A;  1YJ6 A;  3HVX A;  5KEJ A;  3M3M A;  1M2B A;  3FRC A;  3GX0 A;  3TRX A;  3ERG A;  4KX4 A;  1LBK A;  3TGZ A;  2YV7 A;  2IMF A;  5HR0 A;  1GUM A;  1JFU A;  3FR9 A;  3HDC A;  4DSS A;  3APS A;  4TVE A;  2OBI A;  4JU5 A;  4Z2U A;  4IQ1 A;  5ECS A;  2CZ3 A;  3QFA C;  4GST A;  4LLR A;  2VCQ A;  2H74 A;  2ES7 A;  1EP8 A;  2VL9 A;  1FB0 A;  3RHB A;  1DE1 A;  3H1N A;  5COH A;  2EC4 A;  4KUN A;  5B6M A;  1Y6E A;  4KSM A;  1R7H A;  1BG5 A;  4AGS A;  1FOH A;  1GSU A;  2VLV A;  1PRX A;  5IM9 A;  3IRA A;  2AJQ B;  1DBY A;  1X5C A;  1SJI A;  3ME8 A;  2VL2 A;  5JWR B;  4CY8 A;  1VF3 A;  2V6O A;  2MMZ A;  3MDK A;  1K0B A;  1A2L A;  2Z9S A;  3TKS E;  2YV9 A;  3QPM A;  11GS A;  2M72 A;  4MH3 A;  1PSQ A;  2C3N A;  4N10 A;  2QKE A;  5CRE A;  1YZX A;  2GGT A;  4YH2 A;  5ELG A;  4EC0 A;  5KOX A;  2DML A;  4HJ2 A;  1Z5Y E;  2X8H A;  3IPZ A;  2CVB A;  5DDL A;  1EEJ A;  3ZRD A;  4WBR D;  4OCF A;  2JL4 A;  2I1U A;  5H5Q A;  1GSS A;  2GVP A;  4ECC A;  4PXO A;  2LRN A;  2OA7 A;  1B48 A;  5JCW A;  2I3Y A;  4OWY A;  5IMD A;  1F2E A;  3GTU B;  3GYK A;  1TRS A;  2GS3 A;  2FGX A;  3CRT A;  3IC4 A;  3P7X A;  4YKF A;  1M99 A;  3GST A;  4MNN A;  1K3L A;  2O7K A;  5DCH A;  5KN0 A;  3F3Q A;  2G2Q A;  1BED A;  1YEX A;  5G5E A;  4KAE A;  20GS A;  4F9Z A;  3LYK A;  1T3B A;  3WGX A;  1OYJ A;  4IQA A;  4K0N A;  2XPE A;  1SK0 A;  4O5R A;  1GTB A;  3FZ4 A;  1TK0 B;  5IMV A;  5DCG A;  1K0C A;  2DBC A;  5HFG A;  1T8E B;  1K0O A;  4AF2 A;  1QMV A;  2JZT A;  1SL2 B;  2L5L A;  3EE2 A;  4HZ2 A;  4L5O A;  4H86 A;  6GST A;  2PUK C;  3FK8 A;  2IFQ A;  3LFL A;  2BJX A;  4Z2R A;  3BBY A;  1K3Y A;  5L71 A;  4WF5 A;  1A23 A;  4PTS A;  4IEL A;  2LST A;  1NM3 A;  2GSS A;  4GRF A;  2LJA A;  3GUR A;  2B5X A;  2VCV A;  4KCE A;  4I2T A;  5FT3 A;  3EU3 A;  4ISD A;  2YWN A;  4O7H A;  4TR0 A;  3GA4 A;  2HZE A;  2LRT A;  5AIV A;  3WGE A;  1FB6 A;  3GFK A;  1TP9 A;  3UBK A;  1ZL9 A;  3IK7 A;  4TOP A;  2KP1 A;  1XVQ A;  2LS5 A;  3RPN A;  4YQU A;  4G10 A;  4ML6 A;  2E7P A;  2KLX A;  1NW2 A;  1XZO A;  4F0C A;  4JE1 A;  1RK4 A;  4EF0 A;  4Z7X A;  4MJE A;  1B8X A;  2MBS A;  2HYX A;  3BCI A;  2FHE A;  4ZB6 A;  3R2Q A;  4JR6 A;  3ZFL A;  5AIX A;  3F4R A;  1ZYE A;  5IPG A;  2H72 A;  1SJ6 A;  4K0G A;  3DML A;  3HA9 A;  8GSS A;  1OE7 A;  1OAZ A;  2LV3 A;  5IO0 A;  3LEF A;  3FR3 A;  1R5P A;  4RI7 A;  2N5A A;  3UMA A;  5GZZ B;  3GX8 A;  2IMI A;  3ERW A;  1PX6 A;  4PQ1 A;  1G0T A;  1AQV A;  4ZB9 A;  4JED A;  2H76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...