2VOEA

Crystal structure of rv2780 from m. tuberculosis h37rv
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
371
structure length
371
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALANINE DEHYDROGENASE
publication title Crystal Structures of the Mycobacterium Tuberculosis Secretory Antigen Alanine Dehydrogenase (Rv2780) in Apo and Ternary Complex Forms Captures "Open" and "Closed" Enzyme Conformations.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 107
structure length 371
sequence length 371
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2008-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2voeA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2voeA02
5GY7A 3GY0A 1JAXA 2Q4EA 3BYZA 1JKFA 4P4GA 3KVOA 4FFPA 4QO8A 2VZ9A 2BI7A 4R3NA 1AHHA 4OO3A 5FI5A 3JD2A 3A14A 1YJQA 2Z1NA 3PQEA 5A5EA 3RWBA 4RZHA 1DIGA 3BHIA 5FEUA 1VJ0A 4HFRA 5I7FA 1EUZA 3QP9A 1YWGO 2B4TO 3AFMA 4GKBA 1P1IA 5TX7A 1TT5A 2JHFA 4NG5A 1U5CA 2ET6A 1V3VA 4BNHA 3DBVO 2OO5A 1N5DA 3MWEB 4D44A 4Q3CA 2GRAA 1BXZA 5IXSA 5A06A 5JO0A 1YXMA 3PWSA 5A4DA 3OIDA 5IDXA 1QLJA 4J6FA 1EDZA 4BNTA 2LDXA 4E2ZA 5LDHA 2HK8A 3GG9A 4B3HA 1H94A 2UV8A 4WK6A 3RI3A 3AUTA 1NR7A 1X14A 1U4OA 1PGOA 3UCXA 2UVDA 2OXIA 2HRZA 2GZ1A 4D79A 1A71A 3C24A 2NQ8A 5U9CA 3PRJA 1SNYA 2P4HX 5I8ZA 3GF4A 2Q1SA 1EBFA 4BKPA 3FBTA 5COBA 3TF5A 4WEQA 3GHYA 5T64A 3NEPX 4WCFC 3ZWWA 4DVJA 3RUFA 3QQPA 4K28A 3TRIA 5CG2A 1E7RA 2CVOA 4OKNA 2CZCA 4RVHA 5TC4A 3ZHXA 4AJOA 3SXPA 4MVJF 1WDKA 1ZJZA 3F3SA 4QSMA 3DBLA 3AU9A 2GZ3A 5BNFA 2Y1OA 1P9LA 2GN8A 1WW8A 2DFVA 1YDEA 1E3SA 1VL6A 2CF6A 3C7AA 5BR7A 1O89A 2Q45A 4IDDA 3BMNB 4XQ9A 4TZKA 5C3MA 1NAIA 2WM3A 4F3YA 1YO6A 2W8ZA 3LT2A 2W2KA 1BHSA 1R37A 3HDQA 1EEHA 1DFGA 1K89A 2P68A 3MJTA 3QLJA 3FR7A 2BRUA 3RUCA 1TB4A 4WUVA 1HETA 4DC0A 1UXJA 3KV3O 4EW6A 6LDHA 4IPTA 1LX6A 4OIMA 1B3BA 5A04A 4W9NA 1N9GA 1VE9A 2O2YA 4G2NA 1MFZA 4HY3A 3ROKA 4CM1A 5HBRA 4FN4A 2PD4A 5IF3A 3GFBA 1Y9AA 2BFAA 1AUPA 4CMKA 4DIFA 1LRKA 3QVXA 3GZNA 3KLPX 3C3XA 3H7AA 1FMCA 4DYDA 1GCOA 3L6EA 3N74A 2JL1A 3OQBA 5T57A 1JA9A 2HAEA 3ANLA 4CQMB 1EZ4A 5EIOA 1DSSG 1GCUA 1P45A 3K96A 4KDEA 4PIVA 3ASUA 3QVOA 1ENYA 1BVRA 1DJQA 3CMCO 3DZIA 4XJTA 4ALMA 4E4YA 3HN2A 4IIUA 1VC2A 2D2IA 1S7CA 2Q99A 3UAGA 3ZHZA 2ZCUA 4MKZA 1B16A 1ID1A 1NQ5A 1PJCA 3VVCA 4A10A 3F5SA 4Q39A 4IUYA 5JBIA 2GGSA 4YPOA 3DAPA 1KEVA 4YB8A 1ZXLA 1X1EA 2Q46A 4J7XA 1T2AA 5T8KC 1X0VA 4DPKA 1YBMA 3MZ0A 3LVFO 2JD1A 3GG2A 4IIVA 2J3KA 1T2EA 4FW8A 2O3JA 4B4WA 3SJ7A 4CM8A 3U09A 4O1MA 1ZEJA 3TQHA 3WTBA 3WR5A 2OL4A 4R41A 4RDHA 1KC1A 3PZBA 5HTOA 1PSDA 2R6JA 2IYOA 5BT9A 2P4QA 4E0BA 1RM3A 1NWCA 4D0SA 2X5KO 3STHA 5JAZA 5DCWA 3DZJA 3HJAA 4RORA 1Y5RA 2YYYA 1KY4A 1ZIDA 4BO4A 2QRLA 5K9ZA 4R9RA 5IAAA 3PTZA 3TOXA 3H9GA 3GK3A 1UZMA 1SBYA 3R3SA 4FCCA 4U5QA 1MP0A 2ILTA 3AY7A 1KBZA 3HNPA 4YACA 3PJFA 3DOJA 1YL5A 2C07A 2IZZA 1XGKA 4LGVA 1L7DA 1JVSA 1ZFNA 3GH3A 2AMFA 2AQIA 2YUTA 1P3DA 3I83A 2VUUA 3KETA 3H5AA 2FSSA 1QV7A 4IQ0A 3AM3A 4YT4A 2FR8A 4JN6B 4KP7A 3W6UA 5HRUA 4JXKA 5JS6A 3AWDA 4OH1A 1RYDA 4B7CA 4J1SA 3W6ZA 4GAEA 4K26A 3JCZA 4YVFA 4J4BA 3U49A 4EITA 4RL6A 1QYXA 2VWQA 3JQCA 1JWBB 4TKLA 1U8FO 3NX4A 3D5TA 2F1KA 2QZ9A 3PI7A 1ONPA 4CLDA 3AU8A 3FNEA 3ONEA 3LDHA 1VKNA 2Y1EA 3BMQA 4J91A 4N5MA 1CJCA 5JDIC 3HB5X 1YQDA 2VT3A 3U4HA 3I9LA 1D8AA 3RUIA 4Z0HO 4WLUA 4WPGA 2EG9A 1AHIA 2DBRA 2WEKA 1NWHA 2OP1A 3U5TA 1R16A 1ISGA 1W6UA 3WYEA 3GFGA 3MJCA 1F12A 3HHPA 4DC1A 3AW9A 3F9IA 3OA0A 1VSUA 4EDFA 4ROSA 1GUYA 5JDCC 1XSEA 3B1KA 3HSKA 3I1JA 1ZSNA 1LXCA 3ZU3A 1OC2A 2ZQZA 3TZKA 2EERA 2O2SA 2QHXA 1XEAA 3VH4A 3PWKA 4E2YA 1N2SA 1Y8RA 2AEJA 3AY3A 1M75A 2Q2QA 5IN5A 2W98A 1E3WB 4ZU3A 5JYDA 2X23A 3AUSA 3VKUA 3NTQA 4MP6A 5CDUA 1GD1O 3LC1O 4U7WA 9LDBA 4AJ4A 1RM0A 3ZWMA 4AJPA 2OP0A 4RVSA 1X1TA 1LLDA 3ENNA 2VN8A 4IJKA 1CEQA 3ROMA 3ZZNA 1HDZA 4IDCA 1SOWA 5TF4A 4RPLA 4HFJA 5A3JA 3WX0A 2H5LA 3T7CA 5ENDA 4L74A 4INAA 1EK5A 1EQ2A 5F3RA 2D8AA 2EWMA 1N8KA 1K6XA 2Y0DA 3B70A 3E9QA 4AJNA 3K6JA 1T25A 3TPCA 1BG6A 3KRTA 3L4BC 1FDTA 2GYYA 3GN1A 5ICSA 2PNFA 1EE2A 4RCVA 1GUZA 3CPSA 2ZYGA 3TDKA 4AJHA 1JW9B 4CMAA 1G0OA 1WNTA 1SB9A 2HCTA 3E82A 1N1GA 5DBFA 2I66A 3NGXA 1U2DA 5CDYA 1TVEA 3GVIA 3JYQA 4CMHA 5KVQA 5FFFA 4C7JA 3NTOA 3ICCA 1H93A 4C4OA 1VM6A 2WWRA 3GHHA 4EJMA 1I32A 4BNKA 1UDAA 3DONA 1HE5A 2EIHA 2J5RA 3WQQA 4QECA 3UGKA 2JCYA 1BW9B 3DC2A 3FPCA 2PWZA 1YBVA 3B1JA 5H82A 1PJ2A 3RUAA 3H65A 4LSWA 4Q3AA 4IDEA 4EYEA 4ALKA 4PG8A 4CMCA 4YRDA 2BI8A 3GQVA 4FC6A 5DDIP 2ZJ0A 5JMWA 4RQUA 5JDIA 3JQBA 1E1LA 3RU7A 2Y0CA 3AUAA 4AFNA 2A92A 2YDXA 3ASVA 3GLQA 3CKYA 4NI5A 3U4IA 1Y8QB 4BB5A 4DGSA 3DXFA 1X0XA 3CE6A 4IDFA 5CHEA 3W4KA 4XIYA 2Y93A 3V2HA 4AJ2A 2IRWA 2NU7A 1EUCA 1CF2O 1IL0A 4PZCA 1MG5A 4YR9A 4OMUA 2NV6A 3R1IA 3GGOA 1U7TA 3OMLA 2DFDA 3GVCA 5K6AC 3DZFA 4GWKA 4CUKA 1OOEA 1U8XX 2JD2A 2ZB8A 4Y6SA 4ZA2A 5JDCA 1I01A 3BMOB 4EJ6A 3LYLA 3FTPA 1E6WA 3EUWA 1E3EA 3IOYA 1GV1A 2AW5A 1IYZA 2X0RA 3H8VA 1LDNA 4NBTA 4NH4A 4CLHA 3EY4A 4YJGA 3WFJA 5A02A 4R54A 4J43A 1CQIA 1LC0A 3GT0A 4BNZA 4PZDA 5L40A 3PYXA 2WD7B 1UXKA 1PWXA 1OAAA 2C5AA 4U8GA 5KCZA 2JD0A 2JFHA 5AQ1A 4KUGA 3TJRA 3E48A 2NVUB 3ZW8A 4AL4A 1BWSA 2OBNA 3L6OO 4CR6A 5L4LA 1W4ZA 1H6DA 4NK5A 1LSOA 3O03A 4TSKA 5GMOA 3WJ7A 2FZWA 1P31A 3PWZA 1HDRA 4YWJA 3OM9A 4OSOA 3V1YA 3JD1A 2QZZA 1A7KA 2FPGA 1YKFA 1DLJA 1WPQA 3D64A 3TFQA 3PPIA 4LK3A 3WSWA 1NTOA 1XCBA 2BKAA 3ZU4A 1J5PA 3RC1A 1JLLA 3E5RA 1GZ6A 4GX5A 2I9PA 4OGWA 1S6YA 4TRMA 1ISMA 3RBZA 3JSAA 1O0SA 1Q7BA 3TNLA 1H9BA 2VZ0A 1MX3A 1DLIA 3UFXA 5B4TA 1PJTA 5U4QA 3F1LA 3MCVA 4PFJA 5LC1A 2PTGA 4F6LA 3UICA 1H9AA 3V5NA 3O9ZA 1PX0A 4GVLA 2NWQA 3JQ7A 4QX6A 2Z5LA 4KZPA 5C7OO 1JWAB 1K5HA 3DEYX 4H3VA 4UUOA 3NYWA 5DZSA 1P0FA 4BHTA 1M2WA 4GX2A 5F5NA 4CM4B 2GN6A 3QVTA 4J0EA 2W4QA 3NGLA 4XB1A 3WGZA 4BNMA 5EJ2A 4WEOA 4FSHA 3UCFA 2JAHA 3OA2A 4BKQA 2B37A 3PQFA 4BNGA 1E5QA 1E7SA 1DC6A 4WECA 4R51A 1MB4A 2OOSA 4JX8A 5G0WA 4A27A 4M8SA 4BOYA 1EVYA 2I76A 3BTVA 3GGGA 4WLEA 1UDBA 4RF3A 2I99A 3ZNOA 5T67A 4I8XA 1FDSA 4NJMA 3JQEA 4L0QA 3OFSA 1VL8A 2ZQYA 1A5ZA 1SEPA 1GEGA 1BMDA 5GZ6A 4BB6A 3PFWO 4YJFB 1IOLA 1E1KA 4OXYA 4TRJA 1JQBA 2R2GA 4R1TA 4FDAA 4TVOA 2DBQA 1C3VA 3E18A 3JV7A 4M54A 3W8FA 5I9NA 3HDJA 1I3MA 3DHNA 1QORA 3I52A 3NJ8A 4S3MA 4CMEC 1XWFA 1HLDA 4LRTB 3KYBA 3P5SA 4FFOA 4MOWA 1EBUA 3AOEA 3G17A 4J16A 3OEYA 3G0OA 4TQGA 5IZCC 1SZJG 3DZHA 3TZ6A 5TS3A 4XB2A 1ENPA 1PJ3A 1NVTA 3KUXA 1V9LA 3E6AA 3TN7A 3JYOA 4ZJUA 5I7VA 4B4UA 2BFOA 4BNXA 2X58A 2OGUA 2VOJA 4XD2A 1ZNQO 1XR3A 2ZKLA 3VH1A 4D3FA 1E7QA 4D46A 2DUWA 5EERA 3WQRA 1DFHA 1LJ8A 3ABIA 3HADA 4E5NA 1DOHA 3L9XA 3MJ4A 3UHAA 2IZ1A 4XR4A 4I1IA 4E33A 3VTFA 4N5LA 1HT0A 1SEVA 3VZSA 5CG1A 5G0UA 1ZK0A 4YEDA 3H5RA 4TWRA 1ADCA 1PS0A 2RH8A 2C59A 1G6KA 2NVWA 5HM8A 1LI4A 2Z1MA 1PS8A 1EVJA 5G4KA 1E3JA 5CPBA 3ZHBA 2YW9A 1C0LA 1W0CA 3EC7A 2OBYA 3GVPA 4M55A 3ITKA 1BXGA 5JLAA 4MVJA 3INGA 2HK7A 4CV3A 5IG2A 1R15A 3QWAA 1I10A 1EDOA 5CDSA 1B0AA 4BQPA 1J4AA 4E5KA 3ZNNA 5T6BA 2CMDA 1E92A 3WTCA 2A4KA 1Z74A 2YFQA 2FRDA 2BF7A 4KMSA 3OJLA 1B15A 4IM7A 1DFIA 4U0JA 1ZO8A 4WLFA 3W4IA 2YV3A 4BKUA 4XX0A 3QWHA 5DBIA 1NASA 3HWRA 1B14A 2GLXA 2Q49A 1E3LA 1KYQA 3ANMA 3D4OA 5COQA 3ZI0A 1K2WA 4MKRA 2VHWA 3PIIA 4JJGA 5EPOA 2ZATA 4M1QA 4LVCA 4R69A 4L75A 1HXHA 2YJZA 4AJ1A 1MUUA 4NBUA 4IDAA 3LF2A 5THKA 3N7UA 1E6EA 4H15A 1IE3A 3WB9A 4YDRA 4CMJA 3HB4X 4L4XA 4B3IA 1D7OA 1KVUA 4A73A 3VDQA 2O3RA 3C8MA 3PXXA 3ZHYA 1XDWA 4DQUA 3NDIA 1HF3A 4H16A 3C1OA 4BO0A 4CR8A 3ENKA 3RUHA 4B8ZA 3DBLB 4RF4A 4CM7A 2H63A 3RJ5A 1M76A 3OF2A 2B69A 4OJNA 2B36A 4JK3A 1GFSA 4XYGA 2YQ5A 4ZQHA 1HE3A 2W2KB 3KOUA 5TJHA 1Q7GA 4KUHA 2YZ7A 1NYTA 1E77A 3H5NA 3QWBA 1H2HA 4HKTA 1R4MB 3OJOA 3UN1A 1P0CA 3OICA 3BA1A 2YHIA 3OP4A 1NFFA 2Q1TA 3W4JA 3DMTC 3PLRA 2FZEA 1BSVA 3U0BA 3U3XA 3RIHA 4CMGA 4G81A 5FWNA 4IXTA 4CLOA 4W6ZA 1HEUA 3VZQA 1T1RA 1AGNA 2OMEA 3K9QO 1CYDA 4OXKA 4Q3BA 3QSGA 2X9NA 5TQVA 3GEGA 1NPDA 3GZNB 5A05A 5LDGA 2EGGA 4S1VA 3OJ0A 3DBHB 2ZYDA 3H4VA 2HU2A 2J6IA 5JXWA 4DQXA 4MVJM 4XA8A 4XKJA 3VTZA 2YY7A 2O50A 3IKVA 4QO7A 3LT4A 1SOVA 1A4IA 3WGOA 3BTOA 3ZU5A 5JAMA 3KYDA 2C5EA 3ZV4A 2VWHA 4Y9DA 3DL2A 3KO8A 4FPXA 1X7DA 1PWZA 4GSLA 4ZICA 3E9NA 4DQVA 3QVSA 3CZRA 4GPD1 4OOEA 3ST7A 1GYQA 5KOIA 1ADFA 2HJRA 3D3EA 4E30A 1IY8A 4IZHA 4Z3DA 8ADHA 4FJ0A 1XKQA 1GEEA 1PJ4A 2E49A 2VHVA 4OYRA 1C1DA 4Z9FA 2B5VA 1NBOA 2VWPA 4PLVA 2QQ5A 3WBBA 5ES3A 4MIOA 1PZFA 1LU9A 2EW2A 4CM8B 2D1YA 2PZLA 5L7WA 1DC4A 2BH9A 5B37A 3AUUA 1YS4A 5G0TA 4J2OA 5TIIA 4DIOA 3I9MA 1Z73A 1U4SA 4A26A 3VZRA 3NT4A 1BGVA 2D59A 2JCXA 3G1TA 4BIIA 1SC6A 5EQDA 4LISA 2HKIA 1OBFO 1ZEMA 1YJ8A 2G1UA 3JQ8A 4PLWA 4YQZA 4DXHA 4JROA 4BNVA 3JQFC 4GX0A 2R00C 4TMFA 3L4SO 4UVGA 3RFVA 3S2GA 4CM5A 2PZJA 2NTNA 3D4NA 2DAPA 3ADPA 1OFGA 3Q9NA 5JC8A 5K0ZA 5LCXA 1K6IA 3V1UA 4KQWA 4XYBA 4B7XA 2D5CA 1G1AA 2I67A 4PGFA 4RZIA 5DOVA 3GAFA 2WTBA 3PK0A 3UXYA 3VVBA 1I24A 4EI2A 4XR9A 4XWYA 2W2LA 3NT2A 2CFCA 2BHLA 1ENOA 3IS3A 1ISHA 5L95A 4N18A 1H2BA 3Q9UA 2DKNA 4CUJA 4A0SA 4ND4A 4CR7A 3K92A 2C2XA 5ER9A 3K5PA 1R6DA 1O9BA 2O3QA 3JQAA 5TLSA 3LSYA 4Q3NA 5MGBA 3NRCA 1GU7A 4ID9A 2DUUA 3ITDA 1C0PA 4BGUA 4CQLA 1QSGA 2DPGA 3NKLA 3RCBA 3QE3A 4Z9YA 5JY1A 4J9VA 4XZ3A 3S2EA 2ZTLA 3G49A 2O23A 5A9RA 5JAIA 4IS3A 5JSFA 3CTMA 1JDJA 2CF5A 4E6PA 3MEQA 5G0SA 2O3SA 4XCVA 1Q0LA 4AJIA 3K2BA 5FI3A 4P8RA 5T5QA 1YBAA 1Y1PA 1PEDA 1A27A 2GN4A 2DT5A 3IUSA 1I30A 4UVDA 4YXFA 1M6HA 3IC5A 1VJ1A 4BO5A 1EE9A 1Y8RB 3KSUA 2IXAA 1MXHA 4WOJA 5KJ6A 2C82A 4ND2A 3W8EA 4MVJD 1QXSA 2QYTA 3IP3A 1QKIA 2PA3A 3ZW9A 4C7KA 3JYLA 1DRVA 4CM3A 5BNIA 3K73O 3FTNA 2G5CA 3PHGA 2VHXA 3QWFA 1N7HA 4FOOA 1GY8A 5KJFA 1R0KA 3C1TA 3H6KA 3P2OA 1I3LA 1TT7A 3KYCA 1MV8A 2X9VA 3TL2A 5BNTA 4WCFA 3DTTA 3RSHA 5L3ZA 3ZN2A 2TMGA 5CEFA 3WICA 1R12A 2O7QA 3VKVA 4YJHA 1JKIA 4I5FA 5EL0A 5IFLA 3L0DA 3ADOA 4OM8A 3K8ZA 2FR0A 4AVYA 2V6FA 1C1XB 1VSVA 2X0NA 1K0UA 2NTJA 4YQYA 2VWGA 4M87A 3TOZA 3OHSX 4IJWA 5I7SA 3WLEA 2P2SA 5KIAA 1LDGA 4BNLA 1ZXBA 1R0SA 1C14A 3FN4A 4LVUA 2Y68A 4GH5A 5JYEA 2O7SA 3E03A 3MTJA 1O5IA 3G79A 2PKQO 3BMCB 3WMWA 1ARZA 4YA6A 5DCYA 3WQSB 1KVSA 3DO5A 2C2YA 4BO2A 5A9SB 3OSUA 3ZWYA 2W90A 1HRDA 1PR3A 5J23A 3T4XA 2VNAA 4OQZA 4TVBA 3EYWA 2AG8A 3WWZA 1IB6A 3P2YA 4MVJP 1WAMA 1ZJYA 3QHAA 4U6SA 4R68A 4UAGA 3WG9A 4HFNA 1I3NA 3F4LA 4MVJH 3WWYA 4UUPA 1U3TA 3SC4A 4YRAA 4YRBA 4J7UA 3AOGA 5L4NA 3BIOA 2X5JO 1HDYA 2JFGA 3WNQA 4B3JA 4E5PA 1XU9A 4DLAA 1H5QA 1NFRA 3KSDO 1N92A 2NNLD 4RVFA 4ZQBA 3WGYA 4XJSA 4ZQFA 4HBGA 3IAHA 4FR5A 2OFPA 3INRA 4P22A 1GQ2A 1PQPA 1DBVO 1GPJA 1WP4A 2NQTA 3KM0A 5IZ4A 3LK7A 5G0VA 3UW3A 5EESA 4FS3A 2YDYA 1Y5MA 2E82A 4I9HA 5T8KA 4BNIA 4BO3A 1P1RA 3MJVA 5AYVA 4YAJA 4DMMA 4ZD6A 5JPIA 4E2WA 1HKUA 4IS2A 5AXAA 4HX5A 4URFA 2HMUA 3U62A 5A9TA 4D43A 3K2EA 3PDUA 2PV7A 1VL0A 1NVMB 4NR0A 4B8WA 5DN9A 1V3TA 4EGFA 4DTIA 2GUGA 4ILKA 3ZWOA 1UAGA 1K3TA 1Z75A 5BSGA 4NFSA 2XPCA 4PLCA 3ZWVA 3RFXA 4RLHA 4NPCA 2GPTA 5FF9A 1I36A 1EFKA 3O38A 3KSZO 4X54A 4L4SA 5JC1A 2DU8A 5KNLA 4E21A 4GMFA 1M67A 4J49A 1HYEA 1KC3A 3E1KA 3D4PA 3H9JA 5EQFA 3UH1A 1P1FA 4JIGA 3O8QA 3KEOA 3IIEA 4D42A 1CDOA 5TT0A 3VDRA 3NTRA 4Z3KA 1RPNA 3TFOA 1UDCA 4BV8A 1P44A 3WIEA 3WYBA 1DO8A 3EHEA 1PU2A 3PHLA 3E5MA 3GA0A 3N58A 5CDGA 1KEPA 3NJ4A 1AN9A 3PEFA 2IODA 2Y05A 3ZWCA 2GERA 2Q2WA 4JQCA 1QRRA 5DF1A 3F4BA 2PR2A 5COAA 3WXBA 4CL3A 4K6FA 3COSA 2P9EA 2BFPA 4QFDA 3JQ7B 2HK9A 3H3JA 4YJDA 5ADHA 1WMAA 2NU8A 1RKXA 4NU5A 3PGXA 2Y1DA 1FXSA 2W2LD 3RC2A 1ENZA 1X7GA 5ILGA 4CLRB 4GLLA 4BO8A 4XQEA 3VH3A 1ONOA 5A1TA 3OEWA 2FWMX 4D45A 4GQAA 2D3TA 3M1LA 1EVIA 1EUDA 3T7EA 1UR5A 5KTKA 1T1SA 4NJOA 1YRLA 3JQAD 2FN7A 3BHMA 4FFRA 4PVDA 5HS6A 1WDMA 1PJLA 5CDTA 3RJ9A 2OZPA 3NAQA 5AXDA 1JVBA 4O5OA 1DRUA 3VZPA 1P1JA 4J3FA 2VNSA 4XIJA 5JO9A 1ZVMA 2AA3A 3OH8A 1XA0A 1D1TA 1UXIA 1PZGA 3I23A 3IQDB 3QA9A 1V8BA 1GUFA 1RM4A 4LN1A 2WE7A 4PLGA 3SX2A 3WNVA 3ZWBA 1WVGA 5F1PA 4P4NA 4K1LA 4PCVA 3ZDFA 2ZTMA 5L53A 2VZ8A 3PHJA 1V0JA 2IDZA 1E6UA 3UUWA 4I9UA 3RAJA 3DOCA 3L4BA 2VCYA 4UUNA 2RBEA 3I9KA 1B3RA 4ZQGA 3HUDA 3ONFA 3ROPA 1LQUA 3M2TA 4RQTA 3DAGA 3Q2IA 4RF5A 4OOFA 1NNUA 3GR6A 1QG6A 1T2FA 3B20A 3BHJA 4QXMA 4ESOA 2O3UA 1PQUA 4RPKA 4L4RA 1DIRA 4DLLA 2DTDA 3G3EA 3I6QA 2FSVA 4XYMA 1HYHA 4IY1A 3LLVA 4Y98A 3FNFA 3M1AA 4RPHA 4U0KA 1YOVA 4R3WA 2X9GA 3GEDA 2P91A 4QTZA 4AJKA 2AE2A 3C85A 2DVMA 2J5QA 3TZHA 2F00A 3IP1A 5DOZA 1HZZA 1GQQA 3VHRA 2NADA 4WCDA 1NVGA 5ER6A 4J9UE 2VRBA 3OJEA 4P4LA 4J4TA 3S55A 2PZMA 5AOVA 3WDSA 3DQPA 3KB6A 1A7AA 2YFHA 2CD9A 3H2SA 4JP3A 4LMRA 2VYNA 1Q0HA 4DPLA 3DTYA 3HFGA 2EW8A 3ONDA 4BO9A 1DXYA 3HQ4O 1LSJA 4YAIA 1T24A 3F1KA 4BV9A 1LA2A 1Y9EA 1HDOA 5K6AA 4I5GA 4M49A 3A1NA 1LLUA 1LDEA 1PQWA 2UUPA 1LNQA 3HFSA 3PJGA 3JYPA 4PLYA 5KVCA 2BELA 3DBRB 3ZCXA 4FGWA 3UOGA 3JQ9C 1O94A 1KETA 1HDGO 2YHUA 3GVHA 4CMBA 1E7WA 2P5YA 3BMOA 3WFIA 1O8CA 3CH6A 3E8XA 3Q3CA 1BTOA 1GQYA 4J1QA 4XGKA 4XRRA 1GZ3A 2FHSA 4WOKA 5U1PA 3U9LA 5DULA 1XQ1A 1LDBA 2O4CA 4OXNA 4A03A 3LF1A 1ADGA 4GVXA 4CV0A 1LSUA 2X8LA 3WSVA 1WXDA 3ZWPA 3NDJA 2G82A 2H6EA 4E2XA 1XG5A 4MDHA 4NBRA 4CMIB 3M2PA 2PD3A 2C7GA 3GVXA 3MJSA 1NXQA 3AI2A 4MIEA 4KOAA 2VYVA 1F8FA 2O48X 4L73A 3G1UA 2WYVA 5B12A 1TXGA 2YQ4A 4MP8A 2TMDA 4F45A 4ALNA 3VPGA 1J49A 2XAAA 4R5MA 3QRWA 4CLOB 2NU9A 2PH3A 4CM9A 5CAEA 4GL4A 1EVZA 3KLMX 3R3JA 1UH5A 1NPTO 4E3ZA 1KY5A 1SPXA 2X6TA 4FFNA 4YCAA 1L7EA 5I7EA 3DB2A 3WJAA 4DL9A 1DC5A 5IDQA 4RVUA 3LC2O 1ZCJA 1OC4A 1PZHA 4NQZA 1HWYA 1J6UA 1QR6A 1LEHA 2XOXA 4OHUA 2VHZA 2CSUA 2NVBA 3VAZA 4HXYA 1IUKA 1TT5B 4J1TA 4MKXA 4EEZA 1UXGA 3QY9A 3UCEA 5KKCA 1U3WA 2Q4BA 1AXGA 4CV1A 3GUCA 4IJUA 1UP4A 4BL5A 4UVHA 3A4VA 4RVDA 2ZB4A 1NHGA 4K6CA 4PLFA 3K31A 1NM5A 1UAYA 4XGNA 3IJPA 5BSFA 2WYWA 2OUIA 3F5QA 3D7LA 1M6WA 4M86A 3EZYA 4FFLA 3S2FA 4IGEA 2AQKA 3TL3A 2PD6A 5ENVA 4MVJG 3GNSA 3SJUA 1VPDA 3H9UA 4IMRA 3Q6IA 1F0YA 4A7PA 4WLOA 3RASA 1V35A 1HLPA 2I6TA 3MOIA 1J0XO 2X0IA 3QJ5A 1E1MA 2WD8A 4WJZA 3AY6A 5FYDA 1T4DA 2V6GA 4JJFA 5EINA 1NX6A 4BNWA 5BSHA 3ON5A 3ZNQA 1JU9A 2EP7A 2GSDA 1KOLA 3JQ8B 4JJIA 2Q1WA 4GGOA 1Y6JA 2EF1A 2GCGA 1JTVA 5F1OA 1HSOA 4CMEA 3PP8A 4XYEA 2AEMA 3RKRA 1D3AA 3KZVA 2HO5A 4YJFA 3CIFA 3FPLA 2DTXA 1ZW1A 3TZCA 5IZCA 4YAGA 1B7GO 5L7YA 3FD8A 4RDIA 1UP6A 1ZK1A 1I2ZA 2RHRA 2O3TA 3JD4A 5L45A 1GZ4A 1P1HA 3EDMA 4I5EA 3ANNA 1N9GB 4BNJA 4I5DA 1UZNA 2GDZA 2PKRA 3SVTA 3HG7A 4UREA 4WKGA 1R4NA 2P9CA 3PGJA 3IDSA 4KWHA 1E3IA 1O95A 2LDBA 1MC4A 4BO1A 4W9NC 4ZGWA 4MP3A 3UF0A 2G0TA 3I6IA 1BVUA 1YB1A 1V3UA 5DBGA 3OQ6A 4IDBA 3EVNA 3PVZA 3K30A 1SCUA 4D41A 4BNUA 2BGKA 3GPDG 1B2LA 5TT1A 1VJTA 3P19A 4QUKA 4RV9A 3VPHA 3NT5A 4AJLA 4EUEA 4CQLB 4D3DA 3WGQA 3ZH2A 3RVDA 4HADA 3GPIA 1XQ6A 3AFNA 1IZ9A 2PY6A 2PGDA 3QV1A 1IPEA 4GLOA 5TGDA 2ZCVA 3PDJA 4LCEA 1BXKA 5GZ3A 5THQA 5JCXA 2E4AA 5G2OA 4BQRA 2X7HA 1RM5A 4IDGA 1F14A 1LRLA 1NQOA 1U1IA 4AJJA 1A72A 3L77A 5JW6A 1D4FA 2HQ1A 4DLBA 5KVVA 2AE1A 4LW8A 4D3SA 4Q9NA 4DRYA 1MA0A 1TEHA 4JBIA 4O6VA 4B4VA 1IHYA 1ZBQA 4JCOA 4PZEA 3DR3A 1WZEA 4EEXA 4JNKA 1HSZA 5IDYA 2AG5A 4AG3A 5CEEA 5JCJA 1X15A 2BGMA 2ZYAA 3Q0EA 2CVZA 3RD5A 1YL7A 3SLGA 2X86A 3C7CB 1C0KA 3FWNA 4BO6A 1NFQA 4NK4A 3SLKA 4FOSA 4E12A 5DP2A 4GBJA 1ZH8A 3MWDB 4ZQEA 1DIHA 3KHUA 3H9EO 1T26A 1PL8A 3FNGA 3KYCB 4W4TA 4O63O 2VYND 2UDPA 4MJLA 4WCFB 2FMUA 3SEFA 2VUSA 4JP2A 5KVSA 4NZ9A 4IJVA 1U2GA 2ZB7A 3HZZA 4QQRA 5KWEA 1ZZEA 2FPIA 4YJHB 1NHWA 4NFHA 3W8DA 1CIVA 1JAYA 5ITWA 1PGPA 4L8VA 2CDCA 1T2CA 2C20A 4NNJA 1UJMA 5B4UA 4XYLA 3BAZA 5HWSA 3HDYA 4MINA 1F17A 3ZNPA 4LSMA 4CJXA 4YT8A 4ND1A 1Q1NA 1L1FA 2CDAA 2XXJA 2ZK7A 4Q3EA 2JHGA 4NU6A 1DB3A 1MC5A 3EAGA 3PHIA 1VRWA 4O0LA 2PGLA 1BDMA 4WLNA 4ALLA 1WLYA 4F6CA 1NQAO 3NUGA 4W99A 3JQGA 3FSRA 1Z82A 2QRJA 3PJDA 1I5RA 1ZK4A 3DMTA 4EJ0A 3LT0A 1R4MA 2FPPA 3WIDA 3BMQB 1DRWA 3I9JA 4E31A 1I2CA 1ULUA 1FDVA 4D7AA 3QIVA 4FC7A 2Y0EA 1DDOA 1U9JA 2EHDA 2HUNA 3A28A 4UEOA 1IPFA 4GGPA 5B4VA 2AEFA 3LC7O 4UULA 4BNYA 2VYVD 2Y99A 4ND5A 2BGLA 3D3WA 1KVQA 1KEUA 4CLXA 1D1SA 2AHRA 4MPDA 5AXCA 1LDMA 2X4GA 3I9OA 4M89A 1SMKA 3CUKA 5KJ1A 3I4CA 1P74A 1YONA 2DC1A 4J1NA 2GZ2A 5JAQA 5L9AA 2H9IA 2WE8A 1LBEA 1NPYA 3TZQA 1WWKA 1XIVA 4TKMA 4Z0PA 2G76A 4UVIA 3WGHA 4CM9D 3DBHA 2B4QA 4KTVE 3DHEA 1UZLA 2WJPA 4WASA 3H9QA 3HDHA 2B35A 3CMMA 1JKJA 1MLDA 2BLLA 1NR1A 1SB8A 3PYMA 4H7PA 3AM5A 2JJYA 5IXYA 1DAPA 3WGIA 1HZJA 4PG5A 4PLZA 3F46A 4R5HA 1YGYA 3H3FA 2UYYA 3I5MA 4J7CA 4NIMA 1CETA 2C29D 4DYVA 2Q1UA 4DBVO 3ZV5A 2E37A 4BGEA 3FR8A 5BSEA 4XDZA 1PIWA 1WZIA 2AQHA 1W8DA 2QIOA 7MDHA 1AXEA 1DEHA 5L4SA 4PRLA 1T2DA 4II2A 1QYCA 1YE3A 4YTEA 1JN0A 4K9DA 3X2FA 4WNCA 3DOOA 2J3JA 4ND3A 3EMKA 3GDGA 3ZWAA 3RUEA 1FJHA 4PG6A 2A35A 4HP8A 3IKTA 1TA4A 3DAFA 2RH4A 2VQ3A 3OBBA 4Z6KA 1HYGA 1C0IA 1YH3A 2BFMA 3JQFA 1DPGA 2R00A 1E1NA 5TNXA 2HMWA 2VOEA 4DWVA 1ORRA 1LLQA 2HMVA 4PRKA 3WOHA 3PFFA 1FF9A 4TRNA 3KEQA 2C0CA 4CUZA 1BRMA 4IQ8A 4FBGA 3BMNA 4LRSB 1HTBA 5DP1A 1N1EA 4E13A 4ITUA 1PGJA 4G5HA 3O8QB 4BMSA 3I9NA 4R16A 3KTDA 4BKRA 4RJTA 1E0DA 3ULKA 3NDRA 1NQTA 4TZTA 3V8BA 4N7RA 2WMDA 4I08A 4PG7A 1ISIA 5C5IA 1MGOA 2J8ZA 3DFZA 2Q2VA 2D0IA 3INTA 4R01A 4BVAA 3L9WA 4KQXA 1PJBA 3R0IA 1EK6A 1LUAA 3KBOA 5CPFA 2D4AA 5L7TA 4FB5A 4HUJA 2IEDA 3RROA 2PZKA 3FF4A 5KJEA 3ZWNA 2DBVO 3PYLA 5CFZA 3CXRA 3GC6A 4E5YA 4E5MA 2EXXA 1KERA 2NU6A 1QYWA 1H0KA 1CERA 1EQUA 3JQBC 4Y67A 4CQMA 2HJSA 3OJFA 1FDUA 5ITVA 5H83A 1PTJA 1O6ZA 3CEAA 1WDLA 2I65A 1PZEA 5JY6A 4W82A 3CZMA 1X13A 1ZSVA 2Y66A 3VC7A 1Z6ZA 2O4UX 5HS4A 1H6AA 3PHHA 2GNAA 4EBFA 1GR0A 4YJGB 1K6JA 3AI1A 1Z7BA 8LDHA 4HNHA 1U3UA 5F5LA 4FJ2A 3SBOA 4QT0A 3VPFA 4YAEA 3DDNA 1SO8A 4N5NA 2QRKA 4XQGA 1DC3A 4IZIA 2WSBA 2EEZA 3DZGA 4PLHA 1MXFA 1KIFA 4YAKA 2QW8A 4QFCA 1DHRA 5A3VA 1PGNA 3C1AA 4PN3A 3LT1A 5KJCA 1QLHA 3GRKA 4R1UA 2A9FA 3NV9A 4YT2A 4HV4A 1ONNA 3IL2A 1ISFA 3Q11A 1BDBA 2GD1O 3ROQA 2PLAA 3I4FA 4LMPA 4ZVVA 3RC7A 5JCJD 4FGSA 2HMSA 3IUPA 4BMNA 2XXBA 1F8GA 3RQSA 4HFMA 4NMHA 4U6QA 3WLFA 4CM6A 3LZ6A 1I3KA 3FHLA 3OECA 3M6IA 3OETA 3ICPA 1M66A 3OIFA 5JNLA 1QYVA 3QW2A 3ORFA 2VTEA 4YT5A 2NLOA 4RGBA 1TLTA 1C1XA 4KTTE 2UUOA 1HE4A 4GKVA 1A9ZA 1YB5A 1MG0A 5C7LO 1XHLA 2VRCA 5HA5A 3X2EA 1IHXA 1Z45A 2ZTVA 4DREA 3GMDA 1Y81A 1Z7EA 2IXBA 1U5AA 4E32A 2WYUA 4BNFA 4UUMA 3PIDA 2CUKA 1YOVB 5KKAA 2QX7A 2X1HA 3JQ6A 1YB4A 1UP7A 4BGIA 3PJEA 3BMCA 3S2IA 4DPMA 1Y7TA 2NM0A 3QVWA 5F1KA 3E9MA 4R9SA 4LCJA 5EMHA 1GPDG 5JE8A 4OQYA 3V2UA 4Y6PA 5A9SA 3JD0A 4L9RA 4CPDA 4RLSA 4D0RA 2BD0A 1U3VA 2I3AA 1U28A 5I8WA 5B1YA 1CQJA 2Q3EA 3TSCA 1H6BA 2JFFA 3C7DB 3JD3A 3FCOA 3MJEA 1GAEO 3GMSA 4IGFA 3RKUA 4EUFA 2CY0A 4KDFA 4CODB 5MDHA 4XDYA 3AK4A 1XLTA 3GGPA 3HE3A 1E7YA 1VI2A 4Z0TA 4RPJA 3MTGA 1I8TA 3JQDA 2DM6A 3CINA 1LQTA 4Z9XA 3VPXA 3MOGA 4HWKA 2EGHA 4NJMB 4B79A 5TRTA 3EGOA 2V6MA 6ADHA 3CSDA 1DIBA 1YDWA 3ETGA 2AQ8A 2GO1A 1TI7A 3LLSA 1FK8A 1I2BA 2X5OA 3GUYA 3S1LA 3RUDA 3HN7A 1E3WA 4JBGA 2PK3A 4Y8VA 3W1VA 2IEBA 2B4RO 3B1FA 1ULSA 2RIRA 1ZK2A 2QG4A 2H1SA 1LSSA 4IMPA 1RYEA 1R0LA 2POQX 4KUEA 4XEHA 1DHTA 2P9GA 3DZKA 2PGJA 4TROA 1LTHR 2HDHA 4KWIA 2A94A 3AOEC 4NBWA 5L51A 5JFOA 4PVCA 4R1NA 1B8UA 3ZV6A 4IXWA 4FFMA 2CVQA 2Q50A 3FI9A 1LLCA 4MVJI 1QMGA 2GASA 3BZUA 3KXDA 1VLLA 2J3HA 5ILOA 4BNNA 4A5OA 5BQFA 2RAFA 3ZWXA 2EV9A 4ALIA 2GR9A 4W7HA 5I9LA 1G0NA 1PR9A 1LDYA 3Q2KA 2G17A 2NUAA 1A4UA 1P77A 4WLVA 5G4KB 5H81A 5JMPA 1YL6A 2NSDA 3FNHA 3D1LA 3F47A 5GZ1A 3TWOA 2JKVA 5AXBA 3U4CA 4A2CA 1BXGB 2P5UA 1A9YA 3WYCA 2ZTUA 4GI2A 3A06A 2OORA 2X22A 4XGIA 1BW9A 4BUCA 4JLWA 1ZMOA 2FR1A 4TRRA 4ZHSA 2E48A 3WBFA 3FBGA 5TJ9A 4BKOA 3GAZA 5G4LA 2JCVA 1B26A 4B4OA 1GADO 3F6YA 1QV6A 1XELA 2NTVA 3BXXA 2J5KA 1LRJA 4J4HA 1V6AA 4RPGA 4CLEA 1AE1A 1UUFA 2VT2A 5DT9A 3ETEA 3IMFA 2E6UX 5C37A 2V6BA 2IE0A 1HDXA 2YV1A 1Y8QA 4RVGA 2OHXA 3WMXA 1GYRA 1IULA 4CLRA 1NP3A 3GOHA 3GNTA 2C54A 2GN9A 4O59O 4WE3A 3IJRA 2Y67A 3JTMA 4FD3A 5TSDA 3PZRA 1ZMTA 3WGGA 4BGVA 4CQMD 1F06A 3DWFA 4NDNE 1WMBA 2YV2A 3EZLA 3FWZA 4OAQA 5IJZA 1PJQA 4N54A 1B8PA 2GF2A 3ZGYA 4PG4A 1YVEI 2EP5A 1Q2XA 3H2ZA 3Q1LA 4DBZA 4GMGA 1ZUD1 4IQGA 1E7MA 3JYNA 1T4BA 1KEWA 3BTUA 1PL7A 2WD7A 1X7HA 3GN2A 4MO2A 1GTMA 3EW7A 4R4JA 4ONEA 4CV2A 5ICMA 2EKQA 2J3IA 7ADHA 2NVUA 2FY8A 2I5PO 4HNGA 4FQ8A 2YHIB 4OL9A 3LQFA 2B0JA 1YQGA 1ADBA 4J0FA 4NFYA 3O26A 3V1TC 2PH5A 1DIAA 2EKPA 2VUTA 1ZK3A 3GNQA 4DA9A 4XRGA 3RU9A 4BMVA 2SCUA 1E5LA 1Q7CA 1R4NB 3L07A 1ISJA 1W73A 2HRBA 4FJ1A 2IZ0A 3DHYA 3R6DA 4JGBA 4GWGA 3FRJA 5EN4A 4MIYA 3WS7A 2HMTA 3VH2A 4BO7A 4EUHA 2AXQA 2FOIA 5DNAA 5AVOA 4ALJA 4WGGA 3VPSA 1KVTA 2EJVA 3UKOA 1GYPA 2Y1CA 1DJNA 2JAPA 1EFLA 1MFPA 3PLNA 3D5QA 3OQ1A 4OKIA 3LU1A 1Q0QA 4DMLA 4ZRMA 5F21A 3AM4A 3DZBA 4RF2A 1FDWA 5DCUA 3KYDB 4Q3DA 1VKOA 2DLDA 3A9WA 4EZBA 4UEJA 1I33A 1YQXA 2Y1FA 3EK2A 1N7GA 4NHEA 4XQCA 5IN4A 3GDOA 2DQ4A 2V7PA 2VRCD 5CEJA 1RWBA 1GL3A 1CRWG 4GX1A 1CWUA 4UVEA 4F46A 2Z95A 1ZKMA 3WGTA 1HE2A 3BTSA 2PKQP 3V2GA 1GV0A 1HDCA 4RO0A 2FP4A 2D5AA 3OIGA 4J2HA 4CM4A 1C1DB 2B5WA 1P33A 4IINA 3VOSA 3P7MA 4AJEA 4DUPA 4NBVA 4JBHA 3ETDA 3RFTA 2NACA 4PLTA 4YYZA 3GEMA 4R1SA 2DBZA 1I0ZA 1PGQA 3UVEA 4IBOA 4CL8A 4WNIA 1OMOA 1OZAA 4ZN6A 4GSKA 2DPHA 1QP8A 3JQ9A 2X0JA 2QYSA 1XU7A 2HLPA 4I9NA 2RCYA 3AI3A 2UAGA 1UXHA 2CDBA 2WDZA 4UEKA 1PJSA 1GDHA 1B8VA 3AJRA 3ZU2A 2BMAA 1QYDA 1KVRA 3DBRA 4OSPA 3DFUA 4ZRNA 4QEDA 4II3A 4G65A 4MVJE 3S8MA 1DAOA 3D0OA 1PL6A 3SC6A 1H6CA 1P1KA 1RJWA 2VTDA 1LC3A 1NAHA 2C7VA 2ZJ1A 4FIZA 1KS9A 1PS9A 1ZSYA 3GRPA 3GZ4A 1IZ0A 2B83A 3L6DA 3QWIA 4P38A 2Y1GA 4J90A 1U7HA 9LDTA 2ZIZA 3EVTA 2EKLA 3GDFA 5A5FA 2EJWA 4DIBA 1HL3A 1SAYA 3RBVA 5C7IO 5I9MA 5IDWA 4AICA 3PQDA 3RBXA 2I3GA 4CMIA 2RHCA 3JQGB 5CP8A 3U4DA 3RC9A 4BS9A 4B7UA 4Y6RA 3T4EA 5A03A 4L76A 2HSDA 1XYGA 2CNBA 1OI7A 4PLPA 3O4RA 4W7IA 3ZV3A 2DTEA 3JQAB 2XF8A 2ZB3A 2PFGA 3B6ZA 1R66A 2VHYA 2V65A 1ML3A 3DMYA 3I3OA 3D3WB 2IYPA 1EMDA 4YBZA
chains in the Genus database with same CATH superfamily
1L5FA 3GY0A 1XAIA 1JAXA 2Q4EA 2W2NA 2ZYRA 1K2VN 3HVUA 1ZIYA 4JQZA 2A0FA 1FFCA 1JKFA 3KVOA 5C5CA 4I1PA 3HUUA 4QO8A 1GLGA 1GO2A 4ARZB 3JQQA 1DVRA 2C7PA 4N1AA 4K87A 4GG1A 2H11A 4ACBA 1KI1A 5A5EA 4RZHA 1NC3A 3BHIA 4EGAA 2VDUE 3AUXA 3MBOA 1ZIPA 3A3NA 4MRPA 3JWHA 3QP9A 1NI4B 1WZ2A 5BRJA 2FUG1 3GV0A 2XNCA 5AR1A 3SR4A 3BBPA 2GZMA 3B36A 1HTWA 3CSSA 2RE8A 2JHFA 2CK3D 3BL6A 5CLHA 1U5CA 2QU8A 2ET6A 1V3VA 2HQBA 5JH7B 5BMOA 2ASVA 2O52A 4Q3CA 1A04A 4OG2A 1L5GB 3GCDA 2HYDA 3IDZA 4DZRA 1ULHA 5A06A 5D00A 1MQ9A 5A4DA 4Q6WA 3OIDA 1WP9A 5BO5A 1QZUA 3IBTA 4J6FA 2LDXA 1WKBA 4IW3B 4E2ZA 5LDHA 3QJGA 3X1WA 2YNMA 3TOVA 2UV8A 3SC2A 2IBTA 5HZMA 1X14A 3ECAA 2HPAA 3LPMA 3NIGB 2UVDA 2WNHA 4YS6A 1Z37A 2FW7A 1IIRA 2QNBA 3D54D 3M5DA 1E1CB 2HCFA 1M9NA 5IUKC 3CZQA 1GA6A 3OZRA 4N4AA 4WXMA 2O8CB 2P4HX 4JZYA 5I8ZA 1B0PA 4OIFA 1EBFA 1N75A 1V8OA 1GFWA 1GGJA 1QGUB 5COBA 1GTJ1 4G4SO 3TF5A 3IEMA 1JL3A 3COVA 5KKNB 2HC9A 3ZWWA 4DVJA 1D6MA 2HFKA 4XWWA 1E1RA 4K28A 3GRVA 3TRIA 1E7RA 1P60A 1Z68A 2CVOA 2CZCA 2OB1A 4PFQA 4IHAA 4QBKA 5TC4A 3V4FA 1V3QE 1UJ6A 3WLLA 4AJOA 3SG0A 1WDKA 5I4KA 1XFAA 4BCBA 3A37A 3HWX1 5FOWA 3K0FB 2ZJ3A 4GDMA 1E3SA 3C7AA 1L5HB 1WEKA 1MB2A 2Q45A 3BXHA 3KJZA 4XQ9A 1J2TA 2VHCA 2WVJA 3NTVA 5FRDA 1R5OA 2GKGA 2WM3A 3ESBA 5DWQA 3WADA 3KJIA 4ACAA 4DIMA 4JB2A 3R9WA 1ZONA 3OAAD 1BHSA 1R37A 4H1TA 5I7HA 4G1EB 2JLXA 2NQ2C 3SI7A 1OFUX 2FGKA 3PG5A 3L0OA 4WUVA 1U0LA 4DC0A 1E9VA 3KB2A 1UXJA 1YJAA 3HLTA 1BOFA 3H0CA 4UXJA 3KV3O 1W85B 6LDHA 4IPTA 2DFNA 5FNVA 2VBFA 3K70C 2ZJYA 4UBOA 2CUNA 4W9NA 2RHOA 1VE9A 2ZRCA 1Z28A 3ROKA 3TD2A 2A9PA 1IAVA 2QGFA 1ILWA 1M7HA 5EWLB 2I2BA 1IPHA 2Z8XA 1IHUA 5KTMA 4ENUA 2HLDA 2GTPA 3H4MA 1CQWA 5AKEA 2OXTA 2Y1WA 1F4VA 3GWGA 3F6EX 2H92A 2WKSA 4K9QA 4DUGD 4CMKA 5ESRA 4I66A 2ZCJA 1BROA 3GZNA 3KLPX 3C3XA 3H7AA 3BGVA 3EEQA 3FPGA 1GCOA 3KJNA 3C5CA 5E3IA 4PRYA 1JA9A 3QEMB 5TVGA 4MQLA 3U3KA 1YA8A 1GCUA 2WAMA 1ZH4A 2FF7A 4G36A 1PQYA 2W2MA 1Q1BA 1ZKDA 4KDEA 1YACA 2PQ6A 4OGFA 1FB5A 1XRMA 1ZAKA 2Q0XA 1ENYA 3QVOA 5SZKB 4K1XA 4MRAA 2PUGA 3QV2A 4DCSA 1DGQA 3D2CA 4H7DA 4ALMA 4PHCA 5IANA 5J4HA 4PM4A 4Q16A 4E4YA 2E6KA 1AV6A 4JU9A 5JRJA 3HGMA 2WPNA 4G5OA 4RC9A 3IO5A 1B16A 5FBQB 3JPWA 3ASZA 1NVVR 3VVCA 4C3ZA 4I9FA 5HVNA 4Q39A 5BSTA 4AMZA 4DSUA 3P9PA 1XZLA 2GGSA 3DAPA 1KEVA 1KQOA 4KXXA 1PYOA 5KTRA 1X1EA 4KQ6A 4HGRA 1KMHB 4HAYA 2DX7A 1T2AA 4BE9A 3ESCA 1YBMA 4BJHB 1TK9A 3UZUA 2JD1A 4YCBA 3GG2A 2Q3BA 4IIVA 1U3DA 1T2EA 1DQSA 2BCGY 3CBQA 4FW8A 1OGJA 2Q41A 3GH1A 4BXOB 3U09A 4AY2A 1ZEJA 1S96A 2F9FA 2PRSA 3WTBA 3HCEA 5CNJA 5K3SA 1U8ZA 3C5VA 3SAJA 2OL4A 2PBFA 3WRYA 5L6LB 3WP1B 3O4HA 4E3WA 1C9JA 3OY2A 3PZBA 3H8JA 4JS0A 4K0KB 1PSDA 3HJCA 2RARA 3LI2A 3E2PA 5AQEA 4CIXA 1VGVA 1FBNA 1AKUA 1KL7A 2E55A 2QLFA 3L7KA 4II7A 4KO3S 2WBLC 4UBJA 3STHA 5I4CA 1KMNA 3L7YA 4UUAA 5JNVA 4D3YA 3FOZA 1UOPA 2JH8A 1JFFB 2WTAA 2RHGB 1WABA 2ZPTX 1SUAA 3AHEA 3EEBA 3E3NA 3H0KA 3HJAA 1KY4A 1ZIDA 4HCJA 2QRLA 3V8PA 3VNAA 3O4VA 4JGIA 5F77A 5IAAA 5D1HA 3TOXA 1E5TA 1MEJA 2CNNA 2VNIA 4FCCA 1WUTA 5HBGA 5E0OA 2Y1XA 3HNPA 3B78A 4YACA 3TD9A 2W2OA 2VG8A 2V7VA 4LGVA 1L7DA 3U60B 4MQEA 1ZFNA 3MB5A 4ZTUB 2IHTA 2AMFA 2AQIA 1T6BY 1YRAA 1GPLA 2VUUA 1TUGA 3H5AA 3IE2A 1CUDA 2FSSA 4PNPA 3AM3A 4YT4A 3NBXX 1YRQA 3OEED 3SVZA 4JXKA 1EK0A 2FEPA 3ZJYA 1HNZB 4X3CA 1TVMA 2H31A 1UODA 2Q0HA 3D3KA 4KE7A 4QU0A 1TZBA 3NOVA 2HRQA 2FI1A 1HOXA 3DOUA 4GAEA 4K26A 4HQNA 4KV7A 4IUBS 1L8QA 4YVFA 5DASA 5HCNA 4B6OA 4EITA 3OZ7A 5BPFA 4FZVA 1JWBB 3E5HA 2P6PA 4TKLA 4XFJA 3RJMA 4DR5B 2X4LA 2F1KA 2QZ9A 1EXMA 2QX8A 2B92A 1I4EB 3BMQA 4J91A 4MRSA 4Q3KA 2Q3CA 1CC1S 1U8AA 5AUNB 1YQDA 3RHTA 4K3UA 3I9LA 3RUIA 1ORWA 5K05A 4YRTA 4KXFB 3N8GA 4WPGA 2Z6VA 3ZBUA 2DBRA 3WOVA 2WEKA 3CJRA 4XFKA 1NWHA 2I1VB 3QXSA 1YVPA 1R16A 5FOVA 2BBWA 3WYEA 4M8KA 1V8DA 1XCOA 1ZGBA 3A4YA 4BATA 1F12A 4L2IA 1YQTA 4GE3A 1V6CA 4CT0A 2J1LA 2C9MA 1VSUA 4EDFA 3RU2A 2P35A 2Z83A 4UM7A 1GHTA 4C21A 1XSEA 4MWCA 4W1SA 4UPVA 4DN6A 3PLAE 2X6RA 1AQNA 3H2IA 1VYUA 5YASA 3G0HA 1P8JA 2BDTA 1SC9A 1R8SA 2LUOA 1M0WA 3P4YA 4HLCA 2O2SA 4U2GA 2KMLA 2P9TA 1RAIA 5EWMA 3SSMA 3V2IA 3B9QA 4DNOA 1N2SA 4E2YA 4YRGA 2BHNA 1L4EA 1PFYA 4OHOA 1UAAA 1ZOIA 2PIDA 3E27A 1SU7A 4W5JA 1M75A 2VJLA 4ZYXA 4FE4A 3FTCA 2IPXA 1E3WB 2W98A 2ZB2A 2R44A 3T7DA 3UJ7A 5JYDA 1QDEA 2RGNC 3AUSA 4LECA 3CH4B 3NTQA 1W5AA 3E9DA 1GD1O 3G2LA 5C1OA 4U7WA 3QOFA 5A4MS 2OP0A 3P8ZA 5TQ2A 1E3TA 1ETHA 1TTPB 2C9YA 4XUDA 4RZ3A 4Q9DA 3ELYA 1XZAA 4A8PA 1U1EA 1VI5A 4RWZA 3L79A 2FNAA 1AKYA 2Y0PA 1ORVA 1J00A 1TX4B 3KG2A 4HFJA 1ZVJA 4HQKA 4KXQA 4JC0A 3T7CA 3LQKA 4LSZA 3HU2A 2QW0X 1PNTA 4INAA 1EQ2A 3C3PA 4C5CA 2EWMA 3VYRB 4V0SA 1QP4A 3YASA 3D7KA 4UOZA 2HWYA 2GAAA 2YNMD 3B70A 3I37X 1G5TA 3RHFA 2OUKA 3B5IA 3ZXIA 5BQXA 1EK2A 1ZD8A 4CETA 1TECE 3L4BC 1ZL0A 1LPSA 5ICSA 3COJA 2PNFA 5DI3A 2AK2A 3NV7A 2D5IA 4CEHB 3L7JA 2XV1A 4RCVA 1NNI1 2ZYGA 2OQVA 1XCJA 1JW9B 4AJHA 1DBWA 1QIEA 3QNUA 3IEXA 3K20A 1G0OA 3U7IA 1WNTA 4HEQA 4OY3A 2HCTA 4JLJA 1N1GA 4RM3A 5DBFA 4ENSA 1X7XB 5KREA 2I66A 1T4MA 3KK0A 2NUAB 2OQRA 3WA7A 1FSPA 3ES9A 3R3HA 4MCHA 1E1RD 4X62B 1SK9A 3OLVA 2W42A 1QIJA 1W36D 3M3DA 3SFVA 2AI2A 2H2DA 4EM6A 3K0KA 4DR4B 1FX0B 1XZPA 2JGAA 4ZOBA 3ICCA 1H93A 4C4OA 1L4YA 4LF7B 2P9JA 3KALA 4QOEA 4BNKA 2PSHA 8ABPA 3T0FA 5KTYA 4A1OA 4N0EA 5JDIA 3HJNA 4M9SA 2J5RA 3KQPA 2OV2A 3UGKA 2PO5A 1BW9B 1W30A 4K7JA 3N2ZB 1E69A 2HTEA 5REQB 3ZD7A 2XTJA 1G6Q1 5BW6B 3B1JA 5H82A 5FBWB 3S4YA 1O6GA 2BR4A 3H65A 3BG5A 1A9QA 2ZQ5A 3K9GA 4IDEA 4YRDA 3LP6A 1XBTA 2BI8A 2JFYA 4IICA 4DARA 4MUEA 3GQVA 1T3TA 5DDIP 3GA5A 2D4HA 4LS3A 1RYFA 1E1LA 3KQMA 2PEYA 3AUAA 4L9AA 3GLQA 1Y5IA 3EXIB 1T9KA 1T9CA 2YN4A 1TGVA 1QX4A 2W5UA 4IDFA 3TVYA 1U7WA 3V2HA 3W4KA 5AO9A 3ZCRA 3HRKA 2IRWA 3LO5A 2PWBA 2HLDD 2ZUVA 4HHEA 4S04A 1SOUA 4LF9B 3GGOA 3UPTA 2TRSB 1W96A 2Z3ZA 5TS2A 2DFDA 1SR8A 2FSHA 3FYUB 3GVCA 4YGXB 3R8CA 3TXXA 5JDCA 2JD2A 2HV8A 1J07A 2ZJZA 1F2UB 4OA5A 3GBVA 3PWTA 4HEA6 1QO9A 2WV7A 4FTWA 5KQLA 5DHPA 3O8OA 1F6BA 4MB0A 3HXOA 4ZO8A 1E3EA 3B60A 1M2OB 5I7AA 4MAFA 1HG1A 1MEOA 4MROA 1GV1A 2AW5A 1IYZA 2HLNA 2X0RA 3N59A 4HDKA 5ECGC 1XRQA 4NH4A 4M1YA 3U2QA 1TVKB 4YJ2A 4WAUA 2Z5FA 3EY4A 5IKOA 5EKDA 3JTEA 4R54A 5K0JA 4J43A 4GOXA 3BFPA 3GT0A 5TV2A 4ER0A 1NJFA 3GLFB 4ZVNA 4MDFA 3CLUD 5IMSA 2EFGA 1H05A 1AKMA 1JFRA 5JAHA 2WD7B 1UXKA 1IIBA 1WZUA 4ZEWA 3A6ZA 2HO4A 3LXMA 3T1OA 4BRUA 3EDCA 4H3KB 5AFSA 5IYZF 2QMEA 1XZCA 2NVUB 2IKQA 5AOAA 3GFTA 2FH5B 4G8JA 3UW1A 1J97A 1TDJA 1MT3A 1QGAA 2WMYA 3AMVA 4JP1A 3IGFA 4Q47A 1W4ZA 4RXUA 3QZUA 3TSOA 2VNJA 1EYZA 1Y89A 2X2PA 5GMOA 1QKJA 5IAOA 1P31A 1JI0A 3UJCA 1NSTA 4WKPA 1WM1A 4HNVA 4CQNA 1FLDA 1JS1X 3ZBTA 4OSOA 5I4IA 1V43A 2SCUB 4JD5A 3U48A 4NXNB 1A7KA 2IKSA 1SCBA 4L07A 4YJ3A 5LB4A 1VSBA 1DLJA 2QMQA 3B1YA 3D64A 3GJ4A 5H0IA 4E15A 4QRIA 3WISA 3R20A 3WSWA 4X44A 4NE7A 4DZZA 3PD1A 1JLLA 4Q02A 3L05A 3E5RA 4MCAA 4X66B 1EX7A 2I9PA 5TY0A 3ANTA 4V39A 3HYSA 2AUTA 5JVDF 1S6YA 3RVSA 3W1EA 2A1UB 1XCGB 2AJLI 1M6YA 2I29A 3IEIA 3OE1A 3P32A 1TUEA 1STOA 2ZWMA 3JSAA 3TNLA 3U4QB 2VZ0A 1RCFA 3STWA 3ER8A 2LW7A 5B4TA 3BRCA 2B6HA 4JL5A 4ATNA 1GNTA 2HRRA 3MRTA 1GZ7A 3FOFC 1JQEA 5CA1A 2HRDA 3M4YA 2PTGA 4ZEVA 2Q1YA 2GRUA 3CR8A 3G7UA 4Q9IA 4HDRA 3MELA 4NNPA 4HWPA 4GVLA 2NWQA 4EX7A 1O87A 1LZKA 5FADA 5C7OO 1WSDA 2FVXA 3WNBA 1K5HA 4UUOA 1Q57A 3ZY4A 3C70A 1P0FA 1RQGA 2R4UA 1BJTA 3ZTTA 1NM5C 5F5NA 2ZUBA 3RREA 1ZUNA 3QVTA 3NGLA 4BUZA 3KWJA 1KWKA 2H4FA 3HS3A 1B1AA 4XB1A 4B2PA 4B3XA 2Z4SA 5LOVA 4HWGA 4BNMA 4WEOA 1SVIA 3EGXB 3P20A 3UMBA 4JWTA 4ECAA 2AJTA 1E5QA 1E7SA 1MBZA 5CYOA 5KZMB 2XZDA 5JNTA 1MB4A 1US8A 2HSGA 3TI7A 3OKAA 4JX8A 4A27A 3LCJA 1JALA 4LYFA 2W11A 4G0PA 1W5SA 2BZGA 2Q4RA 2V7XA 1ZD2P 1T9GR 2VXCA 2WKQA 4OI1A 1GG2A 1HORA 4X97A 1X8LA 5HMMA 3SDSA 1RKUA 4I8XA 5JI3E 1EGQA 4ZVLA 2MR6A 4OUDA 4L0QA 3OFSA 3RNOA 3CRQA 1ZD3A 4TMVA 5FWXA 3CNLA 5CB0A 1I7PA 1BMDA 2P41A 2BPOA 1A8PA 1X7ZB 4DMUB 3EIEA 3PFWO 2R7NA 4O4JF 4TXMA 2CVHA 1O96B 1O6FA 4U6NA 5ALNA 3T1NA 3VX4A 3G9ZA 4E88A 1KPGA 3L8FA 4I8IA 5LN1A 2DBQA 4UAVA 3JV7A 4WN9A 2V9ZA 1UKVY 3WQBA 3CLRD 4QA9A 4B76A 1I3MA 3I52A 4CMEC 3SN6A 5KNBH 3A1EA 1MOSA 2TECE 3KFXA 4LRTB 3STXA 2ZRGA 4U2FA 4FFOA 2Q21A 3B2EA 2NZ8A 3BE8A 3NWEA 1QTRA 3PC2A 3QOYA 4UKDA 4LY6A 4J16A 4WBXC 1K4YA 3DOIA 1A9SA 1SZJG 3TZ6A 3KQSA 3RADC 4OHRA 3ZIUA 4KZKA 1ENPA 5FJJA 3VKGA 5D3MA 1GQOA 3VPDA 2GBLC 4MITA 3IV7A 2ZSBA 3E3AA 3O3OB 2VJNA 4JB3A 1SJ9A 1TYCA 5A0TA 3GRFA 3HYTA 4LRYA 4UD6A 4NEGA 5LZ8A 4XD2A 3A1DA 1ZNQO 3OI7A 2FPMA 3O74A 2B61A 1SCIA 2XVMA 4HRXA 3UV6A 3VTKA 1M2GA 4CNQA 1O95C 4ZYTA 5FIUA 3AR7A 1LJ8A 3ABIA 4XSHA 1XTZA 3MJ4A 4H0NA 3PE4A 4EI7A 4AQYB 1YK0A 2CMGA 4PYIA 3VTFA 1SU8A 1HT0A 2R8BA 5E38A 2FZCA 2FK7A 5EJAA 1Q1ZA 3ADKA 1N1DA 2WKWA 3CZ9A 3F9RA 1O97D 1H9CA 2QN9A 1AVTA 4TWRA 1N5RA 4EY6A 2FG7C 2OG1A 3F6PA 4ZIRA 2NVWA 2D13A 2QV0A 4GUAA 1KEEA 2Z1MA 1PS8A 3WY9A 5AM3A 2FWRA 2V74B 4LCBA 1XU4A 1VFPA 4QPNA 1A82A 2BFCA 2XUFA 4PAGA 2HCBA 4US0R 2M6KA 1C0LA 3EC7A 1LBSA 1XD2B 4LYGA 1BXGA 1VXOA 4N6NA 5JLAA 1DV2A 3INGA 2HK7A 1F8UA 3FMIA 1SBIA 5FPYA 4B17A 4HZUA 4B6JA 2PUEA 2X13A 3QWAA 3N8HA 3HB7A 1E9BA 2O06A 4HLQB 4GM4A 1B0AA 4W1PA 1MJGM 3V6MA 3AHIA 2ECPA 3I6MA 5T6BA 2JAQA 5DGHA 3WXMA 3WTCA 2XMSA 2P3SA 1M54A 1TZ2A 1VI6A 2QL9A 1B15A 2OVFA 2JZOA 3QX9A 4OU5A 3BZBA 4I4IA 4WXHA 3MYRA 3T4UA 4I1UA 3W4IA 2GCOB 2YV3A 1WV0A 3QWHA 3OC6A 2VPQA 4RZQA 2OHFA 1OE0A 2VDWB 4QASA 1W88A 4UHDA 1E3LA 1KYQA 1YS9A 1PNQA 1WPXA 5D6NA 1K2WA 3SOPA 4MWTA 1XQWA 4U63A 4JJGA 5EPOA 2IU4A 2CXTA 4HAIA 3OQIB 4P4SB 4Q1CA 3FHOA 3H4TA 4R69A 4L75A 1M2FA 1CUYA 2BWJA 3S0JA 4NBUA 4DY4A 4PO9A 1KGDA 2P1RA 5ICCA 3OZIA 1KZ7B 2FX2A 3WB9A 1R0YA 4QYIB 1N2CA 4M0MA 2NXCA 3DVSX 5BN3A 4HPXB 3UWSA 3UK0A 3N8KA 4KE6A 5DI9A 3DEKA 3C8MA 1U2GC 4RZXA 4RCZA 3A1WA 3T7AA 4QARA 1Z2CA 3NDIA 1HF3A 1VGQA 3C1OA 3B1ZA 1VYVA 3IUYA 4H16A 5HIMA 1MC8A 3RUHA 5KINB 4BN0A 5B7GA 1MRSA 3IAS1 4X0EA 1MOQA 4ENVA 3MGCA 2QPTA 4G9GA 3PC8C 4GXNA 4YMIA 2XAUA 3TCKA 4AN0A 4CQJA 2H63A 4RX1A 2QF7A 3QBTA 3RJ5A 2B69A 3TIFA 3OJWA 1LVHA 4MQBA 4EB8A 2YQ5A 1HOTA 2C58A 3X1ZA 1HE3A 5FLEX 3KOUA 4KUHA 3P27A 3BGOS 4C43A 1G7SA 1R4MB 5AW2A 1B6SA 1V6SA 2GUWA 1P4JA 2CSXA 1FDOA 2RKWA 1XZNA 3BA1A 3OP4A 1N78A 4KH0A 1NFFA 2MINA 2Q1TA 1J90A 5DM2A 4YN3A 2W8BB 2UZ1B 3GFSA 3UPUA 1BCSB 1JEJA 1BSVA 1OILA 3RIHA 1ZIOA 2BFEB 4G23A 4YCMA 1MQAA 4U3JB 3D31A 4W8HA 4I1SA 2VJKA 2QUBA 5EQJB 3IPYA 1M0TA 1NXPA 1AGNA 3V3TA 5AW7A 3EF0A 2NVOA 2X9NA 4XB6B 4ZAYA 5JWOA 2HK6A 5A05A 5ECWA 2B1JA 3D1JA 2VYQA 3FMGA 3KDSE 1IUPA 4KWEA 5LDGA 1MR3F 1IK6A 1C3OA 2EGGA 3E15A 3LX8A 4S1VA 1EU1A 1T3SA 2KSQA 1H2FA 3PDIB 1DKPA 1QQTA 2HU2A 3CW8X 3TKLA 4XA8A 4CFZA 5JXWA 4RTMA 4KR2A 3OKPA 1HQDA 1JIXA 1J9EA 2QN8A 4FHGA 2GPYA 2Z5GA 1NATA 3BTOA 3CBGA 4D4GA 4EATA 5D7BA 4CKYA 5A2QA 3LXXA 2QUJA 3CUYA 2C5EA 4YMSA 1O2DA 4EJFA 1GN8A 3K0CC 3KO8A 4MVXA 3LP5A 5I3CA 1X7DA 1PWZA 2CXUA 2ZIFA 3GELA 3NDPA 4GSLA 4MRNA 1Q21A 5LZ2A 1TEXA 1WLSA 1ZI9A 3DDWA 3HK2A 2IQIA 4GLJA 2OPHA 2P1DA 4KPFC 3OO1A 4ZAXA 3NYQA 3UA3A 4E30A 2Y0BA 4C2BA 1KQNA 3LKVA 2J9FB 1EFVA 1XKQA 3U1BA 2E49A 2O8BB 1ACMA 4OYRA 1R4ZA 1U4NA 2ZFUA 4IIHA 1C1DA 1FPMA 121PA 1NBOA 2VWPA 4KQGA 3WBBA 5AVRA 3UKJA 1HMPA 2SNIE 3B3FA 4Y2XA 5L7WA 3LTEA 2D1YA 3MW8A 4DXDA 3A25A 2ZUEA 3JVVA 2EBFX 5TIIA 1Z07A 3F2IA 3ZLUA 1Z63A 4A26A 3I04A 5B3LA 2ETVA 3L5OA 3SZGA 1Y33E 2FSIA 3QKSA 3NT4A 1MQSA 4L1KA 2D59A 1IWPB 4LQLA 4QQKA 3KUDA 4B35A 1YDGA 2RC5A 2XX3A 3HJHA 10MHA 1DQPA 1FRZA 2I4RA 1T9BA 1P5HA 1EGMB 5FP0A 4X95A 4LXHA 4W5OA 1DAEA 2MR5A 1S2LA 4EGQA 2G9RA 4TMFA 5CT4A 2CXSA 4FCWA 3S2GA 4CM5A 4BQIA 4PYRA 2FA9A 5A2GA 1SHLA 4B3MB 4JI2B 5K3CA 2NTNA 3ACBA 2DAPA 5HF9A 4P0TA 3SXUA 2ZZMA 5JC8A 2FPSA 1AU9A 4MWGA 1ODTC 1XVUA 2FPKA 2Z58A 4RK6A 1F6DA 4TQAA 5F76A 2B1GA 4B85A 1Z2AA 4RIEA 4EKIA 5EWJA 2XTAA 4EBBA 4OHZA 1T3LA 5IX8A 4U2EA 1V96A 2XZTA 3GAFA 3E4DA 2WUDA 4AYTA 3IOMA 5EEGA 3FPBA 4LAFA 3QA3E 4JBNA 2BIFA 3TNJA 3ZGOA 1JLMA 4XTCS 1ATIA 1XVIA 2QN6A 3PC3A 2PHZA 4OAOA 1WE2A 5B3JA 4J6EA 4EK9A 1N7IA 4RDCA 2AFIB 2JNWA 4YPFA 4NMMA 1Q11A 1ENOA 2BHLA 5BN5B 3WHLA 4N18A 4JA2A 4ZTBA 2HZBA 2L69A 4CUJA 5JECA 4D5EA 4A0SA 2DKOA 3R7LA 3CTPA 2C2XA 3HCCA 3CE9A 3DP7A 2NU6B 5A7GA 3O94A 1O9BA 3RSGA 4ETWA 4DR7B 3K8YA 3LSYA 4Q3NA 4RWEA 3OP1A 1KY2A 3N0TA 3OJCA 5AJUA 4ID9A 4KXUA 2JI9A 4PY2A 1SKMA 1Y3HA 4UMFA 5HKAA 3BFVA 3T1YB 3VUFA 1S3FA 1EG7A 2F7SA 3PHCA 4LKRA 4H59A 3S2EA 4MULA 3TW8B 2JFWA 2O23A 1RI3A 4RSHA 3U5ZB 1F5SA 1OLUB 1QUEA 5DTRA 1GNRA 2X4IA 3CGGA 3HEAA 1UMBB 2ZE5A 3MEQA 4DLXA 1Q0LA 3I1IA 3FDXA 4AZ3B 2PYDA 4EOGA 5T5QA 5FX2A 4RZSA 3J7AC 1PEDA 3DT9A 3NKFA 2GN4A 4UVDA 5I3ZA 1NI4A 2BH2A 1RT9A 4M83A 1DMRA 2QXUA 4N65A 4BO5A 5F98A 4G01B 3NC4A 4QXRA 1Y63A 1FS5A 1EJ6A 1AHPA 3W8EA 4RV5A 1HRKA 3IKMB 1YQUA 2P2GA 1U0BB 3ZW9A 3WNZA 1NUHA 4C7KA 1R0WA 3ET4A 3HPQA 1GGMA 3CJTA 4Y6QA 5EFZA 5K3AA 3HKBB 4ZVQA 2PGAA 4IG4A 1CEYA 1AM4D 1WIWA 2O1WA 5HF5A 4IWYA 2VHXA 3QEBZ 1N5LA 4WN3A 5KYYA 1UBNA 1P8AA 3Q8KA 2ZUSA 5EJ7A 2AC7A 4C29A 2FKAA 1UWCA 1I3LA 1TT7A 3GLSA 2YINC 4X6UA 4C7XA 1IN6A 2ORYA 1PT5A 1RXIA 2L0XA 3DTTA 3IYLW 3NTLA 3M3PA 3WE7A 1D2NA 5GJWC 3T99A 1N6RA 3B53X 2GJ8A 2O6HA 4OJKA 4P81A 2O7QA 3PQCA 1QGUA 3FFWA 4YJHA 1JKIA 5DNUA 2Q3DA 1W8IA 1JBKA 2ZREA 3ADOA 4GNKA 5FD8A 1A7JA 3I53A 3K8ZA 4I4TF 3T9BA 3V4ZA 3U3MA 5FTLA 1J9ZA 1V1RB 2R1ZA 4YQYA 5CLGA 2I1QA 3TOZA 5BYBA 3OHSX 2YN2A 3RC8A 2DETA 1GPUA 4UQLA 5I7SA 4HRYA 2P2SA 4BVLA 1P2TA 3QE2A 1PR2A 4B84A 3K0FA 2F90A 4DHWA 3AUFA 5KYGA 1C14A 3U3RA 4BWGA 1L5HA 1KZYC 3FH0A 2FFRA 3MTJA 4YUAA 4ZXPA 4NZZA 1PJRA 2PKQO 5T4EA 3RS0A 3TQRA 3WMWA 2ZI4A 4IAOA 1DG1G 4IP0A 3X0DA 1ARZA 3N6VA 5LUAA 1W5EA 1KVSA 3DO5A 5SV2A 1BE8A 4FX5A 4TUYB 2XNDA 1XO1A 2W90A 1YQQA 3PEUA 4LPSA 4G07A 2HHAA 5J23A 4JIMA 3T4XA 2K2QB 3WLNA 4DR1B 1W85A 3AR2A 3CV3A 1J99A 3AKDA 1N5JA 3B85A 1TM5E 1TCUA 2QN7A 4OQFA 1SXJC 2HI0A 2PPVA 3DLPX 5CTJA 3AYZB 2X9QA 1I4DD 1ZJYA 1JNYA 2Y71A 1Q6YA 4MJ3A 3UAWA 1YJCA 3AG5A 4R68A 2C9CA 4XOIA 4MRMB 4WA7A 3K6KA 3VAAA 3Q10A 4BFTA 2GBIA 3KQWA 4ESHA 3PNPA 1I3NA 5EJ6A 3Q41A 4UUPA 1U3TA 3SC4A 4YRAA 1T5OA 3CNQS 4P54A 4ND8B 3HZOA 3P9QA 2VNKA 1EUCB 1RBQA 2JS7A 4BQNA 3EF3A 3LY5A 1HDYA 3QEMA 1SM4A 4LE2A 1RYMA 1P1BA 1W44A 2FEAA 1KFBB 1JFTA 4JFAA 2Q3FA 1N92A 2C4VA 2JEOA 3CONA 1Z4IA 4RVFA 5CB4B 3C3WA 4Y18A 2R1TB 2COKA 4XJSA 4EVSA 5KU7A 2GEUA 4KEAA 4ZQFA 4HBGA 3IAHA 1VOTA 5G1NA 5FUWA 4KK3A 3GEPA 1TTHA 3PL5A 4GR9A 5ENZA 1GQ2A 1SHTX 2B20A 1L3IA 1WP4A 4EY4A 2NQTA 1OI4A 1BS2A 3LK7A 5G0VA 5BN4B 5C8ZA 1AA9A 2PGXA 3MAJA 5EESA 4FS3A 4KLAA 1Y5MA 2E82A 4FCVA 1XZMA 2XDQB 4YGYA 1P1RA 3EIUA 1PEAA 3D0KA 3JZFA 5AK3A 1KQ3A 1U81A 5CFPA 2MWMA 4YAJA 1V26A 1WXQA 3ISVA 4R2LA 1EVQA 1BGXT 1JIQA 1U11A 2JHAA 2QAGC 3GUVA 3TRJA 2QTHA 3K09A 3O1LA 1FA9A 4HUQA 1HKUA 2ECQA 2VHJA 1JR3E 2DYKA 3C3KA 3SJBA 4BNDB 3AHDA 4ZRDA 1GFIA 2CJPA 2OSVA 1AO3A 4PBRA 4KQCA 3WQHA 5FV7A 4A5SA 1WQ4A 4BXOA 4QPDA 4BLPA 4Y7CA 2CLOB 2H5JA 4RMGA 4B8WA 1CB7A 5BMVF 4D96A 4DF3A 4EGFA 4DTIA 2Q3JA 5AHKA 1QHFA 5TR9A 1FP4B 1K3TA 4GR5A 4TT8A 2BHRA 3V4VB 3GEBA 1E9DA 2HJVA 4RANA 1YQEA 1L4BA 4NPCA 2GPTA 5JZBA 1BN6A 1DNPA 1SG6A 1I36A 1DAIA 4O08A 4FB4A 3ECSA 3NBFA 3LPAA 4MUGA 4GT1A 4L4SA 2YZMA 3TLBA 1ECPA 4S1NA 1JSRA 4E21A 4J49A 1P62B 5JI2E 1HYEA 2JW5A 1X70A 3R74A 2F8SA 1E18A 3H9JA 1KQPA 2ORWA 3O8QA 4B6PA 3HYCA 1CS0A 5TT0A 3SBDA 1V9SA 2Z9BA 3VMMA 1JE0A 3VYWA 2AN9A 3C8HA 3QKIA 4BV8A 3AF1A 3I2KA 3LSTA 1ZRSA 3K4PA 4IJ6A 3WIEA 4ANFA 4DMKA 6REQA 2RMKA 4N5HX 3E5MA 4DQLA 3C15C 4KXMA 3N58A 3RODA 5CDGA 1XZGA 5TB5A 1KBQA 1AN9A 1KU6A 3PEFA 3ZWCA 5LMNB 1ZXXA 1JXMA 3IBGA 3LX4A 3LHIA 3BERA 3QTLA 3M70A 1N8SA 3ZE2B 3L4JA 5LQNA 5HUJA 4K6FA 3W77A 1OTHA 1EUYA 5EP2A 2HK9A 2K4MA 2R4TA 1E2FA 3H3JA 4YJDA 1OWMA 3GT3A 4EHHA 1D2HA 3PGXA 2G63A 3MJHA 4ITRC 1F48A 2INGX 3A1VA 3NIBA 5F2OA 3AJ8A 1LWNA 1G4UR 3N76A 5T4FA 4B4KA 3ZYZA 4GLLA 1GPMA 1Q3TA 3F49S 5AKXA 3NNDA 5FHRA 2HSJA 2IH2A 2Q7DA 5JUWA 5HCUA 2QORA 4LXUA 1KYYA 5TEWA 3NUQA 4DLPA 3PC7A 1JAIA 2XE8A 4I14A 3C87A 3W2FA 5LQMA 4NJOA 1DUIA 2E4YA 1JVNA 3HR7A 3DDZX 5HS6A 2PT7A 3OQJA 5CDTA 4G63A 3RJ9A 2OZPA 3L8CA 3TQTA 1VE6A 3NAQA 1IBRA 4NEQA 3AC0A 3WK4A 1JVBA 4F3TA 4HC4A 2CHGA 3FKJA 1E3QA 5K8VA 1G4AE 1ULAA 1Y4AE 2OAGA 3EWIA 4KH1A 2X2FA 2VNSA 4JUIA 5JG7A 2PUCA 1RYZA 5HR5A 1VE3A 3H9BA 5LUBA 3W7VA 1K7FB 1DAHA 5JO9A 1H2EA 5H3CA 2PKEA 3ETHA 1ZVMA 2WFAA 4A0QA 1KMQA 1AKQA 1D1TA 2IEIA 3KZ1E 3D8TA 3OHMA 2N46A 1PZGA 3I23A 5C0OE 3MWLA 4JB8A 3BT7A 1E2MA 2IYQA 1WVGA 1JQLB 3HLYA 4IIJA 4HMOA 4JEIA 4YLGA 2GKSA 1COWA 1SIBE 2BM9A 5L53A 3CO5A 3LVQE 1UPXA 2FE1A 2VZ8A 3PC6A 2OAEA 4OX9Y 1FW6A 3UB2A 4F11A 5EA2A 4ZCPA 3ESDA 1E6UA 3A32A 3UUWA 4AWXA 3AEYA 3NYRA 5A3QA 5KS2A 4I9UA 2A0UA 3AFGA 3LOPA 4C6HA 1VP9A 1IK4A 2ZDQA 2IUSA 4OV6B 5MN6A 4IKOA 1OASA 3TD6A 2JBAA 4Z8YA 4XIFA 4C6TB 1Z8FA 3RSSA 3KT0A 3IQWA 5AJTA 4H1VA 2OLKA 1B3RA 2FPXA 2HYIC 3B3JA 1EJ2A 3ED5A 4ZQGA 3AUJB 1USIA 3M4XA 4EPYA 3ONFA 3ROPA 5KC8A 1KEKA 1LQUA 1YR8A 1HT2E 3IP9A 1I1QB 5CX1A 4ADSG 5HQ3A 3Q2IA 1Y98A 4H1UA 5F3DA 1K63A 1NNUA 4GWLA 1T2FA 3B20A 5CR9A 4QXMA 1SVSA 2WLTA 3IOBA 4FEGA 3IEVA 2O3UA 1PQUA 1UADA 1G5QA 2HNAA 1UC5B 2X6QA 3R3XA 4WK0B 3UMRA 4L4RA 1EB9A 3U19A 4PPQA 1H5UA 2DTDA 3LUKA 3OT1B 4RK4A 5AW9A 2V0GA 2YZGA 1JA1A 4IY1A 3UC9A 1QG2A 3H8WA 3MN1A 4P4UA 1RIIA 3N3BC 4UQOA 3M1AA 4U0KA 1ONSA 1YRWA 1BHO1 2IXFA 2R47A 3M9WA 3EFBA 3GEDA 4TLCA 4RABA 3UYKA 2G9NA 3EGIA 4B87A 3T7SA 1Q14A 2QTMA 4N01A 4LHWA 4Q6BA 1KYVA 1ZRNA 4M8NE 3WB1A 3IT0A 3ORSA 1TADA 1HZZA 5K6RA 1C0EA 2FLKA 2PX0A 4US1R 1PYDA 3GLVA 4GIBA 1RAEA 3BB4A 3OJEA 4P4LA 2KYRA 1ZU5A 3S55A 1GQSA 3OIWA 4LV8B 5C1PA 1V1MB 2XNDD 1W25A 2JC3A 1A7AA 1TO2E 4HYQA 1V45E 3VOAA 1MNAA 1G19A 4F2PA 1BKDR 4TWJA 1OFIA 1GA4A 3EGDA 3H5OA 4B31A 4DPLA 4WFJA 2MJLA 3A4IA 3EFHA 3VDNB 5TEVA 2E1PA 1FYEA 4BO9A 1OVMA 1LA2A 1Y9EA 2YVKA 3RGWS 4I5GA 5K6AA 4DV1B 4LF8B 5HK8A 4F0JA 1LLUA 1KK2A 3KR1A 2WT9A 1PQWA 5EY5B 3VR0A 4ARVA 2GJAA 2IVZA 2YZNA 3HFSA 3PJGA 4OTZA 5KVCA 3F7TA 3B7PA 4KWTA 4UTPA 1MAUA 1HG0A 3JQ9C 1O94A 5AVYA 1IEVA 4JC8A 5DNYB 2ID9A 1CZLA 2YHUA 3GVHA 3EVEA 1JAHA 1K5PA 2W48A 1E7WA 1G20E 3A0UA 2IPLA 3CR3C 3KZNA 5IAGA 1N2XA 2WM8A 3DF9A 5LYJF 3TAHA 1RAAA 1GQYA 2EFEB 4J1QA 4LZJA 4XGKA 1T5DX 1E63A 4BX8A 4CF5A 2FHSA 1T6NA 2ZRIA 3FOWA 4NWIA 1LDBA 1NP7A 2O4CA 1I3OA 5HMLA 2M98A 4YQFA 2VQFB 4UM9B 3LF1A 4DEYA 1ADGA 4BBAA 4OI0A 1BC5A 4GVXA 2WHRA 1LGYA 4IKPA 2ZYUX 2WWGA 2JRCA 1CY0A 1XTVA 2HBRA 3NDJA 2DRIA 3TZLA 2DUJA 1QFSA 2H6EA 4MJXA 4BP9A 4NBRA 4AF6A 4NOKA 5BR1A 4QXPA 3I32A 4HDCA 1NONA 3LUCA 1F8FA 2QZPA 4YPVA 1VDMA 3ZZ0A 2J6BA 4X3PA 4L73A 4YP5A 2W0MA 1GFZA 1M1XB 2LP4Y 4BBJA 5B12A 1N2IA 1X19A 3DMPA 1TXGA 3S68A 1M34E 3CG0A 3Q7PA 4MP8A 4XWGA 3S2SA 4WVFA 2G9UA 1JHMA 1K4MA 2V96A 2XAAA 5KB3A 3GLRA 1G3QA 2ZJFA 2IV3A 2BMWA 4Z5XA 5ESXA 1SD1A 1Z5GA 5EZ5A 4TKVA 1NPTO 1Q7TA 4E3ZA 2X6TA 3P0RA 1L7EA 1MO3A 3CUWA 3VO2A 4KMRA 2VUIB 1G4HA 1I7NA 1PI3A 1RWQA 2JDIA 4K9SA 4BFUA 2PFKA 2KLHA 5DE3A 1NXVA 4RVUA 3LC2O 2B8WA 1YB2A 3BJRA 3T6KA 4BLSA 4C0AC 3L6UA 3VHXB 4EHLA 3AFOA 4ZKDA 1YBHA 2A1UA 1LEHA 1T6YA 2R86A 3SHTA 4I55B 4C5BA 1XPJA 2VHZA 4BJ6A 1SCJA 4YUYA 4LK2A 1TT5B 4M60A 4MKXA 4EEZA 5BT8A 1M8JA 5KYKA 3WYDA 4IIGA 4OLFA 1KI3A 4R05A 2Q4BA 2XMQA 5HGJA 1PD1A 5M29A 4BCCA 5EIWA 4MQ4A 3Q8MA 3O90A 4L16A 5AK0A 2FEKA 4E08A 4WX2B 4FGJA 4GKJB 4K6CA 2I03A 3RBAA 1G7RA 3LLMA 3PB3A 4B7AA 1DCKA 2A7XA 2OO5C 3IJPA 4XGNA 4C2TA 4FMDF 5LP6B 4G25A 3F5QA