2VOEA

Crystal structure of rv2780 from m. tuberculosis h37rv
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
371
structure length
371
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALANINE DEHYDROGENASE
publication title Crystal Structures of the Mycobacterium Tuberculosis Secretory Antigen Alanine Dehydrogenase (Rv2780) in Apo and Ternary Complex Forms Captures "Open" and "Closed" Enzyme Conformations.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 107
structure length 371
sequence length 371
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2008-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2voeA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2voeA02
4IS2A 1F0YA 3DO5A 3QVOA 4DA9A 4WLFA 5HS4A 5DT9A 3LYLA 3HB4X 3OICA 4XGIA 5ITWA 3AWDA 3IC5A 1XGKA 1Y9AA 4KQXA 4TMFA 3DTTA 1ISMA 1XKQA 5IDXA 3BHJA 2E48A 4J1SA 4PZEA 5EL0A 3MJVA 1E7QA 2RHRA 2VTDA 3U4DA 3GFGA 3NT2A 4YAIA 1DHTA 1PL6A 2VYVD 4UVGA 1YL5A 2Q46A 4MIOA 3TOZA 2J8ZA 4NHEA 1FDUA 3ZNNA 4AG3A 2AXQA 4YR9A 3C1TA 4WCFA 1BW9A 1T2FA 4J7CA 4OKIA 2G76A 5JC8A 1SNYA 2NADA 1HTBA 1K5HA 3QV1A 5CDUA 4FFMA 4LW8A 1HXHA 2EJVA 3GC6A 3RC9A 4GKBA 4J7UA 3K2EA 5CFZA 2DU8A 3LLSA 3RUEA 3ON5A 3I3OA 4K6CA 4MO2A 2UAGA 2EP5A 3C7DB 4NK4A 1R66A 4J1TA 1YJ8A 2EKLA 2ZJ0A 1PL8A 3ABIA 3L0DA 4A7PA 4U8GA 2I3AA 3GRPA 1N8KA 1LDGA 3KM0A 4RQUA 2Y0DA 2QG4A 3GFBA 3CZRA 3DL2A 1BVUA 1NVGA 3DR3A 5JW6A 2EWMA 1PGNA 2B83A 4J91A 5DOVA 3WGTA 3WGYA 2I6TA 4WNCA 5JDCC 1UAGA 1SBYA 2ZB7A 3Q2KA 5B4VA 3M2PA 4YVFA 3PEFA 5I7VA 4GQAA 1U7TA 4U7WA 3VH3A 3BZUA 4PG7A 4D44A 5KCZA 1SO8A 4EUHA 1N5DA 4UUMA 1DLJA 1EMDA 5BSEA 3DAPA 5EINA 1RJWA 1Z75A 4RVUA 1KERA 3C85A 4NPCA 5JBIA 3PQDA 3G1TA 4NJMA 2DAPA 3MJSA 4YQZA 5LC1A 4CUKA 3N58A 1ZK4A 3TSCA 4ILKA 1NFRA 3I6IA 3GVCA 1E1NA 3ROPA 2SCUA 2PZMA 4IJVA 2CVQA 4FB5A 3DHYA 1I3MA 5I8ZA 4CM8B 4CUJA 2O2YA 4CLOB 4IQ8A 4AJOA 1S7CA 4BOYA 1X7HA 1T2DA 3VPXA 2OHXA 3KEQA 1NBOA 1IUKA 4R51A 4Q3CA 5GZ3A 1K3TA 5B1YA 4A5OA 1Z6ZA 3RU9A 1VJTA 5FI5A 3TF5A 5A9TA 4UVHA 3S8MA 2YUTA 2FP4A 4ALIA 3CXRA 3ONFA 3CEAA 5FYDA 3JYNA 3ZV5A 3KLMX 5A04A 3TFOA 4MKRA 3ICCA 4NFHA 2NUAA 3KSZO 5I9MA 2ZQZA 4FQ8A 4IUYA 1AXGA 2J5RA 5EPOA 1H2BA 3I4FA 2X9VA 2Z1NA 1LDNA 4DXHA 1U5CA 1BXKA 1RM4A 4JXKA 5FWNA 3WS7A 4PCVA 1J0XO 3LT4A 3WMWA 2PD4A 3NJ8A 1U7HA 4FFRA 5LCXA 3K5PA 3HUDA 4ND5A 4CL8A 4RVSA 4YT2A 4JBGA 3EK2A 2R2GA 4BO9A 3PWKA 3BXXA 1D3AA 3BMCB 2IYOA 4GWGA 3JD1A 1ZMTA 4J43A 2FR1A 1A7KA 4IPTA 3DDNA 4A0SA 2WD7B 4ZGWA 5HRUA 4EZBA 1FJHA 1DJQA 3JD0A 1F17A 2C20A 1GY8A 4G65A 1E1MA 4Q9NA 1AHIA 4YA6A 4JROA 3FPCA 4GKVA 3K8ZA 3W4IA 3BTVA 3UKOA 5F21A 2CD9A 4Q3EA 2ET6A 4UUPA 5IN4A 1JTVA 2GLXA 1LDYA 1ZEMA 4BNJA 1A9ZA 2BI7A 4YCAA 4Q3NA 4CV0A 5ILOA 4Q39A 4TWRA 4CLHA 1CEQA 1A4UA 2AQKA 3AM5A 4BNYA 1PQPA 5L45A 3OQBA 5C7OO 1ADFA 2JAHA 1V0JA 4N5LA 1O94A 2VNSA 4IINA 3GNTA 1K6XA 3FD8A 1J4AA 5DBIA 1BVRA 1LNQA 1B2LA 3ZNPA 2YQ5A 2DBQA 5BQFA 4CMBA 1LUAA 4OMUA 3WB9A 4JX8A 2VZ9A 1L1FA 1QXSA 2BHLA 1YKFA 5ADHA 1ENPA 1CDOA 2QRJA 1OMOA 1GQQA 4P8RA 2PA3A 3U9LA 3VOSA 3WNQA 1MC5A 5AXAA 4XB2A 3HADA 3UFXA 4DGSA 2JCVA 4I8XA 1E1LA 2Y1GA 4AJIA 1GZ4A 4NJOA 2CFCA 3M1AA 2D5CA 3R3SA 2I66A 3RBXA 1P0FA 1AE1A 1XWFA 4UVIA 1HDGO 2ZYDA 3P7MA 4DYVA 2P4QA 1RM0A 1T4BA 1QYWA 4E2XA 2E37A 4WCFB 4BO2A 2YFQA 1BW9B 1PR9A 4NK5A 4PLTA 3W4KA 2HQ1A 1ENYA 4MVJI 5I9LA 1DC6A 2D4AA 2FN7A 2I67A 5KJ1A 2X58A 4DIBA 3RFXA 5AYVA 1LXCA 1XA0A 4NDNE 4QFDA 4TQGA 3ZU3A 1O5IA 4N18A 2IZ0A 3SJ7A 2A94A 3VKUA 3L6EA 2V6BA 4RPJA 5JO0A 3U4IA 1UUFA 5HA5A 2FZWA 2EP7A 4YT4A 2J3JA 4KP7A 5A03A 1ARZA 4MP3A 3H5RA 3Q11A 2AG5A 2PWZA 1HYGA 4ROSA 4CM7A 3PHLA 4AJ2A 4CMEC 5L4NA 1M6WA 4MVJE 1NXQA 1RM5A 3E8XA 2O3QA 2PR2A 3PZRA 2BGKA 2VRCD 3FR8A 4ALNA 1KC1A 3ZW8A 3COSA 2X1HA 3LC1O 1HE4A 4UEOA 1E5QA 4RPHA 4Y8VA 3HFGA 2FWMX 4IDDA 2PY6A 3DFUA 4Z0HO 4CQMA 1OBFO 1GQYA 3DHEA 5U1PA 4PZCA 4WLEA 4J9UE 3ADOA 2Q1SA 2HSDA 3IP3A 1LTHR 2Y1DA 3ZNQA 5KJEA 3HZZA 1IY8A 1ZBQA 2IXBA 4NJMB 5JDCA 3WYEA 2P68A 4OHUA 5JYEA 1YBVA 1ZVMA 4GGPA 3ENKA 1QRRA 5G4LA 1VJ0A 4A2CA 1HDZA 1TI7A 5JXWA 1LLUA 2PFGA 3TZCA 4R5MA 3UGKA 3PFFA 5JC1A 1KVTA 2GDZA 2RAFA 3K30A 3KHUA 4GAEA 5U4QA 3E6AA 4L8VA 1S6YA 4XD2A 3UW3A 1X7GA 2AW5A 2IODA 1YQDA 4HY3A 1NPDA 3JYPA 2PKQP 4II3A 4Y6SA 1PGPA 5CPFA 1D1SA 4M55A 3ICPA 4AJPA 4WGGA 3ROQA 3SLKA 4RJTA 3KLPX 1UXGA 5DCYA 2P5UA 1JVBA 2PH3A 4WJZA 1E0DA 3H65A 4PVCA 2X5JO 3WBBA 1GV0A 3GG9A 3RROA 1NR7A 5A5FA 1MFZA 4ZQFA 3H9UA 3QA9A 3S2FA 3EC7A 3F1LA 4Q3DA 1H6BA 1T1RA 5TT0A 3RFTA 4YAKA 4RVHA 3ZWAA 1ID1A 3D3EA 4TZKA 1PGQA 2FR8A 2NU9A 3U62A 1DFHA 1MLDA 1U5AA 1KETA 3BA1A 1ZFNA 3PJEA 4NR0A 5BNTA 4YEDA 3WSWA 3RIHA 3I9JA 4HFRA 4XJSA 1YL6A 3MWEB 2G0TA 4B8ZA 2GYYA 4O59O 1A7AA 3D0OA 4WK6A 4CM9D 2C7VA 3RFVA 5JCJD 4IDBA 3T4EA 4FR5A 5CAEA 4EEXA 1FK8A 1C0PA 3EY4A 1R4MA 3MJCA 1OFGA 2Y93A 4ZRMA 3W8FA 1I24A 1LRLA 2E82A 1PEDA 3B20A 3RBZA 2HO5A 1ZMOA 2X22A 2P9CA 3F46A 2X23A 4MVJP 5C7IO 5T8KC 1HDCA 3JYOA 4KWHA 4XYEA 3OJ0A 3TNLA 2FR0A 1GUZA 3KYBA 4DLAA 3GPDG 4QUKA 1XLTA 3RUIA 3D4PA 1RYDA 1NHWA 3DZFA 1DPGA 2QQ5A 2V6FA 3AM4A 3HHPA 2C07A 2YZ7A 1DIRA 5T5QA 4RF2A 1XQ1A 1YL7A 3PXXA 2D3TA 3DZJA 3NTRA 3OECA 4I9NA 5DCWA 2VWPA 4CR6A 3HDHA 2W8ZA 3JD2A 1NAHA 2EW2A 2NQ8A 4BQPA 3NYWA 1R12A 1NM5A 4CM4A 4HKTA 1DEHA 1PJ2A 3H9GA 4B7UA 3I9MA 4DLBA 2GZ3A 2NQTA 3NDJA 4E3ZA 1BSVA 4U6QA 1ZIDA 2Y68A 3KSUA 3KO8A 2YHUA 4GX1A 4M87A 1EE2A 4G81A 3WGQA 4ALKA 4JCOA 3H6KA 4DC1A 2D59A 5DOZA 3C1AA 3RI3A 1JVSA 2WYUA 1DOHA 3CMMA 2YJZA 4QT0A 4E21A 1M66A 2NTJA 2HK9A 3QY9A 3JQAA 3AJRA 1FXSA 3VZPA 4UAGA 1MP0A 2XOXA 4DLLA 4WNIA 1PWXA 1ZNQO 1QP8A 3KTDA 2BGMA 1EFKA 3GR6A 4AJ4A 1MV8A 2G1UA 2FSVA 3V1TC 3U4HA 4HV4A 2X86A 4CM5A 4RVFA 2R00A 4LCEA 5ER9A 1E3IA 4OIMA 1MXFA 5L9AA 5ITVA 4XYBA 5A3JA 3E1KA 2NWQA 1K6IA 1ZK2A 3NEPX 2Q1UA 1FF9A 3K92A 3M6IA 3E5RA 4S3MA 3OP4A 4E6PA 2YY7A 3S1LA 1GL3A 1P3DA 3IJPA 4CQMB 1U4OA 1X1TA 4CMEA 1VL6A 1R4NA 3OJFA 2UUOA 3C7CB 4K26A 4NNJA 5ES3A 4AL4A 3TL2A 1Y1PA 1NWHA 2VTEA 1OC2A 1YDEA 1GYQA 4MIEA 4BNIA 3RWBA 1T2EA 3RJ9A 2Q49A 3C1OA 3GY0A 3HJAA 4UEJA 3I4CA 4XQCA 5DBFA 3DMTA 4AJHA 4CODB 5AXDA 3DOCA 4AICA 2QW8A 4CJXA 4XCVA 3G0OA 2AQHA 3D4NA 1O9BA 3BMOA 5IFLA 3VPGA 2IYPA 3DFZA 3GMSA 1GYRA 3HDYA 2BGLA 3H9EO 3F5QA 4FJ0A 5A9SA 3WDSA 4JP2A 4W6ZA 1UP4A 4E2ZA 1ZK3A 1HDXA 3Q9NA 3PVZA 1HKUA 3ZWMA 3INTA 3GEGA 4ZU3A 1KIFA 3QQPA 4WEOA 3U49A 4E31A 2X0NA 3PJFA 3CUKA 3L07A 2CSUA 4X54A 4YQYA 3UXYA 1U4SA 2ZTUA 3UCFA 4J1NA 4IGFA 5CEEA 2B36A 3GGPA 2P5YA 2HRZA 1PZFA 3D3WA 4XIJA 3WMXA 1Z82A 5H81A 3GG2A 4XWYA 1Z7EA 2VWGA 1SMKA 5B37A 2C2XA 5IDYA 1GFSA 1H6DA 5C3MA 1TB4A 4XZ3A 1E1KA 1LA2A 3FSRA 1P77A 4DPKA 2CDCA 2OOSA 2P2SA 2ZYAA 3S2GA 1WVGA 4WASA 1L7EA 4CMIA 4EJ6A 2W90A 1HT0A 4E32A 2GASA 1QYDA 4L0QA 4NU5A 1E7SA 2QYTA 2HLPA 1Q0QA 3IKVA 1ZK0A 3ZWCA 1R0KA 1CWUA 4OQYA 2X5OA 1UDCA 1IULA 4TSKA 3WFIA 1E92A 2FY8A 1CRWG 4U0JA 3AFNA 1R4MB 4F45A 3WGHA 3ROMA 3S2EA 3FNGA 3EHEA 2PH5A 3JQ7A 3A4VA 1LRKA 4JP3A 1DIGA 1LRJA 3PYMA 4JJIA 3NT4A 2NVWA 4Y98A 4JNKA 2O3RA 4KOAA 5JAZA 3LT0A 1NPYA 5L53A 1ISGA 1EFLA 4RVGA 5TNXA 4PLHA 1E3JA 3OA0A 2OXIA 1NYTA 2I3GA 2QIOA 1O89A 1YH3A 1UXJA 1PU2A 4R1TA 4DPLA 3ST7A 1MUUA 1R16A 3AU9A 3VVBA 4RF3A 4Z3DA 3JQ8A 3AI2A 2VNAA 4OSPA 1GDHA 1IB6A 4L75A 3WQSB 2D2IA 1YBMA 1KBZA 3SBOA 2Q2VA 3ZWNA 1R0LA 5KWEA 2PNFA 4EGFA 4CM4B 1RM3A 1UR5A 3C8MA 4CMCA 2VUUA 2GSDA 2RBEA 5DNAA 3BTSA 3OJLA 4I9HA 4K28A 3VZRA 5TGDA 2JFGA 3OA2A 2VYND 1NQTA 1J6UA 3GT0A 4BO4A 4R01A 2JD2A 2JCXA 3WYCA 3X2FA 1SZJG 4FN4A 1PS8A 5IG2A 1U3VA 2BH9A 3C3XA 3TZQA 3ZWXA 4BNWA 3RAJA 1PQWA 3G3EA 2NNLD 3CSDA 3KUXA 4YT8A 1KVQA 2B0JA 3GGOA 1EVJA 1G0NA 1EBFA 5IN5A 1JDJA 1ISJA 4BO8A 1JKFA 1BDMA 4ZJUA 4GPD1 3JCZA 3JQAB 4EUFA 4EJMA 3QJ5A 4E13A 1WDKA 3SEFA 4TKLA 2PZKA 4OJNA 3TPCA 4BGEA 5HBRA 3C24A 1EUCA 1QR6A 3AUAA 3L4SO 3GN1A 1N9GA 1Q7GA 2RHCA 4YJFB 3DZHA 2NM0A 1AGNA 2DTXA 3D4OA 1PGOA 3IQDB 3UF0A 1ZSYA 3AI3A 3UVEA 3IMFA 1QORA 1BDBA 1YB1A 1NTOA 5TJ9A 3E9MA 4CM1A 2XXBA 1G0OA 4ESOA 3ZW9A 5CDGA 2OGUA 3LC2O 1EE9A 1M75A 4MVJF 1KYQA 1LEHA 4H7PA 4J4BA 4UVDA 3WYBA 2EG9A 3MOIA 2YDXA 3PLNA 2GN4A 9LDTA 2CY0A 2P9EA 2YYYA 3O38A 1DLIA 1VL8A 5JMWA 1YE3A 4FW8A 5IXYA 5CEFA 1R4NB 1JQBA 4ND3A 4IJUA 3GRKA 4XR9A 1NWCA 5LDGA 1NPTO 1XYGA 3X2EA 1NFFA 4J0EA 4BNFA 1M67A 1XR3A 2EGHA 3QW2A 2DBVO 4RORA 3WWZA 5DZSA 4J4HA 1X0XA 4YJGA 3BMOB 4IBOA 1X0VA 2C0CA 5DN9A 4D0SA 4R9RA 3RUDA 1NR1A 2RCYA 2YV3A 1WZIA 1JN0A 2OL4A 1VPDA 4ITUA 3KSDO 3RKRA 5HTOA 2Y66A 3AFMA 4M54A 4PLGA 4WE3A 1ADCA 4I5EA 4C4OA 5A9SB 4FD3A 1C0LA 1W6UA 2C2YA 3DBLA 2AEFA 3WOHA 3EVTA 5A4DA 2BKAA 5IZ4A 4XRGA 3OIDA 4RCVA 1M2WA 4KUHA 3WX0A 5T57A 4B4OA 2FZEA 2QZZA 3Q9UA 4HWKA 2IRWA 1DAOA 3LU1A 3V5NA 2DUWA 1I8TA 3E48A 3LVFO 4R5HA 1YOVB 4U5QA 3D64A 4D7AA 4E5YA 2AA3A 1WPQA 3N7UA 4PLZA 3FWNA 1I01A 2Y99A 3U5TA 4Z6KA 5L4LA 1DC3A 4F6LA 5KVSA 1LLCA 1J49A 5EESA 2VZ8A 2B5WA 1DC4A 4XQ9A 3ANMA 4DQVA 3DZKA 4HFJA 4RGBA 3RC7A 4CMIB 1G1AA 4KUGA 1UP7A 4R1NA 3WQRA 4HFMA 3PHJA 3AK4A 3ZWPA 4DBZA 4D3DA 1XDWA 4YXFA 4B4VA 4M86A 2YFHA 3DBRA 3PGJA 1C3VA 1PJ4A 3G49A 4O6VA 4NBVA 3RQSA 3B70A 3WNVA 4XQGA 3AU8A 3OFSA 4ZVVA 1UDBA 4E5MA 3HE3A 4P4LA 4CMJA 1LLQA 5KJ6A 2VT3A 4MIYA 1DIBA 4J1QA 3T4XA 3NTOA 4QX6A 1BTOA 3MTGA 5AQ1A 3MEQA 4TZTA 1I10A 2ZTMA 2X9NA 3F4LA 5DDIP 5ICSA 1KEWA 1LSSA 3VH4A 4DTIA 3I52A 2RH8A 2GCGA 4XA8A 1IZ9A 1GEGA 3LZ6A 3P2OA 3NGLA 3JQ8B 1B8UA 1KEPA 4LRTB 2GNAA 3PWZA 4YT5A 4KZPA 1I3KA 3V2GA 3VVCA 3GVPA 3KYDA 2YV1A 1B7GO 4EUEA 3UICA 2AQIA 4L9RA 1LX6A 1YGYA 4DIFA 2CDBA 2CDAA 1UP6A 2Z95A 4DBVO 1IOLA 4HX5A 1V3VA 3GUYA 1HL3A 1BGVA 4KUEA 2UV8A 3HN7A 4L73A 3UH1A 3FNEA 3GLQA 3W6UA 2A35A 1UXIA 4J16A 4J4TA 3L6OO 4DWVA 3VZSA 3U3XA 4IXWA 4D42A 1E77A 5L51A 5KIAA 2I99A 3E03A 4CUZA 3DOJA 3GNSA 3PJDA 4IXTA 5MGBA 1MG0A 2NVUA 4CQLA 2CVZA 3WIDA 2POQX 3I83A 5KOIA 3AOEA 1ONPA 1ZZEA 2XXJA 1PGJA 4BGIA 3V1UA 2C5EA 4PLFA 2JFHA 2OP1A 4L4SA 3DXFA 5JPIA 4NBRA 2TMDA 3AUTA 3NRCA 1H2HA 1WNTA 3EDMA 4GMFA 3PTZA 4ALMA 1Y8QA 2QRKA 2GN9A 2Y1OA 4EDFA 4LCJA 2PV7A 3EZLA 4YB8A 4Q3BA 4YAJA 1B8VA 4LSWA 3CIFA 1G6KA 2H5LA 4E5NA 2Q1WA 4GBJA 1AXEA 1E7WA 3PK0A 2VOJA 3PIDA 3OIGA 1PZEA 2B4RO 4G2NA 4DQXA 4O0LA 4DC0A 4BV9A 4L74A 4XYLA 2BMAA 3Q3CA 4QXMA 1DO8A 3ULKA 2W2LA 2R00C 3FRJA 4BO6A 4DMLA 4J7XA 4NQZA 1ULUA 3B1KA 4JBHA 4L4RA 1Y9EA 3LF2A 4URFA 1XHLA 1IYZA 4YJHA 2DLDA 4D41A 2DUUA 3TZ6A 3EMKA 4BNUA 2VRBA 3O03A 3GZNA 2LDXA 4L4XA 4FFPA 3CH6A 4I08A 4ZN6A 1XELA 4FFLA 2OMEA 4O1MA 2NV6A 4MKXA 3KB6A 1WP4A 3UCEA 3I9NA 5I7FA 5FI3A 3F47A 4I5DA 4RZIA 3BMQA 3A28A 2UDPA 2XF8A 4I1IA 4RVDA 4Y9DA 4KWIA 3DMTC 4R68A 1LU9A 3FR7A 2ZATA 4YJGB 1HE3A 2VHVA 1PJBA 1A72A 3PWSA 4XDZA 3NGXA 2BLLA 3NTQA 1WWKA 4KDFA 1VKOA 5AVOA 1B14A 4G5HA 4BB6A 1CQJA 1M76A 2O3JA 3PIIA 5DULA 1SAYA 3ANLA 3DBLB 5C37A 3ZU4A 3VPHA 4MVJA 4WOJA 4H16A 2J3KA 1XQ6A 4BO1A 2WD8A 4HFNA 4Y67A 1Z73A 3IP1A 5H83A 1YXMA 3AW9A 2VQ3A 3RKUA 1H6CA 2HJSA 2OFPA 4LK3A 3IS3A 4E2YA 2LDBA 5HWSA 5K9ZA 4W4TA 4PN3A 3E82A 2AE2A 5EERA 4MKZA 1UXKA 4K6FA 4BKOA 4CL3A 5K0ZA 2OZPA 2B4TO 5K6AA 1KVSA 3RSHA 1HYEA 4XQEA 3GUCA 2GR9A 5J23A 2EKQA 4J90A 2G82A 2PZJA 3OJEA 3LDHA 2O4CA 3LT2A 1SPXA 3I1JA 1DRWA 2X8LA 3JQGA 3OJOA 2ZYGA 3OF2A 4F3YA 1N1GA 4FGWA 5CG2A 5GZ1A 4R1UA 5I8WA 1IL0A 2C5AA 5JYDA 3O8QA 3MOGA 1LDBA 3DBRB 4W7IA 4WLUA 5L7WA 3FBGA 3A06A 1YO6A 3OQ6A 3ZWOA 1TEHA 1MGOA 1PJSA 4EI2A 1P45A 1WMBA 4S1VA 1A4IA 2H6EA 1O0SA 2WM3A 4YRAA 1TT5A 2O48X 5B4TA 1Y5MA 3CZMA 1C0IA 1XEAA 4LMPA 4E33A 1YRLA 3TZKA 4JJFA 3ENNA 1ZJZA 2B4QA 4NBTA 3SVTA 2AHRA 1K6JA 1BXGA 3SX2A 1NQOA 2H63A 1U8XX 4DRYA 1R15A 3PYLA 4WOKA 3PJGA 4BNTA 5DP1A 2VT2A 4GSLA 3BMNA 2WWRA 5DP2A 2EERA 3QWIA 1MFPA 4FC7A 2GPTA 5COQA 1JAXA 4Z9YA 4A73A 1LBEA 2HK7A 2DVMA 2VHWA 1I30A 4CM6A 1EQ2A 3KYDB 3FTNA 4JGBA 4ZQHA 3LK7A 4CMAA 1Q0LA 3P19A 4WLOA 1TA4A 1O95A 1SCUA 3VZQA 3KEOA 4BMNA 8LDHA 3MWDB 1OOEA 3TDKA 5CP8A 3P2YA 4FFOA 3VKVA 4OYRA 2O3SA 4E0BA 3AM3A 3QWHA 2IXAA 1UZMA 1YJQA 4XB1A 5KJCA 1HLPA 4D43A 1YBAA 4BNLA 2BFMA 5BNFA 1PZHA 2VWHA 3ZV6A 4YRBA 1DSSG 3DZIA 2NVUB 1VM6A 2E49A 3R3JA 1YB5A 4CQLB 1EVIA 1A27A 4H15A 4Y6RA 5T6BA 3RUCA 4DVJA 3ONDA 1W8DA 4DUPA 1D4FA 1H94A 2J3IA 1J5PA 4IIVA 4XDYA 1AN9A 3LF1A 4B3HA 2EXXA 1PJ3A 1AUPA 4J2OA 1B15A 3E9NA 1PJQA 5A05A 2ZTLA 3K96A 4BKPA 1Y6JA 5A02A 5GZ6A 4GSKA 5IDQA 1B3RA 1I33A 3MTJA 1HDYA 3ZHBA 5JY6A 2AQ8A 4Z9XA 3WXBA 1JW9B 2VYVA 3ZWWA 4NMHA 3PPIA 3ETDA 3SXPA 4B4UA 3U0BA 4TKMA 1PX0A 4B4WA 4EBFA 3FCOA 4TRMA 1V9LA 1SEVA 1YS4A 2IZZA 4J9VA 4O63O 4XKJA 3IKTA 1RYEA 1LJ8A 3K73O 3H2SA 4R54A 4JLWA 3QWFA 2AEJA 2OBNA 2IEBA 4OSOA 1P31A 3DHNA 3L77A 2CNBA 1R37A 2FPPA 4B7CA 3RD5A 3IJRA 2Y0EA 5I7EA 3TL3A 1QYCA 2JCYA 4YJHB 2G5CA 1GCOA 4ALLA 1KVRA 3GMDA 4ZQEA 3P5SA 2HU2A 4DYDA 3HDJA 2X6TA 3O4RA 2D8AA 4M49A 3TJRA 1UDAA 1NAIA 4AJEA 3DWFA 1GAEO 1P74A 3FF4A 3JQEA 1NFQA 5TS3A 3NX4A 1RKXA 3UN1A 1B0AA 5L7TA 1DRVA 1F8FA 4N5NA 2EHDA 1LSJA 4PGFA 1Y8RA 3BMQB 5C7LO 3HFSA 3GGGA 4XYGA 3QWAA 3WICA 2W2LD 3LSYA 5F1KA 4B8WA 4J3FA 4M89A 1XU7A 1D8AA 1DIHA 2VHXA 4GLOA 5TT1A 5CDTA 1HWYA 2BF7A 5EIOA 4CR7A 2PD3A 3VDQA 3JD3A 3ZGYA 3ZU5A 4RPLA 3PQFA 1YONA 1GU7A 2Y05A 4LVUA 3WTCA 3K6JA 4BNVA 5IXSA 2IDZA 5GMOA 5JAQA 2NSDA 1I3LA 1E3LA 6LDHA 2DBRA 4K1LA 2F1KA 3RC1A 4BKQA 2JD1A 1P1RA 3SLGA 4RDIA 3IOYA 4IM7A 4UULA 4CQMD 1BMDA 3ZDFA 3GDOA 4CMKA 1EVYA 1YWGO 3CPSA 2PKRA 4BNHA 1ZSNA 1JU9A 1OI7A 3NV9A 3ONEA 2ZB3A 4UVEA 5AXCA 2GN6A 2IZ1A 4W99A 4BUCA 2BD0A 1E3WA 1EK6A 1SB9A 1UZLA 1B8PA 2VUSA 4LMRA 1IPEA 1EUDA 1L7DA 1OAAA 2E4AA 1DRUA 4MVJD 3WFJA 4AJLA 4NFSA 1U1IA 5L7YA 3JQGB 3E9QA 4OXNA 2V6GA 2ZIZA 1Y5RA 5JS6A 3GHYA 2EGGA 4XR4A 5DBGA 2PGLA 3I5MA 4ND4A 2VWQA 4NG5A 1GEEA 1QG6A 2FOIA 4NU6A 4OL9A 2AE1A 1E7YA 1D1TA 5BT9A 1CF2O 4QSMA 3WLEA 1FDSA 1ONOA 4FGSA 1DHRA 4BNNA 4CLOA 1TT5B 2ZCUA 4QTZA 5AXBA 2X0RA 1R6DA 2Y67A 5FEUA 4RV9A 1N7GA 3A1NA 4CM3A 5F1OA 3LLVA 2HRBA 4PLCA 1BXGB 1PZGA 4GX0A 2E6UX 1T1SA 5I9NA 3GN2A 3BMNB 3KBOA 2DC1A 4RF4A 3H3JA 1D7OA 1MA0A 4GLLA 3QHAA 1KVUA 6ADHA 1MX3A 4W82A 3I9KA 4F46A 2Q2WA 4MVJH 5CDSA 2EEZA 1Q7CA 3W4JA 1O8CA 2Y1FA 4JN6B 1GTMA 1VSUA 4OO3A 3ANNA 5DCUA 3WQQA 1P0CA 4N54A 5F1PA 3RUAA 2V65A 2WE8A 1YQXA 5JCXA 3SC6A 1I3NA 3UAGA 2PLAA 5JE8A 2VUTA 3ZHYA 2Q2QA 2A9FA 5ENDA 3MJTA 3BMCA 5ICMA 1T26A 1VL0A 1BG6A 3L6DA 3U4CA 1CJCA 2D1YA 4LGVA 1EZ4A 3OEYA 4E4YA 5BNIA 4CV2A 1ZO8A 3JYQA 4IJKA 3STHA 2ZQYA 4OGWA 3AOEC 2IE0A 3OETA 4IDAA 4MVJG 3HQ4O 3TN7A 1CETA 1SOVA 5B4UA 4DIOA 3G1UA 1FDTA 3ZHZA 3ZV4A 3FI9A 5CEJA 1CYDA 1ENZA 2B35A 4NBWA 4J49A 1C1DA 3O26A 3E18A 4WLNA 5JO9A 4RLSA 3QVXA 1I5RA 2CF5A 3RBVA 1NVTA 5THQA 5L3ZA 2A92A 3NUGA 4RPGA 4BO3A 1A71A 2YHIA 3CTMA 1X15A 4CV3A 5EN4A 2IEDA 1KS9A 3WSVA 1WW8A 4IDGA 5A1TA 4FDAA 1YDWA 4UEKA 4BGVA 3N74A 4GH5A 3SC4A 3M2TA 4KTVE 4B79A 7MDHA 4D79A 3VH1A 2HKIA 2Z1MA 4FOSA 5IDWA 2Y0CA 3QP9A 3HG7A 3ASUA 4A27A 7ADHA 4TRJA 2FPIA 3DZGA 5KKCA 3QSGA 5H82A 1F14A 2QHXA 5JY1A 2DTEA 2C59A 3ZI0A 1GZ6A 4PG8A 5L40A 2ZK7A 3PLRA 3GK3A 3GVHA 3GA0A 3OEWA 1E6WA 2NACA 5HS6A 1Y8RB 4I5FA 4PLYA 3ZH2A 3WGGA 1WLYA 4FBGA 2VRCA 3ETEA 5TF4A 3JQAD 4BO5A 4CPDA 1EUZA 3KOUA 1DJNA 4FS3A 4BO7A 2DFDA 1RWBA 5ENVA 2D5AA 4RLHA 3G79A 5KKAA 1Y81A 2V7PA 3JQBC 3ZNOA 3FBTA 2UUPA 5JFOA 3GNQA 3NKLA 1V6AA 4BB5A 1ZK1A 3W1VA 2WMDA 4NBUA 3VHRA 4A10A 1TVEA 5GY7A 3JQFC 4MP8A 3VDRA 1MXHA 5TLSA 1PQUA 5G0UA 3I9OA 3OQ1A 3FHLA 4IQGA 1E6EA 4IZIA 5JDIA 4IDFA 4NI5A 1VC2A 5CDYA 2ZB4A 3PDJA 3QE3A 1N92A 1GV1A 3UUWA 4LISA 4OXYA 3ZZNA 4PG4A 3Q0EA 1JWAB 2Y1EA 4CMGA 3OSUA 1PTJA 1VI2A 4R3WA 5BSGA 1X7DA 2O50A 3I23A 3ORFA 4RQTA 4OKNA 1NX6A 2WEKA 3D7LA 4R41A 5T67A 4RPKA 1KEVA 1T25A 4OXKA 1HSZA 3HNPA 3WBFA 2UYYA 2CZCA 5K6AC 1PIWA 1U3WA 1V3TA 3H9JA 3B1FA 1E3WB 4ZICA 1JKIA 2BELA 1MG5A 5KNLA 3ITKA 3H4VA 1LQTA 2JFFA 1PL7A 1U9JA 3D3WB 1ZXLA 2YV2A 3T7EA 3IIEA 3JYLA 1H9BA 3JD4A 3ZHXA 4MDHA 2GN8A 4E5KA 5KVQA 3EAGA 3GVIA 2CMDA 1JWBB 2O4UX 5G0WA 1UZNA 4D0RA 3DBHA 2PZLA 3NDRA 3PFWO 2GD1O 1Q2XA 2HMUA 1K89A 2NVBA 1HETA 3RASA 2PKQO 4OM8A 3RUHA 1X1EA 1DXYA 1UJMA 3OBBA 4PG6A 3GH3A 3PRJA 3ZWYA 4GVXA 4AVYA 3W8DA 4W9NC 1V35A 2GF2A 2ZKLA 2I9PA 1LI4A 3WR5A 4CM9A 3JQ7B 4J2HA 4ONEA 3WIEA 5JCJA 1W4ZA 2QRLA 1H0KA 4GX5A 3KV3O 1PJCA 3H3FA 3VAZA 5F3RA 5G2OA 1YB4A 3L4BC 1X14A 5BSHA 2RH4A 4QEDA 1ZSVA 1IHYA 1U8FO 1UH5A 3WLFA 4PLPA 2HMVA 1ULSA 4IDEA 4D3FA 1OZAA 4IY1A 1H9AA 1DDOA 5IZCC 4BNKA 3EZYA 2O23A 1X13A 2VCYA 4ZA2A 4YWJA 1ZW1A 2WJPA 4BMVA 1LC3A 2QYSA 1XG5A 4D46A 3JQ9A 5G0VA 1C1XA 1N7HA 4OAQA 3B1JA 4UUNA 3PGXA 4D3SA 4M1QA 2D0IA 1EQUA 2NU7A 4R69A 3NT5A 1I2BA 2BI8A 1BWSA 5F5LA 1O6ZA 3QVTA 4OOEA 4FJ2A 5CHEA 3K9QO 2FRDA 3DONA 3GVXA 4GGOA 1QV7A 3INGA 3JV7A 4JK3A 3BHMA 1FDWA 4O5OA 1UAYA 3GF4A 4PFJA 3UHAA 1GQ2A 3QRWA 4RZHA 5I7SA 3DC2A 2GZ1A 3DMYA 3HN2A 3OH8A 4KQWA 2Z5LA 2EF1A 1GZ3A 2Q1TA 2B5VA 2ZTVA 1JLLA 1C1DB 3GAFA 1JAYA 3H5NA 4FOOA 2J5QA 3OHSX 4R3NA 1I0ZA 2C54A 4OH1A 1QYVA 3IAHA 1HF3A 4DPMA 3H9QA 1TT7A 3JQDA 2FPGA 1U2GA 2YHIB 1I2CA 3CE6A 3QWBA 3F5SA 1W73A 2UVDA 4MJLA 3UCXA 2NLOA 1B16A 2V6MA 5TX7A 1OC4A 1MC4A 1VLLA 4GWKA 4HNGA 5TJHA 4PIVA 1T4DA 1YQGA 5IJZA 3BHIA 3TFQA 1HE5A 1H6AA 1ML3A 1N9GB 1PS9A 5U9CA 2RIRA 2DPGA 1EBUA 1E3EA 3PI7A 4BIIA 2O3UA 5KTKA 2NTVA 1U2DA 2O2SA 3KXDA 4Z9FA 4E30A 5A06A 4XGNA 2EIHA 1E7RA 1E6UA 4KDEA 2X7HA 1K0UA 2OORA 2VHYA 3CMCO 4WPGA 4BNZA 4U6SA 2GGSA 2DM6A 4Z0PA 3D5TA 1C14A 3ETGA 3R0IA 5JMPA 2H9IA 2XAAA 3DB2A 2Q4EA 2Q45A 4PLVA 2X5KO 4QO7A 5C5IA 3V2HA 4ZRNA 2P4HX 2W2KA 4IMRA 2DPHA 2PGDA 4TRNA 3AUUA 4TRRA 3DOOA 4MOWA 4U0KA 3WGOA 3IDSA 3LT1A 4A03A 1Z45A 1DBVO 3F6YA 3GQVA 1XIVA 5COBA 2YW9A 3JSAA 3GHHA 5FFFA 3TRIA 4LN1A 1EK5A 4IQ0A 4LRSB 3K31A 2Q50A 4OOFA 1UXHA 2OUIA 4FFNA 5FF9A 3CINA 4KTTE 4R16A 4P4GA 2CUKA 3L9WA 1IPFA 3DBVO 2JKVA 4TVBA 1H5QA 4CLEA 3GDGA 5G4KA 4ZQBA 1ZUD1 3KYCA 2BFAA 3D1LA 3JQBA 4HNHA 1XSEA 4IIUA 3I9LA 4ND1A 3HWRA 1QKIA 1ISHA 2PTGA 4JJGA 3AUSA 2NTNA 4YYZA 3PYXA 3HSKA 3JQFA 4DREA 1LSOA 1ORRA 3PHGA 4C7KA 2WSBA 4YAGA 1LC0A 1WXDA 4HUJA 4YJDA 4BVAA 1QSGA 3KRTA 1P1HA 4WCDA 5BR7A 1IZ0A 1E3SA 3T7CA 1PJTA 2P9GA 1N2SA 4E5PA 1I2ZA 3ASVA 4Z0TA 2I65A 4BNXA 3Q6IA 4L76A 3AY7A 2JJYA 1GUYA 1IE3A 4ZD6A 4WEQA 1VRWA 3DTYA 3SJUA 2TMGA 1HSOA 4IS3A 1P33A 1F12A 4J6FA 2ILTA 4P4NA 4AJ1A 4BKUA 1LSUA 3KVOA 2OO5A 3FWZA 5IAAA 1NNUA 1ZXBA 2CF6A 2HUNA 3IUPA 3ZCXA 4DQUA 3DBHB 4EITA 4PZDA 4ZHSA 3ZV3A 2JL1A 3H2ZA 3AY6A 1EDOA 4Z3KA 5L4SA 3NDIA 1QLJA 1GD1O 4XX0A 3AI1A 1XCBA 3H7AA 5DF1A 5A3VA 4PVDA 3PP8A 1ZEJA 2Q99A 4BV8A 9LDBA 1QLHA 1Z74A 5G0TA 1NP3A 3EUWA 2JHGA 5ER6A 4KMSA 4CLDA 4DMMA 3OM9A 2BFPA 1ZCJA 4JIGA 2GRAA 4OQZA 3VC7A 3ADPA 3Q1LA 5KVCA 4XGKA 3PZBA 4BGUA 5THKA 4N7RA 1WZEA 5JLAA 1U3UA 5TRTA 2VN8A 3K2BA 4I9UA 4W9NA 3TWOA 3LQFA 2VHZA 4Q3AA 4DL9A 2FHSA 5G0SA 4I5GA 4CLRA 2X4GA 3BTOA 4EYEA 3UOGA 3DAGA 5HM8A 1DFIA 3L4BA 4BQRA 1C1XB 4FJ1A 1RPNA 1CQIA 1HRDA 3F1KA 2W98A 2X0JA 2FSSA 1VJ1A 5MDHA 1HE2A 4M8SA 4C7JA 1GPDG 4JQCA 4YAEA 2YQ4A 5IZCA 4EW6A 1HEUA 4PLWA 2GUGA 2B37A 4YPOA 4K9DA 1TLTA 4NFYA 1QV6A 2BRUA 3EGOA 1LDEA 3BYZA 3HDQA 2NU6A 1HDOA 3RJ5A 5KVVA 2PK3A 1A9YA 2CVOA 2DBZA 3AOGA 4HXYA 4QQRA 1DC5A 3AY3A 4E2WA 4B3IA 4UUOA 5B12A 4QECA 1I32A 1GR0A 2R6JA 2DFVA 4A26A 5CG1A 2VYNA 1VE9A 3HB5X 1GUFA 3ROKA 3WWYA 4IJWA 2OBYA 1QYXA 1SC6A 4XEHA 1E7MA 2ZB8A 4WLVA 1R0SA 4NZ9A 1CERA 2J3HA 1Y8QB 3MCVA 1WDMA 3INRA 1C0KA 2OP0A 3VTFA 4CV1A 4JBIA 4WUVA 5TQVA 3QLJA 5EJ2A 1P9LA 1PWZA 2JD0A 4CLXA 1VSVA 4NIMA 3WTBA 4GVLA 2HDHA 4AFNA 2JAPA 5JNLA 2C29D 1NASA 4FC6A 2HMWA 3EYWA 4CMHA 3V1YA 5LDHA 1ADBA 4YACA 2WE7A 3R1IA 4IZHA 4B3JA 1U28A 2VZ0A 1DB3A 4W7HA 4YRDA 3QIVA 2C7GA 3JQ6A 3RUFA 3V8BA 1KEUA 1Y7TA 4WCFC 3WJ7A 5KJFA 1SOWA 1F06A 1CIVA 1W0CA 2HCTA 3DZBA 4IDCA 1KC3A 3GZNB 3MJEA 3Q2IA 4EEZA 2PGJA 2W2KB 3E5MA 4QO8A 3O9ZA 4MVJM 5F5NA 2WYVA 1Q1NA 3WG9A 1Z7BA 5AOVA 3VTZA 2Y1CA 1NVMB 1E5LA 4R1SA 1SEPA 2QZ9A 2EKPA 3OMLA 1KY5A 5JAIA 4BHTA 3ITDA 2FMUA 4FIZA 3WGZA 3FTPA 5A5EA 4UREA 2DKNA 1PR3A 2X9GA 3JQCA 4YJFA 5JDIC 3FPLA 3V2UA 1PSDA 2W4QA 3C7AA 5G4KB 1EDZA 3KZVA 3KYCB 4LVCA 4NH4A 1V3UA 2B69A 4YBZA 3TZHA 4HBGA 3PHHA 5COAA 5A9RA 5IF3A 2J6IA 1T2AA 3OIFA 2HMTA 1ADGA 1NQAO 5EQDA 4N5MA 1N1EA 2JHFA 3GPIA 3ZWBA 3F4BA 3GDFA 1HZJA 5TC4A 4WKGA 1KOLA 4ZQGA 3BTUA 3RC2A 3NAQA 1K2WA 2Q3EA 5T64A 4INAA 3IUSA 3GZ4A 3PQEA 3BAZA 2WYWA 5TIIA 2WDZA 4GX2A 2GERA 1P1JA 1ZH8A 3EW7A 1GPJA 1HDRA 1AHHA 1NHGA 1ZKMA 3ZN2A 1H93A 3QVWA 3CKYA 5JAMA 3H8VA 4MPDA 3PDUA 1PJLA 4MINA 1GCUA 1HZZA 4R9SA 1EVZA 4GL4A 2BFOA 3I6QA 3A9WA 4ND2A 4J0FA 4BMSA 3GAZA 2O3TA 1WAMA 4PRKA 1Q7BA 4CR8A 3F3SA 2EW8A 4D45A 4F6CA 8ADHA 1MB4A 3ZU2A 4XYMA 1Q0HA 3EVNA 3DQPA 1HLDA 3RCBA 3W6ZA 2X0IA 1T24A 3JTMA 3O8QB 2F00A 4GMGA 1F8GA 3GEMA 4FPXA 3MZ0A 4MP6A 3DAFA 4RO0A 3LC7O 4CM8A 1KY4A 1NQ5A 1ZJYA 3TQHA 2I5PO 5BSFA 1FDVA 1ONNA 1LDMA 1U3TA 1B3BA 3VPFA 2O7SA 2EV9A 2GO1A 1YOVA 4B7XA 4TROA 1T2CA 1P44A 3R6DA 4EJ0A 4WECA 2C82A 3H5AA 3B6ZA 3WGIA 1VKNA 4XJTA 1JA9A 4LSMA 1I36A 1V8BA 2AEMA 2HAEA 3VPSA 4BKRA 5L95A 4CLRB 2DT5A 1WMAA 1YVEI 5EQFA 4FSHA 4E12A 5JSFA 1ISIA 3A14A 1DFGA 3TOXA 1DAPA 4AJKA 3RVDA 3S55A 3WJAA 3GOHA 3RU7A 3JQ9C 2NU8A 1M6HA 1BHSA 2WTBA 3KETA 4P22A 2XPCA 4RF5A 4GI2A 2AMFA 3PHIA 1P1KA 5ILGA 1PS0A 4QFCA 4RL6A 5EMHA 1EEHA 1SB8A 1B26A 3W8EA 4HADA 2GZ2A 2O7QA 1P1FA 1QMGA 4ID9A 4AJNA 3IL2A 1JKJA 1ENOA 4XRRA 2AG8A 2H1SA 2P91A 4XIYA 2DQ4A 3GEDA 3D5QA 3FNHA 1DIAA 1ISFA 2HJRA 2HMSA 4H3VA 4P38A 1BRMA 1TXGA 2I76A 3G17A 2VOEA 4Y6PA 2QX7A 4RDHA 1IHXA 2DTDA 2WD7A 3VH2A 4IGEA 2HK8A 1HYHA 3QVSA 1FMCA 5TSDA 4PG5A 3ZWVA 4ALJA 1A5ZA 4BO0A 2J5KA 3S2IA 3L9XA 3U09A 3FNFA 3DEYX 4AJJA 1BXZA 4BS9A 3M1LA 2EJWA 4YTEA 4YDRA 2YDYA 4TVOA 4BNMA 3MJ4A 2ZCVA 4FCCA 4II2A 2PD6A 2Q4BA 1LQUA 3F9IA 5T8KA 1WDLA 1P1IA 4HP8A 1GADO 1GYPA 2A4KA 3FN4A 1LLDA 4PRLA 3BIOA 3NJ4A 5CPBA 4BL5A 2ZJ1A 4IMPA 4R4JA 2G17A 4BNGA 1XU9A
chains in the Genus database with same CATH superfamily
1YS7A 1RI3A 1F0YA 3C4QA 3VPCA 4DCSA 4E5KA 2I87A 1WABA 3ED5A 5EEHA 2JJMA 3GEIA 4TL7A 5HXAA 2JVIA 3ZE9A 1WQ3A 3OICA 3LX6A 1YRAA 5ITWA 3AWDA 1LCIA 3DQZA 1K9VF 3ENQA 4C7XA 1C1HA 1ISMA 3LQRA 1USWA 2I7DA 4KIFA 2HA6A 2AFIE 2AN3A 4QT4A 3H19A 3PICA 4IDNA 4MX8A 5EJ4A 3MJVA 2RHRA 2ZETA 5E7QA 3EPLA 1E62A 2JANA 2A8YA 2PRSA 3FHOA 3NZEA 4UHJA 4GPZA 1W88B 4CIWA 2NP7A 2UZ1B 3NKVA 1ODJA 1WB5A 3NT2A 3QNWA 4ZKEA 1COWA 3NHBA 1PL6A 1C4OA 3GOQA 4GEGA 4DOMA 1NL3A 1QHIA 4MIOA 4TTRA 2J8ZA 2OK7A 4INJA 4IEFB 1DBSA 3WV4A 5ECGC 3AF5A 2R85A 1FDUA 5I3ZA 4IIJA 4WJKB 3D8UA 2AXQA 4BLWA 3ZG6A 4YR9A 5K0EA 1U8EA 2GH1A 1BW9A 2VJCA 4G84A 1UDRA 1DU4A 2G7ZA 2ZSDA 2OCBA 3HMQA 4FN5A 4OKIA 4TQUS 4ZCQA 4KSBA 2XVYA 2E4VA 2GZDA 3GLUA 3D6FA 4ZYXA 2E0IA 5FTMA 1AQ6A 3THYA 4G5OA 4LW8A 2O19A 1OASA 2AFIA 5KYGA 1CVLA 1RRKA 1N33B 3LLSA 3RUEA 3LNCA 1FUIA 3ON5A 4MO2A 5E1MA 5LD2B 2UAGA 4HVTA 3AESB 4E1AA 1R66A 3IUNA 4J1TA 4YMLA 4WBXC 4F5ZA 1RRCA 3RK4A 3TZEA 3I2IA 6AT1A 2XCRB 2FW1A 3ABIA 4YRMA 4A7PA 4U8GA 2I3AA 1N8KA 5JNRA 3L1UA 3MT0A 3AFOA 4ASUD 4PYKA 1DBPA 2QG4A 3N6VA 1WS6A 3IERA 4W1PA 2DSTA 3DL2A 4R71A 1Y63A 1AQLA 1EFVA 1GA4A 3GLGB 4MVWA 5EKTA 1CUJA 1PGNA 2B83A 2Z2ZA 4L8FA 4YX9A 1C9JA 1CB7A 1OLUB 2PANA 2ZSEA 4XIIA 3VNAA 5JDCC 2DUJA 4FZ3A 4XE5A 4YMIA 3M2PA 2B8TA 1W1WA 1Z13A 5LLDA 2B2NA 4NCJA 3VH3A 5BQPA 3BZUA 3T1TA 4YV1A 1IUOA 4NFLA 3STVA 1N5DA 3EQ6A 1DLJA 1EMDA 3I3SR 4JLPA 2KQUA 5EINA 1ZD5A 3A1DA 2W6JD 1FS6A 1LNZA 4HRVA 1JMYA 3RIMA 1J8VA 3PQDA 3D2BA 3VU9A 2DAPA 3OKPA 5LZ2A 2YWCA 3IUYA 1R6XA 4GICA 4XFJA 1M1UA 3V2IA 3I6IA 2FJ0A 4ID3A 3UKJA 3ROPA 4JENA 1F2TA 4GI3A 2CVQA 3KJGA 1FXWF 4BRUA 3U7EB 4CUJA 3H3XA 3VR2A 1IWBB 1MGPA 2EZ4A 5FV7A 3PNKA 4YRJA 2CHQA 2VJDA 1GVHA 1IH8A 1JQEA 3FE2A 3JQRA 4AJOA 4QGSA 4RQAA 3ONNA 4M0LA 3VHLB 3A4NA 2RKOA 1KJQA 1TLFA 1T2DA 2A1UB 2IF2A 2BC9A 2XHZA 3O5AA 521PA 2PU5A 5EKDA 4ZYYA 3LWZA 2EYUA 5DX8A 1IUKA 2BMVA 5BV8A 3A2NA 2ID4A 4JBXA 2WNHA 2WM8A 4HDNB 1K3TA 4FGKA 1CRQA 1XYVA 4R7GA 4ZWNA 3ZHVA 3G88A 4KE6A 1VJTA 5FI5A 1ZU5A 1Q3KA 2FP4A 1T15A 421PA 2IYZA 1YJ5A 3EUFA 2RGYA 4ZKDA 5IYZA 3CXRA 3IQFA 4XQ0A 5FYDA 2TYSB 2FVYA 4MUJA 2IF0A 4MKRA 5HUQA 3SBDA 3C15C 4BRWA 1B73A 3A6FA 4WVFA 1AXGA 5CRIA 2YXEA 1H2BA 2Z1NA 4C3ZA 4UHBA 1SHTX 4U2KA 2D1FA 1RM4A 1H4QA 4JXKA 4M8IA 5B7GA 1Z2PX 3FOEC 2PHZA 1TYCA 1R27A 1W9HA 1U7HA 5LCXA 1SKYB 4JWTA 2UYOA 3IMGA 1JHZA 4LFAB 4COKA 3LVQE 4YT2A 5EMKA 1FLVA 2VK1A 3EK2A 2R2GA 5EAIA 4DCVA 3BERA 2PS0A 4PGGA 4TQ9A 1X8LA 3NATA 3SHWA 3TRJA 1D3AA 2IYOA 2HD4A 2RHTA 3JD1A 1ZMTA 1N3IA 1NW4A 2CEKA 2H4ZA 3F74A 4J43A 4JI3B 1Z37A 2NUTA 1OREA 2VAVA 4BMZA 4ZGWA 3CO5A 3K09C 2OKCA 3JD0A 4GQIA 3MA0A 4X41A 5EUCA 3VRHA 5KNDA 1AHIA 3K8QA 2YVAA 5HHTA 2GNPA 4JROA 5LZ5A 2X2PA 3P2MA 1M5RA 4UOZA 1JAHA 4QEKA 1FYFA 3EIXA 2HT6A 2W4MA 2NPFA 2EEPA 1PV2A 1YC5A 3PXUA 3PX2A 2CD9A 3JWHA 5FULA 4Q3EA 3VAYA 5J4HA 1LJLA 3EAQA 4ZC8A 2PVSA 1JTVA 1USKA 1LDYA 2X19A 3NEJA 4A0RA 4ZI7A 4V1CB 1KO8A 4BNJA 3A3NA 3QE9Y 2PGAA 1GFZA 1ZNYA 4GC9A 3S5UA 1V6SA 1P80A 4TWRA 4BNYA 2AQKA 1U7WA 4TYQA 2GD2A 1YJXA 1JFFA 2J31A 2PNJA 1V0JA 2G77B 2HF9A 2RG7A 4YCCA 5IEBA 2FMTA 3AUXA 3EXIA 4AS3A 1EAYA 1R6VA 2CLEB 3MWDA 3ZLUA 1OH8A 3WMFA 1ZXXA 3PF8A 1RJGA 1RMQA 1UFRA 2UXBB 2RONA 1U8CB 3ZNPA 2PRYA 2WDPA 3SFTA 4CMBA 1NJ5A 1UZAA 4FLFA 4JX8A 4JYPA 4RTSA 1E5TA 4AY6A 3ZLJA 1KYVA 3HVHA 2VPYA 1BE1A 3AHHA 2QVZX 3N2GB 3SZMA 4TZ0A 1JA1A 1J97A 4JVLA 4V0LA 5EKXA 2K7FA 2KM1A 1DUVG 4A5SA 5EFOA 1ENPA 1DWPA 3SOPA 1QJ4A 1CDOA 3AHJA 4I4TF 4KQ9A 2OBMA 4G25A 1GQQA 4GECA 4WZAE 3UAVA 2D1TA 2VC2B 1T9DA 2I33A 3LBFA 3UFXA 1RU3A 1E1LA 2R8BA 1L9XA 3RKSA 3STTA 2CFCA 3M1AA 1U1FA 1E2BA 2BMDA 4MCAA 5FWXB 4ZI3A 2ZVDA 4YN3A 1P0FA 5K3FB 1XWFA 1XAHA 3BK2A 4OPMA 3W9YA 3PRYA 4DYVA 4Y2PA 4C14A 4PXSA 2ZIWB 3AYXB 3HU5A 4D9NA 5E6UA 4BO2A 1RCUA 5IT5A 4FM9A 1JDNA 2YFQA 1PR9A 9MHTA 2XE4A 3MIIA 2HQ1A 1GUAA 1RCTE 5B3JA 2RGWA 1ENYA 2IKSA 2PGXA 2ZAYA 4MVJI 1DC6A 2B8NA 2I67A 4KO2S 3FOZA 5JFGA 2X58A 4DIBA 3ZJTA 4R8SA 1MHPA 1TF5A 2VDKB 3DHVA 3IXQA 5AW6A 2ZTSA 3PF9A 4HTFB 4NE7A 1UIMA 4YRGA 1SIOA 2I3DA 2J9FA 3ZU3A 3ELWA 4N18A 1J9EA 2XH8A 3FGOA 2FK7A 4PC7A 5BV7A 1G5FA 1TMGE 2G07A 3DM9B 1PEKE 1L8QA 4Z7NB 4AF7A 5B36A 1QF6A 2IWRA 1TQ2A 1KY3A 5HA5A 1ZZGA 2INGX 4XVQA 3SIXA 3FWYA 2EP7A 4F1WA 1JUDA 2WHXA 1ARZA 1EINA 1WXWA 4MP3A 4AZTA 3ROEA 5CJJA 1EXMA 1JB9A 2QBYB 4PW0A 4MV1A 1GRVA 3GLVA 3LWNA 4DVGA 3ENWA 2PWZA 4QYIB 4QBIA 3QA3E 1M6WA 1OJ7A 1FQKA 1HRKA 1NXQA 1RM5A 1RC0A 2PR2A 4ALNA 2BGKA 3D1JA 3GJ8A 3QX3A 4CQNA 2FQXA 4EARA 5LZ4A 1V5GA 3SU8A 1NUAA 1FFXB 2FFJA 2X1HA 3DO8A 4O4JB 1EM6A 2W70A 1HZZC 4EAAA 2OXTA 4RPHA 3HFGA 3E7XA 2J7PD 1AK1A 1RYNA 2PY6A 3LY5A 3OF5A 4IDDA 1KRHA 1OBFO 3NIDB 4CDGA 1D07A 1XK7A 5CDHA 2WAOA 4KOEC 2DR2A 3ADOA 1E4OA 2HSDA 2Q1SA 3GXBA 1XROA 3IP3A 5CJPA 2GS9A 1ZISA 1Q83A 3LUGA 3A36A 2IXBA 1ZAKA 2IXTA 3WYEA 4UTOA 2P68A 1MTZA 3HJCA 1XTQA 1ZVMA 3ENKA 5ERGB 1QPGA 2C31A 3LYAA 1KI4A 2XDQA 4RXTA 5AW8A 2VDWB 1EVLA 1VMEA 2ZWIA 1HDZA 3P2KA 4S0ZA 4A2CA 4EX6A 4YPVA 2C7OA 2XRMA 1JAIA 5EMJA 3TMKA 3WO1A 3TZCA 2P0YA 2QK4A 2R1VA 4G63A 3UGKA 5LDDC 3ZE6A 3TE7A 2RAFA 4RZUA 4UXIA 2ZP1A 3KVYA 4C21A 2HNKA 1SUPA 3E6AA 3JZMA 4L57A 4YAOA 4XD2A 4KDRA 1C3JA 3FUUA 4KBFA 2E89A 4HY3A 2AC4A 1OTYA 2ZR7A 1W29A 4TL6A 1KEZA 2PKQP 2VK2A 1RWKA 1QNFA 4WUTA 4Y6SA 4F72A 2V1UA 5AI5A 3E9YA 1A0OA 1UM9B 1X7WB 4CNQA 4CU2A 3RS2A 4POOA 5IFKA 3KWFA 2E5FA 2PMCA 2XA2A 3ROQA 3SLKA 3ZE8A 2PSSA 3MB5A 4ZCSA 4C29A 4PHGA 4G4JA 4W5JA 3UJBA 2WRZA 2F1IA 5TQ0A 3ZX4A 3I6MA 3MW8A 3P2EA 2QPTA 4ZQIA 2IX9A 3DH0A 1DOAA 3GG9A 2FW9A 3CX8A 221PA 1Z0KA 4PHHA 3SXUB 5FNZA 5LQUA 2C4UA 2PWYA 1M1NB 5DHTA 4R9VA 3D59A 4CKCB 3IAUA 1UKYA 2NU9A 3O95A 2MMGA 1G41A 4G26A 5JQGA 4GKJB 1DFHA 1VCNA 3H2KA 1U5AA 3KT0A 3OI7A 1KETA 2FN4A 2D5BA 5AVSA 5D51S 1DQRA 2Q5OA 2ICAA 5E9JA 3UMRA 3WL4A 2QENA 1F20A 3WSWA 3RIHA 3OURA 2RGUA 2WP8J 4YUYA 1CZNA 3QVMA 4B3MB 1IJEA 1YL6A 2G0TA 3MWEB 5JPCA 4LX0A 3PVSA 1R9NA 2V59A 1V2HE 3R9KA 2C9DA 1ULZA 2ATCA 1X42A 3D0OA 1I0IA 4O59O 4CM9D 4UASA 1RQGA 4KQEA 1XAIA 3R6WA 4L51A 5JCJD 4XOUA 3U6KA 3T4EA 1QOPB 5CAEA 5DU2A 1FK8A 1TJ4A 3MJCA 2PZFA 3F3MA 4C6HA 3IILA 4L2IA 1I24A 4AM8A 3KX2A 2MSDB 2BEUA 1SUCA 3SBEA 1AGRA 1TM4E 1JI3A 2X22A 2I80A 4GYWA 3IAAA 3PDIB 2P9CA 4KSCA 3F46A 3KYIB 5EJ7A 2QAGB 2X23A 2PSDA 5JNVA 5DTQA 3AW8A 5KQMA 2JW5A 2FFAA 2VJYA 3F97A 3JYOA 3UPDA 2VA9A 1U0JA 1KHTA 2FR0A 4HEJA 1SBTA 2QIPA 3A4IA 4DLAA 5TPZA 5A0FA 5A1JA 1F51E 4QUKA 4EL0A 3R0ZA 4M1YA 3D4PA 4CTKA 1AU9A 3OM0A 4HEHA 2P9FA 4Y2TA 4DDMA 2FPSA 3OY7A 5LYJF 1U7ZA 2JGFA 4L27A 1F6WA 5LP6B 1VPTA 1GUDA 3H0KA 5HF6A 1Z0DA 4QPDA 2SKEA 2AZTA 4QGGA 2JLUA 4KE8A 4X1KA 1GZSA 3OECA 3HDHA 4G5RA 2JHAA 3H11B 1TO6A 2C92A 4RETA 2B1GA 2DWPA 4D0GA 1NM5A 4I50F 2MOKA 4CM4A 4HKTA 5FCDA 1ESZA 1J0EA 4F4UA 1JEEA 1O8BA 2B20A 2DF8A 2FUG6 3AEZA 2GBFA 2CL7X 3ZOKA 4C07A 3AP2A 1P1BA 3IBCA 3KSUA 1DIOB 3KSAC 3W3AD 4LTNA 1JT2A 5HCIA 6CHYA 5JI2E 4KPUA 4QG7A 3OZAA 1FP7A 4US0R 4GX1A 2VO1A 3ZD7A 1EE2A 2QMEA 4K6MA 3TVYA 4Q4JA 4ZO8A 4MQFB 5KYYA 3F67A 1YGPA 3P9CA 5IHXA 1XNQB 4ALKA 4JCOA 4PZZA 3H6KA 5EJ6A 5D2CA 2H0AA 2OHJA 4BCDA 4C4YA 1MJFA 5M7EA 5DOZA 3V1LA 4UHHA 4O3MA 1JVSA 2VCEA 3CMMA 1XFDA 2YJZA 1RQLA 3LCVB 3U40A 3VNQA 1G5QA 1NI4A 2MJLA 5EJMA 3UGTA 2HK9A 3Q41A 1GNVA 1HLGA 5JSUA 4EPTA 4G0XA 5H3HA 3AJRA 1OBHA 1Y4DE 2Q3LA 4OCZA 5KNDH 2GCOA 2MMCA 4WNIA 3ZZTA 3MSCA 2V7UA 1SBHA 1KMQA 1PDWA 1VMKA 2YIMA 3M1IA 2QJRA 5A2GA 3AR2A 5AM2A 3USZA 2IEIA 1AH2A 3INYA 4BRZA 3KV1A 4JP8A 4M76B 5ERXA 2AYXA 2ZS8A 3SYMA 3QE2A 2X86A 4YUAA 3LQQA 2R00A 2JATA 3U7RA 5AP9A 5JSHA 1ZS9A 1H8EA 5I4IA 1DG1G 4OIMA 3THXB 1MXFA 2G1KA 2P27A 5ITVA 3R9XB 3K4HA 1CFJA 2GARA 3JQQA 1RABA 3BK1A 5TR9A 1JLSA 4PGHA 5HMLA 2Q1UA 2J33A 3IQIX 4JU8A 4F9GA 1GSIA 1R9GA 4U7FA 2PX0A 1KOFA 3NYIA 4FSXA 4ZARA 3RVKA 4TMZA 4AO6A 4B3CA 1KTVA 3L6RA 4S3MA 1VL2A 3WHLA 4CQMB 4U2DA 4LG1A 4BMXA 1C7JA 1WOMA 1DWUA 3CRRA 4I4LA 2UUOA 1JB1A 3DEKA 3V4FA 2DHCA 3PJRA 4KBYA 4BFCA 1YDEA 2FI1A 2AB0A 5HUJA 3RWBA 3GGDA 4R7ZA 4IHKA 2YUIA 2B99A 3JAKA 2JLAA 2VDMB 4KMOA 2IDMA 4N0EA 4XQCA 3SMVA 1Z15A 4AJHA 5LA6F 2UXDB 4RYDA 1G4AE 2WHRA 2AQHA 4XCVA 5FTKA 2GILA 3LKVA 4MZXA 5CLQA 5EPEA 1OROA 2BFEB 2C7BA 2IYYA 1KPIA 4YP5A 4X3CA 2AKYA 3SJBA 2C9ZA 2ZSBA 1GG8A 4RH1A 3WKAA 3RVMA 2PIDA 2ZCJA 3DE3X 4I1VA 4ZYWA 2A9JA 4YH1A 4BWFB 5IF9A 4FJ0A 5M2QA 1YACA 3WDSA 4JP2A 3C5VA 4Y0AA 1GIAA 1UP4A 4E2ZA 1RVV1 5AM0A 1IBMB 2PZAA 5AOCA 4BX2A 3HLTA 3VMMA 5JALA 2IH4A 2Z5VA 1TQ4A 1PFWA 2FLVA 3I5UA 2VYFA 2P30A 5DYIA 4J3NA 3ZWMA 1BDHA 1CQWA 3DZDA 1XMXA 2VNJA 4ZU3A 1KSJA 3QQPA 1ZH6A 3EQ9A 4E31A 2AOUA 4FFWA 3UXYA 1IN4A 5T4HA 1R8XA 2ZTUA 2BKUA 2C1ZA 2D3WA 3PFNA 2RG1A 2QS9A 3GGPA 4YCJA 3HO1A 2HRZA 1PZFA 4AZ0A 1DT5A 1T1IA 4XIJA 4YGXB 5CT9A 2QJTA 1Z82A 3MTAA 1C7QA 1VB3A 2VWGA 5B37A 4DCGA 1UT8A 4L9AA 1J0BA 1O6BA 1B6SA 1E1KA 3M0EA 1QP0A 3EARA 2FOLA 3A3YA 3CF6R 1P3Y1 4MWTA 3FTEA 5JMOA 4C4AA 4DR1B 4BMYA 2DB3A 3KD3A 2ZYAA 3JU3A 4WASA 4MITA 5CX1A 2F8MA 3AR3A 1D1PA 3H5WA 1K75A 5ETJA 2IVZA 2XT9A 1CBUA 2QTLA 1UK7A 2HLPA 2C78A 1Q0QA 4L95C 1KTIA 1YS6A 3IA7A 4DIEA 1QUEA 1WO8A 1Q92A 3BBLA 2X5OA 1IULA 3WFIA 4M9CA 4OLHA 1WE2A 3AFNA 1R4MB 4O4LB 5B58C 1VG1A 3FNGA 3NYQA 4LYDA 4OFXA 4JP3A 1ZA2A 3PFHA 3ZJ4A 4WVLA 1XNGA 1Z18A 4PGAA 4W5RA 2AMLA 1I2MA 3B6IA 4JNKA 3LKBA 3EDRA 2FCRA 3LT0A 1JG2A 1IZYA 2D7JA 2QRUA 1LD3A 3FVRA 4FYXA 4GD3Q 4TKUA 1EFDN 4ZAZA 5L53A 1ISGA 1EFLA 4M8LA 1KKLA 1L7MA 1LTQA 4CCSA 3E2IA 2FWPA 3IULA 1E3JA 3OA0A 3K9LA 5KU1A 4DNPA 3SAJA 4H7JA 2CLHB 1Y3FE 3D3NA 4RZXA 3D8NA 1V3QE 3V3TA 1X1DA 3PUWA 4UHCA 1O7JA 1UJNA 2VSFA 3HYNA 1NMYA 1PR0A 3TGPA 4Z3DA 3M9XA 4J94A 1SG6A 3KQTA 1SUEA 4NICA 5C35A 1TUBB 3WHKA 2VNAA 2QR5A 5ARCA 4BVGA 4DMCA 3FPGA 4LI3X 4OSPA 3L7LA 2DPXA 3BHNA 4P31A 1GDHA 2W00A 4P5PA 5REQA 1VHJA 4AUNA 1U81A 2XTAA 4AS1A 4C1NA 1W34A 4BJ5A 3GV0A 1Y5LA 4DS3A 4GPEA 3I6YA 1R0LA 2PNFA 5CXUA 2AF4C 5JHGB 1T8PA 4MAAA 1RM3A 2ZUCA 4A2PA 2VUUA 1CUDA 3I5AA 3NBZC 5DNAA 1QP4A 1GL9B 1X77A 3RS4A 3VZRA 3KFXA 1XJ0A 2JFGA 3OQHA 3MGCA 4KVFA 1NQTA 5CA0A 1XPRA 2XQJA 4YBRA 1OWOA 2JD2A 2GF9A 3H97A 1SQ0A 3X2FA 4QRDA 1T9BA 3O1LA 4HQFA 1BDJA 3F98A 5AHXA 4YPFA 3SZOA 1EZ1A 2WUDA 5DLEA 3DKIA 3RAJA 1Z6PA 1UJ5A 3QVJA 2OBBA 4QAJA 1T3SA 4RMHA 1RHQA 5B3JC 4IW3B 2FWNA 1I0LA 2PQ2A 3LLMA 4F2PA 3AVTA 1E1CA 3H0CA 1G0NA 4OOFA 3K9FC 2IXDA 3L7KA 4ZYLA 4YREA 2ZRCA 4X1IA 3C8HA 3HO6A 4L72A 2ZRBA 1X7ZB 3U61B 4LYEA 3JQAB 5LXTB 3PRKE 2FW7A 3QJ5A 2FX3A 3BKXA 1ZMRA 3RT9A 4PTLA 4TKLA 3SFZA 1RPAA 2XNDA 2VPWA 4OJNA 1TU3A 3ED1A 3SYNA 3OKFA 3C24A 1QR6A 1GRRA 2C2MA 2H5EA 3MS2A 4YJFB 5FA8A 1J2TA 2NM0A 2AMYA 4TKZA 5D00A 1NC1A 4Z4IA 5HIJA 3W5IA 1KARA 1QORA 5C31A 1GL6A 1NTOA 4FP9A 2ACVA 1G18A 3HSYA 2XXBA 1YDFA 3EFHA 5IAGA 1G0OA 2QRQA 1YS1X 2W6PA 3PNLA 3PQ6A 2JFQA 5IEJA 2ZE5A 1GG2A 1XZQA 2F90A 2OGUA 4ZYZA 1EE9A 4QJ4A 3T9AA 4EMTA 5BVHB 2GFHA 3MT7A 1MO4A 3NIGB 3AERA 4MVJF 3VHXA 1GGEA 4UVDA 4PPYA 4RKQA 1E60A 2EG9A 2YDXA 1P91A 4TLEA 5MFPA 3VNUA 2H8KA 3MXTA 1JU4A 3V6MA 4DJEC 3ZVMA 1JFTA 1UDXA 2P9EA 1TCUA 2P90A 3ZEIA 1EE1A 2AD5A 3O38A 4QDJA 2GF0A 5F7JA 3FLEA 1OH5A 5K4GA 5CD9A 1KK0A 3MC1A 3U48A 2O06A 2EWWA 4PFKA 2EKBA 4QLOA 5IXYA 1CUSA 1JQBA 3AEQB 4UPDA 2FB9A 4EB6B 1OX6A 5AHKA 5CTJA 3ZLBA 4XR9A 3EBPA 5LDGA 1T5TA 3E1GA 1UBUS 1GTJ1 2II6A 2BF4A 2VXYA 3B3QA 4QULA 2L42A 1CNFA 2D0OB 2OO7A 2WW8A 2WJYA 5CBPB 1M67A 1QHNA 3SC2B 1E58A 5HDQA 3L5KA 4OHKA 2EU8A 2UZAA 4AS2A 5BWMA 3KJHA 4PBRA 5TQ2B 4IBOA 1KZ7B 1X0VA 2PE5A 3T1YB 5DN9A 1E4EA 3TSYA 4AG5A 1GU0A 1U0SY 2YV4A 1L4FA 1WZIA 3GA5A 4HH4A 3ETHA 3KJIA 2CC2A 3V8RA 1TYBE 2DRIA 5JRDS 2QTMA 5HDBB 1N34B 3KG2A 5A9SB 4FD3A 1C0LA 1N6HA 3LKZA 5A4AA 3RYCA 3DBLA 2FG6C 3B1ZA 3UA3A 3WOHA 4K87A 5IZ4A 3NP7A 3M6MD 1M2WA 1SCAA 4KUHA 3WX0A 5T57A 4BO6A 3EIUA 4DJAA 2QZZA 1I1HA 3BK7A 1PFVA 3QFHA 4L78A 4BQQA 1RLIA 3LU1A 3V5NA 2DUWA 2PBLA 4G09A 3LVFO 5KAMA 2JVKA 4NCIA 4URYR 2ZUEA 4KYUA 1QGZA 2H48A 2AA3A 3NVDA 2AXNA 4RMIA 4F3RA 3QMMA 4FHZA 4WNCA 4LFCB 1DC3A 1Z2OX 2OO3A 3RRFA 5C8YB 2PBZA 2Z58A 4M53A 4PE5B 3W9BA 1WZNA 1LLCA 1ZU4A 4NYMQ 1ODCA 1P2UA 2BZ1A 2VCHA 2ZR0A 3AZQA 5D8DA 3AH8A 4RD1A 1GGFA 3VC3A 5HSGA 3FVWA 3H6GA 4RGBA 4KUGA 1UP7A 2VTKA 3WDMA 2HXSA 1KY2A 5KWVA 3R09A 4R2XA 3Q4GA 3T5PA 4TTIA 2VDLB 3G8AA 3FYDA 2BGRA 2CJWA 2DT8A 3AK4A 5J40A 1EHCA 5K8CA 2XY4A 1WP9A 1LZKA 4JHXA 4B4VA 4YXFA 2Q4OA 2EJTA 4DDKA 1EVEA 4NYIR 5BPFA 3DBRA 4MGKR 2GLUA 3CWQA 3VHQA 1RPZA 3G49A 1MDFA 4O6VA 1V8PA 4HXFB 2IP1A 3RQSA 1JSRA 2PUCA 4R0NA 1Y34E 4QZVA 2XSZA 3T9DA 3FBWA 3WNVA 2IPOA 3LX8A 2QTHA 3I9V6 3AU8A 4ZVKA 1PV4A 2ZYTX 5GTDA 1YS9A 1U94A 1K0FA 1ZD4A 1EP9A 2PXAA 4N48A 4CMJA 3L7NA 1B0PA 4JBLA 2DETA 1VFNA 5KJ6A 4LF4B 3A1EA 3F2VA 5H3LA 3VKGA 4QG3A 1KMMA 3NXKA 1I7QB 4ITRC 4PQYA 1QS0B 2A5LA 3NTOA 1AQUA 4UDOA 1BTOA 1G2PA 1MQAA 2C42A 3HN6A 3TKLA 3HVUA 4P6VF 1OTHA 2IDJA 4UXJA 3D7RA 3MEQA 1RC1A 1I10A 2ZTMA 1Z35A 4H7IA 4X95A 3T06B 2O8EA 4GP9A 4UU1A 2PX3A 3VH4A 4OIFA 1MH1A 4JNCA 1Y6RA 2RH8A 4XA8A 5HJ5A 3P2OA 3U13A 1BAPA 2F9MA 2PAAA 5F2EA 2XHEA 4RBNA 5ALFA 1L5KA 4BIMA 1PNRA 1JNXX 3PWZA 3SJAA 4JV5B 1AS3A 1I3KA 2M1ZA 1UMCA 1GAXA 3ZE2B 2AX3A 3GVPA 3H9CA 3L7AA 2FEXA 4N47A 2IDKA 2Y1WA 1P75A 1YGYA 4MLPA 2CDAA 1T34A 1UP6A 4OD0A 1IOLA 4HX5A 4DBVO 1FTSA 2PO5A 1QIDA 3PXGA 4KUEA 1CR1A 1EP2B 2JIZD 2RJ3A 3HN7A 3FCAA 2P4SA 3FTCA 2WU1A 3NH6A 5DNYB 3X1DA 3L6OO 3HJHA 4AMYA 4C5BA 4OQ4A 3VZSA 3NAMA 5LIPA 3AIOA 2WMYA 3HYLA 1T2VA 1K8YB 3WRWA 3LUCA 2E18A 5F2NA 3EGEA 4KODA 4CUZA 4D81A 4BQEA 3AVUA 1GILA 1T5BA 1MG0A 5J9FA 4X6XA 5KSZA 2IITA 3L4KA 2FW6A 4B82A 3ZIAA 1QAQA 5KOIA 1ONPA 1ZZEA 3QPBA 2AV6A 1R1DA 1A2KC 1H8HD 1YB2A 1Z6GA 1YK0A 4P54A 4EVSA 4YMGA 1QU2A 3B1VA 3PL1A 2EC5A 2VF4X 4DLSA 3PXCX 4L4SA 3T35A 4YONB 5JPIA 1JSXA 4INPA 1L8XA 3TSAA 2UKDA 1DBIA 5CVUA 3VI4B 4K03A 2YWJA 4KQKA 1XZHA 2YJGA 1Z3CA 4IIJB 1B8NA 3GLFE 1PNOA 1U0FA 5B1SA 2VJAA 3LUKA 1S3FA 2ERCA 2FQYA 4Q3BA 4TT3D 3BXOA 2PU7A 4U9UA 3H04A 2H5LA 1CX9B 3N5KA 3O1IC 3E8MA 4KIJA 3JQPA 1H0RA 1G8SA 2M6KA 3CEJA 2P0EA 1S2MA 2AN5A 5F4ZA 3ESAA 2B4RO 2W8BA 4G2NA 4URVR 4QQFA 2QDKA 4CIXA 1S2LA 2ZSFA 2AFIB 4D3XA 3CSUA 1CW2B 1ML4A 1L7BA 2R00C 1XTUA 3FRJA 1GPBA 4J7XA 4J0CA 4WESB 1UQRA 3PS9A 1IEWA 2FWBA 2WJGA 1E6KA 5BW8A 2GWRA 1I1OA 3H84A 1QHFA 1QIIA 2WWWA 1UK6A 4JBHA 4L4RA 1ODSA 1RXIA 1NI3A 3NQ41 1YHNA 4M1OA 3W2EA 1COWD 2WT8A 3NCTA 1ZGGA 4BKMA 4D41A 1EAMA 4ZO9A 1USVA 1KJNA 2VJNA 3F3YA 4KIWA 2LRHA 2VRBA 3O03A 4P7JA 2O05A 1SK8A 2LDXA 3AR4A 2M2IA 4HNRA 4L4XA 3OQIA 3CH6A 1QV9A 3CRNA 1NXXA 2OZKA 2QTGA 4G07A 3VPBA 4AWBA 2OBXA 2P2GA 4ZN6A 4FFLA 2Q5HA 3CUSA 3F90A 4RK6A 1VL5A 1Y5NA 1OI4A 4I5DA 4RZIA 3COZA 1J1IA 4J8PA 4JVMA 4F5EA 3OHPA 1KP9A 4RVDA 2RD2A 4KWIA 1V37A 3FR7A 2VP0A 4ES6A 3OT4A 4YJGB 1V4NA 1KZ9A 1HE3A 4P35A 4UDYX 4X7BA 4LJLA 1JGTA 3NHLA 1R6UA 4XDZA 4TWZA 2HWXA 1Z38A 1NA5A 2EFGA 2QB5A 1PD0A 4H08A 1U31A 3CC8A 1T8SA 1MZPA 4DLWA 2JIRA 3ENVA 4ZO7A 1JI0A 1VKOA 2C61A 4EKNB 5AVOA 4FILA 2GPBA 4G5HA 5CVEA 4EVIA 1SOAA 2VDJA 3ANLA 2GK6A 5JVDA 4NQRA 3EGDA 2J48A 1L4GA 3Q72A 4KK4A 4KQFA 4WOJA 2NOAA 4H16A 1XQ6A 3CH7A 1DXOA 3E22A 1H2XA 1QVVA 1QFMA 4HFNA 3TBKA 1Z73A 2ZDGA 4WERA 3AW9A 4RS3A 2GM5A 3U3DA 1ZICA 3RKUA 2G70A 1RP7A 3WB1A 4LK3A 4YV2A 1B23P 3PA6A 4BAZA 3HY6A 4R40A 1FYDA 1P6UA 3PI6A 3CU5A 3GCZA 4NOJA 2WILA 2PUEA 3GYBA 4I0WB 4IH1A 2WF5A 3ND8A 1UIRA 2C3UA 5FPPA 1ZCFA 4MKZA 5LQSA 4K6FA 2YIDA 4CL3A 2A9OA 3L02A 1I9CA 1TNDA 3D31A 1V5WA 3QYFA 3I61A 2CT8A 1JFLA 2HIHA 2QRNA 3QK7A 3ERCA 1ISPA 2EKQA 3TCXB 5KTOA 1SG0A 1ULTA 2HMYB 3LT2A 4EKIA 3AEUA 3EMBA 4TTQA 1AKMA 1IQPA 1DRWA 2W42A 5KTNA 1UFKA 3WZ2A 2GN1A 1FP4A 2AFRA 3OMXA 3FRHA 1U0TA 3VR2D 2YVKA 4KXUA 4DCTA 1IL0A 4RGQA 5GZ1A 2G5TA 1DKUA 1OXXK 1LDBA 1E9VA 1KDPA 1SRRA 1ZGCA 2P69A 4EELA 4EFNA 3OQ6A 3ZWOA 2H4FA 5SV2A 1CZHA 5ECYA 4U4AA 3PFCA 1SC3A 1RAEA 1R6TA 1TM1E 2WM3A 3UMGA 1PZNA 3FLAA 5B4TA 5E0OA 4MWGA 1U8AA 2HK6A 1RZRD 4F4JA 1XEAA 2CXOA 4QQKA 3W5UA 4YR7A 3G6WA 4DRXA 2P6PA 3ENNA 3WXMA 2OSBA 4EG5A 5ESWA 3FTFA 1PG2A 1ZR4A 3D6VA 3UXEA 1PEYA 2AZDA 1IEXA 4U7HA 2P2LA 3TW4A 1R15A 3R20A 4BNTA 2WWYA 3QUCA 2YOGA 1N7IA 1R6BX 2BEWA 3BMNA 2GBCA 2EERA 4KWEA 4F8EA 1MFPA 4FC7A 1DINA 5JECA 1N4DA 1RADA 5COQA 1AV6A 3N6RA 4A73A 3IUJA 4Z9YA 1LBEA 1RJFA 1TK9A 1EQ2A 1KMIY 4G8BA 1CY7A 1U0BB 4N6NA 4MWZA 3WZMA 1O95A 1DARA 4RHXA 2EFDB 3KEOA 4WHMA 4YY3B 3MWDB 4JJAA 5F12A 1OOEA 2UZ3A 3OBIA 1XO1A 1IXRC 5TVKA 2XVXA 4OYRA 2O3SA 3ROFA 1L7QA 3THWB 1ONBA 3EVBA 2IXAA 4NZNA 1Z4IA 2G67A 3ZDAA 1YJQA 4XB1A 2WYOA 5KNDD 5KYKA 4PWYA 4BNLA 4D9HA 1TVKB 1F9AA 1PFKA 2P8JA 3T52A 4LXHA 1N5KA 2BFMA 3FUWA 1RBMA 1RP1A 3FMFA 1PZHA 1Y9JA 1KMHB 4BEBA 4YRBA 5CR9A 4L3OA 4J7AA 1D2GA 1LZLA 1OXKB 2DECA 3DZIA 2YMLA 3O47A 4OQFA 2E49A 4OB6A 5T6BA 1PUIA 4Z4FA 2XVMA 3RUCA 4LQLA 3UFXB 1P60A 3Q7IA 2J3IA 2HQRA 1G3RA 3FPKA 4O2BA 1WUTA 2WNIA 3HKEB 3C45A 3FX2A 5DHRA 5EQTA 3SBXA 4NP6A 1KU6A 2FV8A 3PU6A 1VIYA 3T7DA 4YRCA 1L5LA 5DM70 1AUPA 5DX0A 1PJQA 1URPA 4R98A 3A4LA 3T8YA 4TMTA 3UG6A 1CEEA 5C32A 5KC8A 1EHYA 5GZ6A 2A9KA 1HDYA 1K3FA 1ZI9A 2NO9A 1T5HX 3AR6A 3IALA 5HEKA 4NMHA 2ZVPX 1JR6A 3ILSA 3U0BA 1PX0A 3TW0A 3X3HA 3X44A 1VMIA 4NOKA 5A4FS 3QXSA 4HMQA 4XKJA 4L02A 2IZZA 4ZZ1A 4UHEA 3FGZA 1FTWA 2M9MA 3AX6A 3VX3A 4WZAB 2PQMA 3EEOA 1JFRA 3G2MA 1NX9A 4BMDA 3C98A 3IUEA 1X2BA 4OSOA 2VSYA 3KVRA 3WLQA 5FNVB 5JXIA 1FFCA 3RD5A 2CN1A 1D5WA 3VO1A 1XPJA 2Y0EA 1G2IA 1IAVA 3OC0A 4FGJA 4QUHA 3LS2A 1QFZA 1WHSA 2PRIA 2JCYA 2NXCA 5KNBA 4HI0E 4PRYA 3VOAA 3ZS8A 4YHBA 2Y1LA 1GCOA 4NNPA 4PRZA 1S8NA 1BFKA 2I55A 2MYNA 3NALA 4JB8A 4RHEA 3W7BA 2VBCA 5CITA 5C53B 1DQYA 1SY7A 2OXEA 3CF0A 4FFBA 1UFVA 4DIUA 4DEYA 4FCWA 4JI0B 2FWRA 2ACKA 3K7EA 2X6TA 4IUBS 4RKWA 2MINA 4JJEA 4CKZA 2XXAA 4R84A 4HEA1 4PIPA 2E5WA 3F7NA 3TJRA 4ERNA 1H2EA 3EH2A 5LOVF 3OMWA 1HMYA 2LVBA 2P3LA 3O9VA 1GAEO 1P0PA 1P74A 3JQEA 1NFQA 3SZ3A 3AB7A 1RKXA 4X1YB 3UN1A 2ZM6B 2XYGA 1F8FA 2HREA 3BSFA 2PJUA 4FFDA 1LSJA 3IAS1 4PHTA 3BMQB 2X40A 3AUYA 2H1WA 3GGGA 5FJJA 4XYGA 5CB4A 3J81k 1C9MA 2A59A 1UKEA 3L4JA 4ZOLA 2J9XB 3LDFA 3NHMA 3X1MA 1OT3A 2ZJ3A 5HIIA 4DCPA 5C8VA 3UQZA 1BC5A 5TT1A 1MX1A 1PT5A 1UFOA 3BN3A 3ZQJA 2UZ4A 5K3OA 3KLNA 2R65A 3ZGYA 4TMVA 2VEOA 4KO8A 2VF5X 1GU7A 1TK3A 3IAXA 4BNVA 4Z4QA 4NNOA 4YASA 4YWHA 5CCXA 3H4TA 4LZOA 4EB0A 1I14A 1LPNA 3O73A 3LFHA 1WU7A 3FNBA 1FFWA 2QLBA 2WAXA 6LDHA 4MB0A 3S3TA 1XE3A 3MTIA 1K5DA 1N6NA 4LJ9A 1QQ7A 1VSQA 4K1LA 2F1KA 3CZ4A 5AKXA 3II6X 1U3GA 3PUIA 2QKYA 1JALA 4IQFA 1HA3A 4V0SA 3FB4A 1P1RA 1ZPDA 2RAUA 3SLGA 4IFTA 5CM8B 4OYYA 1CJMA 4MPRA 4HGPA 1BMDA 4BMCA 3ICVA 4QUJA 4MEBA 3CPSA 2BZ0A 4OHPA 1WDTA 4X8LA 2PT5A 4BNHA 2G80A 2YWFA 4PZ9A 4DV4B 1JU9A 2Q9UA 2Q07A 3HEMA 2W37A 3A7EA 4UVEA 3KQUA 4BUCA 1HR0B 2WWGA 2BD0A 1JEQB 2RE8A 4CEHA 2XIQA 4K05A 4PC2A 1XDUA 1OAAA 4MDYA 1DWOA 2AVNA 1XTZA 2QW0X 3ZGOA 5J58A 3PR1A 4LJSA 3QBTA 1YC2A 5HILA 5L7YA 3B78A 4FYMA 3EHDA 3RB8A 2Q6OA 4OXNA 3LECA 1FVXA 1VA4A 2V6GA 4TWBA 4HWPA 5AKZA 1Q84A 3OCVA 3LY8A 4UZEA 3RSSA 1SC1A 5DBGA 1B93A 2B82A 3B9PA 1FL9A 4NG5A 4R8VA 1KORA 3EGXA 4KMRA 3U7IA 2FOIA 1T43A 4OL9A 2YBDA 1KOGA 1EFPB 5BT9A 1JQ3A 1SCBA 1H1TA 3E61A 4HYEA 3ACBA 4RVNA 4HNQA 5EZYA 5K7SA 1FZQA 1WSAA 1GUBA 1TKCA 2B4AA 2GM4A 3FMOB 3TOVA 1DKOA 1TT5B 3H2GA 3OF3A 2XOKA 4LYFA 3G8DA 1BVYF 4MV5A 4ETNA 5AI0A 5M5BA 3COVA 3SMQA 2Y1XA 4C4TA 2O7VA 3ACDA 5K0NA 3HJUA 1E0AA 2H1IA 1GG5A 4ZHQA 1R6DA 5KQSA 5KX5A 1G8KA 2JH8A 4F7WA 2A6PA 2NSLA 4CM3A 4RTLA 5FEUA 5M34A