2VOXA

An oxidized tryptophan facilitates copper-binding in methylococcus capsulatus secreted protein mope. the structure of mercury soaked mope to 1.9aa
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
290
structure length
289
Chain Sequence
GVAEVVETFKNPGTYSSPVINFKIASPPGPGTPIYGPPRDFSGYNKSYSLAIGKTSYYDPTTGTKWNDDTITPVSDGQDIWRGTHTGKWSFFNGKAGDKITLSVQRDAQEASLKGAHPGFILFWRPEGGPLFWAGTQDLDEGQTALPADSDTVIGHVIVQHADWTLQGLPPKADHTAPAGVDTELYPMKPDSYTMYYVDSGYDADKYVASKKLIMHPTAFKGLALNDGTAGAFTKSITLPKTGYYMLYVANVLEVDDWSVDADGKLTTTGEVWEVPAKGCWVNITISKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SURFACE-ASSOCIATED PROTEIN
publication title An Oxidized Tryptophan Facilitates Copper Binding in Methylococcus Capsulatus-Secreted Protein Mope.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 69
structure length 289
sequence length 290
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11617 Cu-binding_MopE Putative metal-binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1220 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2voxA00
2VOWA 2VOXA 2VOVA 4BZ4A
chains in the Genus database with same CATH superfamily
4C0BA 2AACA 1RUF3 4J6GA 4DIQA 3ST7A 3VV1A 3CMGA 3DL3A 3L2YA 4LO8A 4Q2FA 4A7KA 3AB0A 2GNMA 4X6QB 4HKLA 3IIAA 4N43C 1NCQB 1ULFA 1UZZA 4DFSA 1LHWA 1F5FA 4XXPA 1NZIA 1PM4A 5LBFA 1WLCA 5L9RA 1ZZ9A 5JCTA 2D93A 2ZGKA 2ARAA 4SLIA 4BA6A 2D5FA 4YYOA 1V9U1 2WO1A 5DAWA 1ZREA 1GOGA 1AJKA 4W65A 2ZAAA 4NHYA 3KF3A 3POBA 1D2SA 2F6BA 1O6UA 4I3GA 4P9GA 1GWKA 4Q0PA 1KEXA 5E16A 3DGTA 2YC2A 1W0PA 3RMXA 4IV1C 3HD8B 3SH3A 4HPKB 5FZ8A 5K9YA 3RWNA 4IDZA 2WZEA 4OMDA 3DKQA 3KB5A 1DZTA 1UF2C 2ZOEB 1KDMA 4XABA 3WQBA 1QMJA 2ZX0A 4C90A 3OGRA 5JXJA 3QD6A 2VUDA 2YBSA 4QDQA 4CU7A 5F5IA 1J1TA 1S0GA 4GA9A 4PHZA 3C7HA 2WN3A 3GF6A 2GNTA 1R092 4BH9A 1JZ7A 1MS9A 2EVXA 4DRVA 5DDJ2 5IHRA 4XPVA 4E4ZA 1KRIA 4M3CA 3WF3A 1CVNA 1S0CA 4XUPA 1VRBA 4Y1VA 3IN9A 3S7EA 2NM1A 5JOWA 2V5DA 3BI3A 2BNOA 2PHFA 1AR73 2PHTA 3WNNA 3AZXA 2E7TA 3N3HA 3RZLA 1OPMA 3FHAA 2HH9A 1XQNA 2P6HA 3HAGA 3NKTA 4FFHA 4QB2A 4XXAA 1TQ5A 1MVEA 1FOD1 4XURA 1OLQA 4BK4A 1RUF1 4A3XA 2QCSB 4LUKA 2YDEA 4CCNA 3BTXA 1RUJ3 3LAGA 4MGKE 5DG1A 2GH2A 2W9XA 3PUAA 1JZ6A 4P5HA 4YG6A 1R082 2IC1A 1G6NA 2YU1A 4HT1T 1UW8A 3THTA 3HQUA 4F7ZA 5IK7A 3GHNA 5HCAA 4ORFA 4AEMA 5ISLA 1FT9A 4ARXA 2CL2A 1PGL1 2FDFA 2HWC2 4RHV2 5CFCA 1QU0A 1GFF2 2EIBA 4NIIA 2ORZA 3D0SA 1SLBA 3WG3A 5DAQA 5BNNB 2D3SA 2RS53 4N53A 1FYUA 1RUNA 3VZOA 5A7NA 4IE0A 3WQ1A 2YHJA 4PQ9A 4A7YA 4D7TA 1POV3 1DGWA 4QU2A 2XBO2 2NMOA 2QZ2A 2D6PA 4PDWA 4JQRA 2GC1A 3OB8A 4LIUA 4QX0A 4XOGA 4MGYE 1AZDA 2JDNA 4QPGA 5J3UA 3H8XA 2ILMA 5IYYA 1TNRA 3SCFA 1DQ6A 1URXA 3IKWA 1OH4A 2E9QA 3M1HA 4ONUA 4Y1XA 4LORA 5DZFA 1H2NA 3KT1A 1WWYA 5CFDA 1FAYA 3HQRA 2W3JA 3PJYA 1JYTA 2WO7A 5AVPA 4YW3A 4MX3A 3PU3A 2MHFA 5D2AA 5AVAA 5APAA 3H8UA 5A70A 4W50A 1O91A 4JRLA 3POFA 1AR71 3U10A 2Y8KA 3U75A 2JD4A 4BIOA 4HKOA 3VDDB 4YZ5A 2IFRA 3PIJA 1W9YA 4NHLA 3ZFGB 3ES4A 2ZHMA 5FOJB 1M4WA 4JKLA 1LRHA 1AF9A 4WVZA 1JTZX 1OA4A 1RUJ1 2YZ4A 4JC1A 1SFPA 1V9U2 3VL8A 2Z42A 1H0BA 2WWSA 1X9PA 3H7JA 3QOPA 1E5HA 1ZM1A 2OQ6A 3LQCA 3NVCA 1OSGA 1ZRDA 1W6MA 3KVBA 1SG3A 1PGW1 5ACA2 1E5RA 3CQOA 2EXIA 4QB1A 2P1BA 1Z7S3 4C8DA 4QU1A 3B93A 1ZBA3 4CCOA 1AHSA 4KG8A 3UYJA 2WQ4A 2RS51 4DXRA 2C6SA 1K12A 3VDCA 4EWAA 1HQLA 4GH4A 4IW3A 1C28A 2D3PA 4LBMA 5A33B 3O1PA 5FZKA 2A1XA 4AAXA 2ZABA 4AEDA 1VPHA 4DXSA 5CZKA 4OULA 1ZRFA 4PLNA 2XJSA 4B7EA 2UY8A 1LOGA 3VBUA 1PMJX 2KM2A 5A1FA 1HIXA 4WM7B 4E2SA 1BK0A 5DUXA 3VD9A 1OLME 1AYM2 2ZEZA 1N3PA 1UOFA 1H8VA 5FY5A 2ZMKA 3ZR6A 2DU1A 2BWCA 3CJIB 1N47A 4KH9A 1WLTA 5FJHA 3VZNA 1H6XA 5C9AB 2JE7A 1DF0A 4FAGA 1EYBA 5TSWA 5FO7B 5FOBB 1XJAA 5IVFA 4ZONA 4AQTA 1UY4A 4QPWA 1W8UA 2IFWA 4D69A 3HN1A 1N1SA 3VKOA 1IS5A 1EP0A 2RR13 1OMIA 4CCEA 3FMGA 2C4XA 2E53A 1NQJA 3AZZA 4QX8A 3RGBA 1VAKA 3E5UA 3E1F1 2OKXA 2Q4SA 3LEKA 2RS32 3GXUA 3WDTA 3WF4A 2YU2A 2O1QA 4WZFA 3WW3A 3LA7A 2XONA 2D6KA 3AKPA 5K7PA 4MGSA 1W8OA 3K4DA 3NNLA 2RM22 2AENA 5LW9A 3ZKUA 1Z7S1 2WNUB 1ZBA1 1Y43B 2ORXA 2W1WA 5JWPA 4AGVA 3S7IA 5CFCC 3LEGA 3C7OA 2VQAA 1XBFA 2P3JA 3NV4A 4NROA 4HLTA 4UFIA 4HMZA 2JDPA 4N53C 5C5TA 4GALA 5IVJA 1GP5A 1C8NA 1CPMA 2XL7A 1XC6A 4AG4A 4BMEA 3P1IA 5F2WA 5LA2A 2JG9B 3ORJA 4PDWC 1DGRA 3HMYA 5I8SA 4M01A 1LGCA 1OPOA 1KFUL 1GMMA 1D4VB 1W6PB 2XJRA 4XUTA 3DUIA 4LK7A 4QPGC 4RL7A 3BB6A 2FD8A 4FPGA 1HKDA 2D43A 4OUEA 1C4RA 3AYAA 4E4DX 1L7LA 1XU1A 2ZGUA 5D21A 4ASMB 3OUIA 3ME2A 4MV2A 2OIIA 3WW2A 3DXUA 1YJKA 2O8OA 5CFDC 3AYCA 2DVBA 3IWZA 1RJ8A 1BEV1 1DU3D 4E8CA 1GNHA 2E32A 2K9ZA 1I1EA 1SFYA 4IEZA 4UI9L 5FZ7A 3FWEA 2ZX4A 3UJOA 3R4SA 3MPBA 1VIWB 2WRAA 2VVFA 2WQ8A 5JZGA 3W21A 1PGW2 3T1LA 3OPZA 5I91A 2VMHA 4AHZA 3O1UA 1UXZA 1AR62 2VZVA 3JBG3 2VQTA 1X9TA 1NLRA 3PUIA 5FCCA 1NA1A 4CDUA 1GOFA 3JQWA 1ND2A 3C7EA 4BQ5A 3TNPB 3BU0A 3RJRA 1ZBE2 3IIIA 4XIOA 4XIKA 4XMIA 5LZ6A 1QIQA 2Y0IA 4LBJA 1W6QA 1X7NA 1GUIA 2YUEA 5LB6A 3THPA 1TME2 3P3PA 4J1WA 4PF5A 3CIHA 3MYXA 3ZXAC 1VALA 4XUNA 1YNAA 3V0BA 3AMQA 4GH4C 1XPWA 4OHZA 4AVCA 2CDOA 3KVAA 3QH6A 3DV8A 3LCPA 1BKZA 2TEPA 2W91A 5FXVA 4AEDC 3TN92 1LOCA 3SXWA 4Z2WA 1YFWA 2P6CA 2IXJA 4WM8A 3VBUC 5J36A 2LW8A 4JDOA 2ZGSA 2JXAA 3AZYA 1W2AX 4XAAA 4CYDA 2VMIA 2VO5A 5LRSA 1JUIA 3PUHA 3Q8CA 4UWDA 5A7WB 5I0SA 2XHKA 1QXPA 1YQ2A 2E7QA 3J7MA 1FPN3 1XE7A 4YW4A 3LPGA 2HKXA 2XG3A 4UFJA 3TRSB 1VBD3 2R0HA 1EV13 4GZ9A 4UW4A 4LBOA 3E5XA 3VBOB 4CA9A 3AVRA 3K48A 3X29B 1I3HA 5A7QA 5FFOC 3U4SA 3VB9A 4GMP0 4YWAA 5FKCA 3UGGA 4FTBA 1U5IA 2E63A 1HX6A 3VDAA 4YVWB 4XJAA 1YRZA 2BYVE 3JBG1 2WBKA 2J7MA 3EJKA 4FP3A 1WGPA 4HZFA 3JXSA 2GAUA 2VZ1A 3K75B 2J1SA 1XYPA 5FZ0A 1UZ0A 1V6LA 4K8FA 1K5MB 4BLIA 3POYA 3KWVA 1PK6A 3KV4A 1JHJA 1MS3A 1AR93 1F4HA 3RZMA 1UY3A 4TXWA 3SH5A 4OUSA 4I02A 1D7PM 3LEIA 5F9TA 3BIWE 4JKMA 3VHOA 5DAVA 4W8JA 3LE0A 4CXYA 1Q5OA 4AR2A 2DTWA 5I93A 2EXJA 2JDMA 4UF0A 1H2LA 2VZSA 5GLZA 1GZWA 3LA3A 4XYXA 3WNLA 1NCRB 3BALA 2CAVA 2H0BA 2YGLA 3AMMA 3C7FA 5FJKA 5EZWA 3A23A 5FZIA 2VNGA 4OI2A 1WCUA 2BP6A 3K77A 4RQPA 3ZSEA 4GAZA 5FYZA 4IEWA 3ZSJA 4A44A 2DBIA 2BNMA 2PELA 2RR12 2QQPA 3GZUC 4B4RA 1FPN1 1PZ9A 5FXWA 1VBD1 4XZPA 5LBEA 3LGRA 4OUMA 4NPMA 4IERA 5FIXA 1YQ5A 4YVSA 4YM1A 3BTAA 1S0FA 4CEWB 3R4DB 2WR9A 1MZEA 4NRMA 5FAXA 2Q1ZB 5F6LB 5GZEA 5FPZA 2A3XA 3B9IA 3N9LA 5JZGC 5BNPB 4MZUA 3MLJA 1VBC3 4PIZA 5LWBA 4YM3A 3FL7A 4AQ2A 3FX3A 3AKQA 3OY8B 4LBQD 2NYYA 2ZGRA 2BJSA 1NA1C 1UNBA 4CDUC 5LRRA 4BK5A 1KGYA 2UWAA 1ZZBA 2WQZC 2YYOA 1ND2C 1RTVA 4YGEA 5ANQA 4COUA 1CZTA 1AR91 1QY4A 4XDOA 4XQ4A 1XNAA 1OUXA 2X53S 3RYRA 1US3A 4PLOA 5BPXA 4CDXA 3NJXA 1CIYA 3D3AA 4OLLA 1ASJ3 2DVGA 3GCXA 4QGLA 1YQ8A 4FOWA 4NAOA 1ENXA 1MACA 2P3YA 2ZXQA 4AEJA 5H9QA 4Z8BA 2HLEA 1BMV1 2DUPA 1GANA 4B7KA 4BXSV 2A6XA 2DVDA 2ERFA 2VL4A 4B3NA 4INDA 4QPYA 2VTXJ 4NVPA 1FX5A 1TMF3 4H2AA 1LJ7A 1G9CA 2PHWA 1MS1A 1UMHA 5FYCA 2HWE2 5B4XA 1RHI3 3IPVB 5IWFA 4LBQB 1UIKA 3FHIB 3WP5A 4FPKA 2ARXA 2GN7A 4WM8C 3ETQA 3NAPA 1ULPA 2DVAA 3TB0A 3BPSA 5A3UA 1JUHA 1H1IA 3V0AB 3VBFB 4CRQA 3CEWA 2R0FA 2ZGMA 5FDBA 1QJX2 3N7LA 3MIEA 5IFTA 3VKLA 4WVMA 3AC0A 3UESA 4Q8KA 5CISA 1QNYA 1R1A3 1LOBA 4IGOA 4TLGA 3WZ1A 5A7SA 1H8TB 1F5JA 2FMDA 2XH6A 4OYUA 3DPRA 1DQ5A 1VBC1 2VULA 3ZFEA 4RSUA 1HV0A 1WA4A 5BV6A 4EN6B 4BIFA 3MF6A 4DQAA 5FK8A 4YGCA 5A1AA 1GZ9A 4AVSA 1OD5A 4N90A 2PN5A 4TN7A 2W52A 1FMD2 2OX0A 2ZX3A 2ZPXA 3VBHB 1JOPA 3QACA 3Q9OA 3URFA 2OPKA 2BDRA 2VZUA 2EICA 1IQAA 1DYKA 1PK6C 1UU4A 2RDSA 2EAKA 3J8F3 3PDQA 5JUVA 4A6OA 3FC0A 3IMNA 1DGLA 4JGYB 1YFYA 5BNOA 1ASJ1 4F83A 1F8VA 1J3QA 3HNMA 1DQ4A 1LNSA 4OMCA 5L9VA 1YLLA 2QVSB 2V4AA 2A6ZA 2ZGNA 5J1XA 2BW8A 4L97A 2WLPA 1TMF1 3ZYJB 4NMIA 4JTNA 1KD7A 3KF5A 3WDXA 1R093 2BUKA 4YZ1A 5KBFA 2BRTA 2EALA 1EV12 5CKQA 3U0ZA 2FDGA 2H0VA 2D98A 1UY0A 1UYYA 1UX7A 5DDJ3 3CO2A 2W87A 3KT7A 2ATFA 5I0UA 3ZMNA 1HB2A 2Q8CA 3ZYBA 2AR6A 4RQPC 2YPDA 4ZXKA 3POJA 1CWPA 3NO8A 4ZY9A 1FI2A 2A70A 1YWKA 5FZDA 3NSTA 5FUIA 5IAXA 3ACIA 1D0GA 1FNZA 1REEA 2J22A 2W39A 3H3LA 3IAQA 4IEYA 4LULA 4MXWB 4R9DA 1W04A 2QQVA 2YROA 5FYMA 4ES8A 4HPKA 5E8AA 4LLFA 1R1A1 4R9BA 4YVSC 5EQUA 3PU8A 4GWJA 1GU3A 3B7MA 4GIQA 3N9OA 3U78A 3FLPA 4ZKTB 3GYDA 1Y7BA 4D7YA 1W8TA 2QKDA 1DLCA 4M4PA 1SPPB 3AMNA 1NLQA 1OA2A 2VMFA 4QQLA 4AW7A 4K3UA 1Y3TA 4CDWB 5A32A 3O1SA 1Y9QA 2HWC3 1S55A 1UOJA 3CHXA 4RHV3 4I0WB 1GQHA 2HYKA 2XUEA 1GYKA 3O0XA 3ECQA 4KI5M 4XACA 2VTFA 3MO4A 3SKVA 4P02B 4ZU4A 4EN7B 1W28A 2Q1MA 3J8F1 5E6HA 3CU7A 5KWRA 3VGIA 2XBO3 4CPBD 1E5IA 2Y0OA 5JXHA 4LOTA 4CDXC 3L9JT 4OZOA 5J09A 2XMLA 2PAKA 1CIWA 5I0DA 2B39A 2W92A 3OUJA 1YI9A 4XFIA 1FATA 1UKGA 4CSWA 2IZWA 2CGNA 3AXDA 1JU3A 4LJHA 5FZ9A 5HV4A 2DUQA 2VBPA 1AYN2 4HG6B 4XILA 2XDVA 5I8YA 2OXBA 4BISA 4RFT0 1ULCA 4OI1A 1SBDA 5F2SA 1R091 3TAYA 1H4HA 1ND3B 3H1YA 3BKZA 5DDJ1 3FN9A 4PJYA 1U0AA 1S2BA 1Q8OA 3SHRA 4QKDA 3ZDVA 2BTVC 4BQ2A 5LY1A 3JCIA 3LDKA 3NAPC 3KV9A 2D6OX 2JDYA 3H42B 3LSEA 2JECA 5BNNA 2DCZA 2G19A 2WNEA 2ZHNA 2BOIA 3OD0A 4IL7A 4Q4X2 5FK7A 2GU9A 2WSVA 5L36A 2MEV3 3A0NA 2AEZA 2ARBA 4H7MA 3VBSA 4Y1YA 4HETA 4Q1RA 1GQGA 5FMDA 3WF2A 3EMRA 4F8AA 1XNDA 2CDPA 3V56A 1WD4A 5EJZB 1UD1A 5F6KA 2DCTA 2BV4A 5HCBA 3DPRC 3ZFEC 3ZMOA 5FZBA 5ACA3 3ES1A 1KJRA 2VMGA 1XYNA 5FPBA 2XVKA 1F2NA 3O5SA 2HWC1 3GJAA 4RHV1 5F32A 4JZRA 3HOBA 5FR3A 3I49A 1RUD2 4GD4A 1O59A 1N3OA 1DYOA 2PTMA 5EPAA 1N3QA 2A73B 3USSA 5DN2A 3LA2A 1TMF2 3I59A 2XBO1 4Q27A 4WBBA 1AXYA 2GC2A 5IVBA 3VZJA 3D4KA 3HNYM 4CTEA 1RHI2 5A80A 1UPSA 1YCIA 1YXWA 2QUOA 1RXFA 3PMEA 4YGDA 5BNOC 2OA2A 3AKSA 2FQPA 5F3GA 2YC0A 5LCWL 2B4KA 2ZEYA 2XJQA 4YZ4A 3I3QA 3FBMA 1BHGA 1Q8SA 1AYM3 2R32A 3T30A 3M4FA 5A1LA 5FPXA 5C7GA 2JKXA 1I5ZA 1LOAA 4XCAA 5FYTA 5C4WA 4D8MA 2DFCA 4XF9A 3OUHA 3WD5A 3SC7X 5GALA 5JI7A 2XWBB 3I3DA 2PLV2 5A33A 1CAVB 1I9RA 4W4ZA 3ZN5A 3WHUA 3WNPA 5BUVA 5HXMA 3DEMA 1UL9A 1MQTB 3H50A 1ACCA 1GLHA 4M0NA 3O1MA 1UYXA 1IKQA 2R49A 1F9KA 5IAVA 2RS33 4QGMA 5LA0A 2WWJA 3GBWA 4DXZA 4HK8A 4WM7A 3J8F2 4RYDA 2V73A 1PO12 3UT0A 4AF9A 5ACA1 5DZEA 4CCJA 4XFBA 4JKKA 2RM23 3E97A 4GKYA 2SBAA 5ABJB 2G4IA 3PVNA 1WMDA 3CJIA 4UFMA 5FMCA 2ZGQA 5SV8A 1NKGA 5C9AA 3ASIA 1QJY2 4OHYA 4R9CA 1XE8A 2XHNA 2Y6JA 1Q8PA 3OG2A 3MUZ1 4IGPA 5FQ0B 4YW7A 3ZLIA 4C0HA 5G04L 2RVAA 5FRAA 1K5JA 4BQ1A 2JE9A 5CBLA 4MH0E 5DMYA 1JZ3A 2X5IB 1N1YA 3J4UH 2ZBJA 4EV0A 3ZXLA 4CEYA 3RZGA 4KWJA 3I3MA 1ZVFA 2NLRA 4DRRA 3MW4A 3AMPA 4CUBA 1POQA 2P34A 2WT0A 4N43B 4OFGA 1RINA 2VPVA 5DUWA 1S4CA 1XYOA 3WDWA 2R6QA 4QQOA 5FY4A 1VP6A 4EN8B 1ULGA 1P8JA 2VW0A 5EJ1B 1LHOA 1YC61 4XFAA 3KS7A 4JHZA 4IEQA 2XVLA 2JKBA 1IS3A 2EA7A 3KGLA 1AYM1 2WO2A 3PVBB 1JYXA 1J1LA 3G7DA 4BE3A 2R063 3KHCA 1JYWA 3FZ3A 5JR7B 3I97A 1X50A 1RUC2 4QT6A 4BQWA 1NY72 4HOOA 3GDBA 1COV2 2CYFA 1XNTA 5BNNC 1A8DA 2Z5WA 5T3NA 3CZUA 1LODA 4LE3A 3K46A 4EJRA 1CAUB 2P5BA 4MGTA 2TBVA 5JPMB 3TEXA 5FY1A 3ELNA 1AR63 1V6IA 2JG9A 3KCCA 3VBSC 3VD5A 2R072 3ZXJA 4NIAA 3UJQA 2VMEA 1YUDA 2RS31 1BZWA 1JHNA 1JS9A 1RUI2 2CY6A 2WFF2 3WNXA 1XSQA 1DZRA 3T0DA 1Q8QA 1ZBE3 2RM21 4HFSA 1J83A 1DG6A 3LIGA 3JD72 4GXLA 4UFLA 2XXZA 3IB3A 1EPWA 5F3IA 1TME3 4CCKA 1NX9A 2LM3A 4IEXA 5E89A 5JPNB 3OCPA 3KQ4B 3BPZA 4COZA 4Q5OA 4FPEA 3BGAA 4P9YA 4QGNA 4R4ZA 2YV8A 5KC6A 2CU5A 3I4IA 3MPPG 5DAPA 4O9GA 4OI4A 4U2AA 3PURA 5FY0A 5EWSA 4XE9A 3W20A 1PM7A 1OVSA 3WDYA 5BY5A 5FZCA 4FP2A 2LUWA 3W59A 4BQYA 3I2OA 2B46X 3TN93 1HQNA 1QGLA 2RMU2 3E5QA 4XF3A 3LDBA 4BWOA 3T4HB 3QH7A 5C5UA 1JODA 1IPSA 2BVBA 2IXIA 4QPIA 2XJTA 3RVHA 4FXGB 2MEV2 3VKMA 2R061 5C8WA 2BFUL 3ACLA 1AL0G 4FOQA 3NJYA 3W5MA 2XR4A 3M3EA 4JTOA 5C4WC 3NW4A 5DG2A 1WUVA 3BIEA 3ZYRA 4QQ2A 1VMFA 1RC6A 1JBCA 3LB9A 3NV3A 4IEOA 1WW5A 2NQYA 4K7JA 4L99A 1H2MA 1CZVA 1W3VA 1GOHA 2W1UA 5I0RA 2HBTA 4XFFA 2DYCA 3MZHA 1W6NB 5FP8A 1EUUA 1UQXA 1AR61 4MYEA 3CBNA 4NHKA 4XCBA 3SNMA 4FPCA 1HV1A 3DYMA 3OEAA 4XF4A 3ZN4A 2UYBA 2RS12 5IK4A 2YMZA 2VOTA 3T09A 1V00A 1ZZ8A 4PI2A 1JI6A 2ZKLA 1IG3A 3WDVA 1UY2A 1POV1 3ILRA 4PIYA 2Y38A 1ZBE1 3A4UA 4CP1A 4WM7C 1OD3A 3RYKA 1ENRA 1TME1 3PUQA 4CCLA 1J3RA 2D3RA 2RDQA 3MV11 5GKAC 3WUDA 3CJIC 5C9AC 2Y6LA 1W06A 1QEXA 4CU8A 2NP0A 1WCQA 2XLFA 3ATGA 3HT1A 2PFWA 3OPWA 5FO8B 3ZKYA 1VAMA 2Q0AA 2QQMA 4JCKA 3AP9A 1SDWA 5FZ4A 4K21A 1U5XA 5AC92 4CEYC 3I2FA 2VE1A 2B7YA 1OF3A 4S2GA 3TN91 3POSA 1LU2A 2RDNA 5DPNA 2E6VA 2V72A 5KHJA 3BOPA 2BGPA 5BXXA 1ALYA 3NV1A 1POV0 1D0HA 4DPNA 4PQQA 1HN1A 3I7DA 4FO9A 2B9VA 1XNCA 3R05A 4KU7A 5C8CB 1JYNA 3ZN6B 3NWKA 1ST8A 2XJUA 4IEUA 5FV3A 2HWD2 3WCRA 1CQ9A 4Y22A 4KGQA 1AUYA 4AHXA 2ZX2A 5M0TA 4QDSA 3NNMA 3VD7A 3ZIWA 2ZHKA 1JMUB 1VMJA 3WVJA 5CG9A 2Q8EA 5A6QA 3VDBA 5LEKA 1ZA7A 1MZFA 3WCSA 1PZ7A 4LBNA 1NOVA 3H3UA 5HPOA 1AX0A 1MS8A 3ITQA 3N9QA 5J37A 1XB9A 1CONA 1RMU2 5KR7A 1J3PA 2Z2SB 2W1SA 4D3WA 4DEQA 1NCRA 2JG9C 3AXEA 2XQXA 2IXHA 2YGMA 4TLFA 2VZRA 1OA3A 1WKYA 3DN7A 5FYIA 1UOGA 3UGHA 5GLWA 2WS92 3MV01 4LHNA 3T1MA 5LBCA 1DFQA 1W9TA 3PL0A 1W90A 4AOCA 2QQUA 1WCKA 5E1RA 1ZZ6A 5I0TA 5GZDA 4H55A 4E27A 1JYVA 3GALA 1WLDA 4B4QA 5C70A 1CAWA 1OUSA 4AAPA 2XB6C 4CEWA 3ZPYA 4ARYA 4A41A 5KXCA 3I54A 1O4TA 1PVC3 1MR5A 4IEPA 4JGZA 5HV0A 3E6CC 4AYUA 3QCWA 1UYPA 2B9UA 5BNPA 2R062 3MIHA 2VW2A 3N9NA 5IATA 4C1WA 2WNVB 3HIFA 4FFIA 2W95A 3N35A 2HWE3 2XVGA 2AZ5A 2B5HA 1ZNPA 2JDZA 3GHMA 2JICA 1YQCA 4FFGA 1SBFA 4O7XA 4QAWA 4QXBA 4URAA 5H9RA 5CFCB 1MZ6A 3WG2A 3JB4C 4GULA 2RR11 5DXDA 3ZFFB 3LPFA 3LFIA 4QPIC 3H1MA 4N53B 1QJX3 2QTWB 2PAMA 2PQQA 3RI8A 3U1XA 4ZHNA 4A6SA 4GQ7A 5EIYB 3FHQA 5F5AA 5F5QA 4LHSA 1LGNA 5FZOA 2ADDA 5KHKA 4LKFA 3W9AA 2UYAA 2VQUA 4H3WA 5C71A 2BEOA 5CB7A 2OZ6A 2JB8A 4QPGB 5B4NA 2QQWA 3AP5A 3SEPA 1CX4A 2VNOA 2P3KA 3PJQA 4V2VA 3RI9A 5F37A 4NN0A 4DB5A 1JZ8A 2C9AA 1W05A 4Y33A 4BDVB 5CFDB 3NQHA 1DYPA 5FWJA 5FLIA 3IPVA 1F35A 4LBQA 5A3TA 5FZHA 2YC4A 3OBTA 1FMD3 2WINB 3S5QA 3V0AA 3EHKA 3Q8BA 2IXKA 3HBKA 2QJVA 4COWA 2YFUA 5A3OA 3N7KA 5C33A 4MXVA 5JIAA 4HN0A 3DECA 4NRQA 1DIWA 3LSDA 3T0AA 1LCLA 4OVEA 5F1RA 5FP7A 2NMNA 2VOKA 3VHNA 2Y34A 3NMBA 1L7RA 1RYYA 4OHWA 3KGZA 1JN2P 1RUE2 2ETEA 3PVEA 4XBQA 1QH7A 1LEDA 4URTA 4L2NA 4E2QA 1ENSA 4QHBA 2HWE1 2FDKA 1W6MB 2PA7A 4FVVA 4LOSA 4PLMA 1SLTA 1CAXB 1G86A 1QOSA 4I3PA 5CNAA 1AJOA 4FT8A 4Q4V2 2NPIA 5JSOA 3VBHA 3ZYFA 1AL23 1GZTA 3LIHA 1NLSA 4CE8A 1O3RA 3S30A 1QJX1 3T2OA 1CESA 1GP4A 1H6YA 3S6PA 2JIJA 1BVP1 2GMEA 3J9SA 4FPJA 4UYBA 5DUUA 4BQXA 1V70A 2FDHA 1DZQA 2EF6A 2ENRA 3VLBB 1E57A 3JUUA 2JEMA 1UKRA 3TWIA 2CGOA 1DHKB 3ZSMA 4A2UA 4AFAA 2FCUA 4IGQA 3UKTA 2DV9A 1OFNA 2VUJA 4V1PA 4P00B 3NNJA 5CU1A 1HDKA 1UU6A 4Y24A 5F7UA 1B35A 4B4PA 4GWMA 2F17A 5FMOL 1NCRC 3VUOA 5ANNA 5FUNA 3UKNA 4NPLA 4EE2A 1SMVA 1MEC2 1FMD1 1XE0A 1WZXA 5FMBA 4Q4W2 3M8LA 5HI0A 4R9AA 2FBEA 3B00A 3BU7A 1APNA 3NJVA 2BWAA 2LTNA 1WD3A 1GP6A 2A3YA 3CL1A 3FUOA 3HJRA 3UL2A 2W68A 2GC0A 2JENA 2GZWA 2QE3A 3OBAA 4MXWA 1BBT2 4A45A 2KXLA 3I8TA 3KMHA 3HT2A 2P4EA 3M7AA 4CEWC 5CYYA 1BQPA 2W08A 1PZ8A 1DP0A 1QDOA 4HXCA 4JGZC 2WT1A 1AYN3 3DXTA 5SV5A 3POEA 2QQKA 3JZVA 5IVYA 4Z2AA 5JXGA 3DF0A 5BNPC 1QJEA 4HSJA 3MI8A 4NO4A 4A42A 1EV11 2DVFA 2VM9A 2WJSA 5C3PA 4CDWA 4CU6A 4FBFA 1O3QA 4XTPA 1VBB2 3OJBA 1RL3A 1VLNA 2CAUA 5A6XA 1ZYBA 3IDCB 1ULEA 2EIGA 1AL21 2ZTNA 3GZEA 5FY7A 4E4HA 3MIGA 3LOBA 1NAEA 4C91A 1HW5A 1SBEA 4XETA 2GN3A 2WAAA 2GDFA 4Q4X3 1W99A 2YXSA 4Z1VA 1UMZA 4AFDA 3R6SA 1ZRIA 4YW5A 4Y20A 4M3CE 2IVJA 3TOJA 1IPJA 1BJQA 2VOWA 1JOJA 3MF9A 3MUY1 4EZ4A 2L9LA 1YIFA 2DCJA 2B42B 3M70A 4ATEA 2I07B 2FZ1A 2ZEWA 2H6BA 2VUCA 5JOZA 4FOYA 3WV6A 4KBBA 4AQSA 2A6YA 4YW2A 1KS4A 3K4AA 4D0QA 1S0BA 4NAMA 4XDPA 4LQRA 4AGRA 1RUD3 2O0OA 4P5YA 1TNFA 3C7GA 1PVC2 1O5LA 3ZDSA 4D6SA 1Q43A 5J96B 2H6CA 3D8CA 4YW1A 2WZR2 3AJYA 3J26N 4UW5A 4YPJA 3ZXFA 4QKBA 1MZ5A 1ODMA 3I2IA 3FFQA 1AXZA 2AC1A 3IMMA 2IVIB 3KCXA 4M4RA 5A7OA 1ODNA 3ZSKA 1D4M2 5A3NA 4PF1A 2OQ7A 3CZJA 4AEKA 5FP9A 1BLZA 1AYN1 2AGSA 4EN9B 4CDUB 2R1DA 3QBQA 1QXRA 1DQ2A 2LALA 2YB7A 2ZAHA 4IV3B 4XFHA 1SZBA 3WUCA 3HVDA 5FPUA 5GZGA 3AM2A 2BU9A 2PMWB 4DS0A 4XBNA 5T50A 1XU2A 5JAXA 3KQRA 1DCSA 1W6QB 2QNKA 3OOXA 2VAUA 2JB4A 3PNAA 3VD3A 3UK9A 4KNCA 1PO23 4Q4X1 3VBHC 5C3RA 1GNYA 5EP9A 4LHLA 5HXVA 2HWF2 4FFFA 4JHTA 2HEVF 2J1UA 4RS5A 5FLHA 3T2PA 4BB3A 3V0BB 2PLV3 4AWDA 4N7IA 2VZTA 5C3QA 4QKNA 2EIEA 1EPZA 2A75A 3WXPA 5FPVA 3I2HA 1X8MA 3WEZA 4KBZA 3AK0A 1C8M2 1OHFA 5CADA 2VZQA 3IM0A 1QQP2 1PIV2 4I0BA 4L92A 4YLZA 2QFEA 1UZYA 3N7JA 5KXEA 1PO13 2WKKA 2D44A 3AJZA 4K9SA 1K3IA 2QQLA 1W39A 3TEWA 4AI1A 4OI0A 3FLRA 1B35C 1H1AA 1TE1B 2ES3A 2XL9A 2ZGTA 2Y6KA 1H30A 1RUD1 2WA3A 4X6RB 1QJY3 1JZ5A 4FTSA 4Z92B 5FYBA 5CEHA 1WBLA 5CKMA 3JB8A 1OLMA 4K40A 3CDZB 3ZO0B 4NWWA 2K0GA 4M0HA 3ZPOA 2VD7A 1Z78A 1SCSA 4Q0QA 1H4GA 1VAVA 2RE9A 4KWKA 1NCQA 4KWUA 4R8HA 1CAVA 4FPOB 4NHXA 2VUAA 4DUWA 3OF1A 1RHI1 5FZLA 5FO9B 2A6WA 3D82A 1MQTA 1W6OB 3POIA 4E8DA 1A3KA 1AL22 2QDNA 5I8TA 4Q0SA 3MGUA 4COVA 1S0IA 2WO3A 2WL1A 1W8FA 5FXXA 5CA6A 3G6JB 2RHPA 2X09A 3S5AA 2WC2A 4N7UA 4P9WA 1WA6X 4M00A 3O7OA 5EXOA 5EV7A 3M2MA 5ABJA 4XUQA 5JMCA 1OLRA 1US2A 2VW1A 1TVGA 4CDWC 4OHXA 3BOWA 4XJ8A 1LGBA 2HJIA 1X33A 2A5ZA 4QX5A 1ENQA 2VECA 1RUC3 4QX3A 1ULDA 3RMYA 3ZM8A 5FQ0A 1TG7A 1COV3 4XW3A 2R042 3MICA 3BN6A 4JDNA 3IZOA 3GZTB 1C5HA 2BGOA 1CJPA 2PLV1 2X5IA 5EFUA 1W9SA 4LEJA 3POWA 5BYNA 5D8AB 4A3ZA 2WNOA 4CCMA 4UF0B 4KMQA 1BK1A 4GJZA 3LEMA 1OOPB 1GZWB 2R073 4K20A 1B09A 3OD4A 2OZJA 2ZX1A 1NZCA 1JU4A 1RUI3 1Y4WA 1FXZA 2WFF3 4CDQB 2GC3A 4RFRB 1S0EA 4HVQA 1PO11 4RQPB 3SLIA 1DQ1A 4BZ4A 4Q4Y3 4QQHA 4AQ6A 1A6CA 2P2KA 3AP7A 3JD73 3RSJA 4GB33 2PHRA 2I45A 1QJY1 3AFKA 1UO9A 3OGSA 4HVOA 4QDRA 5LY2A 4UFKA 4BPZA 4NPRA 1HQWA 1WMEA 3AYDA 4LA2A 2QZ3A 3WG4A 4D6RA 4ZXEA 2R1BA 2RJLA 1EUTA 1UIJA 1LOFA 4EWDA 1LAJA 1CAUA 2DDUA 3NRUA 1QJU2 3TBDA 4BJ0A 4IE7A 4AI2A 2VMCA 1HRI2 2RMU3 3K3OA 4PIXA 3JQXA 1AR82 1CZSA 3H8RA 4I2OA 2OT7A 4I0AA 4EYUA 4LBKA 2JIGA 2HYXA 1MS5A 4XVHA 1QDCA 3VBOC 4MOAA 3VKNA 1OI6A 2J42A 1W9FA 2JG8B 2PHUA 4NRPA 5CVRA 3ZYIB 4IE6A 2Y6FA 1RUC1 2KD7A 1NY71 4JRAA 1COV1 1VMHA 1G9BA 3NL1A 1W2TA 5FLJA 1QH6A 4CP9B 1W3XA 1S2KA 4G3YC 4RS5C 5CAZA 3AYEA 3WT3A 3QLQA 4RR3B 3WINE 4O9EA 3LOIA 3BCWA 5A3WA 4TWTA 5C3SA 1K42A 3CLPA 4QWNA 5IT6A 2R071 4FOVA 1GSLA 4UW3A 2RS13 3ZYGA 1OKOA 4QQPA 5FZ6A 1LULA 1RUI1 2WFF1 3OGGA 3VBRB 4CUAA 4DUVA 5IK5A 4LK6A 2J1VA 1VRH2 3O0VA 4PI0A 1OC1A 1SLCA 3VDDA 3ALQA 3B02A 3EBRA 3NAPB 1NG0A 4P9XA 2VY0A 3JD71 4YNIA 4DUXA 4K6BA 3ILFA 4GB31 3ZFGA 2YG0A 3R4UA 3HWJA 5K0UB 5IJRA 2VVEA 4FTEA 1QHDA 2OS2A 4MGZE 5C6CA 5F5CA 3SH4A 3VD4A 4RA0A 4WVMB 3DCQA 3WP6A 1KQRA 3OBRA 3K2OA 1GV9A 4Y1UA 3I2JA 5KXBA 1IHMA 1LOEA 1V0AA 3APBA 4DZGA 5AC93 1NCQC 1SDDB 1STMA 4HANA 1S2EA 1HB4A 1W6NA 2UWCA 2UU8A 1GICA 1HXS2 1BVVA 1C5IA 2JJ6A 1MQTC 2RMU1 2Y26A 3LD8A 1PO22 4YM0A 3FBYA 2AUYA 4XFGA 1FNYA 1VBE2 2MEV1 4LUMA 2IXLA 3D6EA 1Y9MA 4NOTA 2HWD3 3GJBA 4ZU7A 2ZZJA 1Q3EA 1RUH2 3IDBB 5ABJC 1CR7A 1W8NA 1LHUA 4XZUG 5L7OB 3HNBM 2ID4A 4FXKB 1TEIA 2AREA 1S0JA 4BM8A 1KDKA 1W8ZA 3C2UA 4QX1A 1ZA4A 4MG2A 3GCWA 1GZCA 3K4ZA 2GMMA 1LESA 3MIDA 2X5IC 2XGXA 3N36A 5LK5A 1RMU3 4LO7A 5CIRA 2RS11 2W0XA 3IDAA 2WT2A 4UBHA 3Q8FA 4IXLA 1YEWA 3MHZA 5FXZA 3RWKX 4AVVA 1H9WA 4BXFA 2VVDA 1SHWB 2LRPA 1QNWA 3WP3A 4LMFA 4XJ9A 3ON7A 2DURA 2VQ0A 5C8CA 2Y64A 1T6BX 2WS93 4BMBA 5JIUA 5HCFA 1CPNA 3ZN6A 4XC9A 3LFMA 1Q56A 1UXXX 2OUHA 3L2HA 2TUNA 3WHTA 4Q29A 4RGKA 1JZ2A 1DDLA 2A6VA 3USUB 1QXJA 2WZPP 3KSCA 1I6XA 4KL1A 4IQPA 2DUOA 4LHKA 2GP5A 4LT5A 2HWB2 3OPTA 5JSPA 3KM5A 1HRV2 1CD3G 5AC91 2VBDA 4LKDA 1RITA 5JR2A 2DCKA 1LOFC 1NXMA 2ZHLA 3P5BA 3KZ4C 3NNGA 3UNPA 2CV6A 3OGVA 3SITA 2WNUA 3I2GA 3WY6A 4AL9A 4A7ZA 2V09A 2ARCA 5JOYA 4IV1B 2C0ZA 2ET1A 4TSVA 4YZ2A 4JQTA 5A6ZA 1C3HA 4CUCA 4DINB 4CP2A 1N1TA 4Y5Z0 4Y3OA 2A71A 2HWD1 2Y60A 1VBA2 4QM9A 4YSFA 2CNAA 5GLVA 1W6PA 3KCYA 2RJ2A 5J7MA 5LEJA 3I2KA 2O8QA 4E2GA 1W8HA 1IKPA 4FPHA 5KHGA 2ZKNA 3ENRA 1C1FA 4RGGA 1OFSA 4Q4Y2 3FE5A 4UBGA 1RMU1 4YG0A 2JWPA 4GB32 1NT0A 2D6LX 5A7PA 4LO6B 2WNVA 2BZDA 5D1IA 4ISQA 1XNKA 3GM8A 4SBVA 1W9WA 2ZGPA 5FZAA 3WSOA 4YRDA 3RDIA 3ZXKA 4EROA 2GP3A 4MHUA 4QMAA 2WS91 2XWJB 3IAPA 4I30A 4OQ9A 3VDDC 4Q0UA 3CKHA 2PQSA 3ZFFA 4CXXA 2PYTA 4LKEA 4D6QA 3ZFGC 5FREA 1OQDA 5F3EA 2PXJA 2WLQA 2C1FA 4GWIA 2X29A 2VNRA 2ET7A 3WQ7A 1RIRA 3EQEA 4LA3A 5FZGA 3SMHA 3VBSB 4AI0A 2IUWA 1HJFA 3AL5A 5A3PA 1RUE3 4AFBA 4D94A 1SQ4A 4HONA 4PCRA 4META 3E6DA 1O3TA 2BNNA 3Q8EA 3W58A 4LR4A 2VBBA 3NV2A 2RG4A 1ZZCA 2ZMNA 1YYNA 5DQ0A 2EXKA 3HR9A 5H9SA 5AFEA 1PMIA 4H7LA 3J7NA 1A34A 5T52A 1VB2A 4AI9A 2GH8A 3ZVXA 4Q4V3 3U14A 1OQ1A 1F4AA 1M06G 2VXJA 1RUG2 2PHDA 2K2SA 2VR4A 5FMOS 3ACFA 5FTTC 4IETA 1E5SA 3BTYA 4HN1A 4AHYA 3M3OA 2WSUA 3I59B 1PNFA 1QOTA 2G1MA 3MFCA 2JD9A 4AK3A 4BQ3A 4XAEA 4XTMA 2CHHA 3K51A 4DMIA 2OYZA 4E4SA 1S1AA 3V65A 2RV9A 4AZZA 3T2QA 1AXKA 5A7WA 2DCYA 2VOVA 2YPJA 4Q1PA 3N9PA 4YARA 1YI7A 4X8NA 2VU9A 4L0PA 5EJ3A 5JOXA 1CAXA 1PNGA 1W2UA 1MEC3 2ADEA 4YM2A 1GNZA 3OYWB 4Q4W3 1H9PA 1JYIA 5C4WB 2J1TA 5C8CC 2KR2A 4FSJA 1WCDJ 3BVCA 3T3YA 4CZSA 4YVWA 2ZACA 4AGGA 2O14A 4FPYA 2UURA 4Z07A 1H1MA 3KV5A 3SEEA 1BBT3 4LITA 1K45A 3WNMA 1UY1A 1IPKA 2VCBA 1RUE1 3B3QE 2XKPA 5FPAA 2E26A 2XOMA 1K5MA 5IVCA 4ZPIA 4QB6A 3WNOA 3BODA 3RNSA 5B2GB 1ONAA 1BYHA 1YHFA 4A4AA 1IZ3A 4HL0A 4FPFA 4XJUA 2VCAA 2WNUC 4ZU5A 1F15A 3WDUA 3N4MA 2W46A 1VBB3 1WMFA 2ZZQA 3RJ2X 4Q4V1 4D7SA 2HEYF 5DZGA 3IBMA 4DY3A 1MS0A 2V4VA 1FOD2 2Y33A 2ZGLA 1EAH3 1KXGA 1PMHX 1BEV3 1ZRRA 4GKXA 2OW4A 1RUF2 2YBKA 3MW3A 4WVVA 4CCDA 4XFCA 2BBAA 3ETPA 2IXCA 5FY9A 2IWGB 1R1ZA 1Y9GA 3HPNA 4ZS3A 4BOWA 2W47A 4LKSA 5FYHA 1S0DA 4CEYB 2FMYA 4XF1A 4O65A 5T5OA 4RGAA 1XRUA 2VNVA 5EYXA 5A32B 3WQ0A 1A78A 2Z79A 4MO3M 4AVTA 4JV4A 5A3LA 4ET7A 4QX2A 1PGL2 4M3CB 3TEZA 2WZ8A 4G9SB 3MLLA 2D97A 2ZCWA 5LASA 4NIHA 4QM8A 2EAAA 3VHPA 4EWEA 3H3ZA 2WNVC 3PLQA 4MVTA 5JVVA 1G7YA 1MEC1 3I2DA 5GLUA 1OBNA 4B1LA 3OGJA 5FZEA 4Q4W1 2Q8DA 2ZEXA 2YY1A 4UW6A 1J59A 5GLTA 4J1XA 5A3MA 1O4ZA 3T4VA 3H0OA 3ZFFC 1NYWA 2WZR3 3F95A 2R7EB 3RYPA 1BBT1 5FYUA 2PHXA 2QQNA 4GMP3 4S2DA 3OY8A 2R16A 4NWVA 3RG0A 4AVBA 2QDRA 1D4M3 2J1RA 3F2ZA 4AFCA 5GM0A 1OVPA 4KGGA 2WWUA 5DUVA 2D5HA 1RXGA 4Q26A 1AR72 4ISRA 2EXHA 4KWLA 2VZOA 1IS4A 1WBFA 5FBZA 3HEIA 1LB2A 1VBB1 4UT5A 4K1YA 3WW4A 5KHHA 1UN1A 3FFZA 3N9MA 1PX3A 2C9KA 4PDWB 4YG3A 4HBNA 1EAH1 1HB1A 4N9IA 4ZS2A 1AVBA 1J58A 2D6MA 4PBOA 1CJDA 2BGCA 1RUJ2 2DBNA 2HWF3 2GSYA 4XHBA 4DNYA 3EXUA 4JAAA 4P08A 4AXOA 1VJ2A 1IOAA 3M3CA 1SFNA 3W5NA 3E6BA 2FCVA 5J98B 1C8M3 2FCTA 3LKJA 4OQ8A 1VB4A 2GNDA 1QQP3 1PIV3 2QQIA 4J25A 1V6MA 2D6NA 3VBFA 4CXWA 1W0OA 1NE6A 2RS52 4IV3A 2VG9A 3OBZA 2BERA 2G9ZA 3NJZA 4QPIB 2VZPA 4P14A 5KC5A 1H2KA 3D0JA 5L9BA 1Z0HA 1PVC1 3ACGA 3S57A 1H8TA 5IK8A 3ZR5A 1SLAA 2Z4FA 3VHRA 2RDRA 2EIDA 4WZCA 1OT5A 2WZR1 1JW6A 1PVXA 1W2NA 2BVVA 4L9BA 4YVWC 2XJPA 2F4LA 3MLKA 4E9KA 3ABZA 3KD4A 1ULOA 4FI9A 1DLLA 4G4FA 4GMP1 5FBJA 5T54A 3WR0A 5IVVA 1D4M1 3O12A 1DGRN 3O14A 1LEMA 4H14A 4Y26A 1OURA 2F4PA 1BCXA 4IEVA 4LO5B 4NUBA 1JH5A 2B45X 1UX6A 5E88A 4QXCA 1K5MC 3GBFA 3N7MA 2E33A 1QKQA 1GQPA 3M3QA 4GH4B 4W6YA 4COYA 4AE2A 5IVEA 2VZ3A 3B94A 4HK9A 2WIIB 4JGYA 5K8SA 4QD2A 1QF3A 2DFBA 3ILNA 3ZXGA 4AEDB 4XMAA 3T0BA 3NNFA 2JE8A 1IGOA 2XPJA 2D7FA 2VC9A 4BU2A 3VBUB 2HWF1 2R043 2Y6HA 4KG0A 1OKQA 1YFUA 3WNKA 4LPLA 4L11A 5F8PA 1ZX5A 4DY5A 3VZKA 4Q8LA 1KITA 1WW4A 3KV6A 4NR1A 2W1QA 5ERLA 1T6GC 2ZMLA 4BHPA 4L8QA 3EO6A 3O1OA 2AEYA 1C8M1 2W5FA 1R64A 4QXHA 1W6OA 4W6WA 4I01A 2HEWF 1Z7S2 1QQP1 1PIV1 3U37A 5BNQA 1HB3A 1ZBA2 2D40A 3Q8AA 1SACA 3SQOA 4IE4A 2A7AA 2LROA 1XSRA 2VOXA 1LECA 3HN3A 3PUSA 4LXLA 1V6OA 2WA4A 1ZZ7A 3RRDA 1W03A 1AX1A 3MIFA 2I2SA 1QOOA 4IESA 3EYPA 2MNGA 4TZDA 1WW6A 2Q1FA 1QJFA 2OUJA 4UAPA 1SLIA 4Y22B 3RZJA 2AYHA 3B01A 1BXHA 3AMHA 2JDAA 5LATA 2VCCA 3O1VA 1QWRA 2Q8OA 4ATFA 1CX1A 4LBLA 4EZHA 1LU1A 4BYYA 1G9DA 1EY2A 1SPPA 5D8AA 5FP4A 3IDEA 5L73A 1QJU3 1RVF3 4OCTA 4V2WA 4XBLA 2C5DA 4OZXA 1ZRCA 3O1TA 3T2TA 1OOPA 1HRI3 2WDBA 4XHXA 4DXTA 2JDKA 1EAH2 1BEV2 1AR83 5FYVA 1KFXL 5L19A 1QJZA 4K1ZA 4LO4B 4CDQA 1DQ0A 2VMDA 4KU8A 2DF7A 5AFBA 5JLVA 2X10A 1GWMA 1U12A 4Z82A 1LKNA 4AVAA 1L3JA 3ZYHA 2GMPA 1U5ZA 4JX0A 3SCHA 1GBGA 1WLWA 3GNEA 1NXD1 3WF0A 2WAOA 2GNBA 1CAWB 2R041 4CP0A 5F3CA 1G9AA 2FDJA 5FY8A 4S2HA 3PTRB 4RN5A 1SCRA 1UZWA 5IFPA 4JGZB 4NIGA 4LIVA 5FYYA 1ND3A 5FZFA 3O0WA 1RUOA 3UGFA 1O5UA 4B8EA 2W94A 2JDUA 3U07A 2BQPA 3D5OA 4KQ7A 2E51A 4MGIE 2X05A 1OXCA 1VRH3 3AKTA 4W6XA 5FPLA 4X8PA 3VBFC 5GZCA 1RJ7A 3K3NA 4S2FA 2TNFA 4QHZA 4QHOA 4IV3C 4Y4YA 5JZGB 4CPBA 3UV9A 2JG8A 1Q8VA 1YJLA 3TNQA 2V5YA 4AFMA 3JU9A 3AZWA 4JDMA 3B9CA 1UOBA 3THCA 4LE4A 4M3CF 4P9LA 1A8MA 1O8PA 3I3BA 1H8TC 3RZKA 1GWLA 1NA1B 1C1LA 3ZSLA 5FZOB 2WYFA 4Y4RA 5T5JA 4CP9A 1FV2A 1ND2B 2UWBA 3H1WA 2VJXA 2B8MA 1QJU1 1RVF1 4RR3A 2CGPA 3MIBA 1W0NA 5CG8A 3H9AA 2PHLA 1UU5A 2P17A 4O61A 3UKVA 1HRI1 1HXS3 3LF7A 3POGA 4ZZ8A 3MDPA 4MSVA 1AR81 2A3WA 3VBRA 5KHIA 3ZIXA 3GGLA 5JMOA 3BTZA 1J84A 1OH3A 5GZFA 5T55A 1UCXA 2CWSA 2E7AA 1VBE3 3WOGA 3WF1A 2LS6A 1IS6A 2QBXA 1DBNA 1GR3A 1LHVA 2MPFA 2OVUA 3IT8A 1UMIA 2OPWA 3PTYA 3A0KA 1RUH3 3KHBA 2RJKA 4JGYC 3TYJA 2WABA 5K0UA 3ZX7A 2BBVA 3KLSA 2VGDA 1X8EA 3FJSA 3JBG2 1NQDA 3UETA 1YIPA 1UZVA 4WM8B 4Y5SA 2XLAA 2DWRA 4XQWA 2PAEA 3A22A 4XQDA 4YZ3A 3KT4A 4XUOA 5GJ6A 5LK7B 4BQ4A 2WFPA 4CU9A 5DABA 4ES9A 2JX9A 2XQRA 4ZZ5A 4FAHA 5A6YA 5JXIA 1G8WA 2R30A 4WVWA 2FDIA 2VH9A 3BYWA 1VRH1 2G9FA 5LA1A 3DYOA 1CN1A 3T08A 3H7YA 4R4XA 3C3VA 1KS5A 1X36A 2XLGA 1WMXA 3M3IA 1MPXA 4MLOA 4AI3A 2VTXA 5L7OA 4AI8A 1U5YA 1F31A 3LZZA 4IE5A 2HWB3 2I74A 2K46A 3INAA 3J7HA 2XKOA 3RS6A 1HRV3 2W2IA 1W8WA 4XF0A 4UXAA 2JDHA 5F39A 5FZMA 5LBBA 2ZGOA 5FZ3A 3NKGA 1PK6B 3P3NA 4NHMA 4UOJA 4N9HA 5D8AC 5LA9A 3CJXA 1HXS1 4ASKA 4MUVA 1N1VA 3U4XA 5FKBA 1KJLA 1FPN2 3LDRA 4FPLA 3VZMA 5EYYA 3VN4A 3WX5A 1PO21 2NZ9A 1B35B 1OOPC 3AVSA 1VBD2 3B5LB 1L7QA 4FQZA 4U36A 3ZXDA 5HBAA 5IW0A 3S0MA 2DTYA 4GJYA 2X8KA 1VBE1 4CDQC 3SISA 4PBPA 3PHMA 3BUCA 2HBUA 3PMSA 3VKFC 1RUH1 1VBA3 4N43A 5FUPA 2WYSA 1W2OA 1X82A 1XOYA 4OHVA 3SKJE 3THDA 3USUA 4BLJA 1WCSA 2E31A 3RQ0A 1REFA 1VE0A 3AP4A 1RGSA 4DO0A 3CF6E 1LENA 4HKWA 2CWMA 1V6KA 1IG0A 2XUMA 4P9JA 4RD7A 2Q30A 5G05L 3O1RA 3OSDA 4XEZA 1TZOA 4B29A 3PVOA 2VXRA 1JOBA 4XJWA 2CSGA 1ND3C 3ZXEA 1AR92 1R083 4FQ4A 3MFAA 2Z69A 1JZ4A 4DEVA 1RB8G 3V64A 4TYSA 3ZOIA 4IV1A 4MADA 1JYCA 1UWWA 3DKWA 4P9IA 4YVSB 2G9GA 3RFRA 3ROUA 4NIDA 4EQVA 2BFUS 2C26A 4CUGA 1XXNA 1T2XA 3AFGA 5FWEA 4QXKA 5JI9A 1BMV2 1I5PA 3ACHA 1RVF2 1HLCA 4PT6A 4CCCA 2JG8C 2J1AA 1O4YA 2QQJA 1O7FA 4ITCA 1JXNA 2YFZA 4Q0VA 4Y20B 1IQDC 2HWB1 3SCGA 2BOJA 3VZLA 3DYPA 1HRV1 4QX7A 4F3JA 3HBZA 1OF4A 1SLLA 5T5LA 4DOUA 3RZHA 4LTAA 1V6NA 3P6BA 5JDBA 1WW7A 1LR5A 2VCMA 4QKFA 4RR3C 3GBGA 5H9PA 3MBWA 4NE9A 1O8SA 4CDXB 4MGQA 4XJZA 5J48A 2N7GA 3AL6A 1PX4A 1MS4A 2WUHA 4NJ4A 5JSRA 2YBPA 3VBRC 1NUKA 1YFXA 1RUG3 1LHNA 1MVQA 2CTVA 3LWCA 5FP3A 2KA3A 1UPIA 2WN2A 2DU0A 3B69A 3GZAA 5DAXA 3WG1A 1VBA1 2FZ2A 2UY9A 3EB7A 4MHRA 4YW6A 4XDQA 2Q5TA 4Y1ZA 3H8OA 1VBC2 3AP6A 5K0UC 1O3SA 2FHRA 3HQXA 4LLOA 3RPQA 4EN0A 1G9FA 3OEBA 3WW1A 4I09A 1OQEA 4LNVA 4YFZA 1V6JA 4Q4Y1 5T5PA 3RZZA 1UYZA 1V9U3 3OTFA 4Y5TA 4AHWA 2P3IA 2Y6GA 1R081 1YO8A 1PHMA 1LTEA 1AX2A 1YQ6A 1HN0A 2J1EA 1UAIA 3A21A 2AH2A 3FLTA 2ZJCA 3U11A 1HJGA 2SLIA 4B1MA 3MW2A 4FCAA 3R0RA 3VL9A 4R52A 4TTGA 2C24A 5KXDA 5HCHA 5IUQA 1D2QA 1ASJ2 1REDA 1C57A 5FYSA 5FZ1A 3WLUA 5EHDA 4WV8A 3DPRB 3AX4A 3I3EA 3FUQA 3ZFEB 2BPA2 4RS5B 1CGPA 3WP4A 3A7QA 4HSLA 2P37A 2QQOA 2NN8A 3CNAA 2ZS6B 4C1XA 1SEFA 4BCUA 5L7OC 1DGWX 3J7LA 4IUGA 5K4LA 1PGSA 2XJVA 5CKNA 4UFHA 3AZVA 2GALA 4YFWA 4HVRA 1NE4A 1FV3A 3VBOA 3MEPA 3ZYPA 3PIGA 1XNBA 5C3OA 1VR3A 3AKRA 4GWNA 3TEYA 1GKBA 3C8XA 4ASLA 5BNOB 4CVUA 2ZA9A 4K8RB 4N8MA 1FOD3 4YGBA 1RUG1 3OYWA 4JVAA 1R1A2
chains in the Genus database with same CATH topology
4C0BA 1RUF3 4J6GA 3ST7A 3VV1A 3DL3A 3L2YA 4LO8A 4Q2FA 4A7KA 3AB0A 2GNMA 4X6QB 4HKLA 3IIAA 4N43C 1NCQB 1ULFA 1UZZA 4DFSA 1LHWA 1F5FA 4XXPA 1WLCA 1ZZ9A 5JCTA 2D93A 2ZGKA 4SLIA 4BA6A 2D5FA 4YYOA 1V9U1 1ZREA 4W65A 1AJKA 2ZAAA 1D2SA 2F6BA 4I3GA 4P9GA 4Q0PA 5E16A 5CADA 2NP0A 3DGTA 3RMXA 1W0PA 4IV1C 3HD8B 3SH3A 4HPKB 5K9YA 3RWNA 3KB5A 1DZTA 1UF2C 2ZOEB 1KDMA 1QMJA 2ZX0A 4C90A 3QD6A 1J1TA 1S0GA 4GA9A 3GF6A 2GNTA 1R092 4BH9A 1MS9A 2EVXA 4DRVA 5DDJ2 4XPVA 4E4ZA 1KRIA 4M3CA 1CVNA 1S0CA 4Y1VA 3IN9A 3S7EA 2NM1A 5JOWA 2BNOA 2PHFA 1AR73 2PHTA 3AZXA 2E7TA 3N3HA 1OPMA 3NKTA 1XQNA 3HAGA 4XXAA 1TQ5A 1MVEA 1FOD1 1OLQA 1RUF1 4A3XA 2QCSB 4LUKA 2YDEA 1RUJ3 3LAGA 4MGKE 5DG1A 2GH2A 4P5HA 4YG6A 1R082 2IC1A 1G6NA 3THTA 4HT1T 1UW8A 4F7ZA 5IK7A 3GHNA 5HCAA 4ORFA 4AEMA 1FT9A 2CL2A 1PGL1 2HWC2 4RHV2 5CFCA 1QU0A 1GFF2 3D0SA 1SLBA 3WG3A 5BNNB 2D3SA 2RS53 4N53A 1FYUA 1RUNA 3VZOA 3WQ1A 2YHJA 4PQ9A 4A7YA 4D7TA 1POV3 1DGWA 4QU2A 2XBO2 2NMOA 2QZ2A 2D6PA 4PDWA 4JQRA 2GC1A 4XOGA 4MGYE 1AZDA 4QPGA 5J3UA 2ILMA 1TNRA 3SCFA 1DQ6A 1URXA 3IKWA 3M1HA 2E9QA 4ONUA 4Y1XA 5DZFA 1H2NA 3KT1A 5CFDA 1FAYA 3PJYA 5AVPA 4YW3A 4MX3A 2MHFA 5AVAA 3H8UA 1O91A 4JRLA 1AR71 3U10A 2JD4A 4BIOA 4HKOA 3VDDB 4YZ5A 2IFRA 4NHLA 3ZFGB 3ES4A 2ZHMA 5FOJB 1M4WA 1LRHA 1AF9A 4WVZA 1JTZX 1OA4A 1RUJ1 2YZ4A 4JC1A 1V9U2 3VL8A 2Z42A 1H0BA 2WWSA 3QOPA 3H7JA 1ZM1A 3NVCA 1OSGA 1ZRDA 1W6MA 1PGW1 5ACA2 2EXIA 1Z7S3 3B93A 1ZBA3 1AHSA 4KG8A 2WQ4A 2RS51 4EWAA 1HQLA 4GH4A 1C28A 2D3PA 4LBMA 5A33B 2ZABA 4AEDA 4OULA 1ZRFA 4PLNA 2XJSA 4B7EA 2UY8A 1LOGA 3VBUA 2KM2A 1HIXA 4WM7B 4E2SA 5DUXA 1AYM2 1N3PA 1H8VA 2ZMKA 2DU1A 2BWCA 3CJIB 1N47A 4KH9A 1WLTA 3VZNA 5C9AB 2JE7A 1DF0A 4FAGA 1EYBA 5TSWA 5FO7B 5FOBB 4AQTA 2IFWA 4D69A 3HN1A 1N1SA 3VKOA 1IS5A 1EP0A 2RR13 1OMIA 3FMGA 2E53A 1NQJA 3AZZA 1VAKA 3E5UA 2Q4SA 2RS32 3WDTA 2O1QA 4WZFA 3WW3A 3LA7A 2D6KA 3AKPA 5K7PA 2RM22 2AENA 1Z7S1 2WNUB 1ZBA1 1Y43B 5JWPA 4AGVA 3S7IA 5CFCC 2VQAA 2P3JA 3NV4A 4HLTA 4HMZA 4N53C 4GALA 1C8NA 1CPMA 2XL7A 4AG4A 4BMEA 2JG9B 4PDWC 1DGRA 3HMYA 5I8SA 4M01A 1LGCA 1OPOA 1KFUL 1W6PB 1D4VB 2XJRA 3DUIA 4QPGC 4RL7A 3BB6A 4FPGA 1HKDA 2D43A 1C4RA 3AYAA 4E4DX 1XU1A 4ASMB 2ZGUA 3ME2A 4MV2A 2OIIA 3WW2A 1YJKA 2O8OA 5CFDC 3AYCA 2DVBA 3IWZA 1RJ8A 1BEV1 1DU3D 1GNHA 2K9ZA 1I1EA 1SFYA 4IEZA 3FWEA 2ZX4A 3UJOA 3R4SA 3MPBA 1VIWB 2VVFA 5JZGA 1PGW2 3T1LA 3OPZA 5I91A 2VMHA 4AHZA 1AR62 3JBG3 1NLRA 5FCCA 1NA1A 4CDUA 3JQWA 1ND2A 3TNPB 3RJRA 1ZBE2 4XIOA 4XIKA 4XMIA 2Y0IA 4LBJA 1W6QA 1X7NA 2YUEA 3THPA 1TME2 3P3PA 4J1WA 4PF5A 3MYXA 3ZXAC 1VALA 1YNAA 3V0BA 3AMQA 4GH4C 4OHZA 4AVCA 3QH6A 3DV8A 3LCPA 1BKZA 2TEPA 4AEDC 3TN92 1LOCA 3SXWA 4Z2WA 1YFWA 2IXJA 4WM8A 3VBUC 5J36A 4JDOA 2ZGSA 2JXAA 3AZYA 4CYDA 2VMIA 5LRSA 1JUIA 5I0SA 2XHKA 1QXPA 2E7QA 4YW4A 1FPN3 1XE7A 2HKXA 2XG3A 3TRSB 1VBD3 2R0HA 1EV13 4UW4A 4LBOA 3E5XA 3K48A 3X29B 1I3HA 5FFOC 4GMP0 4FTBA 1U5IA 2E63A 1HX6A 4YVWB 4XJAA 1YRZA 2BYVE 3JBG1 3EJKA 4FP3A 1WGPA 4HZFA 2GAUA 1XYPA 1V6LA 4K8FA 1K5MB 4BLIA 3POYA 1PK6A 1MS3A 1AR93 3SH5A 4OUSA 4I02A 5F9TA 3BIWE 3VHOA 1Q5OA 2DTWA 5I93A 2EXJA 1H2LA 5GLZA 1GZWA 3LA3A 4XYXA 1NCRB 3BALA 2CAVA 2H0BA 2YGLA 3AMMA 5EZWA 2VNGA 4OI2A 4RQPA 3ZSEA 4IEWA 3ZSJA 2BNMA 2PELA 2RR12 2QQPA 3GZUC 4B4RA 1FPN1 1PZ9A 1VBD1 4XZPA 3LGRA 4OUMA 4IERA 4YVSA 4YM1A 3BTAA 1S0FA 4CEWB 3R4DB 1MZEA 5FAXA 2Q1ZB 5F6LB 5GZEA 5FPZA 2A3XA 3B9IA 5JZGC 5BNPB 4MZUA 3MLJA 1VBC3 4PIZA 4YM3A 4AQ2A 3FX3A 3AKQA 3OY8B 4LBQD 2NYYA 2ZGRA 1NA1C 4CDUC 5LRRA 2UWAA 1ZZBA 2WQZC 2YYOA 1ND2C 1RTVA 4YGEA 4COUA 1AR91 1QY4A 4XQ4A 2X53S 3RYRA 4PLOA 5BPXA 4CDXA 4OLLA 1ASJ3 2DVGA 4QGLA 4FOWA 1ENXA 1MACA 4AEJA 4Z8BA 5H9QA 1BMV1 2DUPA 1GANA 4B7KA 2A6XA 2DVDA 2ERFA 4B3NA 4INDA 4QPYA 4NVPA 1FX5A 1TMF3 1G9CA 1LJ7A 2PHWA 1MS1A 2HWE2 1RHI3 3IPVB 4LBQB 1UIKA 3FHIB 3WP5A 4FPKA 2ARXA 2GN7A 4WM8C 3ETQA 3NAPA 3TB0A 2DVAA 3V0AB 1JUHA 1H1IA 3VBFB 4CRQA 3CEWA 2R0FA 2ZGMA 5FDBA 1QJX2 3N7LA 3MIEA 3VKLA 4WVMA 4Q8KA 1QNYA 1R1A3 1LOBA 3WZ1A 1H8TB 1F5JA 2FMDA 2XH6A 3DPRA 1DQ5A 1VBC1 2VULA 3ZFEA 4RSUA 1HV0A 1WA4A 5BV6A 4EN6B 4BIFA 3MF6A 4DQAA 4YGCA 1GZ9A 4AVSA 1OD5A 4N90A 2PN5A 2W52A 1FMD2 2ZX3A 2ZPXA 3VBHB 3QACA 3Q9OA 3URFA 2OPKA 1IQAA 1DYKA 1PK6C 1UU4A 3J8F3 2EAKA 3FC0A 3IMNA 1DGLA 4JGYB 1YFYA 5BNOA 1ASJ1 4F83A 1F8VA 1J3QA 1DQ4A 1YLLA 2QVSB 2A6ZA 2ZGNA 2BW8A 4L97A 2WLPA 1TMF1 3ZYJB 4JTNA 1KD7A 3WDXA 1R093 2BUKA 4YZ1A 5KBFA 2EALA 1EV12 3U0ZA 2H0VA 2D98A 5DDJ3 3CO2A 3KT7A 5I0UA 2ATFA 3ZMNA 2AR6A 4RQPC 4ZXKA 3NO8A 1FI2A 2A70A 1YWKA 3NSTA 1D0GA 1FNZA 1REEA 2W39A 4IEYA 4MXWB 4R9DA 4LULA 2YROA 4ES8A 4HPKA 5E8AA 4LLFA 1R1A1 4R9BA 4YVSC 3B7MA 4GIQA 4ZKTB 3FLPA 3GYDA 1Y7BA 4D7YA 2QKDA 3AMNA 4AW7A 1OA2A 4QQLA 4K3UA 1Y3TA 4CDWB 1Y9QA 2HWC3 1S55A 4RHV3 4I0WB 1GQHA 2HYKA 1GYKA 3O0XA 3ECQA 4ZU4A 4EN7B 2Q1MA 3J8F1 3CU7A 5KWRA 3VGIA 2XBO3 2Y0OA 4CDXC 3L9JT 5J09A 2PAKA 1CIWA 2B39A 1YI9A 4XFIA 1FATA 1UKGA 2IZWA 2CGNA 3AXDA 2DUQA 1AYN2 5I8YA 4XILA 4RFT0 1ULCA 4OI1A 1SBDA 1R091 3TAYA 1H4HA 1ND3B 3H1YA 5DDJ1 4PJYA 1U0AA 1S2BA 1Q8OA 3SHRA 2BTVC 3JCIA 3NAPC 5BNNA 2D6OX 3LSEA 2JECA 2DCZA 2ZHNA 2WNEA 4IL7A 4Q4X2 3OD0A 2GU9A 2WSVA 5L36A 2MEV3 3A0NA 2ARBA 4H7MA 3VBSA 4Y1YA 4HETA 4Q1RA 1GQGA 4F8AA 1XNDA 3V56A 1WD4A 1UD1A 5F6KA 2DCTA 5HCBA 3DPRC 3ZFEC 3ZMOA 5ACA3 3ES1A 1KJRA 2VMGA 1XYNA 2XVKA 1F2NA 3O5SA 2HWC1 4RHV1 1RUD2 1N3OA 2PTMA 1N3QA 2A73B 3USSA 3LA2A 1TMF2 3I59A 2XBO1 4Q27A 4WBBA 1AXYA 2GC2A 3VZJA 3D4KA 4CTEA 1RHI2 1UPSA 1YCIA 1YXWA 2QUOA 4YGDA 3PMEA 5BNOC 2OA2A 3AKSA 2FQPA 2YC0A 2XJQA 4YZ4A 3FBMA 1Q8SA 1AYM3 2R32A 5FPXA 3M4FA 1I5ZA 1LOAA 5C4WA 2DFCA 4XF9A 3WD5A 5GALA 5JI7A 2XWBB 2PLV2 5A33A 1CAVB 1I9RA 3ZN5A 3WHUA 5BUVA 1UL9A 1MQTB 3H50A 1GLHA 4M0NA 1IKQA 2R49A 1F9KA 2RS33 4QGMA 3GBWA 4DXZA 4HK8A 4WM7A 3J8F2 4AF9A 2V73A 1PO12 5ACA1 5DZEA 4XFBA 2RM23 3E97A 4GKYA 2SBAA 5ABJB 2G4IA 3PVNA 1WMDA 3CJIA 5SV8A 5C9AA 2ZGQA 4OHYA 3ASIA 1QJY2 4R9CA 1XE8A 1Q8PA 5FQ0B 4C0HA 5FRAA 4BQ1A 2JE9A 5CBLA 4MH0E 2X5IB 1N1YA 3J4UH 2ZBJA 4EV0A 3ZXLA 4CEYA 4KWJA 1ZVFA 2NLRA 4DRRA 3MW4A 3AMPA 2P34A 2WT0A 4N43B 4OFGA 5DUWA 1RINA 2VPVA 5A32A 1XYOA 3WDWA 2R6QA 4QQOA 1VP6A 4EN8B 1ULGA 2VW0A 1LHOA 4XFAA 3KS7A 4IEQA 2XVLA 2JKBA 1IS3A 2EA7A 3KGLA 1AYM1 3PVBB 1J1LA 3G7DA 4BE3A 2R063 3FZ3A 5JR7B 1X50A 1RUC2 4QT6A 1NY72 1COV2 2CYFA 5BNNC 1A8DA 2Z5WA 5T3NA 1LODA 4LE3A 4EJRA 1CAUB 2TBVA 5JPMB 3ELNA 1AR63 1V6IA 2JG9A 3KCCA 3VBSC 2R072 3ZXJA 3UJQA 1YUDA 2RS31 1BZWA 1JHNA 1RUI2 2CY6A 2WFF2 3WNXA 1DZRA 1Q8QA 1ZBE3 2RM21 4HFSA 1DG6A 4GXLA 3JD72 1EPWA 1TME3 2LM3A 4IEXA 5E89A 5JPNB 3OCPA 3BPZA 4COZA 4FPEA 4P9YA 4QGNA 4R4ZA 2YV8A 5KC6A 3I4IA 3MPPG 4O9GA 4OI4A 4U2AA 5EWSA 4XE9A 1PM7A 5BY5A 3WDYA 4FP2A 2LUWA 3W59A 2B46X 3TN93 1HQNA 1QGLA 2RMU2 3E5QA 4XF3A 4BWOA 3QH7A 2BVBA 2IXIA 4QPIA 2XJTA 4FXGB 2MEV2 3VKMA 2R061 5C8WA 2BFUL 3ACLA 1AL0G 4FOQA 3M3EA 4JTOA 5C4WC 3NW4A 5DG2A 1WUVA 3ZYRA 4QQ2A 1RC6A 1JBCA 3LB9A 3NV3A 4IEOA 1WW5A 2NQYA 4K7JA 4L99A 1H2MA 5I0RA 4XFFA 2DYCA 3MZHA 1W6NB 4MYEA 4NHKA 1AR61 3SNMA 3ZN4A 4FPCA 1HV1A 4XF4A 2UYBA 2RS12 5IK4A 2YMZA 1V00A 1ZZ8A 2ZKLA 3WDVA 4PIYA 1POV1 3ILRA 4CP1A 2Y38A 1ZBE1 3A4UA 4WM7C 3RYKA 1ENRA 1TME1 1J3RA 2D3RA 5GKAC 3WUDA 3CJIC 5C9AC 2XLFA 3ATGA 3HT1A 2PFWA 5FO8B 1VAMA 2Q0AA 4JCKA 5AC92 3AP9A 1SDWA 4K21A 1U5XA 4CEYC 2B7YA 4S2GA 3TN91 3POSA 1LU2A 2E6VA 5KHJA 3BOPA 5BXXA 1ALYA 3NV1A 1POV0 1D0HA 4DPNA 5C8CB 3I7DA 4FO9A 1XNCA 3R05A 4KU7A 3ZN6B 3NWKA 2XJUA 4IEUA 2HWD2 3WCRA 1CQ9A 4Y22A 4KGQA 1AUYA 4AHXA 2ZX2A 3ZIWA 2ZHKA 3WVJA 5CG9A 5LEKA 1MZFA 3WCSA 1PZ7A 4LBNA 1NOVA 3H3UA 5J37A 1AX0A 1MS8A 1CONA 1RMU2 1J3PA 2Z2SB 4D3WA 1NCRA 2JG9C 3AXEA 2IXHA 2YGMA 4TLFA 1OA3A 3DN7A 5GLWA 2WS92 4LHNA 3T1MA 1DFQA 1WCKA 5E1RA 1ZZ6A 5I0TA 5GZDA 4H55A 4E27A 3GALA 1WLDA 4B4QA 1CAWA 2XB6C 4CEWA 3ZPYA 5KXCA 3I54A 1O4TA 1PVC3 1MR5A 4IEPA 4JGZA 3E6CC 4AYUA 3QCWA 2B9UA 5BNPA 2R062 3MIHA 2VW2A 4C1WA 2WNVB 3HIFA 3N35A 2HWE3 2XVGA 2AZ5A 2B5HA 1ZNPA 2JDZA 3GHMA 2JICA 1SBFA 5H9RA 5CFCB 1MZ6A 3WG2A 3JB4C 4GULA 2RR11 5DXDA 3ZFFB 4QPIC 3H1MA 4N53B 1QJX3 2PAMA 2PQQA 3RI8A 4GQ7A 5F5QA 1LGNA 5KHKA 3W9AA 2UYAA 4H3WA 2BEOA 5CB7A 2OZ6A 4QPGB 3AP5A 1CX4A 2VNOA 2P3KA 3PJQA 3RI9A 4NN0A 4DB5A 2C9AA 5CFDB 1DYPA 5FLIA 3IPVA 4LBQA 3OBTA 1FMD3 2WINB 3V0AA 3EHKA 2IXKA 2QJVA 4COWA 5C33A 3N7KA 4MXVA 5JIAA 4HN0A 1DIWA 3LSDA 1LCLA 4OVEA 5F1RA 2NMNA 2VOKA 3VHNA 4OHWA 3KGZA 1JN2P 1RUE2 2ETEA 3PVEA 4XBQA 1QH7A 1LEDA 4URTA 4L2NA 4E2QA 1ENSA 4QHBA 2HWE1 1W6MB 2PA7A 4FVVA 4PLMA 1SLTA 1CAXB 1G86A 1QOSA 4I3PA 5CNAA 1AJOA 4FT8A 4Q4V2 2NPIA 5JSOA 3VBHA 1AL23 1NLSA 1O3RA 3S30A 1QJX1 1CESA 3S6PA 1BVP1 2GMEA 3J9SA 4FPJA 5DUUA 1V70A 1DZQA 2EF6A 2ENRA 3VLBB 1E57A 3JUUA 2JEMA 1UKRA 3TWIA 2CGOA 1DHKB 3ZSMA 4A2UA 4AFAA 3UKTA 2DV9A 1OFNA 2VUJA 4V1PA 5CU1A 1HDKA 1UU6A 4Y24A 1B35A 4B4PA 4GWMA 5FMOL 1NCRC 3VUOA 3UKNA 1SMVA 1MEC2 1FMD1 4Q4W2 3M8LA 5HI0A 4R9AA 2FBEA 3B00A 3BU7A 1APNA 2BWAA 2LTNA 1WD3A 2A3YA 3CL1A 3FUOA 3UL2A 2W68A 2GC0A 2JENA 2GZWA 2QE3A 4MXWA 1BBT2 2KXLA 3I8TA 3KMHA 3HT2A 3M7AA 4CEWC 1BQPA 2W08A 1PZ8A 1QDOA 4JGZC 2WT1A 1AYN3 5SV5A 3JZVA 3DF0A 5BNPC 4HSJA 3MI8A 4NO4A 1EV11 2DVFA 2WJSA 4CDWA 4FBFA 1O3QA 4XTPA 1VBB2 3OJBA 1RL3A 1VLNA 2CAUA 1ZYBA 3IDCB 1ULEA 2EIGA 1AL21 2ZTNA 3MIGA 3LOBA 4C91A 1HW5A 1SBEA 4XETA 2GN3A 2GDFA 4Q4X3 2YXSA 4Z1VA 1UMZA 4AFDA 3R6SA 4YW5A 4Y20A 4M3CE 3TOJA 1IPJA 1BJQA 2VOWA 1JOJA 3MF9A 1YIFA 2DCJA 2B42B 3M70A 4ATEA 2I07B 2FZ1A 2H6BA 5JOZA 4FOYA 3WV6A 4KBBA 4AQSA 2A6YA 4YW2A 1KS4A 1S0BA 4AGRA 1RUD3 2O0OA 1TNFA 1PVC2 1O5LA 3ZDSA 1Q43A 5J96B 2H6CA 3D8CA 4YW1A 2WZR2 3AJYA 3J26N 4UW5A 3ZXFA 1MZ5A 3KCXA 3FFQA 1AXZA 3ZSKA 1D4M2 4AEKA 1AYN1 2AGSA 4EN9B 4CDUB 2R1DA 3QBQA 1QXRA 1DQ2A 2LALA 2ZAHA 4IV3B 4XFHA 3VBOA 3WUCA 5GZGA 3AM2A 4DS0A 4XBNA 5T50A 1XU2A 5JAXA 3KQRA 1W6QB 2QNKA 3PNAA 3UK9A 4KNCA 1PO23 4Q4X1 3VBHC 4LHLA 5HXVA 2HWF2 3ZYIB 2HEVF 4RS5A 5FLHA 3V0BB 2PLV3 4AWDA 4N7IA 1EPZA 2A75A 3WXPA 1X8MA 3AK0A 1C8M2 1OHFA 3IM0A 1QQP2 1PIV2 4I0BA 4L92A 4YLZA 2QFEA 1UZYA 3N7JA 5KXEA 1PO13 2WKKA 2D44A 3AJZA 4K9SA 1W39A 4AI1A 4OI0A 3FLRA 1B35C 1H1AA 1TE1B 2ES3A 2XL9A 2ZGTA 1H30A 1RUD1 2WA3A 4X6RB 1QJY3 4FTSA 4Z92B 1WBLA 3JB8A 4K40A 3ZO0B 4NWWA 2K0GA 4M0HA 1Z78A 1SCSA 4Q0QA 1H4GA 1VAVA 2RE9A 4KWKA 1NCQA 4R8HA 1CAVA 4FPOB 2VUAA 3OF1A 1RHI1 5FO9B 2A6WA 3D82A 1MQTA 1W6OB 1A3KA 1AL22 2QDNA 5I8TA 4Q0SA 3MGUA 4COVA 1S0IA 2WL1A 5CA6A 3G6JB 2RHPA 2WC2A 4N7UA 4P9WA 4M00A 3O7OA 5EXOA 5EV7A 3M2MA 5ABJA 5JMCA 1OLRA 2VW1A 4CDWC 4OHXA 3BOWA 4XJ8A 1LGBA 2HJIA 1X33A 2A5ZA 4QX5A 1ENQA 2VECA 1RUC3 3RMYA 1ULDA 5FQ0A 1COV3 4XW3A 2R042 3MICA 4JDNA 3GZTB 1C5HA 1CJPA 2PLV1 2X5IA 5EFUA 5BYNA 4LEJA 3POWA 5D8AB 1BK1A 1OOPB 1GZWB 2R073 4K20A 1B09A 3OD4A 2OZJA 2ZX1A 1NZCA 1RUI3 2WFF3 1FXZA 4CDQB 2GC3A 4HVQA 1S0EA 1PO11 4RQPB 3SLIA 1DQ1A 4BZ4A 4Q4Y3 4QQHA 4AQ6A 1A6CA 2P2KA 3AP7A 3JD73 3RSJA 4GB33 2PHRA 2I45A 1QJY1 3AFKA 4HVOA 4BPZA 4NPRA 1HQWA 1WMEA 3AYDA 4LA2A 2QZ3A 3WG4A 2R1BA 2RJLA 1UIJA 1LOFA 4EWDA 1CAUA 1QJU2 3TBDA 4AI2A 1HRI2 2RMU3 4PIXA 3JQXA 1AR82 4I2OA 4I0AA 4LBKA 1MS5A 1QDCA 3VBOC 3VKNA 1OI6A 2JG8B 2PHUA 5CVRA 1RUC1 1NY71 4JRAA 1COV1 1G9BA 3NL1A 5FLJA 1QH6A 1S2KA 4G3YC 4RS5C 5CAZA 3AYEA 3WT3A 3QLQA 4RR3B 3WINE 4O9EA 3LOIA 3BCWA 4TWTA 3CLPA 5IT6A 2R071 4FOVA 1GSLA 4UW3A 2RS13 3ZYGA 4QQPA 1LULA 1RUI1 2WFF1 3OGGA 3VBRB 5IK5A 1VRH2 3O0VA 1SLCA 3VDDA 3ALQA 3B02A 3EBRA 3NAPB 1NG0A 4P9XA 2VY0A 3JD71 4YNIA 4K6BA 3ILFA 4GB31 3ZFGA 3R4UA 3HWJA 5K0UB 4FTEA 2VVEA 1QHDA 4MGZE 5C6CA 3SH4A 4RA0A 4WVMB 3WP6A 1KQRA 3OBRA 1GV9A 4Y1UA 5KXBA 1IHMA 1LOEA 3APBA 4DZGA 5AC93 1NCQC 4HANA 1W6NA 2UWCA 2UU8A 1GICA 1HXS2 1BVVA 1C5IA 2JJ6A 1MQTC 2RMU1 2Y26A 1PO22 4YM0A 3FBYA 2AUYA 4XFGA 1FNYA 1VBE2 2MEV1 4LUMA 2IXLA 3D6EA 4NOTA 2HWD3 4ZU7A 2ZZJA 1Q3EA 1RUH2 3IDBB 5ABJC 1CR7A 1LHUA 5L7OB 4FXKB 1TEIA 2AREA 1S0JA 4BM8A 1KDKA 3C2UA 1ZA4A 1GZCA 2GMMA 1LESA 3MIDA 2X5IC 2XGXA 3N36A 5LK5A 1RMU3 4LO7A 5CIRA 2RS11 2W0XA 2WT2A 4UBHA 4IXLA 4AVVA 1H9WA 2VVDA 1QNWA 3WP3A 4XJ9A 2DURA 2VQ0A 5C8CA 2WS93 4BMBA 5JIUA 5HCFA 1CPNA 3ZN6A 1Q56A 2OUHA 3L2HA 2TUNA 3WHTA 4Q29A 1DDLA 2A6VA 3USUB 1QXJA 2WZPP 3KSCA 1I6XA 4KL1A 4IQPA 2DUOA 4LHKA 4LT5A 2HWB2 5JSPA 3KM5A 1HRV2 1CD3G 5AC91 1RITA 2DCKA 1LOFC 1NXMA 2ZHLA 3KZ4C 2CV6A 4A7ZA 3SITA 2WNUA 3WY6A 2V09A 5JOYA 4IV1B 2C0ZA 2ET1A 4TSVA 4YZ2A 1C3HA 4DINB 4CP2A 1N1TA 4Y5Z0 2A71A 2HWD1 1VBA2 4QM9A 4YSFA 2CNAA 5GLVA 1W6PA 3KCYA 5J7MA 5LEJA 2O8QA 4E2GA 1IKPA 4FPHA 5KHGA 2ZKNA 3ENRA 1C1FA 4RGGA 1OFSA 4Q4Y2 3FE5A 4UBGA 1RMU1 4YG0A 4GB32 2D6LX 4LO6B 2WNVA 5D1IA 4ISQA 1XNKA 4SBVA 2ZGPA 4YRDA 3RDIA 3ZXKA 4EROA 4QMAA 2WS91 2XWJB 4I30A 3VDDC 4Q0UA 3ZFFA 2PYTA 3ZFGC 5FREA 1OQDA 2WLQA 2C1FA 2X29A 2VNRA 2ET7A 3WQ7A 1RIRA 3EQEA 4LA3A 3SMHA 3VBSB 4AI0A 1RUE3 4AFBA 4D94A 1SQ4A 4PCRA 4META 3E6DA 1O3TA 2BNNA 3W58A 4LR4A 3NV2A 1ZZCA 2ZMNA 1YYNA 2EXKA 3HR9A 5H9SA 5AFEA 1PMIA 4H7LA 5T52A 1VB2A 2GH8A 3ZVXA 4Q4V3 1OQ1A 1M06G 1RUG2 2PHDA 2K2SA 5FMOS 5FTTC 4IETA 4HN1A 4AHYA 3M3OA 2WSUA 3I59B 1PNFA 1QOTA 3MFCA 4AK3A 4XTMA 3K51A 4DMIA 2OYZA 4E4SA 1S1AA 3V65A 1AXKA 2DCYA 2VOVA 2YPJA 4Q1PA 4YARA 1YI7A 4X8NA 2VU9A 5EJ3A 5JOXA 1CAXA 1PNGA 1W2UA 1MEC3 4YM2A 1GNZA 3OYWB 4Q4W3 1H9PA 1JYIA 5C4WB 5C8CC 4FSJA 1WCDJ 4CZSA 4YVWA 2ZACA 4AGGA 4FPYA 2UURA 4Z07A 1H1MA 1BBT3 1IPKA 1RUE1 3B3QE 2XKPA 1K5MA 3BODA 3RNSA 5B2GB 1ONAA 1BYHA 1YHFA 1IZ3A 4HL0A 4FPFA 4XJUA 2WNUC 4ZU5A 3WDUA 3N4MA 1VBB3 1WMFA 2ZZQA 3RJ2X 4Q4V1 4D7SA 2HEYF 5DZGA 3IBMA 4DY3A 1MS0A 1FOD2 2ZGLA 1EAH3 1KXGA 1ZRRA 1BEV3 4GKXA 2OW4A 1RUF2 3MW3A 4WVVA 4XFCA 2IXCA 4BOWA 2IWGB 1R1ZA 1S0DA 4CEYB 2FMYA 4XF1A 5T5OA 4RGAA 1XRUA 5A32B 5EYXA 3WQ0A 1A78A 2Z79A 5A3LA 4AVTA 4JV4A 1PGL2 4M3CB 4G9SB 3MLLA 2D97A 2ZCWA 4QM8A 2EAAA 3VHPA 4EWEA 3H3ZA 2WNVC 3PLQA 4MVTA 5JVVA 1G7YA 1MEC1 3I2DA 5GLUA 3OGJA 4Q4W1 2YY1A 4UW6A 1J59A 5GLTA 4J1XA 5A3MA 1O4ZA 3H0OA 3ZFFC 1NYWA 2WZR3 3RYPA 1BBT1 2PHXA 4GMP3 4S2DA 3OY8A 2R16A 4NWVA 3RG0A 4AVBA 2QDRA