2VOXA

An oxidized tryptophan facilitates copper-binding in methylococcus capsulatus secreted protein mope. the structure of mercury soaked mope to 1.9aa
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
290
structure length
289
Chain Sequence
b'GVAEVVETFKNPGTYSSPVINFKIASPPGPGTPIYGPPRDFSGYNKSYSLAIGKTSYYDPTTGTKWNDDTITPVSDGQDIWRGTHTGKWSFFNGKAGDKITLSVQRDAQEASLKGAHPGFILFWRPEGGPLFWAGTQDLDEGQTALPADSDTVIGHVIVQHADWTLQGLPPKADHTAPAGVDTELYPMKPDSYTMYYVDSGYDADKYVASKKLIMHPTAFKGLALNDGTAGAFTKSITLPKTGYYMLYVANVLEVDDWSVDADGKLTTTGEVWEVPAKGCWVNITISKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SURFACE-ASSOCIATED PROTEIN
publication title An Oxidized Tryptophan Facilitates Copper Binding in Methylococcus Capsulatus-Secreted Protein Mope.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 69
structure length 289
sequence length 290
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11617 Cu-binding_MopE Putative metal-binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1220 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2voxA00
2VOXA 4BZ4A 2VOWA 2VOVA
chains in the Genus database with same CATH superfamily
1JOJA 3AX4A 3URFA 2K9ZA 2DCTA 5KWRA 2PHXA 1WZXA 1WCSA 1MZ5A 4AEDA 1AR92 2XVGA 2PHRA 3POYA 4LLOA 3KWVA 1O8SA 2ZOEB 1RJ8A 4MGYE 2AEYA 5BPXA 4AVBA 1XPWA 4BDVB 4MSVA 2NYYA 1Z0HA 1XSQA 2WR9A 4Q1PA 1C5HA 4LJHA 2JE7A 3RZGA 1COV3 1BXHA 3O12A 5LBCA 5BYNA 1PM4A 1XXNA 4JKMA 2IXHA 4YGCA 1IKPA 1KJLA 4XEZA 1DQ5A 3BPSA 4XFFA 4XFGA 4RN5A 1JXNA 4HMZA 5C8WA 2FDIA 2R072 4GWMA 2ADDA 3O1UA 1H0BA 1W99A 2ZMNA 5EJZB 5FPAA 4Q4Y3 1VBE2 3ZFFA 3ZYBA 1WMDA 1UOBA 4LA3A 5CKQA 1OF4A 2VUJA 1JUIA 4GB32 4B3NA 3KQ4B 4BK4A 1KRIA 2XJQA 1ZBA1 1GANA 2JEMA 2ZGMA 4OHZA 1PZ8A 1HV1A 1Z7S1 1O59A 4LBQB 4DXZA 5JSPA 1YC61 1I6XA 3OGGA 1V9U2 5JR7B 4NR1A 5FUPA 2WT1A 5DZFA 4CSWA 2JDMA 2E53A 3P3NA 1IKQA 2QZ3A 4UFLA 4PDWC 1KDKA 2XG3A 4KL1A 2P34A 2J42A 1NA1C 4CEYC 1DYKA 5I0UA 1XSRA 2OX0A 1URXA 1ST8A 1CJPA 1FOD3 1OA4A 3POGA 4RYDA 1LEMA 5F7UA 2XLFA 5FP7A 2ILMA 1DGWA 1OQDA 4BLIA 1SPPA 2Y6HA 3HOBA 3V0BA 1QXRA 1VBA2 2EVXA 3LPFA 4Q4V1 2LUWA 4COWA 1IGOA 3G7DA 5F5AA 3KLSA 4LQRA 1PVC2 2D44A 4YM1A 2ZHKA 1B35A 3M4FA 5DAPA 1JYXA 4AAXA 2D6LX 1N47A 5LA1A 5C4WA 2GC1A 2JICA 3DPRC 5A1LA 3E6CC 1UY2A 3RYPA 3WEZA 3J7NA 2E9QA 5CADA 3PHMA 5CVRA 5K9YA 5IVEA 3ZFEA 1X8EA 3DV8A 3O1TA 1ZZ9A 1Z7S3 1W8FA 3MGUA 4AVSA 3S57A 2VQTA 3KMHA 2BFUS 2G19A 4IV1A 1ZZ8A 4QPWA 1AYM2 1OVPA 2YU2A 4FT8A 1H9WA 1VP6A 5FPVA 4D94A 5EYYA 2DVAA 1G9BA 5CG8A 2B42B 2AZ5A 4S2DA 5F3CA 4XQDA 4MO3M 5T3NA 4AQTA 4YGEA 4Q4W3 3U78A 4F83A 1ENSA 1FXZA 4YFZA 5L7OA 3ACGA 4IEWA 1F8VA 2B4KA 4Y1YA 3UKTA 4OI0A 2RS51 3N36A 3R6SA 4BQ4A 1LU2A 2WYSA 1QH6A 2MEV1 1QH7A 4COYA 2WDBA 4WVWA 1JODA 1YFUA 4CU8A 5JSRA 2CSGA 2VCCA 4IEYA 4RGKA 4YZ5A 1LOCA 1ZM1A 1E5HA 1HV0A 1ULGA 1LRHA 2UYAA 1WW7A 4YNIA 3PJQA 1K12A 1PZ9A 4JHZA 1UX7A 2A7AA 3JD71 3LFMA 4EROA 4HBNA 2JKBA 2E7AA 2VXJA 1T6GC 2DFCA 4FPLA 1FPN2 1LENA 3AMMA 5G05L 1GNZA 1RXFA 3FC0A 1N1VA 5FZDA 3FHIB 2PHFA 3M3EA 3POJA 3ZXGA 1DP0A 1AF9A 1OD3A 1BLZA 2ZX0A 3VDBA 5DPNA 5FP9A 2XJVA 5A1FA 1K5MB 1HXS1 4YM0A 2GZWA 4WV8A 5BNNB 2YV8A 4FSJA 3I97A 1CAUA 4D7SA 1RL3A 1UYZA 3H3UA 2WINB 4M01A 4Y5TA 2Q30A 2GNDA 4WBBA 1ND3B 5A3TA 1VBB1 3AXDA 3U11A 1DYOA 2GP5A 3WNKA 1Y3TA 3E97A 2J1EA 4QQLA 4Y1ZA 4W4ZA 1W6MB 1W6PA 1MS1A 2WBKA 4LTAA 2ZEXA 3C8XA 4ZU5A 1QQP2 4WM8C 3RWKX 3AMNA 5IVJA 4ASMB 3USUB 2MEV3 1UWWA 3ZYPA 1W0NA 4BIFA 1H4HA 1AR61 1I3HA 3NAPC 2R16A 2R061 5DUVA 4NWWA 1MPXA 2ZX3A 1TG7A 1GOFA 4Z82A 2R1DA 1F4AA 5JR2A 5HCFA 3S30A 1R082 5I93A 3FWEA 1RUC1 3D3AA 3WZ1A 4C91A 5C8CC 2JD9A 2XKOA 1S0DA 4H7LA 2XH6A 4ITCA 2HEWF 2ZA9A 2ENRA 1RHI2 2PHUA 4AI8A 2CV6A 5FP8A 1QXJA 3HAGA 1W9SA 4UFHA 2RV9A 2W5FA 5I0SA 3IPVA 3Q9OA 4XJZA 1VBD1 3N7JA 3BYWA 3RMXA 1QMJA 3KGZA 3AFGA 1AHSA 4AZZA 1UCXA 1AJOA 5BNPC 5A6QA 2E63A 2X09A 5BNNA 1U5YA 5A7PA 4XZPA 1RINA 1OOPC 1RJ7A 3OEBA 2OZ6A 1QDOA 2QDNA 2WSVA 1XOYA 1RMU1 3BCWA 4V1PA 5B4XA 5FYHA 1O5UA 4M3CB 1ND3A 5ANNA 3VBFC 3ZFGA 2VO5A 5IWFA 4OI1A 1J83A 3LA3A 3VZLA 2W52A 1W6MA 1O3QA 1VMJA 1AR71 2AYHA 1WW5A 4MZUA 1R093 2DCZA 2V72A 3USUA 3OTFA 1QJX1 2OT7A 1RUG1 4Y5SA 3T2OA 1UY3A 3LA7A 1RUC3 1UYPA 2RS31 2WNOA 1H8VA 2FZ1A 4GH4B 5A70A 3D82A 3M8LA 4XTPA 3I54A 2OPKA 2O8QA 3O7OA 4QB6A 3ASIA 3GNEA 3JQWA 3VZJA 4YG0A 1OH4A 1W8OA 5C70A 1J58A 2VNVA 1E5RA 3KZ4C 1GKBA 3B02A 5DQ0A 2WFF3 4CUCA 3AZZA 2YXSA 4FFFA 4R4ZA 1LOFC 1JMUB 2HJIA 3SQOA 2Y6LA 5FZLA 2WZPP 4Z8BA 4JGZC 3WX5A 3ZYIB 1HQWA 3FMGA 1UOFA 5LWBA 2P3IA 4AI0A 1ASJ1 4PI2A 2EIDA 4LORA 3LE0A 4LHSA 3I3EA 3SKVA 3B9IA 1RMU3 4JTOA 5A32A 1LAJA 4K8RB 4ES9A 2F4PA 1C8M1 1LGNA 2D3PA 2VY0A 3OYWA 3DYMA 5IVVA 3MIGA 2P37A 2Z42A 4V2WA 2UWCA 3VV1A 3IIIA 4FVVA 2RS11 2NM1A 1QJX3 3N7LA 1IS4A 2QFEA 3WT3A 3PMSA 1AXKA 4NN0A 5JZGB 2HWE3 5LRRA 4YM3A 2XR4A 4XF9A 1MEC2 3VDDB 4CP2A 5JVVA 3KCXA 4BMEA 3SMHA 2WAAA 3B94A 4LLFA 2XJRA 1WA4A 3GJAA 4LBKA 4B1MA 1ACCA 1HRI1 2QCSB 4GH4A 2F4LA 4Y22B 4C8DA 4Q27A 4CXWA 2WA3A 5LRSA 5FYBA 5KHHA 1F35A 4D7TA 5IYYA 1A6CA 2E33A 2HWC3 4HPKA 2TUNA 1XRUA 4H55A 4CDXB 5LCWL 3O1SA 4K3UA 2O8OA 4NHKA 4IGQA 5FZ7A 5A7NA 2R32A 4NUBA 4HETA 4DY3A 1NZIA 1Q3EA 4PIZA 1REEA 5FFOC 1ASJ3 1EPZA 2BQPA 3QACA 2GH8A 2BP6A 4L9BA 4LKDA 5C3RA 4F7ZA 3VUOA 1G7YA 1Q5OA 1RUH3 5F2WA 1S0FA 4CYDA 3A0NA 4X8NA 1NCRA 4QPIA 2D43A 3OD0A 2VW2A 4HN1A 2ZS6B 4DB5A 5C9AA 1H8TC 2JDYA 1C8M3 1KD7A 5EXOA 1QU0A 3T2TA 4MADA 2B46X 5D8AB 3VDDC 4A2UA 4W8JA 3K3NA 1UPSA 2Y6KA 4PF5A 1QJZA 2WS91 5DG2A 2L9LA 1QGLA 4MOAA 3UJOA 1SDDB 4QX0A 2OUJA 1W05A 1IPJA 2DVBA 2ZEWA 3AM2A 3SLIA 1AR82 4URAA 4CDXC 3O0VA 1MS9A 3KHCA 4K8FA 4UWDA 2W0XA 2BBVA 5FWEA 1V70A 2ZCWA 2EXHA 2QQWA 3R05A 1KXGA 4CDQB 3DKWA 3NV2A 1LR5A 2VVFA 2MPFA 5CYYA 3ZKUA 3N7KA 5BUVA 2VR4A 4QDRA 1WW6A 4YSFA 1AL23 2JG8C 5J96B 2ZX2A 2A6YA 1UU5A 5A80A 3WP4A 2V73A 3GBFA 1DQ2A 1ULFA 5J37A 2X29A 5JXGA 4GWIA 4BPZA 3OGVA 1YRZA 3RI9A 3K4ZA 2DDUA 3RZZA 3D5OA 4B8EA 5FZ6A 5L9VA 2FMDA 2D6NA 4RA0A 3W5MA 1RC6A 1JS9A 1GUIA 3PUIA 4HONA 3MFCA 1LB2A 5FZ0A 3UNPA 1Y9MA 3WCRA 5CG9A 1HQNA 1AL0G 4L99A 4CDQC 1CJDA 1RVF2 4UF0A 5FK8A 4FP3A 1YQ6A 3AMQA 2PELA 4L92A 4UBGA 4BZ4A 5D8AA 2XGXA 1CAWB 3OBTA 5A3MA 1PGW1 3ACLA 4P08A 2XJUA 2RG4A 3IZOA 5FPZA 3GZTB 1W2AX 3N7MA 1YXWA 1AYN1 4QAWA 1L7LA 1ZA4A 3K48A 4Q0UA 4Q4X2 2X05A 4HLTA 2DURA 3LKJA 2YU1A 3ZSJA 4XQ4A 4CCKA 5CFCA 5FAXA 4BQXA 5LEKA 1TNRA 2WO1A 4O65A 3NJYA 4BU2A 4ATFA 4Q26A 2RMU3 3MLJA 4KWKA 2HBUA 2D3RA 2BTVC 4QU2A 2HWD1 1LTEA 4Y1UA 2P6CA 3MV01 1OHFA 1G86A 5FZ1A 2UY8A 4QX7A 3UGHA 1O3SA 4HK9A 2C26A 1PO12 4R9BA 3RYRA 2Y34A 3POFA 4NPMA 5IT6A 1XQNA 1D4M1 4UOJA 5F2SA 2FDGA 5JMCA 3UL2A 1RUD2 1XC6A 4I09A 4EYUA 2ZPXA 2E32A 3AKTA 4CDWB 2D5HA 3ETPA 3NNMA 4QKNA 3DCQA 2OQ7A 4QGNA 4QPGC 3ZXEA 2JG9A 1AYN3 4Y1VA 4QX3A 2YUEA 5GZEA 3RJ2X 5GM0A 2QE3A 3FBMA 4LBJA 4Y4RA 2DU1A 1SBDA 3OBZA 1NQDA 3M3OA 4Q29A 2VL4A 3TNPB 5CKNA 2VNGA 2VQ0A 1REFA 2AUYA 2LALA 5JPMB 4Y20A 2DVDA 4HVRA 1SCSA 1POV3 2ZGOA 3JQXA 4AFMA 1MACA 2PLV2 1JI6A 1OA2A 2HWD3 2MHFA 4GWNA 3ZIWA 3H1WA 4LUKA 3MF6A 3BTYA 1WD4A 2A73B 2JE9A 3MI8A 2R041 4P5HA 2DYCA 2VUAA 1U12A 4BOWA 4ZXEA 2GNBA 2QQPA 1MR5A 1D4M3 2G9FA 2CWSA 1XNDA 5C5TA 1HDKA 2WABA 4Y5Z0 3R4SA 3B9CA 3N9QA 5IK4A 2D6OX 2TEPA 1OSGA 1W6OB 1PHMA 4Q0QA 1SHWB 2ATFA 3M3IA 2Z5WA 4BIOA 4FFHA 4N43B 1FI2A 3WNLA 1PK6C 2ZHMA 3FN9A 1HIXA 1KFXL 5IHRA 4CDWA 2O1QA 4IE7A 2VMCA 1S2EA 1MQTC 4MGZE 5FPBA 1S0BA 4XPVA 1PM7A 2VG9A 1X9PA 2ZACA 3KV6A 3LFIA 1HW5A 1FATA 1NLRA 4QD2A 4LITA 4HVQA 2Z2SB 2ZKNA 5I0DA 4QGLA 4XIOA 2IVJA 5A7WA 3SH4A 4C1WA 2A6XA 1LHNA 3FFZA 3LCPA 5LASA 2VW0A 4ATEA 2XJTA 1WW4A 5AVAA 5JIAA 2WQ4A 4NJ4A 3WNOA 4AFCA 4AVAA 3WF2A 4BK5A 3ZYFA 1FMD2 3GBGA 5K0UA 3C2UA 3UETA 1UW8A 2WNVB 3NNGA 1W2OA 4FPHA 4NPRA 1RGSA 3ORJA 1XNBA 3WD5A 1OLRA 1ULOA 1CAVB 1LHWA 5FCCA 5B2GB 3E1F1 5AC92 4UW5A 4GALA 1DHKB 4LO4B 2A1XA 3ZPYA 3JBG1 2CDOA 1A8MA 1XU1A 4RR3A 1D4VB 4OFGA 4K7JA 1JW6A 4DFSA 1W9TA 2XHNA 4A6SA 1J59A 3TN92 4AHZA 1IZ3A 5CB7A 5JSOA 4UT5A 4XF3A 4EWDA 1VLNA 2W1WA 3ITQA 2ZGQA 4JRAA 4PCRA 3WF0A 5CEHA 2CAUA 3KF3A 3CQOA 2QQUA 3I59B 3ILRA 3OGSA 1GOGA 2ARXA 5AFBA 4OVEA 3T09A 3FJSA 4C0HA 3DEMA 4IE5A 4DZGA 2JXAA 4IDZA 5ANQA 5F3EA 3LDRA 1ZRCA 1OC1A 1OUSA 2CYFA 3BGAA 4XETA 4G4FA 2SBAA 1OPMA 1YJLA 1ZNPA 5FOJB 2YBPA 4RHV3 1RUE1 4PF1A 1HRV1 4XJUA 5FMDA 2VTXA 2JB4A 5E89A 5J98B 4P9IA 5FYSA 1F2NA 1XNKA 3MICA 4JDNA 1R1A2 3P1IA 5IK8A 3U75A 1ND2C 3AP7A 3WLUA 2WL1A 1SQ4A 1J3QA 1L7RA 5KHKA 1H30A 2WLPA 3E5QA 3TOJA 1JHNA 5DUWA 4B4RA 3ZXAC 5BV6A 4LT5A 4LNVA 4Z2WA 4HKOA 1I5ZA 2C0ZA 4L8QA 5ACA2 2ZGTA 2YPJA 2A3XA 2BGCA 3OUHA 5CA6A 4PT6A 2DU0A 4IV3A 3LB9A 3CZUA 2I45A 1UD1A 2BNMA 2X10A 4NO4A 1H2KA 2KXLA 4E27A 1KGYA 3L9JT 4K40A 2XBO2 2VZUA 4UFIA 3I3QA 4FPOB 3ZSKA 1W8ZA 1TMF1 4UW4A 4N7IA 1CPNA 1O4TA 2ORXA 3KQRA 4GXLA 3KB5A 2RR12 1UYXA 2WN3A 2FCUA 4IL7A 3CJIB 3K75B 1SFNA 1W8HA 3LIGA 4XFCA 3RVHA 1LNSA 5FQ0A 3P6BA 5FZCA 1O7FA 4AEDB 4QX2A 5A6YA 2ARCA 3ES1A 1RUE3 4E8DA 4HL0A 2KA3A 2Z79A 2B8MA 4YARA 3C7HA 3ETQA 2WT2A 3GBWA 4CP1A 4ZU4A 3BTXA 1MZEA 1VBC1 2W9XA 3CEWA 1Y9QA 3JB8A 3AZWA 5SV5A 2FCVA 5DDJ2 5A6XA 5ABJA 4YPJA 3THCA 3IAQA 3RZJA 3MZHA 3JZVA 4AOCA 4YW6A 4XFBA 2C24A 3WOGA 1RYYA 5T5JA 4FXKB 3U4XA 1BVP1 1MS8A 2BNOA 3LPGA 2HYKA 3EQEA 4IW3A 1BQPA 3TBDA 5FY9A 4ZZ8A 2P3JA 3ZFFB 5EWSA 4PIYA 1PO23 3WUDA 4JX0A 5LK5A 3OY8A 5FY5A 1PIV3 4AEDC 1COV2 3DF0A 3PURA 3RNSA 1MVQA 1AX1A 3K4AA 5FPXA 1JZ3A 4XUNA 4OHXA 2HLEA 4A45A 1POQA 1UKRA 1LECA 5IFTA 4BQYA 1YHFA 4QPYA 3WNNA 4COUA 3MIFA 4B29A 4FQZA 5D1IA 4XUQA 3VKMA 4AGGA 3TRSB 3PJYA 2Q1MA 2DWRA 3QBQA 4Q4Y2 2YROA 3RFRA 5HV4A 5T54A 4QDQA 2QJVA 4Y24A 2WT0A 3CJIA 1ZBE1 1CIYA 1BEV3 3HT1A 3J8F1 5APAA 5CZKA 1HJGA 3MHZA 5E88A 1G8WA 2W91A 2ZGRA 3PDQA 4OQ9A 5BNOC 3WF4A 2D97A 1A34A 3C7GA 1UZ0A 2VOXA 4JRLA 4X8PA 5F3IA 5FUIA 4NHMA 1SPPB 1YYNA 4JQRA 4D0QA 3V0BB 1V6JA 4IE0A 1V6NA 1OI6A 5DZEA 4LIUA 1AR91 4HK8A 4CCMA 2XWJB 1VALA 1B35B 4K9SA 5J3UA 2HWB3 2VZVA 4LE3A 3RYKA 1NE4A 3POSA 1BVVA 5C4WB 1FOD2 4XXPA 4ISRA 3HEIA 3RS6A 1AXYA 5FYIA 2GP3A 3WUCA 2BVVA 3RZLA 4YLZA 3SKJE 2RE9A 2VECA 1AJKA 4LOTA 3RZMA 4R4XA 3ZFEB 2YY1A 4E4SA 2HWF3 4S2FA 1RUF3 4XJ8A 3VBOA 3GJBA 3KCYA 1DG6A 2HYXA 2DVGA 1GZ9A 2BBAA 2GSYA 4IV1B 3N35A 1NKGA 2R071 3ZXFA 4CCNA 1REDA 1G9AA 2WKKA 1CZTA 2VZOA 3A22A 3AK0A 1UXXX 4OLLA 1PX4A 1Y7BA 4QHBA 4BH9A 1OLQA 1OFNA 1VBE1 1FT9A 4NIDA 3RI8A 5IW0A 3ZKYA 4ARYA 4FO9A 2BU9A 3J8F3 1A78A 2OA2A 1YJKA 4IE6A 5DMYA 2IFRA 5L7OB 5T50A 2W2IA 1QOTA 5I8TA 3E5UA 1YQ2A 1UN1A 4W6YA 5GLUA 5C4WC 1V9U1 2W1UA 3HNYM 3S7EA 5LA2A 4Q0VA 3NSTA 4FOVA 3KT1A 4XF4A 2J1UA 3LAGA 3ON7A 4YW2A 2I07B 1UMIA 4IEXA 2CL2A 4XC9A 3VDCA 3OPWA 3ZFEC 4CTEA 1AR93 1BHGA 2H0VA 2A6WA 2J1VA 4Q4W2 4JHTA 4KBZA 3NW4A 4H7MA 5EQUA 4PJYA 3O1PA 2WO7A 3ZYRA 4LOSA 5AFEA 1LULA 1UOGA 3SH5A 3A4UA 1ZZCA 1FV3A 4WM7A 5KHJA 4KGGA 1GICA 4ONUA 2IXKA 1UMHA 4KG0A 1VBA1 2CGPA 5L7OC 4AYUA 5CKMA 2X5IB 4N9HA 4XAEA 1MS0A 3LDBA 4PLNA 4TWTA 1ZBA3 4ASLA 1CAUB 3AP5A 1UL9A 1GZTA 2R073 3ACIA 1BCXA 2AACA 2XKPA 2A70A 1O6UA 1GU3A 3DKQA 1H2MA 1RIRA 4CPBD 4JGYA 1OLMA 1VBE3 2AH2A 2D7FA 1BBT2 1CONA 1UIKA 5C3PA 2H0BA 5IK5A 1LCLA 4I3PA 4XHXA 3UGGA 1T2XA 1W6PB 3SHRA 4YW4A 1QF3A 4Q5OA 4PBPA 1YQ5A 4OYUA 4CEYA 3ACHA 5JDBA 3IIAA 4MG2A 4R52A 1AYM1 3WNMA 3AYAA 3H42B 5E1RA 2IVIB 2VZSA 4YZ2A 5HV0A 4C1XA 3R4DB 2Q1FA 2QVSB 3TAYA 4Q4V3 1WA6X 1POV0 2R0HA 2PTMA 1VB4A 4CU9A 5BXXA 1FNYA 2Z4FA 2P5BA 2ZGPA 3B7MA 4QX5A 5FLIA 4GMP1 5FYYA 3F2ZA 4FPCA 3U4SA 3JCIA 4D8MA 3ACFA 5H9PA 5C3SA 2WIIB 1GNHA 2GMEA 2RM21 1UY1A 3IPVB 5FZMA 5JLVA 1ZRDA 3NO8A 3TB0A 4BQ5A 1NXD1 2UWAA 1VBA3 4AVCA 2QTWB 3MIBA 2D98A 2XMLA 3MW3A 4MV2A 2AC1A 2WNUA 1ENXA 1FPN1 4XE9A 2ZHLA 3CIHA 4LO8A 3RDIA 3WINE 3OPTA 1CX4A 2X5IA 3WQ1A 5FOBB 1CD3G 3T4VA 4OI2A 1VE0A 1JOPA 3SEPA 3ZFGB 2QQJA 2HBTA 1ENRA 1SACA 2BDRA 1GQHA 3MIHA 2H6BA 1GWLA 2WSUA 1AXZA 1KITA 5IUQA 4CCOA 1S0EA 4PQ9A 4CUGA 4Q0PA 4YGDA 1HN1A 3M70A 4CEWA 3LIHA 2DUOA 3E6BA 5FZEA 4CVUA 2JDHA 3D4KA 2RS53 3INAA 5JXHA 1WMFA 4Z1VA 5KXEA 1F5FA 3OGJA 5FZ4A 2RJ2A 3NV4A 3VZNA 1GYKA 5LEJA 2ZMKA 2VZ1A 1K5MC 3JD73 3UJQA 1QQP1 3MF9A 4CUBA 1RUJ2 5BNNC 4QKFA 5CU1A 2RM23 4B7KA 3GZAA 4XTMA 1NOVA 1WD3A 4DXRA 1R092 4IEZA 3ZFGC 3U07A 3BIEA 1ND3C 5FWJA 2NMNA 5F8PA 2AR6A 3I8TA 1R081 1HXS3 2W94A 2EXKA 2Y0OA 2GN3A 1FPN3 2QQKA 5CFDA 1PMHX 1ZRIA 4QQPA 5FBJA 2R1BA 4QT6A 2VVDA 3FUQA 2WNEA 1DQ6A 4FOQA 1RHI1 4A41A 2W95A 5EHDA 4GKYA 1I9RA 1F15A 4JC1A 3HMYA 4GAZA 2YPDA 1EUUA 2Y26A 4I0WB 4JVAA 4LMFA 1VBB3 5A32B 2EF6A 2WFF2 2VZTA 3KVAA 1QXPA 2FHRA 1CAXA 1NT0A 3KVBA 1DCSA 4J6GA 4XCAA 5DUUA 3OYWB 3P5BA 4R8HA 4OHYA 5BNQA 1MZFA 2ORZA 2ZGLA 4NHLA 4QHZA 1MS4A 4NIAA 3X29B 3UT0A 2XVKA 1AR63 4RS5B 3PMEA 1IS3A 2H6CA 2R063 3LSEA 3NAPA 3KS7A 3D8CA 5HXVA 3OD4A 2OXBA 3I2HA 1KS5A 3TNQA 2IXIA 4B4QA 2BW8A 4AAPA 1L3JA 3K77A 2PHLA 3T2PA 3AL6A 3HVDA 2ARBA 3Q8FA 1UNBA 2OS2A 3MYXA 4M3CF 3J7HA 1D7PM 1U0AA 3GCXA 1J1TA 3NKGA 5FKBA 2WWJA 3WW2A 3ZSEA 1ZRRA 4D3WA 1VRH2 1WCDJ 4HPKB 1H1AA 4D7YA 3PUHA 3IDCB 1QJX2 5LBEA 1XJAA 4CPBA 4DOUA 1HB3A 1NZCA 1R083 1EV12 1VBD3 3DXTA 2HWE2 4QKDA 3S0MA 2WLQA 3NWKA 4HFSA 4YGBA 2RJKA 1W0OA 2ZX4A 1RHI3 1SLLA 4JDOA 4LK7A 4OCTA 2DTYA 2Y60A 2VU9A 2X53S 4TSVA 1NCRB 4QPIB 3O1VA 4NIGA 5C9AB 1IOAA 1OKOA 1S1AA 4ZZ5A 2HWC2 2VULA 1OOPA 1J1LA 1FX5A 3MFAA 2IUWA 1QNYA 3VBFA 3U14A 1S0CA 4GH4C 3IDBB 2XWBB 1IS5A 4TN7A 2EIGA 4M4PA 3O0WA 1QJY1 4K21A 1W03A 1AR73 1RUH2 3J7MA 4CDUB 1O5LA 1BK0A 4BWOA 5DG1A 1RUG3 3H8RA 4BM8A 4JV4A 1I5PA 4RS5A 4P9WA 5FXVA 2RS33 1V6OA 4HXCA 4QQOA 1EUTA 2VOWA 4CE8A 3DYPA 1IPKA 1VB2A 1RUNA 2VE1A 1RUI2 1OUXA 2P4EA 4HG6B 4QQHA 3VHRA 3LZZA 3VZMA 4A6OA 1NCRC 2XUMA 1GBGA 4OZOA 4QPIC 1GSLA 2ZTNA 4HN0A 3AYEA 5C9AC 5H9QA 4U2AA 1U5ZA 3O1OA 1UX6A 5J7MA 2Y6GA 2A75A 1ZREA 1MZ6A 3ATGA 3BODA 1LOFA 1MEC1 2WO2A 3B69A 2YC4A 3FL7A 4P9JA 4AXOA 4KNCA 5FY8A 3SXWA 3P3PA 2XQRA 4FTEA 4INDA 3WW3A 2D93A 1RB8G 1US3A 3C3VA 3CZJA 2VMDA 3FLRA 5IVBA 1PNFA 3TEZA 1CESA 1AL22 4N9IA 3IAPA 5HCHA 1WLDA 3VD4A 3MLKA 4P02B 4UF0B 1WLTA 1LOGA 3N9OA 4AI1A 5HCAA 5JZGC 4XCBA 1EAH2 2PQSA 3TEXA 1EY2A 3OEAA 3VZKA 1QJY3 4TXWA 2JJ6A 1IHMA 1RTVA 4O9GA 4XUPA 4IUGA 5A1AA 3DUIA 2UY9A 2RS13 1OQEA 2RDQA 3LEMA 1UIJA 4YW1A 1DZQA 4QX8A 5EV7A 3Q8EA 4R9CA 1D2QA 3POBA 2W1QA 3WQBA 1EPWA 1BMV2 1SG3A 4CDUA 2Y8KA 5I0RA 3LOIA 3AB0A 5CFCB 3QCWA 2Y0IA 2UU8A 2OPWA 4I0BA 4K20A 4KMQA 4QXBA 3VKFC 3FBYA 3ZXDA 1Y4WA 1HRI3 2JIGA 1TE1B 3KGLA 3FZ3A 2MNGA 4YZ4A 1OVSA 4TLGA 4CZSA 1OQ1A 2ZGKA 1SLAA 3EJKA 2VZQA 2RDNA 2EA7A 1MEC3 2GMPA 2J1TA 5JIUA 3IKWA 1K42A 4SBVA 3O14A 3QLQA 3A0KA 5D8AC 1K45A 3FUOA 1UAIA 2J1SA 3MLLA 2OQ6A 3GZUC 3V64A 1SBEA 1SLIA 3SEEA 2Y6JA 5J36A 2V4VA 2VXRA 3BTZA 4KG8A 3GHNA 2R0FA 1U5IA 3AVSA 2RJLA 3LEIA 2Y64A 1LGBA 1PGL2 2JDPA 2YZ4A 1V00A 2RMU2 4GJYA 1WGPA 1UO9A 1UU4A 4PLOA 2VTXJ 2W68A 3QD6A 1QJEA 2YBKA 2WS93 2XUEA 3M2MA 5FTTC 4KI5M 2JG9B 4NRMA 4HZFA 5F9TA 3OF1A 2YMZA 1ZRFA 2VCAA 3O0XA 3JXSA 2VOTA 2XOMA 2D6PA 3EB7A 2WYFA 5FYVA 4E2GA 5FDBA 1RVF1 4AGRA 2P3KA 4AR2A 5LA0A 4R9AA 1KJRA 2E31A 4COVA 4Y20B 1XNTA 1UPIA 2CGOA 1NUKA 1DGWX 4FBFA 2GC0A 2E6VA 4Y33A 4H14A 4ZONA 4Q4X1 4HANA 1US2A 4XJ9A 4YZ1A 4DMIA 5KC6A 1GZWA 3KT4A 4UW6A 1YEWA 2E26A 2WWUA 4N90A 4GIQA 1H1MA 3KHBA 3WVJA 3ZMNA 2QQLA 4AFBA 1AUYA 4IETA 3WDWA 1F31A 5T55A 1HN0A 1RITA 2VQAA 3L2YA 1QJU2 2FDKA 4FPJA 4FP2A 3ST7A 3NV1A 2YBSA 2HWD2 4JAAA 5JWPA 4YW7A 4M4RA 3FHQA 4H3WA 3LQCA 3POIA 4M00A 5F5CA 4DUXA 1R64A 3MV11 4YG6A 1GWKA 1PO11 2W92A 5K4LA 2FDJA 2YDEA 3THTA 5KC5A 4NVPA 4LHLA 4DUVA 3ZYJB 5FO8B 1SZBA 1RUD1 1UY0A 1JZ7A 1T6BX 4AF9A 5SV8A 3T30A 3NKTA 1LJ7A 4NROA 2AENA 3PIGA 4YG3A 4IEVA 2BOJA 3LOBA 3AKSA 5FMBA 3RZKA 5FREA 1DFQA 3UGFA 3AZYA 5A7WB 5FZOA 4CCJA 3OB8A 1X9TA 4Q4X3 1MS5A 1W39A 1YWKA 2VNRA 5FZIA 5FZ8A 3ZXJA 3ZR5A 4BE3A 1JH5A 2VBBA 4CP0A 1C5IA 3I3BA 5K0UB 1SMVA 1I1EA 2C5DA 3LEGA 5IAVA 4ASKA 1TME2 2JIJA 5L9BA 4CDWC 1ZZ6A 5L9RA 5FIXA 3THPA 2XXZA 1DF0A 1YQ8A 3GXUA 1EYBA 2O0OA 4MGTA 5DUXA 3APBA 3CMGA 1GP4A 1HB2A 2PLV1 5DAWA 3WSOA 1J3PA 5HPOA 3MUY1 1PGSA 3N9PA 4P9GA 3VBHB 3W21A 3H3LA 3ZDSA 4COZA 4P00B 2I74A 1ONAA 4RR3B 4X6QB 1UXZA 2G1MA 2PHTA 2DF7A 2AREA 1JYVA 1PO13 1NCQA 3ZXLA 4IEUA 3WG2A 2BZDA 4UYBA 1NY72 1O4YA 5DAXA 4EN8B 1RUD3 4QPGA 4IEOA 4DUWA 3MDPA 3WHUA 2V09A 3OGRA 2B39A 4JCKA 5IJRA 5GLZA 4CP9A 5K0UC 3H8UA 4YVWA 1XE7A 2Q8CA 3HWJA 3IN9A 1UMZA 3KSCA 1R1ZA 1HX6A 5FJKA 1W04A 1W6NA 5FLJA 1SCRA 3KT7A 4FOYA 4LA2A 2BNNA 1VAKA 4FTBA 2CU5A 3WV6A 4E2QA 5FYUA 5KXDA 1QWRA 1W8TA 4MGSA 2C4XA 3VGIA 3PU8A 3PUAA 2R043 4N43C 4B1LA 5E6HA 3HQUA 5FYCA 1P8JA 4QB2A 3H1YA 3NRUA 2E7TA 4GA9A 2PLV3 4BQ1A 4CA9A 1G6NA 2ZABA 4RHV2 2Q8DA 2W47A 4GKXA 3WG4A 2YGLA 4IV3B 1FMD1 1UZYA 1ULPA 1JYTA 4ZU7A 2BV4A 3PVNA 3VBHA 2FDFA 4AI9A 1GNYA 3UESA 4LHKA 1PK6A 5AVPA 2ZKLA 2VMFA 5EJ1B 5TSWA 1JYIA 2YGMA 5I0TA 4O9EA 3NJVA 3R0RA 4Y1XA 5FPUA 1MQTA 1KDMA 5AC91 3HBKA 1KS4A 5EYXA 2A71A 3U1XA 5T5OA 2BRTA 2JB8A 3KD4A 4TYSA 1XYNA 2UURA 2Q8OA 1W2NA 1F4HA 4RQPA 5JAXA 5FQ0B 3RRDA 3E6DA 2XHKA 4OHVA 2F17A 5FP3A 4LE4A 2BVBA 2WNVC 2P1BA 4PIXA 4JTNA 4NHXA 1JZ2A 3TN91 4CXXA 1XE8A 2EALA 4XBLA 3BU7A 1DQ1A 2EXJA 3ZMOA 3ZO0B 3LD8A 3PL0A 5J1XA 4QXCA 3Q8BA 3MW4A 3B01A 3UKVA 4Q1RA 3I2GA 4D69A 2D6MA 4BHPA 5A33B 2B9VA 5FJHA 5ABJB 4MXVA 5G04L 4AFDA 4BMBA 1NX9A 3I7DA 4XDQA 5JMOA 4AK3A 2DCYA 3VKOA 4XUOA 3ROUA 1O8PA 3VL9A 2Y38A 2X8KA 2VM9A 2ZAAA 1MVEA 5FXZA 4BCUA 4OQ8A 3C7OA 5A3PA 1FMD3 4S2HA 3AXEA 5LATA 3CU7A 1R1A1 4XABA 3WCSA 3OY8B 2NPIA 3JBG3 3UYJA 2ZHNA 1SEFA 4XBQA 2YB7A 1UZZA 4RFT0 5F39A 4XMIA 3ZYHA 2QQIA 3PTYA 4PI0A 5LK7B 1S4CA 3ZR6A 2CWMA 1LOAA 4GZ9A 5FMOL 1TQ5A 2VZPA 1JN2P 2BOIA 2XPJA 1XYOA 4KBBA 2IXLA 2VC9A 2BWCA 4MYEA 2BGOA 3K3OA 4NIHA 3KCCA 3WNXA 1PO22 4URTA 3VHOA 3SC7X 1PIV2 3HPNA 5E16A 1ALYA 3V0AA 4HSJA 2WZR2 3GGLA 2XBO1 4WVMA 5DAVA 2ET1A 3ZN6A 1X8MA 5F6LB 2W3JA 1AX2A 1HRV3 1KQRA 3VD9A 2GU9A 2RR11 5A6ZA 1W8WA 3ECQA 5C71A 1SFYA 1CGPA 2NZ9A 4AI3A 4NAMA 4UFMA 4AVVA 2QQOA 2DFBA 5DABA 5M0TA 5A33A 2P3YA 4ZHNA 1BEV2 1V6LA 5T52A 1NLQA 3GCWA 4GJZA 4YWAA 2W1SA 3OPZA 3HT2A 4LXLA 3WP3A 2OKXA 5EIYB 5IVYA 5LBBA 5L19A 2PHDA 2VMGA 5DDJ1 1XE0A 3CJIC 5FZHA 2JDAA 3NQHA 3BIWE 3VBOB 2BPA2 3JB4C 3U37A 3A23A 2W87A 2RHPA 4FXGB 4M0NA 2GAUA 4FAGA 1N3PA 1Y43B 1ZZ7A 3ME2A 1YIPA 4DS0A 1WLCA 1TMF3 3VBSA 2WC2A 2HWB2 3ALQA 1V0AA 5EJ3A 3PUQA 2PN5A 3I2KA 4N53B 1JYNA 3W59A 1UZWA 5FRAA 4Q2FA 2ZZQA 1SLTA 1QJFA 2B45X 3S5QA 2YG0A 1WKYA 1CIWA 2GNMA 1COV1 1ZVFA 2IC1A 3D6EA 2VMIA 3BVCA 2HWF2 2VUCA 1RUF2 3MUZ1 4XAAA 1PX3A 2A6VA 2ZAHA 4O7XA 2CY6A 3HIFA 2G4IA 3WY6A 5F37A 4F8AA 4BQ2A 1GLHA 3J7LA 1VBC3 1YI9A 1YO8A 4S2GA 4META 3VBOC 4Q4Y1 2PHWA 4QM8A 3ZFFC 4EJRA 4LBNA 5FZ3A 3DGTA 4XVHA 1WMXA 2ZXQA 4IE4A 5FUNA 1O3TA 3VBRA 2VMHA 4MVTA 5LB6A 1XU2A 1GV9A 3BOWA 1JU4A 4MXWB 1STMA 1LKNA 1Y9GA 4WM7B 3T3YA 1BJQA 1OD5A 2ZJCA 3FE5A 3GYDA 1WBLA 2A3YA 4XF0A 1A3KA 4YVSA 2WFPA 4Z07A 4FPYA 4NRPA 2XONA 3WHTA 3KF5A 1SDWA 4LEJA 1O4ZA 1DGRA 2VBPA 4RFRB 1S0IA 1XNCA 4JKKA 1GFF2 4P9LA 4RGGA 4UI9L 4I2OA 2XJSA 4OI4A 2VW1A 3VBUA 1GMMA 3AFKA 1X36A 1JOBA 3BOPA 4JGYB 4CXYA 1FOD1 4LBMA 1HJFA 3J26N 2NN8A 3B93A 5GZFA 1W3VA 2GALA 2QNKA 4PDWB 3NNLA 3ENRA 5K7PA 3DYOA 3H7JA 4N53A 1DGRN 4LIVA 3F95A 1NA1B 2JX9A 1ZBE3 2SLIA 5FXWA 3FLTA 4GB31 3ZLIA 1LHVA 4CEYB 1WCUA 1ZBA2 3H3ZA 5CIRA 4UBHA 1HB1A 4WM7C 1B35C 4FPGA 4EN0A 3CKHA 1Z7S2 2ZGUA 3EHKA 4ARXA 3Q8CA 5BNOA 1CZSA 1S0GA 2VD7A 2CHHA 2IFWA 1HB4A 2BUKA 2ET7A 3WDUA 3MO4A 2Q4SA 2GMMA 2P17A 3HQXA 1VMFA 2J22A 4M3CE 4NWVA 4C0BA 3RSJA 2VQUA 5H9RA 1S55A 2VMEA 4JGYC 1UF2C 4IV1C 4Z2AA 1GP6A 1HKDA 1UOJA 3MPBA 1JYCA 3FX3A 3WP6A 4BJ0A 1Q8PA 3DPRB 4MXWA 1YNAA 3RJRA 3H1MA 4NIIA 5T5PA 1DIWA 1O91A 4CCDA 4W50A 1UZVA 1Z78A 4AHWA 1UKGA 2YC2A 4L11A 1QEXA 3QH7A 4LKSA 3MIDA 2KD7A 1XB9A 2GC3A 4Q4V2 2WNUB 4Q4W1 4GULA 3I2IA 1JHJA 5H9SA 3AP4A 1H2NA 2DCJA 4NRQA 1NG0A 4XHBA 1PVC1 3AZVA 3I2JA 3GM8A 4WVZA 1OF3A 3ZN5A 4C90A 2NLRA 4LUMA 1H6YA 4MHUA 4NHYA 4XYXA 4HVOA 4GB33 1ZA7A 4A3ZA 5C3QA 3MW2A 5EZWA 5FYMA 4PDWA 4CEWB 3BB6A 3E5XA 1QDCA 3D0JA 4YZ3A 1NA1A 3R4UA 3OUJA 1APNA 1V9U3 1C1LA 5KXCA 1BBT1 1VRBA 4J1WA 3WDXA 4DRVA 4ET7A 1H6XA 4MUVA 5GZCA 4A3XA 2WNUC 4XACA 3NVCA 1Q8SA 5I8YA 1HLCA 4QKBA 4BA6A 2X5IC 4X6RB 1WCQA 2IXCA 1TNFA 2VGDA 2QQVA 3I2DA 4EZHA 2RS52 4ISQA 4UXAA 4HOOA 4EN9B 4PQQA 3RZHA 2MEV2 4LBQA 4XUTA 1W6QB 5KHGA 2A6ZA 4HKWA 2IWGB 2I2SA 1CVNA 1QY4A 2K46A 2V4AA 2EICA 4DNYA 5CFDB 4UW3A 3DPRA 2ID4A 4CEWC 1G9CA 3JD72 2JWPA 4A7ZA 2ZEYA 4KWJA 1PVC3 3THDA 1G9FA 4ZS3A 2IXJA 2K2SA 1W8UA 2RM22 4N8MA 4AEJA 2Z69A 3AP9A 2VPVA 5DXDA 5FY1A 3BPZA 3T4HB 3SITA 1C4RA 1CAXB 5DN2A 2VCBA 2YHJA 4EWAA 1C1FA 3O5SA 5FO7B 3MPPG 4OMCA 4XZUG 1HXS2 1LHOA 2WO3A 3MIEA 4UAPA 4DIQA 4WM8B 1W2UA 1DU3D 2WUHA 4FCAA 1ZYBA 5FMOS 5ISLA 4DQAA 4J1XA 1JUHA 2BGPA 1DLLA 3NAPB 5EFUA 1AYM3 4I01A 1BBT3 3AKPA 4LHNA 1TZOA 2P2KA 1W9WA 2Q0AA 4OHWA 4QDSA 3KV4A 4XQWA 4B4PA 5J48A 2V5YA 4LBLA 1VBB2 2DCKA 3MEPA 4A7KA 4E4DX 1SLCA 5CFDC 4FAHA 2BJSA 3WQ7A 1JU3A 1VMHA 3AC0A 3V56A 4EV0A 5C8CB 4I3GA 2WQZC 1IG3A 3I4IA 3OCPA 1HQLA 5C5UA 3W9AA 1WCKA 4GMP3 4IEQA 1S2KA 5GZDA 1AR62 1D2SA 4QU1A 4RL7A 2GC2A 2R062 4PLMA 2O14A 5FKCA 5B4NA 4E9KA 4E4HA 5DZGA 2PAMA 1W6QA 5GLTA 2OYZA 2ETEA 2JE8A 1ODNA 1RUC2 1RUJ1 3N9NA 5BNPB 3GF6A 4L97A 1NYWA 1GOHA 2VTFA 3IDEA 5FY7A 3UKNA 3T08A 1OOPB 4XDOA 3ES4A 1R091 2RDSA 4P14A 5FYTA 5LW9A 3B00A 1TEIA 3HNMA 4FI9A 4AQ2A 1ZZBA 3K2OA 3VBFB 1GWMA 1VBD2 1V6KA 3OUIA 3OG2A 4CUAA 4FTSA 4A7YA 4G9SB 5HBAA 3OBAA 2GDFA 3AL5A 3NL1A 1TVGA 4Y26A 1LOBA 2VH9A 3BN6A 3WNPA 3VL8A 4D6SA 1DZRA 1CQ9A 4WM8A 5LY2A 3B5LB 3ILFA 2WA4A 1GQPA 2PQQA 1K3IA 3IB3A 1W90A 2N7GA 2WFF1 4GWJA 4W6XA 4QXKA 3SCFA 4A44A 5BY5A 2J1RA 3QH6A 1RMU2 4LK6A 2QBXA 2DTWA 2BYVE 2YFZA 1K5MA 3PUSA 1QQP3 4U36A 3HBZA 2WRAA 3T2QA 1ULCA 2Y33A 3EMRA 5C8CA 4FFGA 2EIEA 1H2LA 4I02A 1AR72 3IBMA 3T0BA 1YQCA 1E5SA 2JKXA 1S2BA 3TWIA 5IFPA 3PIJA 4IGOA 3VKLA 1RUG2 4OUSA 4K1YA 1N1TA 4AL9A 2EIBA 2A5ZA 1RUJ3 2RS32 3VD3A 4JGZB 5A7OA 1LU1A 3AYCA 3B3QE 3WG3A 3UV9A 1KEXA 1OKQA 2ES3A 1GZCA 2VCMA 5FZFA 3J9SA 1DQ4A 4NPLA 3DECA 3SNMA 4XW3A 1ODMA 1JZ4A 4FFIA 1VRH1 1W8NA 5BNPA 3SCGA 4RS5C 1YFYA 4QHOA 1LEDA 1EV11 2HWE1 1WMEA 2NMOA 3HR9A 3PVEA 4K6BA 3UK9A 3ZPOA 3FLPA 3RGBA 2GN7A 3IDAA 1YFWA 2XL7A 1W28A 1YLLA 1J3RA 2R49A 1W2TA 3TEYA 3U10A 1IQDC 4QM9A 1ASJ2 2Q5TA 3M7AA 1VAMA 4Y4YA 3FHAA 2HWC1 4E4ZA 1OXCA 3NV3A 4QB1A 4XDPA 3I2FA 2ARAA 3O1MA 1BK1A 1DYPA 4QWNA 3I2OA 3EYPA 4RSUA 3RPQA 1C8M2 3WW4A 5GZGA 2PYTA 1QJY2 1VR3A 2GH2A 2RDRA 1N1YA 1XNAA 5GALA 2XQXA 1RUH1 2ADEA 2RS12 4XFIA 1WLWA 3AKRA 2PFWA 3A7QA 4LULA 3KM5A 2B5HA 2QUOA 4B7EA 3H8OA 3W5NA 2QZ2A 3V65A 5JI7A 3Q8AA 4GQ7A 3USSA 3FFQA 4AFAA 5A3WA 4EZ4A 2ERFA 4ZXKA 4O61A 1Q8OA 4M3CA 1RUI1 5GLWA 1VRH3 3AKQA 2KM2A 1HRI2 4JGZA 2TNFA 4LKEA 3HQRA 3ZXKA 2J1AA 5K8SA 1EV13 1LODA 1H1IA 3TYJA 4CDUC 1IQAA 4DO0A 1N3OA 4DINB 3OOXA 1H8TB 4HKLA 4RD7A 3WXPA 4AE2A 2B9UA 5GJ6A 2GNTA 3C7FA 2XLGA 3CLPA 4XXAA 4F3JA 3S7IA 4XMAA 4IEPA 2C1FA 2PA7A 3ZOIA 2F6BA 4EQVA 4BXFA 3L2HA 2XVLA 1LHUA 2ZEZA 5JOWA 1K5JA 1AL21 4BXSV 3AVRA 3M1HA 1LGCA 2VZ3A 5FBZA 5FK7A 3ZSMA 1EAH1 5FLHA 1M06G 5CAZA 1CN1A 2LW8A 4GD4A 4XBNA 4XJAA 3WG1A 3D0SA 5ERLA 3BTAA 3ZIXA 2WS92 2C9AA 4LPLA 4TLFA 2EAKA 4D6QA 1DGLA 2D5FA 3DXUA 5C3OA 2XB6C 4MGKE 4D6RA 4DY5A 2JG8B 4AQ6A 4ZS2A 5CBLA 1QOOA 1AR81 2VVEA 1BMV1 4BLJA 1GZWB 1WUVA 1DQ0A 4AQSA 4BB3A 1NAEA 1DZTA 2FBEA 2WZ8A 4G3YC 4FPEA 2B7YA 1RUI3 1C57A 2EAAA 3RG0A 4PBOA 3LSDA 3VD5A 3N4MA 1D0GA 1YFXA 4NE9A 4QGMA 1BYHA 5GLVA 5F5QA 2JECA 3IT8A 3CO2A 2LS6A 3NMBA 4AEMA 3T0DA 4FQ4A 5JZGA 3POEA 1OMIA 4XFAA 3T1LA 4XILA 3PNAA 3BUCA 3NJZA 1H8TA 4WVVA 1C28A 5CFCC 4YRDA 3VDDA 4IGPA 3GHMA 3K46A 4NAOA 1YI7A 3LGRA 4LBOA 4LO5B 4XFHA 4EN7B 3ELNA 1W9FA 1ZX5A 4DRRA 4Y22A 1FV2A 1PGL1 1NQJA 5CNAA 4FOWA 4KH9A 1EAH3 2RMU1 2UYBA 5IK7A 1IG0A 4CDXA 2OIIA 3OJBA 5IVCA 3WP5A 4OZXA 4CRQA 3W58A 1NLSA 4ORFA 3JUUA 5D2AA 3CBNA 4YYOA 4N7UA 1RXGA 5FZOB 3ZM8A 3S5AA 1PGW2 1UU6A 1AR83 4E2SA 1YUDA 2Y6FA 4YM2A 4RGAA 1OH3A 5F32A 4AW7A 2CAVA 4P9YA 5FO9B 1AYN2 2Q1ZB 4MLOA 2JDNA 2FZ2A 2R7EB 2JG8A 2VOVA 5JOYA 1V6MA 3AYDA 2BWAA 3WF1A 4L2NA 3VN4A 1X33A 1VPHA 2HH9A 2K0GA 2R6QA 1JBCA 1MS3A 1XYPA 2WZEA 1LOEA 3GALA 4CCLA 1KFUL 4Q8KA 1H9PA 2G9ZA 1N1SA 2JG9C 4IXLA 1SLBA 1X82A 4LO6B 3U0ZA 5CISA 3H7YA 3OBRA 4JQTA 5E8AA 2HEYF 3SISA 4W65A 2BERA 1NE6A 3C7EA 4TZDA 3HJRA 2W39A 2VOKA 1NCQB 2ZZJA 4CDQA 4IERA 5JOZA 1UY4A 3NJXA 1ULDA 4V2VA 5L73A 2A3WA 4QPGB 1WWYA 3SH3A 5FZ9A 5A3UA 1QJU1 2D3SA 1D4M2 1POV1 1RUOA 2OW4A 4JDMA 4CP9B 4YVWB 1RVF3 2XL9A 5FY4A 1JTZX 2JDZA 3N9MA 3PVOA 1AVBA 3J4UH 4CU6A 1F9KA 4EE2A 1W6NB 5T5LA 4MGIE 3EO6A 5A7QA 2W08A 2R30A 4MX3A 1GP5A 4WZFA 2VNOA 1Q56A 1NCQC 2Q8EA 5C33A 2PXJA 3BALA 5EP9A 5FMCA 4PHZA 5JPNB 4CCEA 4BYYA 1QHDA 2VBDA 1OURA 3N3HA 1CAWA 5LA9A 3RQ0A 2PAEA 1ENQA 4DXSA 4WZCA 4YVWC 3AJYA 4I0AA 2IZWA 2WAOA 3PVBB 4BISA 1CX1A 1CPMA 1UYYA 4AHXA 3S6PA 2DVFA 1OA3A 1TME1 2CDPA 2J7MA 5J09A 3IMMA 1PK6B 2R042 1U5XA 5IVFA 4MHRA 2D40A 1A8DA 3AP6A 4UFJA 5EPAA 1QJU3 5KR7A 4AGVA 1MQTB 1CZVA 1VIWB 1AZDA 3SCHA 3H8XA 4DEQA 1E5IA 2NP0A 3HD8B 4K1ZA 1GQGA 4EWEA 2NQYA 3LA2A 4RQPB 3JU9A 4SLIA 2WN2A 5JI9A 3CJXA 1C3HA 3N9LA 5FR3A 4A4AA 5D21A 3QOPA 1NY71 4KQ7A 2QKDA 5F1RA 3OSDA 4M0HA 2VJXA 5A3NA 2HEVF 5F3GA 1VJ2A 4ZY9A 4A42A 4KWLA 3VBHC 4QMAA 4CCCA 4ZKTB 4RR3C 2V5DA 4GMP0 1X7NA 3POWA 4NOTA 1QOSA 4J25A 5A3OA 4AVTA 5A7SA 1CWPA 3NNJA 3BU0A 4RQPC 2CGNA 1TME3 3HNBM 1X50A 3AZXA 1IPSA 3H0OA 5KXBA 2HKXA 2ZGNA 4H2AA 1FYUA 3EBRA 3ZX7A 2P6HA 2JDUA 3KV9A 2LROA 3EXUA 3I3DA 4OUMA 4W6WA 1JZ8A 3BI3A 1JYWA 3I3MA 4KGQA 2ZBJA 4DXTA 2BEOA 3T1MA 5A3LA 4RHV1 1QIQA 1DLCA 2XLAA 3ZDVA 2DV9A 1W0PA 3KV5A 2DBIA 1B09A 4QX1A 5FPLA 5F5IA 2PMWB 3WW1A 1CR7A 3DN7A 3JBG2 1OPOA 2VAUA 4YFWA 4WVMB 5FZGA 3V0AB 4MH0E 3TEWA 2LRPA 2E51A 2RVAA 3ZN6B 2FD8A 3AMHA 2JD4A 3HN3A 5DAQA 5JXJA 4OUEA 1OT5A 1OLME 2C9KA 2VUDA 2WJSA 5FZBA 4KU7A 3IMNA 5KHIA 2BFUL 3AMPA 4DEVA 3IM0A 1C8NA 2WWSA 4YW5A 3ZYGA 4UFKA 1W6OA 4IV3C 3O1RA 1ND2B 3GZEA 2DUPA 5FP4A 4KWUA 1EP0A 3CDZB 4N43A 4P5YA 5FXXA 3WDVA 3ZSLA 4AG4A 4QXHA 3RWNA 1PMIA 5I91A 3H50A 4YW3A 3VLBB 1F5JA 4OULA 3M3QA 2FMYA 1OFSA 4ES8A 3VHPA 1RUE2 1HRV2 1PMJX 2KR2A 1PNGA 2LTNA 2YFUA 3H9AA 2OZJA 2WQ8A 2D6KA 4BQ3A 2DBNA 2JENA 3RMYA 5JXIA 2E7QA 2PAKA 4CU7A 4Q8LA 2FQPA 5GKAC 1J84A 2YC0A 1BKZA 3VBSB 1IS6A 4BQWA 5LY1A 5AC93 2XDVA 5HI0A 3LDKA 1Q43A 1G9DA 1DBNA 4L0PA 4AEKA 5ACA1 2JDKA 3PLQA 1FNZA 4AI2A 5ABJC 4FPFA 3LEKA 2LM3A 1SBFA 4XJWA 1YCIA 2QDRA 4LKFA 2WNVA 4Z92B 3TN93 4IESA 2W46A 2AGSA 1PVXA 1UQXA 1O3RA 5IATA 2EXIA 1TMF2 1OBNA 1V6IA 1CAVA 1D0HA 4XIKA 3M3CA 4AWDA 1DDLA 4XF1A 4ZPIA 2CTVA 1SFPA 1VAVA 3WR0A 1W06A 1XBFA 2DUQA 5LZ6A 2QQNA 1M4WA 1PO21 4HT1T 4XURA 5FV3A 5KBFA 1PIV1 1WBFA 5FZAA 3VBRB 2CNAA 1ND2A 2FCTA 2WZR1 3CF6E 2G9GA 3VBSC 3WDYA 3VZOA 1W3XA 3CL1A 2YYOA 1JZ5A 2UWBA 1H4GA 2ZX1A 4HSLA 4IQPA 4YVSB 1FAYA 4OMDA 5C7GA 1BZWA 1N3QA 1R1A3 5JOXA 1VBC2 3LWCA 1YIFA 3I59A 3G6JB 5HXMA 4NMIA 3ABZA 3MBWA 4JZRA 3VDAA 2OVUA 4Q0SA 1NXMA 3ZN4A 4LR4A 1BEV1 3VBUB 2OUHA 2VZRA 5JCTA 1W9YA 3PTRB 3VB9A 5FYZA 5ACA3 5I8SA 3ILNA 4MGQA 4KU8A 4LBQD 4E8CA 4QQ2A 2XJPA 4JKLA 2TBVA 2FDHA 3WQ0A 1Q8VA 1JZ6A 3DL3A 3VBRC 4Y3OA 3WF3A 3CNAA 3GDBA 3K4DA 5FY0A 2ZGSA 2QQMA 3VKNA 2XBO3 4I30A 3WDTA 3K51A 1ULEA 2HWB1 4YVSC 1L7QA 2C6SA 5LBFA 1GR3A 5BNOB 3IWZA 3ZVXA 4XOGA 5C6CA 2RR13 5L36A 3CHXA 5FZKA 3W20A 3I49A 2WZR3 3T0AA 2HWF1 3VHNA 1RUF1 3VBUC 5IAXA 4TTGA 1ZBE2 1PZ7A 3NNFA 4EN6B 4LO7A 4R9DA 5F6KA 4DPNA 3J8F2 4P9XA 4FPKA 3A21A 5HCBA 3VD7A 1S0JA 3BKZA 3AJZA 3HN1A 4AHYA 1E57A 2AEZA 4N53C 5JUVA 1QNWA 5DDJ3 1LESA 2ZMLA 1Q8QA 1QKQA 3PU3A 1AX0A 3LF7A
chains in the Genus database with same CATH topology
1JOJA 3AX4A 3URFA 2K9ZA 2DCTA 5KWRA 2PHXA 1WCSA 1MZ5A 4AEDA 1AR92 2XVGA 2PHRA 3POYA 4LLOA 2ZOEB 1RJ8A 4MGYE 5BPXA 4AVBA 4MSVA 2NYYA 1Z0HA 4Q1PA 1C5HA 2JE7A 1COV3 1BXHA 3O12A 5BYNA 1XXNA 4YGCA 2IXHA 1IKPA 1KJLA 4XEZA 1DQ5A 4XFFA 4XFGA 5C8WA 1JXNA 4HMZA 2R072 4GWMA 1H0BA 2ZMNA 4Q4Y3 1VBE2 3ZFFA 1WMDA 4B3NA 4LA3A 1KRIA 2VUJA 1JUIA 4GB32 2XJQA 1ZBA1 1GANA 2JEMA 2ZGMA 4OHZA 1PZ8A 1HV1A 1Z7S1 4LBQB 4DXZA 5JSPA 1I6XA 3OGGA 1V9U2 5JR7B 4NR1A 2WT1A 5DZFA 2E53A 3P3NA 1IKQA 2QZ3A 4PDWC 1KDKA 2XG3A 4KL1A 2P34A 1NA1C 4CEYC 1DYKA 5I0UA 1URXA 1CJPA 1FOD3 1OA4A 1LEMA 2XLFA 2ILMA 1DGWA 1OQDA 4BLIA 3V0BA 1QXRA 1VBA2 2EVXA 4Q4V1 2LUWA 4COWA 1IGOA 3G7DA 3KLSA 1PVC2 2D44A 4YM1A 2ZHKA 1B35A 3M4FA 2D6LX 1N47A 5C4WA 2GC1A 2JICA 3DPRC 3E6CC 3RYPA 2E9QA 5CADA 3PHMA 5CVRA 5K9YA 3ZFEA 1X8EA 3DV8A 1ZZ9A 1Z7S3 3MGUA 4AVSA 3KMHA 2BFUS 4IV1A 1ZZ8A 1AYM2 4FT8A 1H9WA 1VP6A 4D94A 5EYYA 2DVAA 1G9BA 5CG8A 2B42B 2AZ5A 4S2DA 4XQDA 5T3NA 4AQTA 4YGEA 4Q4W3 4F83A 1ENSA 1FXZA 4YFZA 5L7OA 4IEWA 1F8VA 4Y1YA 3UKTA 4OI0A 2RS51 3N36A 3R6SA 1LU2A 1QH6A 2MEV1 1QH7A 4COYA 4WVWA 1YFUA 5JSRA 4IEYA 4YZ5A 1LOCA 1ZM1A 1HV0A 2UYAA 1ULGA 1LRHA 1WW7A 4YNIA 3PJQA 1PZ9A 2A7AA 3JD71 4EROA 4HBNA 2JKBA 2E7AA 1T6GC 2DFCA 4FPLA 1FPN2 1LENA 3AMMA 1GNZA 3FC0A 1N1VA 3FHIB 2PHFA 3M3EA 3ZXGA 1AF9A 2ZX0A 2XJVA 1K5MB 1HXS1 4YM0A 2GZWA 4WV8A 5BNNB 2YV8A 4FSJA 1CAUA 4D7SA 1RL3A 3H3UA 2WINB 4M01A 2Q30A 2GNDA 4WBBA 1ND3B 1VBB1 3AXDA 3U11A 1Y3TA 3E97A 4QQLA 4Y1ZA 1W6MB 1W6PA 1MS1A 4LTAA 4ZU5A 1QQP2 4WM8C 3AMNA 4ASMB 3USUB 2MEV3 3ZYPA 4BIFA 1H4HA 1AR61 1I3HA 3NAPC 2R16A 2R061 5DUVA 4NWWA 2ZX3A 4Z82A 2R1DA 5HCFA 3S30A 1R082 5I93A 3FWEA 1RUC1 5C8CC 3WZ1A 4C91A 2XKOA 1S0DA 4H7LA 2XH6A 4ITCA 2HEWF 2ZA9A 2ENRA 1RHI2 2PHUA 4AI8A 2CV6A 1QXJA 3HAGA 5I0SA 3IPVA 3Q9OA 4XJZA 1VBD1 3N7JA 3RMXA 1QMJA 3KGZA 3AFGA 1AHSA 1UCXA 1AJOA 5BNPC 2E63A 5BNNA 1U5YA 4XZPA 1RINA 1OOPC 1RJ7A 2OZ6A 1QDOA 2QDNA 2WSVA 1RMU1 3BCWA 4V1PA 3VBFC 3ZFGA 1O5UA 4M3CB 1ND3A 3VUOA 4OI1A 3LA3A 3VZLA 2W52A 1W6MA 1O3QA 1AR71 2AYHA 1WW5A 4MZUA 1R093 2DCZA 3USUA 3OTFA 1QJX1 1RUG1 3LA7A 1RUC3 2RS31 1H8VA 2FZ1A 4GH4B 3D82A 3M8LA 4XTPA 3I54A 2OPKA 2O8QA 3O7OA 3ASIA 3GNEA 3JQWA 3VZJA 4YG0A 1J58A 3KZ4C 1GKBA 3B02A 2WFF3 3AZZA 2YXSA 4R4ZA 1LOFC 2HJIA 4Z8BA 4JGZC 3WX5A 3ZYIB 1HQWA 3FMGA 2P3IA 4AI0A 1ASJ1 3B9IA 1RMU3 4JTOA 5A32A 4ES9A 2F4PA 1C8M1 1LGNA 2D3PA 2VY0A 3OYWA 3MIGA 2P37A 2Z42A 2UWCA 3VV1A 4FVVA 2RS11 2NM1A 1QJX3 3N7LA 1IS4A 2QFEA 3WT3A 3PMSA 1AXKA 4NN0A 5JZGB 2HWE3 5LRRA 4YM3A 4XF9A 1MEC2 3VDDB 4CP2A 5JVVA 3KCXA 4BMEA 3SMHA 3B94A 4LLFA 2XJRA 1WA4A 4LBKA 1HRI1 2QCSB 4GH4A 4Y22B 4Q27A 2WA3A 5LRSA 5KHHA 4D7TA 1A6CA 2HWC3 4HPKA 2TUNA 1XRUA 4H55A 4CDXB 4K3UA 2O8OA 4NHKA 2R32A 4HETA 4DY3A 4PIZA 1Q3EA 1REEA 5FFOC 1ASJ3 1EPZA 2BQPA 3QACA 2GH8A 4L9BA 4F7ZA 1G7YA 1Q5OA 1RUH3 1S0FA 4CYDA 3A0NA 4X8NA 1NCRA 4QPIA 2D43A 3OD0A 2VW2A 4HN1A 2ZS6B 4DB5A 5C9AA 1H8TC 1C8M3 1KD7A 5EXOA 1QU0A 3T2TA 5D8AB 2B46X 3VDDC 4A2UA 1UPSA 4PF5A 1QJZA 2WS91 5DG2A 1QGLA 3UJOA 2OUJA 1IPJA 2DVBA 3AM2A 3SLIA 1AR82 4CDXC 3O0VA 1MS9A 4K8FA 2W0XA 2BBVA 1V70A 2ZCWA 2EXHA 3R05A 1KXGA 4CDQB 3DKWA 3NV2A 1LR5A 2VVFA 2MPFA 3N7KA 5BUVA 1WW6A 4YSFA 1AL23 2JG8C 5J96B 2ZX2A 2A6YA 1UU5A 3WP4A 2V73A 3GBFA 1DQ2A 1ULFA 5J37A 2X29A 4BPZA 1YRZA 3RI9A 3RZZA 3D5OA 4B8EA 2FMDA 2D6NA 4RA0A 1RC6A 3MFCA 1LB2A 3WCRA 5CG9A 1HQNA 1AL0G 4L99A 4CDQC 1CJDA 1RVF2 4FP3A 3AMQA 2PELA 4L92A 4UBGA 4BZ4A 5D8AA 2XGXA 1CAWB 3OBTA 5A3MA 1PGW1 3ACLA 2XJUA 5FPZA 3GZTB 3N7MA 1YXWA 1AYN1 1ZA4A 4Q4X2 3K48A 4Q0UA 4HLTA 2DURA 3LKJA 3ZSJA 4XQ4A 5CFCA 5FAXA 5LEKA 1TNRA 4Q26A 2RMU3 3MLJA 4KWKA 2D3RA 2BTVC 4QU2A 2HWD1 1LTEA 4Y1UA 1OHFA 1G86A 2UY8A 1O3SA 4HK9A 1PO12 4R9BA 3RYRA 5IT6A 1XQNA 1D4M1 5JMCA 3UL2A 1RUD2 4I09A 2ZPXA 3AKTA 4CDWB 2D5HA 4QGNA 4QPGC 3ZXEA 2JG9A 1AYN3 4Y1VA 2YUEA 5GZEA 3RJ2X 5GM0A 2QE3A 3FBMA 4LBJA 2DU1A 1SBDA 1NQDA 3M3OA 4Q29A 3TNPB 2VNGA 2VQ0A 1REFA 2AUYA 2LALA 5JPMB 4Y20A 2DVDA 4HVRA 1SCSA 1POV3 2ZGOA 3JQXA 4AFMA 1MACA 2PLV2 1OA2A 2HWD3 2MHFA 4GWNA 3H1WA 4LUKA 3MF6A 1WD4A 2A73B 2JE9A 3MI8A 2R041 4P5HA 2DYCA 2VUAA 1U12A 4BOWA 2QQPA 2GNBA 1MR5A 1D4M3 2G9FA 2CWSA 1XNDA 1HDKA 4Y5Z0 3R4SA 3B9CA 5IK4A 2D6OX 2TEPA 1OSGA 1W6OB 1PHMA 4Q0QA 2ATFA 3M3IA 2Z5WA 4BIOA 4N43B 1FI2A 1PK6C 2ZHMA 1HIXA 1KFXL 4CDWA 2O1QA 4MGZE 1MQTC 1S0BA 4XPVA 1PM7A 2VG9A 2ZACA 1HW5A 1FATA 1NLRA 4QD2A 4HVQA 2Z2SB 2ZKNA 4QGLA 4XIOA 3SH4A 4C1WA 2A6XA 1LHNA 3FFZA 3LCPA 4ATEA 2VW0A 2XJTA 1WW4A 5AVAA 5JIAA 2WQ4A 4AFCA 4AVAA 1FMD2 3GBGA 5K0UA 3C2UA 1UW8A 2WNVB 4FPHA 4NPRA 1RGSA 1XNBA 3WD5A 1OLRA 1CAVB 1LHWA 5FCCA 5B2GB 5AC92 4UW5A 4GALA 1DHKB 4LO4B 3ZPYA 3JBG1 1A8MA 1XU1A 4RR3A 1D4VB 4OFGA 4K7JA 1JW6A 4DFSA 1J59A 3TN92 4AHZA 1IZ3A 5CB7A 5JSOA 4XF3A 4EWDA 1VLNA 4JRAA 2ZGQA 4PCRA 2CAUA 3I59B 3ILRA 2ARXA 5AFBA 4OVEA 4C0HA 3FJSA 4DZGA 2JXAA 1ZRCA 2CYFA 4XETA 4G4FA 2SBAA 1OPMA 1YJLA 1ZNPA 5FOJB 4RHV3 1RUE1 1HRV1 4XJUA 5E89A 5J98B 4P9IA 1F2NA 1XNKA 3MICA 4JDNA 1R1A2 5IK8A 1ND2C 3AP7A 3WLUA 2WL1A 1SQ4A 1J3QA 5KHKA 1H30A 2WLPA 3E5QA 3TOJA 1JHNA 5DUWA 4B4RA 3ZXAC 5BV6A 4LT5A 4LNVA 4Z2WA 4HKOA 1I5ZA 2C0ZA 4L8QA 5ACA2 2ZGTA 2YPJA 2A3XA 2BGCA 5CA6A 2DU0A 4IV3A 3LB9A 2I45A 1UD1A 2BNMA 4NO4A 1H2KA 2KXLA 4E27A 3L9JT 4K40A 2XBO2 4FPOB 3ZSKA 1TMF1 4UW4A 4N7IA 1CPNA 1O4TA 3KQRA 4GXLA 3KB5A 2RR12 4IL7A 3CJIB 1SFNA 4XFCA 5FQ0A 1O7FA 4AEDB 3ES1A 1RUE3 4HL0A 2KA3A 2Z79A 2B8MA 4YARA 3ETQA 2WT2A 3GBWA 4CP1A 4ZU4A 1MZEA 1VBC1 3CEWA 5SV5A 1Y9QA 3JB8A 3AZWA 5DDJ2 5ABJA 3MZHA 3JZVA 4XFBA 3WOGA 5T5JA 4FXKB 3U4XA 1BVP1 1MS8A 2BNOA 2HYKA 3EQEA 1BQPA 3TBDA 2P3JA 3ZFFB 5EWSA 4PIYA 1PO23 3WUDA 5LK5A 3OY8A 1PIV3 4AEDC 1COV2 3DF0A 3RNSA 1MVQA 1AX1A 5FPXA 4OHXA 1UKRA 1LECA 1YHFA 4QPYA 4COUA 3MIFA 4B29A 4FQZA 5D1IA 3VKMA 4AGGA 3TRSB 3PJYA 2Q1MA 2DWRA 3QBQA 4Q4Y2 2YROA 5T54A 2QJVA 4Y24A 2WT0A 3CJIA 1ZBE1 1BEV3 3HT1A 3J8F1 5E88A 1G8WA 2ZGRA 5BNOC 2D97A 4JRLA 2VOXA 4X8PA 4NHMA 1YYNA 4JQRA 3V0BB 1V6JA 1V6NA 1OI6A 5DZEA 1AR91 4HK8A 2XWJB 1VALA 1B35B 4K9SA 5J3UA 2HWB3 4LE3A 3RYKA 1NE4A 3POSA 1BVVA 5C4WB 1FOD2 4XXPA 4ISRA 3RS6A 1AXYA 3WUCA 2BVVA 4YLZA 2RE9A 2VECA 1AJKA 4R4XA 3ZFEB 2YY1A 4E4SA 2HWF3 4S2FA 1RUF3 4XJ8A 3VBOA 3KCYA 1DG6A 2DVGA 1GZ9A 4IV1B 2GSYA 3N35A 2R071 3ZXFA 1REDA 1G9AA 2WKKA 3AK0A 4OLLA 1Y7BA 4QHBA 4BH9A 1OLQA 1OFNA 1VBE1 1FT9A 3RI8A 4FO9A 3J8F3 1A78A 2OA2A 1YJKA 5L7OB 2IFRA 5T50A 1QOTA 5I8TA 3E5UA 1UN1A 4W6YA 5GLUA 5C4WC 1V9U1 3S7EA 4Q0VA 3NSTA 4FOVA 3KT1A 4XF4A 4YW2A 3LAGA 3ZFEC 2I07B 4IEXA 2CL2A 4CTEA 1AR93 2H0VA 2A6WA 4Q4W2 3NW4A 4H7MA 4PJYA 3ZYRA 5AFEA 1LULA 3SH5A 3A4UA 1ZZCA 1FV3A 4WM7A 5KHJA 4KGGA 1GICA 4ONUA 2IXKA 4KG0A 1VBA1 2CGPA 5L7OC 4AYUA 2X5IB 4N9HA 1MS0A 4PLNA 4TWTA 1ZBA3 4ASLA 1CAUB 3AP5A 1UL9A 2R073 1BCXA 2XKPA 2A70A 1H2MA 1RIRA 4JGYA 2D7FA 1VBE3 2AH2A 1BBT2 1CONA 1UIKA 5IK5A 2H0BA 1LCLA 4I3PA 4XHXA 1W6PB 3SHRA 4YW4A 1QF3A 4PBPA 4CEYA 5JDBA 3IIAA 4R52A 1AYM1 3AYAA 5E1RA 4YZ2A 4C1XA 3R4DB 2QVSB 3TAYA 4Q4V3 1POV0 2R0HA 2PTMA 1VB4A 5BXXA 1FNYA 2ZGPA 3B7MA 4QX5A 5FLIA 4GMP1 4FPCA 3JCIA 5H9PA 2WIIB 1GNHA 2GMEA 2RM21 1ZRDA 3IPVB 5JLVA 3NO8A 3TB0A 1NXD1 2UWAA 1VBA3 4AVCA 3MIBA 2D98A 4MV2A 3MW3A 2WNUA 1ENXA 1FPN1 4XE9A 2ZHLA 4LO8A 3RDIA 3WINE 3WQ1A 5FOBB 1CX4A 2X5IA 1CD3G 4OI2A 3ZFGB 1ENRA 1SACA 1GQHA 3MIHA 2H6BA 2WSUA 1AXZA 1KITA 5IUQA 1S0EA 4PQ9A 4Q0PA 4YGDA 3M70A 4CEWA 2DUOA 3E6BA 3D4KA 2RS53 3INAA 1WMFA 4Z1VA 5KXEA 1F5FA 3OGJA 3NV4A 3VZNA 1GYKA 5LEJA 2ZMKA 1K5MC 3JD73 3UJQA 1QQP1 3MF9A 1RUJ2 5BNNC 5CU1A 2RM23 4B7KA 3GZAA 4XTMA 1NOVA 1WD3A 1R092 4IEZA 3ZFGC 3U07A 1ND3C 2NMNA 2AR6A 3I8TA 1R081 1HXS3 2EXKA 2Y0OA 2GN3A 1FPN3 5CFDA 4QQPA 2R1BA 4QT6A 2VVDA 3FUQA 2WNEA 1DQ6A 4FOQA 1RHI1 4GKYA 1I9RA 4JC1A 3HMYA 2Y26A 5A32B 4I0WB 4JVAA 3ZIWA 1VBB3 4ATFA 2EF6A 2WFF2 3ZMOA 4Z07A 1QXPA 2FHRA 1CAXA 4J6GA 5DUUA 3OYWB 4R8HA 4OHYA 5BNQA 1MZFA 2ZGLA 4NHLA 1MS4A 3X29B 2XVKA 1AR63 4RS5B 3PMEA 1IS3A 2H6CA 2R063 3LSEA 3NAPA 3KS7A 3D8CA 5HXVA 3OD4A 1KS5A 3TNQA 2IXIA 4B4QA 2BW8A 1L3JA 2PHLA 2ARBA 3MYXA 4M3CF 3ZSEA 1U0AA 3NKGA 1J1TA 3WW2A 4FAGA 4D3WA 1ZRRA 1VRH2 1WCDJ 4HPKB 1H1AA 4D7YA 3IDCB 1QJX2 4DOUA 1NZCA 1R083 1EV12 1VBD3 3S0MA 2HWE2 2WLQA 3NWKA 4HFSA 4YGBA 2RJKA 1W0OA 2ZX4A 1RHI3 1SLLA 4JDOA 2DTYA 2VU9A 2X53S 4TSVA 1NCRB 4QPIB 5C9AB 1IOAA 1S1AA 2HWC2 2VULA 1OOPA 1J1LA 1FX5A 3MFAA 1QNYA 3VBFA 1S0CA 4GH4C 3IDBB 2XWBB 1IS5A 2EIGA 3O0WA 1QJY1 4K21A 1AR73 1RUH2 4CDUB 1O5LA 4BWOA 5DG1A 1RUG3 4BM8A 4JV4A 4RS5A 4P9WA 2RS33 1V6OA 4QQOA 2VOWA 1IPKA 1VB2A 1RUNA 1RUI2 3VHRA 4QQHA 3VZMA 3LZZA 1NCRC 2XUMA 1GBGA 4QPIC 1GSLA 2ZTNA 4HN0A 3AYEA 5C9AC 5H9QA 4U2AA 1U5ZA 1UX6A 5J7MA 2A75A 1ZREA 1MZ6A 3ATGA 3BODA 1LOFA 1MEC1 3B69A 4P9JA 4AXOA 4KNCA 3SXWA 3P3PA 4FTEA 4INDA 3WW3A 2D93A 1RB8G 3C3VA 3FLRA 1PNFA 1CESA 1AL22 4N9IA 1WLDA 3MLKA 5JZGC 1WLTA 1LOGA 4AI1A 5HCAA 1EAH2 1EY2A 3VZKA 1QJY3 2JJ6A 1IHMA 1RTVA 4O9GA 3DUIA 2UY9A 2RS13 1OQEA 1UIJA 4YW1A 1DZQA 5EV7A 4R9CA 1D2QA 1EPWA 1BMV2 4CDUA 5I0RA 3LOIA 3AB0A 5CFCB 3QCWA 2Y0IA 2UU8A 4I0BA 4K20A 3VKFC 3FBYA 3ZXDA 1HRI3 1TE1B 3KGLA 3FZ3A 2MNGA 4YZ4A 4CZSA 1OQ1A 2ZGKA 1SLAA 3EJKA 2EA7A 1MEC3 2GMPA 5JIUA 3IKWA 4SBVA 3O14A 3QLQA 3A0KA 5D8AC 3FUOA 1UAIA 3MLLA 3GZUC 3V64A 1SBEA 1SLIA 5J36A 2VXRA 4KG8A 3GHNA 2R0FA 1U5IA 2RJLA 1LGBA 1PGL2 2YZ4A 1V00A 2RMU2 1WGPA 1UU4A 4PLOA 2W68A 3QD6A 2WS93 3M2MA 5FTTC 2JG9B 4HZFA 5F9TA 3OF1A 2YMZA 1ZRFA 3O0XA 2D6PA 4E2GA 5FDBA 1RVF1 4AGRA 2P3KA 4R9AA 1KJRA 4COVA 4Y20B 1UPIA 2CGOA 1DGWX 4FBFA 2GC0A 2E6VA 4H14A 4Q4X1 4HANA 4XJ9A 4YZ1A 5KC6A 4DMIA 1GZWA 3KT4A 4UW6A 4N90A 4GIQA 1H1MA 3WVJA 3ZMNA 4AFBA 1AUYA 4IETA 3WDWA 1F31A 5T55A 1RITA 2VQAA 3L2YA 1QJU2 4FPJA 4FP2A 3ST7A 3NV1A 2HWD2 4JAAA 5JWPA 4H3WA 4M00A 4YG6A 1PO11 2YDEA 3THTA 5KC5A 4NVPA 4LHLA 3ZYJB 5FO8B 1RUD1 4AF9A 5SV8A 3NKTA 1LJ7A 2AENA 4YG3A 4IEVA 3LOBA 3AKSA 5FREA 1DFQA 3AZYA 4Q4X3 1MS5A 1W39A 1YWKA 2VNRA 3ZXJA 4BE3A 1JH5A 4CP0A 1C5IA 5K0UB 1SMVA 1I1EA 2C5DA 1TME2 4CDWC 1ZZ6A 3THPA 1DF0A 1EYBA 2O0OA 5DUXA 3APBA 2PLV1 1J3PA 3ZDSA 1PGSA 4P9GA 3VBHB 4COZA 2I74A 1ONAA 4RR3B 4X6QB 2PHTA 2DF7A 2AREA 1PO13 1NCQA 3ZXLA 4IEUA 3WG2A 4EN8B 1NY72 1O4YA 1RUD3 4QPGA 4IEOA 3MDPA 3WHUA 2V09A 2B39A 4JCKA 5K0UC 5GLZA 3H8UA 4YVWA 1XE7A 3HWJA 3IN9A 1UMZA 3KSCA 1R1ZA 1HX6A 1W6NA 5FLJA 1SCRA 3KT7A 4FOYA 4LA2A 2BNNA 1VAKA 4FTBA 3WV6A 4E2QA 5KXDA 1QWRA 3VGIA 2R043 4N43C 3H1YA 4GA9A 2E7TA 4BQ1A 2PLV3 1G6NA 2ZABA 4RHV2 4GKXA 3WG4A 2YGLA 4IV3B 1FMD1 1UZYA 4ZU7A 3PVNA 3VBHA 4LHKA 1PK6A 5AVPA 2ZKLA 5TSWA 1JYIA 2YGMA 5I0TA 4O9EA 3R0RA 4Y1XA 1MQTA 1KDMA 5AC91 5EYXA 1KS4A 2A71A 5T5OA 3KD4A 4TYSA 1XYNA 2UURA 2Q8OA 5JAXA 4RQPA 5FQ0B 3RRDA 3E6DA 2XHKA 4OHVA 4LE4A 2BVBA 2WNVC 4PIXA 4JTNA 3TN91 1XE8A 2EALA 4XBLA 3BU7A 1DQ1A 2EXJA 3ZO0B 3MW4A 3B01A 3UKVA 4Q1RA 4D69A 2D6MA 4BHPA 5A33B 5ABJB 4MXVA 4AFDA 4BMBA 3I7DA 4XDQA 4AK3A 2DCYA 3VKOA 3ROUA 3VL9A 2Y38A 2X8KA 2ZAAA 1MVEA 4BCUA 1FMD3 4S2HA 3AXEA 3CU7A 1R1A1 3WCSA 3OY8B 2NPIA 3JBG3 2ZHNA 1SEFA 4XBQA 1UZZA 4RFT0 4XMIA 3PTYA 5LK7B 2CWMA 1LOAA 5FMOL 1TQ5A 1JN2P 2XPJA 1XYOA 4KBBA 2IXLA 4MYEA 2BWCA 3KCCA 3WNXA 1PO22 4URTA 3VHOA 1PIV2 5E16A 1ALYA 3V0AA 4HSJA 2WZR2 4WVMA 2XBO1 2ET1A 3ZN6A 1X8MA 5F6LB 1AX2A 1HRV3 1KQRA 2GU9A 2RR11 3ECQA 1SFYA 1CGPA 2NZ9A 4AI3A 4AVVA 2DFBA 5A33A 1BEV2 1V6LA 5T52A 3OPZA 3HT2A 3WP3A 5L19A 2PHDA 2VMGA 5DDJ1 3CJIC 3BIWE 3VBOB 2BPA2 3JB4C 4FXGB 2RHPA 4M0NA 2GAUA 1N3PA 1Y43B 1ZZ7A 3ME2A 1YIPA 4DS0A 1WLCA 1TMF3 3VBSA 2WC2A 2HWB2 3ALQA 5EJ3A 2PN5A 4N53B 3W59A 5FRAA 4Q2FA 2ZZQA 1SLTA 2B45X 1CIWA 2GNMA 1COV1 1ZVFA 2IC1A 3D6EA 2VMIA 2HWF2 1RUF2 2A6VA 2ZAHA 2CY6A 3HIFA 2G4IA 3WY6A 4F8AA 1GLHA 1VBC3 1YI9A 1YO8A 4S2GA 4META 3VBOC 4Q4Y1 2PHWA 4QM8A 3ZFFC 4EJRA 4LBNA 3DGTA 1O3TA 3VBRA 2VMHA 4MVTA 1XU2A 1GV9A 3BOWA 4MXWB 4WM7B 1LKNA 1BJQA 1OD5A 2ZJCA 3FE5A 3GYDA 1WBLA 2A3YA 4XF0A 1A3KA 4YVSA 2WFPA 4FPYA 3WHTA 1SDWA 4LEJA 1O4ZA 1DGRA 1S0IA 1XNCA 1GFF2 4P9LA 4RGGA 4I2OA 2XJSA 4OI4A 2VW1A 3VBUA 3AFKA 1X36A 3BOPA 4JGYB 1FOD1 4LBMA 3J26N 2NN8A 3B93A 5GZFA 2GALA 2QNKA 4PDWB 3ENRA 5K7PA 3H7JA 4N53A 1DGRN 1NA1B 2JX9A 1ZBE3 2SLIA 4CEYB 3FLTA 4GB31 1LHVA 5CIRA 1ZBA2 3H3ZA 4UBHA 4WM7C 1B35C 4FPGA 4EN0A 1Z7S2 2ZGUA 3EHKA 5BNOA 1S0GA 2IFWA 2BUKA 3WDUA 2ET7A 2Q4SA 2GMMA 2P17A 3HQXA 4M3CE 4NWVA 4C0BA 3RSJA 5H9RA 1S55A 4JGYC 1UF2C 4IV1C 1HKDA 3MPBA 1JYCA 3FX3A 3WP6A 1Q8PA 3DPRB 4MXWA 1YNAA 3RJRA 3H1MA 5T5PA 1DIWA 1O91A 4AHWA 1Z78A 1UKGA 4L11A 3QH7A 3MIDA 4Q4V2 2GC3A 4Q4W1 2WNUB 4GULA 5H9SA 3AP4A 1H2NA 2DCJA 1NG0A 4XHBA 1PVC1 3AZVA 4WVZA 3ZN5A 4C90A 2NLRA 4LUMA 4XYXA 4HVOA 4GB33 3MW2A 5EZWA 4CEWB 4PDWA 3BB6A 3E5XA 1QDCA 3D0JA 4YZ3A 1NA1A 3R4UA 1APNA 1V9U3 1C1LA 5KXCA 1BBT1 4J1WA 3WDXA 4DRVA 4MUVA 5GZCA 4A3XA 2WNUC 3NVCA 1Q8SA 5I8YA 1HLCA 4BA6A 2X5IC 4X6RB 2IXCA 1TNFA 2VGDA 3I2DA 2RS52 4ISQA 4UXAA 4EN9B 2MEV2 4LBQA 5KHGA 1W6QB 2A6ZA 4HKWA 2IWGB 2I2SA 1CVNA 1QY4A 4DNYA 5CFDB 4UW3A 3DPRA 4CEWC 1G9CA 3JD72 4A7ZA 4KWJA 1PVC3 1G9FA 2IXJA 2K2SA 2RM22 4AEJA 2Z69A 3AP9A 2VPVA 5DXDA 3BPZA 3SITA 1C4RA 1CAXB 2YHJA 4EWAA 1C1FA 3O5SA 5FO7B 3MPPG 1HXS2 1LHOA 3MIEA 4WM8B 1W2UA 1DU3D 4FCAA 1ZYBA 5FMOS 4DQAA 4J1XA 1JUHA 1DLLA 3NAPB 5EFUA 1AYM3 4I01A 1BBT3 3AKPA 4LHNA 2P2KA 4XQWA 2Q0AA 4OHWA 2WZPP 4B4PA 5J48A 2V5YA 4LBLA 1VBB2 2DCKA 3MEPA 4A7KA 4E4DX 1SLCA 5CFDC 4FAHA 5C8CB 3WQ7A 3V56A 4EV0A 4I3GA 2WQZC 3I4IA 3OCPA 1HQLA 3W9AA 1WCKA 4GMP3 4IEQA 1S2KA 5GZDA 1AR62 1D2SA 4RL7A 2GC2A 2R062 4PLMA 4E9KA 5DZGA 2PAMA 1W6QA 5GLTA 2OYZA 2ETEA 1RUC2 1RUJ1 5BNPB 3GF6A 4L97A 1NYWA 3IDEA 3UKNA 1OOPB 3ES4A 1R091 4P14A 3B00A 1TEIA 4AQ2A 1ZZBA 3VBFB 1VBD2 1V6KA 4FTSA 4A7YA 4G9SB 5HBAA 2GDFA 3NL1A 4Y26A 1LOBA 2VH9A 3VL8A 1DZRA 1CQ9A 4WM8A 3B5LB 3ILFA 2WA4A 2PQQA 2N7GA 2WFF1 4W6XA 5BY5A 4QXKA 3SCFA 3QH6A 1RMU2 2DTWA 2BYVE 1K5MA 4U36A 1QQP3 3HBZA 1ULCA 5C8CA 1H2LA 4I02A 1AR72 3IBMA 1S2BA 3TWIA 3VKLA 1RUG2 4OUSA 4K1YA 1N1TA 2A5ZA 1RUJ3 2RS32 4JGZB 1LU1A 3AYCA