2VP3A

Dc26 mutant of vaccinia virus protein vp39 in complex with s-adenosylhomocysteine and m7g(5')pppg
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific protein recognition of an mRNA cap through its alkylated base.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Methyltransferase
molecule keywords VP39
total genus 106
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2vp3A00
3T0IA 4FGZA 3R0QA 3RODA 5HZMA 5KVAA 3BT7A 2HR1A 4DCGA 5LQRA 1JQDA 4U7PB 1NW7A 3GDHA 1NW6A 3GRRA 3O7WA 1KYZA 4LG1A 1UIRA 4QQKA 4RTSA 4DQ0A 2EG5A 4IWNA 3EVZA 4M36A 2G71A 3AY0A 4WVLA 2P40A 3LDUA 2ZZKA 1NV9A 1KPHA 1XVAA 4KDRA 3GIWA 1ZKDA 2ZWAA 2G70A 4QQNA 2IDKA 4ER0A 1DCTA 2BR5A 2PGXA 5HIIA 1FP1D 1VLMA 2P35A 2ZIGA 3BWCA 3C6KA 2OPBA 3FPJA 4MTLA 3HEMA 2ZCJA 3X0DA 1EJ6A 2C7OA 3GNLA 1YFLA 3MTIA 4ER5A 5HOQA 2P3OA 3ANXA 4PYLA 3FRIA 2ZLBA 5EEHA 3REOA 2YUIA 2XYQA 4C08A 5CCBA 3LBYA 3DMGA 1AV6A 5EMKA 3EVAA 3MERA 2JHCA 3LCVB 2YXLA 3DXZA 4XUDA 4CWAA 3FPGA 2EJTA 4EKGA 2QY6A 2ZBQA 3HVKA 3RIEA 3SSNA 2Z6AA 5HEKA 4CKCA 4E70A 4RTQA 4DF3A 3HCAA 2NYUA 4PIPA 2GS9A 1BOOA 3KPYA 3BZBA 5DLYA 5EMJA 2IBTA 4QTUB 1ZG3A 2OY0A 3KQSA 1M6EX 5T6BA 3ELDA 2A14A 4CTJA 4HTFB 3MGGA 4YV0A 2G1PA 2ESRA 3A26A 3OU6A 1BHJA 1XDSA 3FZGA 3UJDA 5EHGA 1SKMA 3LGAA 2ERCA 2NXNA 3DULA 3E05A 5EQJB 1KR5A 3HVIA 4AZVA 4QDKA 1NW8A 3OZTA 2AOTB 3THRA 5EHIA 4WXHA 5F2KA 4NECA 5HIMA 1WS6A 3FUVA 4RVFA 1FJXA 2XVMA 1AF7A 2CWWA 3OU7A 4RWZA 4DA4A 2FK7A 5EOVA 3TOSA 4GOMD 2ZZNA 2Z6QA 1RJGA 3L8DA 4PYQA 4YUYA 4KRGA 4BP1A 2ADMA 2ZBPA 3KHKA 3E23A 1FBNA 1QYRA 2HV9A 2IP2A 2JH9A 4HGYA 7MHTA 1JG4A 1B42A 3DP7A 2AOVA 4OQEA 1IY9A 1R74A 5E9QA 4RTOA 3Q7EA 3KR1A 3UJAA 3CBGA 3JWGA 4E2WA 1O9HA 2AR0A 2DPMA 5GOZA 4FS8A 3K0BA 4RTLA 2C7RA 3G2PA 2BH2A 1XTPA 4HTFA 3HA3A 3IYLW 1XCLA 3AWIA 4QTTB 2NXJA 3GJYA 3PX3A 2NNWB 4H0NA 5CVJA 2AS0A 1EG2A 4GBED 1R8YA 2XYVA 5GIOE 1YUBA 1SUSA 4FZVA 3CC8A 3MCZA 4PYOA 3CCFA 4P7FA 2WA1A 4E30A 5LQUA 3EVFA 3KQWA 1ORIA 3SM3A 3TMAA 4RTKA 3LECA 3M6UA 2PT6A 1ORHA 3B3GA 3G88A 4AZTA 1N7IA 1R18A 5DX8A 4OX9Y 2PXXA 4AX8A 2DULA 5E2AA 1TW2A 3KQOA 3FUWA 3NW9A 2ONZA 4YUVA 1JQEA 2NXCA 4XCXA 2P8JA 3GRVA 3HCCA 5DM2A 1VQ1A 3T7SA 3LSTA 2IH2A 2JHPA 4GC9A 2ZFUA 5KQSA 4P7JA 5EIFA 4YUWA 4RTPA 1JTEA 2QYOA 1P91A 3LPMA 3FTEA 1SQGA 2AZTA 5CIYA 1EQAA 3P9CA 1TW3A 3PVCA 5D1NA 1N7JA 2C7PA 4P7KA 5CVUA 3EVDA 1IXKA 3MCTA 4F85A 2V7EA 1NBIA 5DM4A 3VC2A 3S68A 4RVDA 3HCEA 2YX1A 5C0OE 3NWBA 1R8XA 4HRAA 1RJDA 1VL5A 4GEKA 4X61A 5BW4A 1BKYA 3GCZA 5GINE 3NTVA 1L9KA 3BWBA 3DMFA 1D2CA 4E2ZA 1G6Q1 1KPGA 2B78A 2Q41A 3P2EA 4EK9A 3GGDA 3C6MA 4V0QA 5IH3A 1L3IA 3G8BA 3A7DA 3QV2A 5GP1A 3K6RA 2HNKA 4PYIA 2CMHA 3UJ6A 2OBFA 1KIAA 2HMYB 2GH1A 4PCAA 3VYWA 3EVEA 1VE3A 4A6DA 4B17A 4YUXA 5DM0A 2B3TA 2BM8A 2P3LA 2PSSA 4PGHA 4ATNA 1G55A 1ZQ9A 2FHPA 3FPHA 3I58A 3OFJA 4XUCA 3EMDA 5HIKA 4X41A 3HA7A 4YV2A 3OPNA 5EZQA 3EGVA 4BLUA 5K03A 3GRYA 2AOTA 2IPXA 3M6WA 3PS9A 5DX1A 1O54A 3BGVA 2ZWVA 1JG2A 3OU2A 5T67A 5KS2A 2IH5A 1G60A 3G2OA 5CVEA 4BY9E 2UYQA 3TLJA 5K0BA 3A25A 3UA3A 2I9KA 1D2HA 5K0CA 3ELWA 5E1BA 2GA9A 3UJ8A 4E33A 2P41A 5BW5A 2FRXA 1KHHA 2IBSA 5LQCA 5FHQA 3R24A 4GQBA 5ICGA 4IV8A 5K0FA 3NVMB 1RI2A 1RI1A 2FCAA 2ZULA 1RI4A 4OQDA 5DXAA 2PV0A 2YTZA 3TM4A 2EX4A 2PWYA 4GOLD 5ICEA 5E1MA 3TM5A 5M5BA 3PX2A 3DMHA 5DRYA 4POOA 4QPPA 1EAMA 1UFKA 2PLWA 4X63A 4DM3A 2AOUA 2QRVA 3LCUA 5FA5A 5DTMA 3P9IA 2VDUE 3CJRA 3AXSA 3DXXA 2BZGA 3NWEA 5CUQA 5EIWA 5EPEA 2O0LA 1WXWA 2OYRA 4QVKA 5K0GA 5CD1A 1YF3A 3V8VA 3SSOA 1NW5A 3KQQA 3G8AA 3UWPA 3BKXA 4RYLA 2PVCA 3NDJA 4Y30A 3CJQA 3HCFA 3ER9A 3JWHA 2I6GA 2GAFA 4HG2A 5KQRA 1WY7A 4MWZA 3FPFA 4BLWA 3OFKA 2PJDA 1X1CA 4G56A 3SR4A 3Q87B 3BWMA 3SX0A 3EVCA 1SUIA 1G38A 3ORHA 1NT2A 3SSMA 3G89A 1BC5A 1L3BA 2YXDA 3KQTA 5CVDA 4E2YA 2OXTA 2FYTA 4PIMA 1G8SA 2IDJA 4YMHA 2JJQA 5E2BA 5GWXA 1PJZA 2AN3A 5FADA 3EVBA 3RW9A 5LQAA 4RVGA 5P8WA 4QVGA 3SVZA 2Z6UA 3R3HA 2IFTA 4OBXA 5LQNA 3KPUA 5DRTA 3DR5A 2UYCA 3KPWA 4PYNA 1Q0SA 1KP9A 3HA5A 5ERGB 3G2QA 3SGLA 1VP9A 3UFBA 5FQNA 2H00A 2OKCA 5D1HA 2PKWA 1X1AA 4AUKA 3G7UA 3O4FA 3MAGA 1VP3A 3PT9A 1JG3A 10MHA 3G5TA 3EVGA 1NBHA 3AXTA 3CGGA 1L1EA 2YVLA 1QANA 1HNNA 3EEYA 2I62A 3G2MA 2NXEA 4RTRA 2F8LA 1Z3CA 3KQVA 4IKPA 1SVUA 4MIKA 2CMGA 2B9EA 1VPTA 2EFJA 2PT9A 3FUTA 5GM1A 5LQKA 1WG8A 2FPOA 3HM2A 2K4MA 2PX4A 1FPQA 3GWZA 4HC4A 2H1RA 4HSGA 5DSXA 2O57A 1DUSA 2R6ZA 3I53A 4OA5A 5E8JA 2YR0A 3TRKA 4AZSA 2PXAA 3D2LA 4YV1A 2I7CA 1D2GA 1NV8A 1RI3A 2AOUB 3KPVA 5KYGA 1P1BA 4GOOD 4RX1A 4EVIA 5ICCA 2G8NA 4CXMA 1M0EA 2UZ4A 1WXXA 3M6XA 3NDIA 5E1DA 2N47A 3DLCA 3GRUA 2UYHA 3DUWA 4MQ4A 3IV6A 5EVJA 5JR3A 4UOEA 4OBWA 1JQ3A 1JSZA 4PONA 1T43A 1YZHA 2QE6A 3FRHA 2V74B 4FT4A 4RV9A 3E8SA 3UJ7A 3P8ZA 3KPJA 4FR0A 3PTAA 1SG9A 2HTEA 2WA2A 3GU3A 4RVHA 2PX5A 5K0NA 3BWYA 4ER3A 1FP2A 5C9ZA 4KW7A 1X1DA 2ZBRA 2ZTHA 5EZSA 2AOXA 3OE5A 4KDCA 4OA8A 5DT2A 4KIGA 2BM9A 4CKBA 4EMSA 1RJEA 1I4WA 2PX2A 3CVOA 3C0KA 1F38A 2ONYA 4BLVA 3FUXA 4PCLA 4GUAA 5U4XA 4KIFA 4AZWA 2B2CA 4KVZA 3T7TA 2ZZMA 2QM3A 3M6VA 3G5LA 1AQIA 1NKVA 2ZIEA 3HP7A 4IV0A 4X1OA 3LDGA 1OR8A 1INLA 5DM1A 2CKDA 1X19A 1IM8A 3P2IA 3HVJA 3SMQA 3BUSA 3CJTA 3MQ2A 3DOUA 4FSDA 3A7EA 4YUZA 3TFWA 3LKDA 3NJRA 3TKYA 1ZGJA 1XCJA 2PWPA 2OZVA 4KWCA 4O29A 4PYKA 3THSA 3UBTA 1EJ0A 1KXZA 3R6TA 4R6XA 4CKEA 2GLUA 3GO4A 2NP6A 3IHTA 2BR4A 3ERCA 3ELUA 3PFHA 1HMYA 2EJUA 3O31A 3MB5A 4M7RA 3M70A 3FTDA 3T7RA 1VBFA 3C3PA 3DH0A 4F86A 3BKWA 2P7HA 4E2XA 3EEOA 4DMGA 1N2XA 4XUEA 3BXOA 3C3YA 2O06A 2H11A 4Y2HA 5B1SA 4ER6A 3OE4A 5DX0A 2OB1A 3JWJA 1O9GA 1SQFA 3EMBA 2AN4A 2IGTA 3OCJA 3HTXA 3UJBA 1XDUA 2HWKA 5E1OA 8MHTA 4PYMA 5CVVA 5E9WA 2P7IA 2IH4A 2Y1WA 1ZGAA 4ISCA 2O05A 4RSRA 3NMUF 2Y1XA 3FYCA 4P7GA 5EKUA 1JR4A 2PBFA 2P1DA 1U2ZA 3CKKA 3HCBA 3HCDA 3JWIA 4FT2A 4QPNA 2FK8A 3H2BA 3DLIA 3KR0A 4M38A 1H1DA 1L3CA 2UYOA 4LECA 5FQOA 3U81A 1QAOA 5LSAA 5DXJA 3LKZA 1JG1A 3MTEA 2VDVE 5FCDA 1XJ5A 1RJFA 4C06A 1R00A 1MJFA 3HNRA 3VC1A 3LHDA 4FSXA 5K0LA 4PGGA 3OZRA 5FWAA 4A6EA 4DCMA 1PRYA 5LR6A 4M37A 3ME5A 3UJ9A 5K0JA 5K0EA 4R6WA 2O07A 2XVAA 4FP9A 5G02A 3R9XB 3I5UA 5FUBA 2VP3A 4YMGA 2CL5A 3M4XA 3KQYA 2P3QA 3EGIA 3B89A 4C07A 2PXCA 2E5WA 3QOXA 4QDJA 1KYWA 2LD4A 2YXEA 4R8SA 2ORED 3KU1A 3LDFA 3FTCA 3LBFA 2GPYA 3HVHA 2AN5A 5FTWA 3TKAA 3PB3A 5EEGA 1Y8CA 2KW5A 2C7QA 2PY6A 4PNEA 3P97A 3MHTA 2OB2A 3BGIA 1QAMA 1P1CA 4GC5A 5CM2Z 5EG5A 5GM2A 5JUWA 5LQJA 4LWPA 2JG3A 3TR6A 3LX6A 1KPIA 1QZZA 1F3LA 3B3JA 3EPPA 3KKZA 3UA4A 3FUUA 4GOND 1YZ3A 3KQMA 4DZRA 5BXYA 1VIDA 5DTRA 2YQZA 2XBMA 1XDZA 3IEIA 3I64A 4CTKA 3I9FA 2OO3A 4E32A 3AJDA 3TPZA 1I1NA 4ZTBA 4Z2YA 3P9NA 5T64A 4ER7A 4R8RA 4V0RA 1ZHFA 4MHTA 4PYJA 1QAQA 3EGEA 5GIPE 5HFJA 1P39A 1DL5A 4HH4A 5K05A 3ER8A 5HILA 2ZW9A 4LWOA 3A4TA 2IIPA 3KR9A 4JXJA 1MHTA 3P2KA 2AVNA 2QRVB 1G8AA 5K8VA 5C1IA 4R05A 3UZUA 1AQJA 1V39A 2VDWA 3B5IA 5HIJA 4E31A 3NVKI 3LCCA 3TQSA 5H02A 4F84A 2GB4A 5K09A 5E8RA 3LL7A 5EMMA 3ELYA 3UJCA 3GRZA 4P58A 2VS1A 3P71T 2NP7A 1WZNA 4BP3A 4EKIA 3F4KA 3A27A 4X60A 3V97A 3QOWA 2AOWA 5E9JA 9MHTA 2ZSUA 5MHTA 5FA8A 5DWQA 1NE2A 2ZVJA 2PX8A 4PWYA 4HGZA 2JH8A 4PINA 5EC8A 4L7VA 3FTFA 1X1BA 3B3FA 4GF5A 5CCXA 5EKXA 3E7PA 4C04A 5DSTA 1NW3A 4DKJA 5F2OA 3WSTA 4RTJA 3SXJA 1I9GA 2R3SA 5DTQA 1RI5A 5IKMA 1UWVA 3BGDA 3PLAE 1R6AA 2XYRA 4C4AA 3M33A 1EIZA 2BR3A 4C03A 3ID6C 4EQZA 5FWDA 3DXYA 3P9KA 3FPEA 1JTFA 5F2NA 1Q0TA 1M6YA 2WK1A 4U7TB 1TPYA 2JHAA 5EGSA 1XXLA 2AVDA 3FYDA 5FHRA 5DPMA 1JSXA 3OZSA 2B25A 3GXOA 5EMLA 3B7PA 5ICFA 4RTMA 4K6MA 3DTNA 5K01A 2ZIFA 4C05A 3VSEA 5BP7A 4RTNA 3KR2A 3PFGA 2VZ9A 5FULA 3KQPA 1YB2A 1YFJA 2G72A
chains in the Genus database with same CATH superfamily
3T0IA 4FGZA 1PLJA 1K06A 1Q0ZA 1G21E 1ZFNA 3MBIA 2AG8A 2V4UA 5DBEX 4HH0A 1HKUA 3W2IA 1NT4A 1X1RA 2B83A 2I99A 4HXFB 5FF9A 3UG6A 3K9HA 4WA8A 3QSYA 5AVVA 2GN4A 4FQ7A 4B3JA 3GBVA 1W2HA 4M49A 4CM6A 4RYDA 1JFVA 3HN6A 4ZCSA 1Y80A 1ZGBA 2YIDA 2P9ZA 4TKUA 1G7SA 1PNQA 4AUNA 121PA 2RGRA 1XNRB 1G59A 1TF5A 1Y5LA 3K2IA 3OZXA 2ZYSA 1IL0A 1L7RA 4C1BA 3KOMA 4F93B 3IC5A 1CP2A 2CLHB 4KDEA 3FPJA 3HEMA 3DEIA 4GU5A 3BH7A 1T1RA 2RGGA 3WDKA 5K99A 2I71A 2D1FA 3ONFA 2WWRA 1GCIA 4A15A 1Y1QA 1SQSA 1E7WA 2QXYA 4ZYYA 5JNUA 1P5FA 4LHYA 5JQGB 4PYLA 1O5IA 2DUMA 4M1WA 1HO3A 1V3TA 2G8LA 1FSFA 2N42A 2VHUA 3DOFA 5I3CA 5KYYB 1SVIA 3E82A 3MW8A 3G0HA 2WFAA 4ND4A 5FBZA 3DXZA 3BB1A 2CXRA 1NDHA 2C0PA 3ABRB 3KS9A 1MZVA 5JASA 2J85A 1VIAA 4EBFA 2O1EA 3G82C 3K1YA 1T4MA 4B6QA 2CFIA 4B2LA 5KZMB 4Q7QA 1E77A 2YDXA 4YDRA 1M34A 2DSNA 4HFNA 4MKIA 1PCXA 3DZ8A 3ZDEA 4ZO9A 4BASA 1ZG3A 2OY0A 2XNDD 3F6BX 4Q1CA 1RQXA 1J0CA 2OCXA 2BGTA 2VJPA 4ZOLA 1HR0B 1P33A 3TX2A 2HLPA 2QI9C 2Q8PA 1RXEA 4CMGA 1OF1A 3NXSA 4RHTA 4O8ZA 4YCNA 3DV0B 1GGNA 2VXOA 3FKQA 3O26A 4Q03A 2C9YA 3EBPA 1XQYA 3HJGA 1JXQA 3UICA 1NVAA 1RKBA 3DUFB 1XQXA 4WUTA 5HIMA 3QXGA 2HHCA 3K9QO 1E7SA 2J9FA 1W4AA 2VK4A 1JKMA 3L4BC 3DE7X 4QDOA 1H9CA 1RJGA 3ZKWA 2IV3A 1QG0A 3IUMA 4FYHA 2YS7A 3EDYA 2D6FA 2HV9A 1IB6A 3COPA 5ALQA 4XIIA 4G0UA 3TI7A 5E9QA 4LMAA 3MCWA 2FG5A 7MDHA 3IALA 4RF3A 3RBXA 1FDSA 2POCA 1G4HA 2HQSA 4P08A 2Q1YA 1U5BB 1QYDA 4CF6A 2FX2A 1NJGA 3FWKA 4OLJA 3VX3A 3IYLW 4N12A 4CIYA 5AK3A 1M6VA 4UAVA 2R7LA 4WASA 1U11A 4IJ6A 1MB2A 3TTVA 1EDZA 3N07A 2ZB8A 3ZE7A 3LZ6A 2WIFA 4GKJB 5K3EA 3HL0A 3LUAA 2IIVA 2R47A 4P7FA 4E30A 4GT1A 2PUGA 1NP7A 2APJA 1GPYA 1WUTA 3RF7A 3NHUA 2QW8A 2PTGA 3DHYA 3WTCA 1D4FA 3ZKAA 2YJ4A 1W35A 3SBEA 1ODFA 3IOEA 3W6ZA 4K81B 1KZ6A 4DHEA 3L4SO 2IEBA 3GFSA 4PG6A 3WICA 1DIGA 2GYYA 1JQEA 1CUJA 2F8MA 3BWVA 4HN9A 3U3OA 3IJ5A 3GP5A 2RH5A 4M0PA 4IIGA 1Z4LA 1OH6A 3DDNA 3RTDA 2TECE 2FMIA 1P8JA 1T9AA 3D8TA 3PPIA 2ZETA 2Q7XA 3OIVA 2WQZA 3QJ5A 5KSPA 3WKCA 2PGIA 4DQXA 1OH8A 2A8YA 3A9VA 3JARB 2VPYA 4ZVUA 1PNRA 2HYIC 4Y18A 4FYXA 1YCDA 2GZMA 4IKOA 4URUR 1LTHR 4ENWA 3OTOB 4JWKA 3LP8A 1L5NA 3P32A 3IBCA 3ZNQA 2PKQP 1TCVA 5DHRA 3W1VA 3PJEA 3Q8XB 1R37A 4K0RA 1EVEA 2RE8A 5C5CA 3R3ZA 2HLDA 3BWBA 3IO5A 1Z4NA 1WHTB 4RZSA 4OI0A 3DGEC 1R5OA 1YB4A 3P2MA 1T8UA 1LB1B 2VKTA 4ROTA 1OMOA 3AB8A 3K6RA 1PW5A 1QO9A 1G2IA 2HBRA 1EFLA 3PHLA 3OWHA 4WBNA 2EIHA 1G19A 4NXMB 2CLLB 1LWOA 1UOQA 2HMYB 3VYWA 4R9RA 3OZDA 3ZGLA 3ZNOA 4X8OA 1F12A 3JALB 1L5GB 4B17A 2BYTA 2WUFA 1SMKA 4GP7A 3M6LA 1ZUNA 2GETA 4AY6A 3HU3A 4Z2AA 2P5YA 2WWTA 2ZR0A 4BNZA 2XRMA 1QVRA 1T5SA 2Z8YA 3AH8A 1TKRA 1Z4OA 4WFIA 4Q3DA 5A02A 2GZ1A 2Z4SA 4Q3EA 2PDAA 4UAUA 1FDVA 4YMVA 3T7CA 4CEHA 3ZE8A 3DNPA 3TJRA 5CVEA 1QHHB 1IEXA 1IG3A 1Q1QA 5K0BA 2PMBA 3A1SA 1I24A 3UOWA 1D2RA 9ATCA 2I9KA 2QMOA 2QKYA 2DHCA 3LIPA 1NUUA 2H1WA 3X1WA 1J8MF 1JQ5A 2B61A 5BW5A 1VRCA 5L3VA 5LQCA 1H22A 2H65A 3NAZA 5BW4A 2HMTA 5FI0B 3RREA 3UAYA 5K0FA 1E1QA 1RT9A 1ZUD1 3UUGA 1JUDA 5DXAA 2YTZA 1NZDA 2RARA 5IDYA 1EQUA 5ALMA 2I9PA 2HOQA 3FFAA 4D9GA 4KZKA 1KMIY 1XPJA 5JXGA 4EH1A 3U39A 4LDZA 5F1OA 1ZNWA 3I01A 3W2EA 821PA 3A3PA 3K94A 2UVPB 3A1TA 3OC0A 3VR2D 1NRIA 5EIWA 4BQFA 5CD1A 1HYGA 1WA5A 3D6MA 1YF3A 1EFRA 2WHEA 4RGVA 4S0XA 3IE2A 4CEHB 2CC2A 2QVBA 3NCHA 3NOXA 3P9ZA 5AVWA 5IF9A 3CJQA 3RC9A 3UBMA 1FQJA 2YWDA 3CFYA 1L4UA 1G21B 3KWJA 2CXOA 2DR0A 3UGTA 3D43A 4Q02A 4ZOEA 4D7AA 2R1VA 3TNYA 3SR4A 1QLHA 3QITA 3SKXA 4ID9A 4P3XA 1G0OA 2KWIA 2Z0MA 4FKMA 4GI2A 4IUBS 3TTWA 1OFUA 1W581 1QR2A 2IOFA 2VWQA 3DLBA 2DM6A 5AXDA 3UOAB 1Q0PA 4EGSA 3STUA 5GWXA 2H59A 2WIGA 2XOKD 1KEWA 2VYND 3ND5A 4OF4A 3MTAA 4WL0A 4PLZA 1N9GB 3SCZA 4ZU1X 1KOJA 3RIGA 5D86A 2C8JA 4DVGA 5GJWC 3LPLA 3UKDA 4EB6A 4ZJUA 4EFMA 5AK6A 1DIBA 1EK6A 2IEDA 4HNQA 3I83A 2WJWA 1QUFA 4BRSA 5K8JB 2C88A 2QRUA 3O4RA 3V1UA 4QKQA 4ESVA 4BQRA 4RULA 3HUDA 4LXUA 3EF0A 4JLMA 4M9SA 4MPJA 5AJHA 5CDFA 5C81A 3S70A 4ZT2A 1L7OA 1KMQA 3CLSD 4WESA 4Z4CA 4L6CA 4MWSA 2HJVA 3CX4A 2NLOA 2NSYA 3P27A 1NN1A 4AROA 4BN0A 3L93A 4ZOQI 1KQ3A 3O83A 2C7BA 3HLYA 4ZMBA 3PWKA 4DA9A 4D9KA 2HDOA 5H80A 1TCUA 2UZ1B 1N2BA 1M1ZA 2OSBA 3L2OB 5I7AA 2F48A 1PJCA 3NP9A 5EINA 3AR2A 4WNCA 4M0EA 1Z4QA 1RI3A 4G3XA 5AJYA 5JXHA 1KJQA 4ZQIA 1Y6JA 4Y0AA 2O5CA 3Q2OA 4BNLA 2Y4NA 3DYVA 5EE3A 1GQRA 1U1IA 1Z7YA 1LBQA 1KNQA 3DA8A 4LGCA 3UT0A 1ZJWA 2CB9A 4OBWA 3JQGB 4JJ8A 4TN1A 1GCOA 4EAAA 3WVNA 4ZVKA 4MUHA 3PWZA 4JR0A 2JLRA 4MKRA 5L7TA 3SZRA 2CNWA 1CLEA 4KXXA 3VJLA 2I7DA 2H57A 3TXXA 1MPXA 4JB2A 3VYUB 4AS2A 3DKPA 1XE3A 1B41A 2E4XA 4KSCA 1IBLB 5TT0A 3SD7A 2LCFA 3EZ9A 1X1DA 4KW7A 1OIXA 3PKZA 1A2BA 1BMDA 1CZKA 2CXPA 4IDHA 3F46A 3ZDZB 4F60A 5I7RA 1DKRA 4IIUA 5AJZA 4CTMA 2BM9A 4X94A 3ROFA 2A0UA 5IEBA 3ZZ1A 2PX2A 3R5XA 4BKPA 2WHRA 4FFBA 5JVDB 3OLXA 4CIBA 3A06A 3GHHA 2R62A 2IHZA 1JGTA 1OC4A 2B2CA 1CQIA 3AP2A 2O0KA 2WOJA 3FR7A 3NZEA 4HRXA 4RY0A 3SM9A 3RLFA 2VVTA 1TF7A 4FE4A 4EX6A 5J4LA 4ZK2A 4NK4A 1PJSA 3A1EA 4IRMA 1RZVA 4FGSA 5JMOA 4S1VA 5LWQA 3GJ3A 1YH3A 1NTOA 4EPXA 2I3BA 1Y8RB 5JS1A 2QAGB 1PU2A 3G9XA 1N2OA 1XCJA 4W6ZA 4Y0NA 1H2FA 1RTTA 3NRBA 4GNKA 4PYKA 4Y9DA 3OJ0A 3WB0A 1I4DD 1MX1A 4JB0A 5CDYA 3L18A 2JFOA 1ZITA 1U0FA 1RXSA 3LF1A 2PK3A 4O2BF 4S2EA 2B8TA 4BZZA 2C4VA 5JMWA 3HADA 3V80A 4XSVA 1GEGA 3ZU2A 5I4CA 1RXCA 2XTNA 3QVXA 1F8UA 4UMFA 4K9NA 3OWXA 3I45A 3HJRA 1FPMA 3IOMA 1VM6A 4PZCA 1XPRA 3EJ6A 1BFUA 2GZAA 1T0HB 1BMFA 5DX0A 3ZWVA 2H8GA 2WIDA 3AQ4A 3OCJA 3RU3A 2O50A 4EF5A 1TQ8A 4XWAA 3O3OB 4EIWA 1XQ1A 3FKSA 3PT5A 5C3UA 1UKBA 4IDNA 3EW7A 1OH5A 2O05A 1XALA 3FYCA 2J9XB 3C3JA 1BKSB 1WBDA 1YTLA 1HXHA 1YGPA 1J1IA 5F5NA 5C52B 3KOUA 1P1KA 2H31A 2O9JA 2UYOA 3G7NA 5DYWA 3QXXA 1GTSA 1RP1A 1EXVA 4FE3A 1JALA 3URMA 2XXAA 1MA3A 3MJTA 1D4AA 3I39X 2Q07A 1L5OA 3OT4A 4X1YA 3VC1A 2ZAYA 1B8OA 1QGZA 2QG9A 3D0QA 1E9BA 2KE5A 1QIDA 1UJ4A 3RC1A 3HDQA 5B7PA 1Z6XA 4DSUA 3ZY5A 2VHQA 3DJFA 2QRMA 3CZPA 4LF8B 1ADBA 3MTJA 1GZVA 2ZWPA 3GGOA 5HCNA 3N87A 2WYWA 3IAEA 4QYIA 4GR5A 2R5FA 1OFHA 2HY7A 5EP3A 1U2DC 1Q1ZA 3RRNA 4NZZA 2FR1A 2X9GA 2EP5A 3PGLA 5LXTA 2ZU0C 1KSFX 3TKAA 4RKWA 2X0JA 3F6YA 1CZHA 3H5NA 3T7DA 4ZHSA 2H07A 1CWUA 2PY6A 1XP5A 2ATCA 2I2CA 4K9DA 5HM8A 1QBKC 1DAOA 4PZDA 2QSUA 2QRHA 3GAMA 2R6R1 4MRMA 5J2UF 2Y1LA 1N3YA 1ILEA 2RKBA 5KJ6A 4HGQA 3LRTA 2NZVG 4J7UA 5EE0A 1X8JA 2I2WA 3ED5A 4FHCA 3UGQA 4ILKA 4TLCA 2DPGA 3DOHA 3D7SA 1CDEA 4BRWA 1FFWA 1D0VA 1YDWA 5FUXA 2OM2A 1BWPA 1H65A 2OO3A 1EDBA 3Q9NA 3QI7A 2GM5A 2Q3LA 2ZJ5A 4MARA 5GZ3A 4V0RA 2I6XA 4PYJA 1KORA 3IHKA 1KY4A 1W5SA 2CLCX 4HH4A 2JVKA 5HILA 2J5XA 4B8WA 4G9EA 1SCNE 4IZ6A 4MHSA 2RH8A 3QBJA 2PTHA 4ZAVA 5I9LA 2ZUUA 3F8WA 3P2KA 2QTHA 1DQZA 2W6OA 3ZE1B 3ESXA 3KT8A 3MPUA 5FJJA 2XB4A 3SJBA 3RPEA 3W3AH 1GILA 4GD3Q 1ZZGA 3LCCA 3B1KA 4E31A 5HJ5A 2JCXA 3DQPA 2B35A 1D6MA 3CKMA 4NJOA 4K8RB 1RSZA 1FDOA 1I7NA 3UMRA 5EMMA 3DNFA 4ZZ0A 1VHDA 1DOZA 3DE4X 2VYNA 4IVNA 1JBKA 3HBMA 4R81A 4L2IA 4FLEA 3SI7A 5LZ5A 5LOVF 2AOWA 1A97A 4Y6PA 5E9JA 2ZPUA 3CEJA 3T9AA 5CYOA 3K6SB 4JX9A 1C4KA 3BXXA 4HGZA 4NBUA 5EC8A 2G9QA 4MW7A 3WDSA 3NNSA 3SVLA 4DW8A 3HWRA 3V46A 4BPRA 3HSYA 3NEAA 5AYVA 3QXCA 3R20A 4G8DA 1I9GA 2V1XA 2IC5A 3RJ9A 1K4YA 3Q3JB 4AC9A 2CBZA 1YZVA 1G8PA 1PZFA 1OFUX 2RGCA 3E8MA 2ID4A 3R9IA 2P6OA 3VI3B 1FFDA 2VP4A 3QX7A 3IGFA 1ZX1A 1M6YA 3NALA 3D4PA 5F3WB 1C7JA 2ZQYA 3E3OA 2KSQA 5AHOA 2P2LA 2BISA 1Y34E 4IZIA 1ENZA 1M6NA 3L7BA 3T1VA 1CULC 1ISFA 5REQA 5GAJA 1W87A 3A1FA 4IHJF 4KYIB 3VR1A 4RTMA 1X7GA 2C5HA 3CR7A 1Z29A 3CRVA 3DT9A 4CF5A 4HVCA 4EPRA 4TT3A 1MVNA 3ZHQA 1E79A 1L5QA 5ELLA 3TLBA 4I08A 1E1NA 3TN7A 2A9JA 1UC9A 4B6PA 2B92A 5FUVA 3KVYA 2G28A 3KXPA 3V8NA 3SHWA 2JIQA 1JIUA 3WA7A 1XDWA 2HRQA 5L3RA 3DMTA 1LSJA 3LDHA 3DBRA 4LRXA 4QU9A 2WOOA 2QSYA 2QK4A 4YS6A 1ZKDA 2Z8XA 5GV8A 5JAQA 3AFIA 3MT0A 2BR5A 2LCQA 4BMXA 4QQ8A 3SX2A 5A7FA 5L7WA 2IGBA 4PVCA 3PUHA 4UBLA 3PEWA 2OBMA 1Z15A 3ISVA 3VHXA 4CKWA 4PZUA 2FPGA 3A04A 4ZVMA 2C58A 1S2MA 1X39A 1U7DA 2AL7A 4Q7LA 5KVVA 3OQNA 3V4ZA 1J8DA 3DR3A 4Z9AA 3JQAB 1UBTS 3F47A 4LEIA 4GQAA 5DH9A 4IHAA 1XC7A 4E2FA 5CNMA 2NMVA 2Y0CA 4DDUA 1A8UA 1UC8A 5ES4B 4D2IA 1ECPA 1PJLA 5AKXA 4BO5A 5DYNA 1WPQA 4RW0A 3T7KA 1TYBE 1ZY2A 3N2EA 3SSNA 3NBUA 2C29D 3H83A 2WYIA 1B23P 4ZAWA 2O54A 1TZMA 2GS9A 2SKEA 4COOA 1M3SA 4PN7A 1DMRA 1EXDA 2I4IA 3RHTA 3ORYA 2QXUA 4EUEA 2ZB7A 2C59A 3AI7A 1PWXA 2Z08A 4YEDA 2BI4A 4C7XA 4EL5A 3Q5EA 3U17A 4P8RA 1XDSA 2ERYA 4R1TA 5CH8A 1AKQA 5SY6A 3UB2A 5JROA 1C1XB 1A2QA 3UGJA 2JLZA 2DMRA 1RTKA 1U6IA 2YMLA 4P54A 5JU6A 1WKCA 1IJKA 3DMYA 3Q1KA 5JDCA 4CQJA 4ZCMA 3A3NA 3NC4A 1F9EA 3OP4A 2DU8A 5SZJA 1WS6A 1ZZEA 4RVFA 4WZBE 5AKEA 4EPVA 4F11A 1TAUA 4WOPA 5EUQB 4JB8A 2FE4A 4RXMA 1N4AA 2Z6QA 2C5AA 3GT3A 2LDXA 3FWNA 2JFFA 5HE8A 4EA6A 2IUSA 3C70A 4ND8A 4DDKA 4UMVA 2PGAA 1WW2A 3A32A 3GZ4A 4BP1A 1OROA 4Y6LA 4XFJA 4YACA 3K9LA 4HGYA 1WQ1R 5TGZA 7MHTA 3HZRA 1UBHS 2AD5A 2YXPX 3L9XA 2UXCB 2VF4X 1TJ4A 3SIWA 2YH2A 4GM1A 1U0LA 2XIJA 1FSZA 1ZA1A 2C2XA 1GTJ1 1NQVA 2JEOA 2PZAA 2MIIA 3FDIA 1GN8A 1O9HA 4FYVA 4ZRDA 4CLXA 1A8PA 2GX6A 3A1VA 3K0BA 5B3JA 3RG2A 5E6UA 3H9EO 3B13B 4LY0A 1CIVA 3U7QB 1XTPA 3GFBA 4OJYA 3SDBA 1A9XA 2J87A 1XCLA 2E4AA 3NT5A 1P6QA 5TQ2A 1HI9A 3THOA 3UK0A 3X1MA 4A92A 3R5SA 3EARA 1TLTA 5ALOA 3ADOA 1HURA 2O2XA 1T29A 1YUBA 2TMGA 1F2TB 4Q7EA 3CCFA 4M1QA 5TQJA 1D9XA 2BFWA 2CZGA 3DYIA 3EVFA 2LE0A 4XDGA 3PL1A 3VAAA 1SUPA 2PMDA 4QE3A 2RC6A 2PT6A 1Z39A 5IJ0B 3IBFA 3OIYA 3S4YA 2Y6VA 4DRXA 5A3VA 5IHPA 5IKXA 2OO5C 1R18A 3AEQB 2QPTA 3F49S 3L0DA 2F7SA 3H9UA 2OUKA 5H83A 2PMWB 2JLBA 2OQRA 4Q16A 5ITZB 1UDRA 2GK4A 1ZNXA 4L74A 3RFFA 4EG0A 1UXJA 4JBYA 2QGFA 4XCXA 2A0FA 1JE1A 1E7YA 2RC5A 1WVMA 4C7VA 1ML3A 4IIVA 3I6YA 4N39A 1FDUA 5EKTA 4US2R 1RR6A 2HRDA 3S2SA 3CRZA 3OECA 2BP7A 2I3ZA 3T3EA 1SZPA 4CDNA 4U63A 1GOTA 2FG7C 5TVGA 3LWDA 2IWHA 1U0NA 2E82A 4YIHA 5ADUS 5JECA 3T1TA 5AKIA 3QI2A 2PJUA 4RLFA 1YR9A 2JIDA 3D1JA 4WACA 1IUOA 3HI4A 1JPUA 4XLTA 4EI9A 3HCEA 1SZDA 4P33A 4QBIA 4EMBA 1QU3A 1VLQA 5TQ0B 1RJDA 4CODB 1UP6A 3JASB 4YJ2B 3NETA 1MW9X 2YBEA 2ZCVA 3MBOA 3E1SA 1LNQA 4NLLA 1NFRA 2B37A 2ORYA 2AMLA 3P0FA 5ECWA 1Y42X 4AYXA 3ES9A 4BNIA 4V1CB 1HYBA 1QGYA 1B6TA 3OOEA 3VA7A 1V1MA 4OUDA 1N1MA 5FA6A 1L7AA 4OSPA 4TMTA 3ZJVA 4JLJA 4Q39A 3GLHB 5AESA 3OQ1A 3AI2A 1PF7E 2GTPA 4I5GA 4TMWA 3HJNA 1RPNA 4PCAA 1VJ5A 3A6DA 4X45A 2CE7A 4K9MA 4A6DA 1OAKA 4PZAA 1QQ6A 4QEDA 3KZNA 1N9ZA 1IUKA 1G55A 2C2GA 2FHPA 4IMIB 3RYHB 3QV1A 5JVDA 3HA7A 3G79A 4OM7A 4QREA 4NU6A 3FAKA 3M6WA 5FBLB 5T67A 3NYIA 1ZL0A 2WWHA 4FMBB 1WD7A 5A9SA 4M46A 4XSGA 2NZWA 4DSAA 5KS2A 3RQSA 3EIEA 1SXPA 1I2DA 4AN1A 1I30A 3GUHA 4ODIA 3UA3A 1SQ5A 3A1DA 5A3SA 2XUGA 1RRMA 3GMTA 3IAUA 3UMJA 4WBSA 1BROA 2XDQB 3QLVA 4GOKA 5FBKA 4H16A 4KQWA 4EA8A 2NSHA 3GBSA 4TV9A 1NBMA 4L4ZA 3R8CA 4EY6A 3A0RB 3Q7QA 3QVLA 3L8FA 3RNOA 4IG4A 3QWFA 2WUDA 4DV6B 2WKRA 1WEKA 2Y1CA 4HGPA 4S3MA 2BKVA 1II9A 4IZHA 4XQCA 1GZDA 1KXJA 4TS9A 2YY6A 3ND6A 1L5WA 5KIAA 3Q15C 4AURA 3K73O 2ZBDA 1UBRS 2ADFA 4LK2A 3TLCA 5JG7A 2EZ8A 1H8EA 1P9WA 5DNAA 4OG2A 3WLPA 4C7BA 4HNRA 5H4GA 1XCGB 3VH4A 5DF1A 2J5KA 4LJ9A 2BZGA 2HIGA 3BCSA 3ZD8A 2VJQA 2O0LA 1GNLA 5BUZA 5FWYA 4XSHA 1KDZA 2X6QA 4I4IA 4IICA 3HL4A 3TQTA 2BM0A 1Q1EA 3NDJA 1VE9A 3P0RA 2VDRB 4AY5A 5DJ5A 1ANKA 2JH3A 4WESB 3EEIA 2DWPA 4UMEA 5DHSA 5BQXA 3ZH2A 1USWA 3LT4A 3EF3A 3DNMA 5ALRA 4NI5A 4R1SA 3KLOA 1COWA 4YRRA 3PC7A 4HHEA 2HSEA 2Y05A 1JDVA 4CIDA 4U7DA 3IR6A 1CJSA 3SVTA 4QATA 2JGDB 3CSDA 3I8XA 2GD1O 3PNPA 5HR5A 1DWUA 2BV3A 2RH9B 5CX1A 1TK2A 1E4YA 3RS8A 3OZEA 3GIDA 4XWOA 4N47A 3RHSA 2XCRB 1PR6A 1FVOA 1B15A 4QDTA 1LRJA 2VJLA 1N9GA 4Z9FA 1E9DA 4K9KA 4YJKA 4HLCA 4CBVA 1KS2A 1Q0UA 2R6FA 5CT4A 4J91A 1GKLA 1KAQA 4MR7A 2JGMA 1ZRHA 3D02A 1QP0A 4GFDA 4HY3A 1RHUA 1T3SA 2FKNA 2JCYA 4C2AA 4CL3A 4LF7B 1B7GO 3DBHB 3MGBA 4N0EA 3Q7TA 4NX2A 4MEJA 3CEPB 4WK0B 4KBGA 4PSDA 2R1VB 1AZWA 3VNQA 3WMEA 3O8CA 1X9IA 3PQ6A 4KEAA 2CNOA 5BY2A 2VT3A 1E79D 2QL6A 1Z3CA 3RIYA 4RTRA 1BVRA 1OQAA 3H84A 1GZSA 1X7DA 4Q9JA 1XJQA 2QNIA 1OYVA 3GWZA 3JQ9A 4IZOA 3C5HA 2H1RA 3PHIA 3I3SR 4ZWNA 2JGRA 4L75A 4KR2A 4Y6OA 3N76A 3PXGA 4P0QB 1LD3A 5CFMA 5JEEA 2WG2A 4NP6A 4HGRA 2QTBA 4CXMA 3OQVA 2BUAA 2AB0A 2C5EA 3NDIA 4XYEA 1T0PA 2BGJA 2AFIB 2ZSEA 3DBLB 3UOGA 2WG1A 3KL2A 3AKYA 4UOEA 3NHSA 2QZ4A 3BHIA 4PONA 2EFEB 3WGYA 4F4FA 3FRHA 4QEZA 4PS1A 2QUBA 3ZDRA 2W4IA 1XAIA 3G23A 4ERNA 4C2UA 1XSEA 1SG9A 3ZHYA 2WA2A 4G41A 4JGIA 2VIIA 4X7PA 3RBVA 2EVWX 4XTRA 3MUEA 2PX5A 5A5EA 1JFRA 1OXVA 1HL7A 4DMRA 3CY6A 3GRFA 5KAMA 1J2EA 3E58A 1Y81A 3TJZA 4CKBA 5IUNC 4EMSA 4ARBA 2R7NA 3DZIA 1Z0UA 2BKAA 4RCYA 3RYFA 1SD2A 3FMOB 3C0KA 2O7NA 1FP4B 2ONYA 4I9UA 4MLDA 3HGQA 3EYWA 3STVA 1ZUNB 1SZJG 2GTHA 3ILVA 1VL8A 4R71A 5AM1A 2WYOA 4OQXA 2O2ZA 4K88A 5BNFA 3N05A 4QO7A 4TZKA 2EV9A 4DNOA 3H5TA 2PR2A 3EH1A 1KOLA 3WO1A 2C57A 1SQ0A 1M83A 1IZ0A 2YXNA 3ZY3A 1JRLA 5BN3B 3V1NA 3DOUA 1ZBDA 5LP6A 2X1LA 2V9PA 3AU9A 4QUAA 4U0KA 5J63A 4OLBA 3JRNA 1SKAA 4DAEA 4RKFA 2EQ5A 4Q3NA 4EUNA 3F96A 4K3UA 4N0PA 1PEKE 1GGKA 1KK1A 4HD8A 4OLAA 3KOXA 3GLTA 3F3SA 2BTEA 4HAYA 3W5AA 1OYWA 2FRDC 5IKPA 1TYCA 2GN0A 4R2HA 4YWHA 4LS3A 2VUSA 1OZ0A 4FW8A 3UTCA 3R5JA 3DL4A 4JEMA 3U9SA 3ZIAD 4IGIA 2WYUA 2XZDA 3KAQA 4M0LA 2E4UA 1ZRNA 3BXOA 2Z1NA 3HWX1 3N70A 1ISIA 2JK0A 3C8DA 3LGSA 4JDPA 3RU7A 1Z0KA 2OFFA 3A4VA 1H9BA 2ANBA 4X65B 3VUEA 1CZUA 2WU4A 3KD2A 4LBYA 2NADA 1M1NB 4P81A 1XWIA 1VSQA 1JW9B 3GGCA 4CLRA 1V9CA 3GZNB 2GBFA 4X8LA 2V8OA 4NCAA 3EXHA 4HDOB 2FEXA 1P2VA 1XRLA 3RBAA 5B1YA 1TKAA 3OCYA 3BMNA 2WM3A 4RHCA 1TOAA 5CW2A 3VFDA 1W96A 1T3TA 1ZSNA 621PA 3VR2A 2GJKA 3UCXA 3L0PA 1A7AA 3RVDA 2DC1A 4A6EA 1RQPA 1DARA 1FTSA 2Y92A 5DLQC 1QIHA 1NFQA 5U4QA 4BJ1A 3II6X 4I4LA 5CIQA 5FUBA 3C8HA 2CHEA 3PDWA 3PFKA 1MO2A 2CL5A 4WLOA 2XVYA 5K8LA 4LY3A 3B89A 5EQTA 1PR4A 2E5WA 5LB2A 4V0SA 2ORED 3KU1A 4NE9A 1NXXA 1XB2A 2Y1GA 4DGQA 4QYMA 1V5FA 2FLKA 3JYOA 1WUIS 2GPYA 2RGEA 4W6QA 5IAGA 1O6FA 5FEUA 5EEGA 2OV6A 4YX9A 2QQFA 4N7JA 4KL8S 2G07A 4YT2A 1J4AA 4UHKA 2F62A 1M2VA 5FFMA 1R4ZA 2GCEA 4KNVA 3LX6A 4MQFB 3WWCA 4Y1RB 3NTLA 4KN5A 4WXMA 2L19A 3ITKA 1QIIA 3ICVA 1G9TA 3O5AA 1DKQA 1EA5A 4IEFB 1NVVR 3HZZA 5DTRA 4D4LA 1I01A 5I5GA 4MWBA 1LTKA 3IQIX 4EA7A 1EXMA 4LDAA 5JJBA 1Q84A 3D8UA 4CNBA 1FZTA 2XA1A 2YHBA 3ZU6A 4F04A 4Z4QA 3OZGA 5G4KA 4WD3A 1ZHFA 4PGAA 5KC9A 1R0ZA 1MD9A 1ZH6A 4LFBB 1BS2A 1EA7A 3W9BA 4MDYA 4BNGA 5HNKA 4O4HB 2CEKA 3KXKA 4HF7A 1MHTA 1H4TA 5A3JA 3BG5A 3TLKA 3PNQA 5C5EA 4PPQA 2VRCA 2VDWA 3WTBA 3CS3A 3D8RA 2QBYB 3C98A 2NU6B 2AJCA 2XA2A 3PXXA 4RFVA 3HDHA 4GXTA 1SUWA 4ZT5A 3H04A 3I2FA 4KOEC 4ZEMA 5BSHA 1TEVA 4H2DA 3AYXB 4YLYA 3TG2A 4L76A 4E6EA 3ICQB 1EEHA 5FA8A 4P5PA 1RWXA 4JQCA 3FPAA 4HWSA 4KFRA 2ZVJA 4PWZA 2AFRA 2PX8A 4CIWA 1CQZA 2PCLA 1G2PA 4ZI7B 5DN6D 4UBKA 1WF3A 2G9UA 4J2TA 1SOVA 3WSTA 4J0CA 3SXJA 1G5PA 3ZCVA 1AK2A 1PT6A 2GXQA 3BZWA 3PLAE 3IEXA 4N3AA 5JD6A 1WBJB 2ZSDA 2QLNA 1SZCA 4L8WB 1S8NA 4W4TA 5H3CA 5ADHA 5HDQA 5F2NA 3VPDA 4ACBA 2JZNA 2AVDA 2B6HA 5IAEA 1GYPA 521PA 4BP8A 4DHWA 2B25A 4QJ4A 1H8ED 1M2VB 1B8UA 3CX3A 4HAWA 4MCJA 3T7JA 4CIVA 1TTTA 4J3NA 5M2QA 3RUHA 4EG1A 4L0DA 3QEAZ 4V1CI 2HHHB 3REFA 1AU9A 2V7QA 1UBOS 4JZKA 3WGVA 2PT5A 3GDHA 3EIHA 3ZVMA 2E3JA 2WMDA 1G3IA 3H4MA 3K1ZA 1SPXA 4JP5A 4PXAA 4W9MC 2VDOB 2J0UA 1ZVKA 3CSUA 1WMEA 3K30A 1ES9A 3MWFA 4FYWA 5G0VA 3OICA 3OBBA 4DQ0A 2DGDA 5TF4A 1O5TA 2B7LA 1GU0A 1MQ9A 4LSGA 4XR9A 3HCPA 8ADHA 2NVUA 1ZM7A 3H1TA 5AVQA 4OHKA 2VPQA 5HYVA 1I2CA 1XNHA 1GLNA 2ZRAA 4HWKA 1YBHA 4HDSB 5MHTA 3QQ5A 2F4VB 3HNPA 1L6RA 2V6FA 5AM5A 2QUAA 3GLIB 3K8ZA 2OPBA 4MTLA 5F5XA 3SEFA 3WV4A 5LNK6 3HLKA 1J2JA 3FF4A 3THYB 5SYNA 3PEYA 5C1PA 2GRJA 3RRFA 3MM4A 3BZUA 2IKSA 4YRDA 2WNSA 3TLAA 3FRIA 3W79A 5HOQA 4HYYA 5E0KB 5K3CA 1S01A 3CZCA 3QLEA 1U7XA 4GYKA 1PJQA 3GUVA 3CUKA 3I6IA 3LQ2A 1U2RA 2G1KA 5JJIA 5IJ0A 3NIGB 1AUOA 1ZUWA 2PQMA 2V54A 1J42A 2JFUA 3RSSA 3TDKA 1DXYA 2WVJA 1ZWKA 2A9VA 3WRYC 1H3NA 2VYVD 3I04M 1KWGA 3RSHA 5AKJA 5DLYA 2X1MA 3CSSA 5J4KA 2CLMB 4QDZA 2FZWA 1S2NA 1M6EX 1PL8A 2PYIA 2I2BA 2WD9A 4P2BA 3A14A 4ZEOA 2FPPB 1U7WA 2ZJ2A 1TVKA 3ZE0B 2HRZA 3PUIA 4GMGA 3AR7A 3F2IA 4FWBA 4HX5A 3TOVA 2RGYA 3OU6A 4FI3C 5HZGA 4NCBA 3BHNA 5K51A 4O0LA 4AECA 1PS0A 4IM7A 2CSXA 2HF8A 2EJWA 2ZUEA 2LGJA 4IXNA 3ZQJA 1O89A 3K5WA 1W36B 5DE3A 5CP8A 4PLTA 3JPWA 1SXQA 3ACBA 4UTPA 3FOBA 3P4YA 4KQCA 2ZRGA 1RXWA 2YWCA 3OU7A 1IN7A 2V65A 3KE8A 4OSEA 3CQ9A 4GOMD 4D96A 1IWBB 3OTGA 1CF4A 2DKOA 1H2XA 2Q62A 3L8DA 4PYQA 4DR2B 5H8WA 1YBAA 5IBQA 1EFCA 3B36A 3ADKA 3F90A 1UWLA 5I4BA 1PFUA 1FBNA 1W8IA 1J24A 3GGPA 4U0JA 2F1JA 5EXTA 4LF9B 3I12A 2IUTA 1B42A 3QTTA 3RVMA 3H1AA 2PSHA 4A1OA 1WWKA 5FLEX 3CZMA 5AVSA 1KZ1A 3IUBA 4NSNA 4Z8YA 3Q3EA 3HB4X 5DSZA 2B8NA 2AR0A 2WEKA 5GOZA 4BO7A 4TL9A 1KI7A 2PLAA 2W6JD 2YUTA 3K8OE 3R76A 2F1KA 1SIUA 4ZC8A 2JJMA 3BMCA 1GU1A 1YS9A 1QC5B 3CX8A 3EXG1 4HPWA 1E0KA 3NPAA 1VB5A 1XJ0A 2GZSA 2X3FA 2A1IA 4PHCA 2P1ZA 5CLFA 3ZWCA 2IU6A 2GJAA 3B82A 3TGPA 4RTOA 5AFSA 1E2IA 1YNOA 1FFCA 4CQMB 3M6UA 4LIPD 3JD2A 2WYVA 1E20A 2G9NA 1KBOA 2PUBA 4B45A 3T3HA 1ZGGA 1BFDA 2WDZA 1LS6A 2I8CA 5KHLB 1NRWA 2YY5A 4OKIA 5AJXA 2HTFA 4GR4A 4LFAB 1EB9A 5IVPA 4PNZA 2QS9A 4EA9A 1VC2A 4MDEA 2B99A 1F5SA 1QB8A 3KWFA 3SOZA 4TLBA 4A7PA 4GI3A 4Q9NA 3DDSA 3LC7O 4EG4A 4ENUA 5IEJA 2ARKA 4GYWA 3HO1A 1C3OA 3DBHA 5KUTA 1W5BA 1UBCA 4NS1A 3WGTA 5KTOA 5K3DA 4XARA 3EFBA 3KZ1E 2PU5A 2OYCA 3EYAA 1M2OB 3L8CA 1OBVA 1FDTA 1KFJB 3A70A 3X2SA 3PC4A 1LC3A 4PAWA 4RJJA 2HKIA 3QNWA 3I0NA 4XGRA 4WFJA 4L5IA 4R9SA 3WX0A 3W5BA 1QZTA 4NE2A 1IK4A 4G81A 2EKDA 3FGZA 3FR8A 2RGAA 5CTAA 2GASA 1YQDA 4C88A 3KTAA 1T4BA 3L49A 5D7BA 1PVOA 5TLSA 4GRAA 5AIAA 2FJ0A 5CX1B 3RR2A 3DC2A 4NF2A 2C2WA 2GXSA 3KRTA 1KIAA 3MZ0A 4MMYB 5IX8A 3GLRA 3U09A 2JI8A 4ZIRB 4LJ8A 3FIUA 3QBEA 2BBTA 1QQ7A 3IESA 4DPMA 1KJ8A 2FQWA 1WSBA 1BAPA 1JR3A 1Z16A 2HF7A 3PUWA 3PP8A 3FWZA 3A9WA 3EGVA 3MQFA 4TXLA 2AOTA 3C7TA 2W42A 3AILA 2C82A 2Z30A 2IYPA 2YXBA 3CMCO 3F8TA 1I3KA 4BRUA 4G1BA 2QX8A 3QEOA 5GONA 3VZSA 4WRRA 5HMLA 2WAYA 2NSLA 5E6RB 3ABIA 4PV7A 4X8MA 1PZEA 4JOCA 5BVHA 4MOWA 4FDAA 3LUBA 1F1JA 4L2IB 4CW7A 1WMFA 1BE6A 4IQ8A 5DWVA 1NFFA 2OGZA 4BV2A 1EVLA 1KHTA 2Q27A 2Z98A 4KGZA 1GYRA 1RI4A 2IEIA 3I6BA 3LY5A 3WGNA 4GOLD 2HLNA 1U4SA 4TQUS 5CG2A 1DBSA 3NOVA 5KPDA 1LLQA 5FP0A 5AKKA 2V7QD 3PQ4A 4UZFA 1Q17A 5EP2A 3UJPA 2UXDB 3O4HA 4I1IA 1D3AA 1IN4A 1NNSA 1OZHA 3OCCA 5EJFA 2BGIA 3HH8A 4DM3A 2JFNA 1KH2A 4PNHA 1Q12A 1JAXA 1X38A 3DG9A 1TQ4A 4UCFA 4L9RA 3CJRA 3CPJB 4MGYR 1CYEA 4KACA 3H19A 1Z2DA 4GICA 4NL4H 3OJOA 3RUEA 3LT0A 5ENZA 3UT5A 1YQXA 2RG7A 3KQQA 3W3AA 4F7WA 3BKXA 3ND9A 3SFVA 3U9TA 1NXWA 1B14A 1X87A 2VF7A 3CG4A 2GPTA 4J0DA 3EDQA 3IPYA 4JKYA 4XA8A 1LV8A 4EW2A 3BORA 1XVTA 4MWZA 3CR3C 3MJFA 2CV1A 2Z5GA 2D2XA 4FMCB 2FOIA 3BWMA 3SX0A 1QH0A 1R8JA 3WADA 2HJHA 5P21A 2J31A 4LYFA 4RDHA 3ENZA 3ZWOA 2VWGA 3B6ZA 1SC1A 3O38A 1MO4A 3ZQUA 3ZHOA 1TO6A 2JIMA 4MW2A 2WJPA 1UADA 1YUMA 3IXMA 4MQBA 4S12A 4J4TA 2Q9BA 2YN0A 3EXIB 1GTRA 3EVBA 4ILEA 1GG2A 2H17A 3D4BA 4OTZA 4RVGA 4EKEA 5LXTB 1Z28A 3UF0A 3VOAA 2IFTA 1NL3A 2MTBA 4OBXA 4KK4A 3GLKA 2ZRCA 3CX7A 4EHBA 2H51A 3IAAA 4XVRA 1QO0D 5TQ0A 5EWMB 4W9NA 5ERGB 3SC6A 1IXYA 1ZGCA 5F9HA 3SGLA 4BQSA 1RRGA 3NUZA 5FQNA 1RJWA 2PVPA 4GLOA 2OKCA 4ZYTA 3O1IC 2OBNA 1PLLA 2AA3A 1DKLA 3H1PA 1NXQA 3O9MA 4DA7A 2ALJA 2NYAA 2E9SA 3V1KA 3WL7A 1GGFA 4EVQA 1POWA 3AUTA 2AX4A 1ZNQO 5JYCA 1IY8A 3MJCA 3IPXA 4J3JA 1GAEO 4LFCB 3HKDA 2NQ8A 2CY0A 3LNCA 4ZAGA 4XD2A 1UZMA 1Y33E 1PX2A 3CUYA 2VJMA 4NBRA 1GM5A 2GPJA 3FCEA 1Q95A 4F91B 3IRUA 3T52A 3K0FA 2VJCA 3KUKA 4OA5A 3SMVA 2JAWA 4NJMA 4JI8B 5DGHA 4CMEA 2D1YA 4IRXA 4D02A 4HLDA 1BDIA 1NUQA 4EVIA 1YB5A 3PNKA 1GSHA 4Z7QB 3WLRA 1EK5A 2A5FA 2ZAOA 3DUWA 4NCXA 2J9YB 5DNEA 2VWHA 3QHQA 2XGGA 4I9HA 1F2TA 1JQ3A 3AF4A 2G4LA 3AWDA 3MCVA 1T43A 4S1WA 5K2OA 4YFYA 4B5LA 1PFVA 4AJ1A 4DVJA 2CK3A 4R2KA 3WYBA 5TQ2B 5IKEA 1CJMA 2J7PA 3IQXA 3OZWA 4JIGA 5F2EA 1XRJA 2DQYA 1H69A 3DOIA 1IH8A 4OY3A 5EVCA 3TJMA 3L8GA 4B3HA 3BIXA 2OHOA 3FYUB 3W6NA 3MT7A 1QTQA 2B0JA 3BK2A 1RQNA 1MJHA 4N40A 3DE0X 5EWLA 1QX4A 1SWWA 3GLUA 2JAQA 4LYDA 5DCWA 3I4FA 1E5LA 2XUHA 2ZAGA 5HCUA 4EW3A 3CVOA 4JL5A 1ESCA 5AVKA 1WBBA 2MYTA 3JQAD 2HZ7A 3Q4GA 3QVGA 4NABA 5FBRB 4GUAA 2TMKA 2WPNA 4FKBA 2HADA 2ZJYA 5EXDA 2Y93A 3GP3A 3W9YA 2A67A 2QM3A 4BFUA 3BDVA 4HDNA 3HMQA 2ZIEA 3FNRA 2JASA 3O8OB 3PXDA 3DHEA 1OR8A 1FB5A 1ZC4A 5BVGB 3E48A 1CDOA 2EAUA 4FSDA 1NLZA 3CO5A 4FZRA 4YUZA 3SP1A 3LKDA 4U2FA 4N1AA 4PZYA 4B74A 4ALJA 2H5EA 2VAVA 4I3HA 3WLSA 4YCMA 1AURA 1P2UA 3BFPA 1ICIA 1C1XA 3KSAC 3O74A 5TJ9A 3AVUA 4XM2A 1VFPA 3H11B 1TO2E 4Q4AB 3O31A 3RI3A 4DQVA 3NWPA 1GCAA 4RA6A 4JLPA 1KY2A 4NE7A 3EDCA 1DCFA 5CA1A 2VZ8A 1I9CA 2EU8A 5FPSA 1U0BB 3IQZA 2YV4A 3QX8A 3JVVA 2JIRA 4BUZA 3HBNA 2XJ9A 4KE9A 3U5TA 4H4CA 5IVKA 4G4SO 2C54A 2E2WA 5AI8A 4BIIA 4JBGA 1NIPA 1E6WA 4W5OA 2MMCA 4L3VA 1B8NA 3ZZUA 2GJ4A 4AVYA 1U9CA 5B53A 4RELA 4GPTA 2ATVA 4NPAA 4REQB 3ZCRA 3CKKA 2PFGA 1LJUA 2X1HA 5HJEA 4H3VA 1M10A 5IKOA 1Y4SA 2XW6A 4M89A 5JCPA 3THYA 1J20A 3M5CA 1NJFA 4ND5A 3IA7A 4YA6A 3B1JA 4RK7A 2NX2A 5FCDA 3PKIA 4A0QA 4AMUA 1NKSA 1R4NA 1NPDA 3V42A 3HNRA 4DR6B 2HO4A 1AXRA 3OZRA 5T41A 3AJ9A 5F64A 1M1YB 1XR3A 1YS7A 2R751 3AHHA 4FK8A 4M37A 4TS4A 3PR3A 5HMMA 4P3OA 2QU8A 3U6KA 1A5SB 2PRKA 1S4QA 3EEQA 2AXQA 5CNKA 1IOWA 5DEIA 2H2HA 4OBEA 4HEA1 4RSMA 3GUCA 5JBNA 3DONA 1ILWA 1QK4A 1SCQA 3FWHA 3G6WA 3WK6A 5LUBA 1NVMB 1C0IA 3GARA 4FCCA 5CT5A 4X3PA 4RL6A 1GPNA 3RVJA 2AN5A 1I2ZA 1WX1A 1BXKA 3U1TA 1XEWX 3KO8A 1NN0A 5A5GA 1S3GA 4BKOA 1NX9A 3I6QA 1GPLA 1ZCBA 2Y1EA 3QU7A 5JUWA 4JJ6A 4TYMA 4FDVA 3S99A 2GWHA 3NUGA 3H86A 2C96A 1K98A 4J07A 5DNVA 3ICOA 2A5JA 3OI7A 2DB3A 3UA4A 2QOEA 5B6IA 3L7JA 1YZ3A 3AHFA 4DZRA 3AVXA 5C7LO 5ALYA 4C3ZA 1NURA 3E3NA 5E95A 4DEVA 1CDDA 1KEEA 1YBVA 1ZW6A 3ESYA 3H5OA 4G0YA 3B3AA 3DUFA 2NWQA 1PNVA 3U62A 3WSWA 2KQUA 4ER7A 3OT5A 1R4MB 4INAA 1J25A 4QXMA 1MB4A 3S55A 2YCBA 1SURA 3N58A 3WNDA 4D4JA 3DFFA 4P53A 2QLMA 2QG4A 2A0KA 4M1YA 4CM9D 4YDQA 3BXHA 1G8AA 1QTIA 4UU0A 3MHPA 1JR6A 3A2KA 1L8LA 4NATA 1DG9A 4F3YA 1L5SA 3WHPA 1BXGA 5AMXA 2NIPA 5DNYB 5IT4A 2WZDA 2QG6A 3ZHXA 4DXDA 3AO0B 2Q4TA 1XCOA 2W6PA 1E5TA 4MO9A 1KAEA 4CKYA 4TMKA 4KXYA 3ZGNA 3VNVA 1VMAA 3KHUA 3GFQA 2A59A 5F3RA 5FBQB 2QD3A 1XRNA 3PQ5A 5M04A 5JWOA 1E9VA 4WY5A 1FYDA 3JZIA 4LOLA 1ZIPA 1FDWA 4IF4A 1YKSA 5CH5A 1JMYA 3KJXA 5EYPB 1E7MA 4ZO4A 2A1UA 4A16A 1A88A 4I1PA 4JI3B 2JGIA 2QQGA 1SVKA 1UBKS 1KRXA 1O94A 3HKDB 6AT1A 2WSMA 2ZM5A 4X62B 2V0CA 3R09A 3ZLBA 1ZMTA 3LE8A 5BR7A 3H9GA 3QX3A 1UZLA 3WMFA 3E5RA 3ZBPA 4MV7A 4PHHA 1WCWA 5FHRA 3GD5A 4Y2UA 5CVTA 3UMMA 1XZQA 2ZYVX 4URFA 5J4YA 1LTQA 4CG2A 5EPUA 1NYLA 4C05A 1GQSA 2IOQA 1V26A 3F9IA 3MNFA 4Z99A 3Q85A 1AA9A 2VBCA 3ZCXA 4E1VA 3N53A 1GUDA 5KVAA 4LZNA 4DCGA 2H1OA 1IZYA 1OHHA 1G8YA 2IPLA 2B8EA 2F90A 3AC0A 2OCIA 4J2OA 2YV3A 4EKNB 7GPBA 3TW0A 4QQKA 1XQWA 4PO8A 4BBPA 2XE7A 2Y9PB 3DMRA 2WKWA 2G1UA 1KNXA 1KZ9A 2VDJA 3FZQA 1HG0A 4FUTA 2J7PD 2NZXA 5GQSA 4AZ0B 2OCKA 1TRHA 5SYAA 4ER0A 5IK2D 2R4TA 2H2WA 1E6LA 2IDKA 4FCWA 3QNMA 3BBPA 1H42A 4GBJA 4RFSB 5AOVA 5EPOA 5KVQA 1XMVA 5JRZA 4Q7KA 1YMQA 2C99A 1MFPA 1KE1A 1M0WA 3IMCA 1NRJB 1G8JA 3ISTA 1N2GA 3V55A 4MMXB 3I09A 5AHWA 3PDIA 4X6XA 3U7EB 2CLSA 1M72A 4YRIA 1RHJA 2BRUC 1U8FO 1OC2A 1C3EA 2EDAA 4QJ3A 3MWLA 3J81A 3AP3A 4GXRA 4N49A 4EPYA 3IBGA 5F4BA 4EEKA 5KEIA 2EJTA 2D06A 4Q12A 3EODA 5FFFA 4K5QA 5PNTA 3RHFA 3ZXUB 3ZHSA 2Z6AA 3CIFA 1HK7A 4QUDA 1I3LA 1SVOA 1YQTA 5BSKA 4Q4HB 4TQGA 4DCSA 2BMEA 1VLJA 2VDNB 4Q9AA 1U2TA 3KQSA 1EK2A 2CJFA 3O75A 4HNUA 2QLJA 3LW8A 4TV9B 4BZWA 1AUVA 5I7EA 3FOCA 4CTJA 2BFDB 4NNJA 2OWEA 2G25A 3RE1A 1TMKA 3GVHA 5F1KA 5JSHA 3BXPA 1JDUA 2UUPA 1FFXB 1GPBA 5K0ZA 3FOAA 3C1UA 1DNPA 2LTAA 3GFRA 4PSVA 3DULA 1AS0A 2Q50A 3KM0A 5K1ZA 3RVSA 5JAMA 5DHQA 5A9SB 1GVNB 1DE0A 5CGZA 3RS3A 1QV6A 2AOTB 2O14A 1Y6FA 3TDNA 4ETNA 1E2KA 4L72A 2F3RA 2QRQA 2AH5A 4S0ZA 4D9MA 1DZIA 1N2CA 4C6HA 2LNDA 3TVDA 2J4DA 2H85A 2YZ7A 3NJ4A 1KY3A 3DD5A 3AUSA 3UC5A 4RE6A 3U80A 4UHBA 2ZUSA 3NQ41 1GNQA 1EAYA 2NTNA 4KRGA 1JEDA 1K7CA 2OECA 2VNJA 1JZTA 2ZBPA 4WZAE 1LW7A 5FB3A 3J81k 1AB5A 1VJ1A 1DC5A 3P9QA 3ZHTA 4QJBA 3MFQA 2FUEA 5IUKC 5JJ5A 1V8OA 4EHJA 2XQKA 4H6XA 1DTSA 5FLKA 3CCCA 5DLEA 1EINA 5LBTA 2YV1A 1GFSA 1LPSA 1XZHA 2G9VA 1M2EA 2DPMA 4Y3UA 2O8EB 3D6AA 3ZV5A 1AUXA 3VOTA 1NF2A 3IUNA 3ACDA 2XUQA 3R3UA 2FPMA 4RAQA 2QSZA 4A1FA 3K9NA 2QENA 3AF6A 2E5LB 1V7CA 4DLBA 2F3QA 2I7XA 2JLVA 3C7CB 1YRWA 1SUSA 2RGNA 2V03A 2D74A 1AF4A 2FFBA 2OV4A 3KQWA 3IR7A 1W0KA 4F3TA 5JMPA 1RNLA 3HXPA 4NH4A 1HWYA 5F78A 4C0BA 3B3GA 5CDTA 4HQLA 1QF7A 1E2NA 1LW6E 2QRGA 5JLJA 3WIUA 1U0JA 4HDAA 2RCYA 5JYEA 1HDOA 4BKMA 2QUZA 3FUWA 1CT9A 3H05A 3WYFA 4M6WA 2QGZA 4DCUA 1X7XA 3VXKA 5BPFA 4K46A 3DE6X 3HE3A 5C8YB 3FNHA 5KQSA 4YCCA 2VBGA 3KJGA 5B7QA 5J4HA 3RH0A 2OMKA 3STTA 2GEKA 5JWHA 2QA5A 2Q2NA 5HKKD 3E15A 1TW3A 5J40A 1NONA 2NU9A 2M6LA 5IXSA 4E09A 2WUWE 2C7PA 4JMLA 4IJWA 5CVUA 1UFOA 4B32A 1BD4A 3K16A 3IUQA 3PVSA 1FFBA 1RWPA 1CY7A 4MR9B 2YX1A 1RABA 1QGDA 2XITA 3NWBA 1SM4A 4RBNA 4ZVRA 1UZNA 1UBJS 1H05A 2G6BA 1CCWA 2QL5A 3QM1A 4DR4B 4KR3A 4JJAA 1MJ5A 4AULA 3H11A 4RXUA 5G3ZA 1SU6A 3TZCA 3QYPA 2A4KA 4QT0A 3ZIDA 4BIMA 2X6RA 1OVMA 4Y7DA 4FGUA 3GLIE 2PKRA 2OK7A 5I7HA 2R8YA 5FTLA 4NICA 4DLWA 1TVCA 5JALA 4PX5A 1UT6A 1T3HA 4LF6B 3ANLA 3FOWA 1I3MA 1B0PA 4G1EB 4HL6A 4O4IA 1OA1A 1N5DA 1DRKA 3PLNA 1C1YA 4EEZA 3AONB 3DF9A 3QHPA 3OFJA 3ON5A 2ZS9A 4HPXB 1F6WA 2ECFA 4G0NA 4X41A 1G21A 4XFKA 5LNK1 3IEMA 2DQKA 5JZSA 1JI0A 4N5LA 2Q5LA 2F64A 1HEYA 3E9YA 3GVPA 3I6MA 1ATIA 1JIQA 2YVKA 4FKZA 4F9EA 5T3YA 1U63A 2O2DA 1VRWA 1QVAA 4U2EA 1YQUA 3CF6R 2IEGA 2VYCA 4N6GA 2P9QA 3TQQA 4PFJA 3C6YA 4BECA 2I55A 3H65A 1E18A 3KFXA 1YL5A 4D6XA 1CRQA 2FRXA 3FSGA 3QKTA 5L3QA 3VPXA 1RADA 2QPOA 3R24A 3MB8A 2XR1A 2CYCA 3VBEA 1TA4A 4IS2A 2P6PA 4S1TA 2R6JA 4LTDA 2UVDA 4YJ3F 1I0ZA 1Y0BA 1IJBA 2CZCA 4CETA 2HI0A 4CKCB 4LGVA 5JJCA 4JC8A 2XYPA 3BX1A 4HDMB 1GEEA 1BXGB 3I2HA 2D8AA 5DRYA 5D3KA 3CPHA 3SPXA 5GOTA 4LJ7A 3R1IA 3M4YA 1NC3A 4HB4A 1WPGA 5CHEA 1C50A 2RHJA 1AKYA 1GRQA 5EPEA 2G3YA 2C3YA 1IHDA 3KUDA 2IYWA 3SSOA 2BEVB 2D3WA 3RRMA 1J0DA 1FYEA 5BURA 1DIHA 1XKLA 4G0VA 1QGUB 3RTCA 5B7NA 2MSNA 3SQWA 1BSVA 4GG1A 5CB8A 4Q9HA 1HC7A 3FDXA 1ZISA 2I6GA 3BF8A 4HG2A 4NQZA 1FUKA 5DI3A 3WL5A 1G41A 2FP3A 1MV8A 3C5VA 1K66A 1E1QD 3HRKA 2YWRA 1LF0A 3FHJA 3JD1A 3HVUA 1T13A 4GLFA 3WOHA 1DQYA 3LUGA 3OKPA 3SSMA 3A9UA 1RCUA 5EJ4A 3GPCA 3HHEA 2R97A 4WUVA 1D0IA 2OXTA 2PMCA 1OAOC 2QVZX 3GAFA 4OIMA 3AINA 1R9MA 3THWB 1NGSA 2VSNA 3N86A 4JT4A 4GGMX 4ND3A 4WNIA 7REQA 5H59A 2H0RA 1DBVO 1BTOA 1O94D 3UFXA 4JLKA 2FMTA 3DV2A 1P9OA 1ZM4A 1Z17A 4KXMA 1YZFA 2QB5A 2C5BA 1IVNA 1EFRD 3QZUA 3WDLA 2PUCA 4NYIR 1KP9A 1PFGA 1R0YA 2RHGB 3NU1A 3KYDB 2VN8A 1PL0A 1COWD 1TA0A 1T5TA 3BMXA 1S3IA 2IUFA 1D8TA 1WEHA 4IG9A 5D1HA 5DN9A 2BFCB 3CH6A 1BCRA 5AVUA 4F3RA 1JHOA 1RYFA 4E4YA 3WRXA 4FXPA 4PPGA 3UQZA 1L1EA 5L4LA 1QANA 3FLEA 1PWYE 4YQZA 4LJ5A 1I3CA 4UMDA 4M53A 3GJQA 1WY5A 5AM3A 4LDJA 4BB0A 1AO0A 3WISA 3EWSA 4PBRA 4Q1EA 2VZ0A 3LQYA 5GM1A 5D6NA 1YFLA 1IATA 3D6NB 1SRRA 1J0XO 3HM2A 4D45A 3QJGA 5FAKA 4EGAA 1NBWB 1PI3A 4XFDA 1VSUA 2ZJAA 4WFQA 3CLHA 1PK8A 4O0MA 1FP7A 1NV8A 1PW7A 5HK9A 1YR3A 1XVUA 4MB2A 5GJCA 2B1RA 3T06B 1XLVA 3OF2A 3G8DA 2QE7D 2HQOA 2I76A 3QVOA 4K6FA 3ZLTA 3ZWBA 1EX7A 3QVWA 4XIJA 1JHXA 2VH5R 1GGJA 1XTJA 2FJPA 3DDWA 5AWFC 4OHPA 1BX0A 1SUCA 4JY7A 3W9SA 3QG1A 2QE6A 4M9CA 5DCLA 1P2BA 2G7MC 2WILA 2Y1FA 2Y99A 3DPSA 3F71A 2GZHA 2XMRA 3KFLA 4LOKA 1X92A 3UJ7A 5JAUA 3N7AA 2HLHA 1JIVA 4IMPA 2FUG6 3TMYA 4MVJD 3PTAA 4MICA 4QBHA 2PQ6A 4I55F 4QUIA 1SXJC 3PCRB 4Q4AA 2IU3A 4WGFA 5EJGA 3S5UA 2CFRA 3WHIA 2FSHA 3L43A 3U4HA 1D8AA 3LU1A 3OLCX 3Q6NA 2RHOA 3R7AA 4ZI7A 1JDNA 2VZLA 5C9ZA 4H0FA 1EP3B 1PQPA 2AJ8A 3TZHA 1NDQA 1CJUC 2FU5C 3F7TA 4GEGA 3U4GA 4B76A 4CI9A 4DLXA 2FZ5A 3A9RA 3OQPA 3U60B 4F3KA 5HQ3B 1IEQA 3ZCUA 1J1ZA 1EHIA 4QIHA 1FRNA 2BEWB 3S6JA 1AKEA 4F6RB 2ZYUX 2VHXA 4WK2B 4C4OA 1V5EA 1ZONA 2MDTA 3T7TA 3WB2A 3FNIA 2Z2KA 2JJYA 1C9KA 2XMBA 3LH5A 2OLKA 1LDMA 3TTSA 1FNBA 3W2FA 4B7CA 3ZBTA 2WP8J 1X19A 2H4JA 3HVJA 3LHIA 4D1YA 1IRIA 3MQ2A 1PLKA 1YE3A 4WOCA 1W5FA 1XA3A 1IDN1 1J8VA 3B7WA 5TV2A 2PWPA 4AYWA 4FEAA 4KSBA 2G83A 2IYTA 2SCUB 3JQQA 1A1VA 2GLUA 4MXDA 3FYUA 4HMOA 2TYSB 3I28A 4BN5A 1AGPA 5JIBA 1IBKB 3R4CA 4MVJE 4MQUA 1RJ9A 3EXAA 3I2YX 3IJPA 1VBFA 2Z1MA 2D5AA 3IIKA 3SZUA 1SXIA 3LBHA 3HBJA 3WK4A 1B76A 1KO8A 1WSWA 1Z0IA 2RAUA 2XTAA 2ZIWB 4A6PA 4NARA 2W6CX 3GNSA 4YI5A 2XA9A 4M0KA 4HO1X 3HVRA 1Y4ZA 3OZ7A 4Y2HA 2Z6VA 4UFNA 4GI7A 1SOAA 3GG9A 2MWMA 2ZJZA 3QWAA 5CVCA 4DLLA 3OKAA 2F9FA 5IW8A 2QU7A 4DZZA 2CUZA 3BAZA 1QLJA 2OD9A 4QL3A 4J76A 1KY5A 2BMWA 5EKUA 1UWCA 1IM5A 2VA9A 3HCDA 4FJ2A 4PBSA 4TWZA 1ZN8A 1P17A 2Z58A 4M38A 2DX7A 3BQMB 4G6ZA 4WZ6A 1GGVA 5ALXA 5LZ4A 5ICSA 5LSAA 1XZPA 4X1IA 2JARA 2G82A 2AFIE 4NG5A 4K2HA 5CLHA 3V8EA 1MJFA 1P62B 4BBZA 4CF4A 1W0KD 4IRUB 4KXNA 3C3KA 5EIOA 1OIVA 3HI6A 2O07A 6NULA 2PJZA 1JJIA 4XDYA 4RUKA 2BTOA 1AH2A 3DBRB 4OI1A 5TMBA 1P0FA 2Z2XA 3BMCB 3MVEA 5D5HA 5FOSA 3RTEA 4BNJA 1ZAKA 1L5FA 3NG1A 4LBWA 4AXBA 4AQYB 1N7GA 3TXYA 3WIVA 4PNEA 2CDRA 4YMLA 3RWOA 1PR2A 3HRHA 2PG3A 2FETA 3BGIA 4KJZA 5CM2Z 5GM2A 4ZCTA 1ZK3A 1ND6A 2GHIA 4G0XA 5CB4B 4MQ6A 3EXEA 3FCXA 3VBCA 1KSGA 1U9YA 3JAKA 4TPKA 4TXMA 4C0LA 5KC8A 2A1TS 3ZOZA 3K9FC 3JRXA 3BQNB 4FFBB 4DYHA 1H4QA 1TAQA 3RSLA 3D81A 1GPAA 3B1VA 2P11A 3GFGA 3P9YA 3T9EA 4H1TA 5FWXB 3LT2A 2PEYA 2AQKA 1R50A 1JDBB 1QQAA 1V35A 4ON9A 2WU1A 4Q3AA 3BOSA 1QG4A 1GO2A 2ZW9A 4CMBA 2J8ZA 5EHZA 3UG7A 3HM9A 3E3LA 3BPSA 3TB6A 5ABPA 1IOVA 1RHMA 1JR3E 4QM6A 3GLFA 3OM0A 2C4TA 3TQSA 2PGJA 3WL3A 3AB3A 3G68A 4JUIA 1Y63A 4KQIA 4D82A 1KWKA 4YXWD 1SIBE 1E61A 1M2NA 2QUKA 3LL7A 3S1AA 3Q11A 1JJAA 4U7GA 2AYYA 4IWYA 2VS1A 3LF2A 4N18A 5FOQA 4B3MB 2IHTA 2CMDA 5EFOA 4XW2A 2FQQA 2WF9A 4I9FA 3SSAA 5C1DA 3L4JA 2HCFA 2BFBB 4XGKA 3C48A 4HYQA 2XUAA 4C89A 1T2VA 2NUBA 1OH7A 4DIBA 1TAHA 1B6GA 1FJHA 2AF4C 3EPKA 2C94A 4LHZA 3OPXA 1GG5A 1HDZA 2LR0A 5CK4A 2HJGA 2PIAA 1SKYE 1BOFA 5DSTA 5FWXA 3ZGYA 4AB1A 1FF9A 4WGGA 1CY6A 2NZ8A 3X3HA 4COKA 4ZZ3A 3FNBA 3AERB 3G0CA 1RLOA 3OO0A 1USKA 5HUQA 2QSJA 5BYBA 5FWDA 2WJHA 1DEOA 2O3UA 4EZBA 2G4VA 2OD7A 1B4DA 1J99A 1HKHA 2HNBA 2VDPB 1IPHA 1CJCA 4UUBA 4YRCA 1ZJJA 4MQLA 2R4UA 3B7PA 4ZCPA 3OEHA 4DANA 3CRRA 2VZ9A 4P0TA 4H35A 1DEHA 1HE5A 1MBZA 1NU6A 1SVNA 2ZJ6A 1HT1E 3KJIA 4D0LB 5HVNA 4ZQCB 2G76A 4X90A 4A91A 5AQEA 3N8KA 4H6VA 4WNAB 1P18A 4J1TC 4YRBA 1TU3A 4FPXA 2YWEA 3GLFE 1OZFA 5JSQA 2QVYX 3VR6A 3WL6A 1ODCA 1NXPA 4C4PA 1G7TA 2NW6A 4UVGA 4MR9A 4WVLA 4EECA 5A71A 3T94A 4RV4A 1KPHA 1YZLA 3H7IA 2IXDA 1D4OA 4N9WA 2GEVA 4J0EA 1GKIA 1Q7RA 1MVOA 3PFIA 2ZQ5A 3AHGA 1JKXA 1CKEA 2CFOA 3C6KA 1J2RA 2Q1SA 4UDNA 3B70A 2P8SA 1TM2A 4XX1A 2C4UA 3HY6A 3TGWA 1Y8ZA 4BLTA 2V5UA 3F5QA 3H7AA 1NLMA 4GGPA 4JUCA 4Q82A 4CMIB 1NYTA 1W48A 3H6KA 1XTIA 1AK1A 4PN3A 4HUQA 2FN4A 3D3JA 3K1AA 3G0GA 2J4CA 2FW8A 3IKMB 2VAPA 4WEQA 4LDNA 2QDXA 4E5YA 4FM9A 1JXMA 1IVSA 1T10A 1NWHA 3KKPA 4MDHA 4AK9A 5JAOA 4K05A 1VPVA 5HF5A 1RKVA 1DEXA 4UE6A 1KQGA 3KYIB 3HCAA 4UEOA 4HI0E 4RHXA 5HG0A 1RWOA 2I03A 1W29A 3GUZA 4F2PA 1B74A 4OGWA 3B6JA 5T6BA 4ZDWA 2A14A 5HZKA 1BHSA 2OL4A 1M76A 4HTFB 3LX8A 3V6MA 4FN4A 3IP7A 2NT3A 3O90A 1Y9JA 3K6JA 4IDQA 4YNBA 1AGXA 5EXSA 2ILVA 3KZXA 1SKMA 1Z62A 5B1IA 4JR2A 4H3SA 1THGA 3K53A 1QYWA 1OCEA 1N6LA 1MXFA 5F7JA 3OTWA 2SKDA 5DIFA 4U2CA 3DDHA 1GQOA 1QB7A 1PV1A 4PLCA 3THRA 4DV0B 1ZH2A 4XRGA 2V7UA 2I3GA 4O4LA 4GAEA 3WAKA 3P7MA 3CH7A 2D7JA 2YC4C 4PO9A 3RAPR 1LSSA 2D5LA 2WTUA 2D1TA 3AVVA 5HTKA 4KITB 3BEOA 1MW8X 1W94A 2ACKA 3FMVA 3M49A 1E3SA 4C43A 5ER9A 4BGEA 2E49A 1JSCA 2PS1A 3H8WA 4IDDA 3O0TA 3QFTA 5AR1A 2Q4RA 5BQPA 3NTXA 3JWGA 4JQYA 2O48X 3DZGA 3E6AA 1ZH8A 4GXQA 4Q5IA 5CGQB 5ALUA 4XVCA 4Q48A 5LVAA 3IIIA 2I80A 3V2IA 4YDSA 5H5JA 1M67A 1VXRA 4DY4A 2EKBA 2OGSA 3QLVC 3RUCA 1GUYA 1EH5A 2FPPA 3A1UA 4LSMA 4CQLA 5JDIA 1N2IA 4ZJYA 4DTCA 2XYVA 4JJ4A 2H9IA 2V9CA 1LLDA 3I04A 4B8ZA 4AJ4A 1RHQA 1HH4A 1XF1A 3G2IA 1PYGA 4R1QA 1SA0B 1SVLA 3DEAA 1OFGA 4U9HS 3WAJA 2CXNA 3IAS1 4XVUA 2HPHA 1EWVA 3CLVA 3R3VA 5GONF 3CUEF 1C2TA 1JN0A 3JAWB 3NR2A 4GE3A 4HLQB 3KQOA 1UKCA 3ZI7A 2FDCA 2PUEA 1CE8B 3ZEIA 2GD0A 4B7XA 2M6KA 3A58B 4NOMA 5J23A 1VKHA 4JI6B 1A9TA 1E8NA 1YJBA 2D0OB 1SIOA 2O4UX 4B3DA 1IBMB 1VGRA 2ZJFA 4CLRB 2XNHA 4L6IA 4RK6A 5EIFA 1KJNA 4YAJA 2DT5A 3PEEA 1WAMA 2D59A 2YBDA 1EVYA 5F76A 2Z9CA 1VE5A 4P5EA 1E6MA 3F5DA 2BFFB 4NRDA 1R6XA 1V6SA 1JJVA 2V7EA 3H6HA 3NHKA 1ECLA 2LIPA 4HK4A 3GRAA 4NPCA 3TVYA 4AUMA 4IOJA 3RVNA 3DB1A 4Y6SA 5J47A 1G4AE 4HN4B 3G9ZA 2GCOB 1RZUA 3BERA 3QLJA 4MJ3A 4O6VA 4M98A 1CUWA 4RA6B 4RQUA 1OZAA 1E7QA 3GCZA 4BNHA 1MAHA 4R2JA 1TUGA 2VCYA 4CMHA 2PMKA 3CLSC 1X7WB 3DMFA 1XAJA 4B9EA 1T6XA 1HETA 1JHDA 2FEWB 1FFHA 4GX1A 5AJTA 5T8KC 4MROA 1WUYA 1KVTA 1XT6A 2G08A 1EESA 1NZJA 2CMHA 5IANA 4YXFA 2WT8A 4BLPA 1P2DA 4C5BA 1C8KA 3D7KA 3HXQA 1GXSA 2Y71A 4LJRA 2VC2B 3EVEA 1NIJA 1NOIA 1XEFA 2F4NA 1RWWA 2ZDGA 3EUFA 3GGSA 4Y9RA 4C4TA 4HUTA 1FP4A 1K6JA 5JD3A 1MAWA 3VSDA 2Q29A 2DFDA 2TS1A 5C8ZA 2O8NA 3U7GA 1CEQA 1NQAO 2R4QA 5AXCA 2NUTB 3R75A 4JYBA 4HZUB 3SHVA 4XXHA 3OF3A 4PRKA 1OFTA 1Y3IA 2ISSD 1IVYA 1O08A 2BAGA 1OWNA 1GL9B 3H5VA 1RLUA 3DV0A 1E62A 2P4QA 5K0CA 4HBGA 5KI6A 4W63A 1W8DA 1R3DA 5SZIA 4MV8A 2I1QA 3RWMB 3ZWDA 4PQGA 3OM1A 4XWKA 1EE1A 3I62A 3WLOA 5JAZA 4GQBA 1X7YB 5ARCA 3NIWA