2VP5A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
191
Chain Sequence
TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords DEOXYNUCLEOSIDE KINASE
total genus 73
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vp5A00
4B34A 3AKDA 5L3SB 2ZJ2A 1SQ5A 1OT3A 1XTQA 4EQ6A 2HT6A 1E69A 2WOOA 3CM0A 4WAUA 5JHHB 221PA 3CWQA 1P60A 5FTLA 4A2PA 3X2SA 2A5YB 3KJIA 1CR4A 2GJ9A 2GJAA 1CJUC 2VA8A 2ONKA 3M4YA 4HB4A 2AKAB 1YVDA 4KODA 4B2PA 2Z83A 3AV0B 1NVXQ 3EXAA 1IXRC 1LF0A 1NJGA 2EFDB 2UZIR 4PSVA 4Q21A 1E2HA 4IVRA 1Q1EA 4LJYA 5DI3B 4O0MA 4PPGA 1EWQA 1LS1A 2VEDA 3DM9B 2W2XA 5FBWB 3TW8B 2AFHE 5FBVB 2WWYA 3H2YA 2C5LA 4FW9A 1DAGA 2HJVA 3PR1A 3CNLA 1Z07A 4F4IA 1OXTA 4B3CA 1Q3TA 1QG2A 1B0UA 2YOHA 4UXHA 4RD6A 5IDVA 4AIIA 2IUTA 3GP8A 3SZRA 3RABA 5JS8A 1CP2A 1U81A 5F9FA 1AIPA 2MSCB 5D3MB 3WHLA 3LX8A 3NBFA 4GOXA 4NYIR 1CKEA 5JI2E 2CCKA 4KSBA 4Q1CA 1OIXA 2H16A 2ZTSA 3T34A 2XXAB 4P31A 1XFAA 3BB4A 3K70B 2XTNA 4RD4A 3IIJA 5FUVA 3QKUA 3GLIB 3LVQE 2W0SA 3KXKA 1G291 5DHFA 2D2FA 2QBYB 2FG5A 2IYZA 2ZSDA 1KDOA 2Z43A 4BLPA 5FUWA 4E03A 4QJ4A 3SJCA 5K8IA 3IEUA 4JLVA 4DLWA 3D8BA 3K09C 5FBLB 2XB2A 2X19A 3AGPA 4BRUA 2QBYA 2QPTA 1W4AA 3ADBA 3BB1A 2J0VA 5DISB 3TUJC 3KUCA 4HATA 3RNLA 3CUEF 4CGZA 3ZYCA 1E9DA 2AWOA 4CDGA 4W7SA 2HLDD 4CIDA 2OT3B 4P3YA 2O8CB 5EE9A 3IHWA 4DCUA 4PQYA 1GILA 3MJRA 4HAXA 4CW7A 3KKNA 3GJ5A 3T1TA 1ELOA 4PPNA 3VHLB 4TQUS 4YDHB 5GJBA 2NZ8A 2QSYA 3GJ0A 5UKDA 2J0QA 4XSGA 3LW7A 4PC3A 2D2EA 3SHWA 3B1ZA 1TQ6A 1P75A 4IRUB 4XWOA 4H1UA 5DYGA 2GEVA 4LX0A 4IVQA 4KYUA 1GAJA 3SR0A 3HJNA 1E9FA 3QNUA 1R7RA 2ATXA 3B6EA 4LK2A 1IN7A 4N0DA 1KI6B 4I1SA 2OM2A 1ZM2A 2NOAA 3SC3A 1CR2A 2PL3A 1D2MA 2E9SA 1N5IA 2YWFA 2ZU6A 1XXHB 4HAVA 1CTQA 1E9EA 3ZD6A 2BBOA 3K8YA 2ZJBA 1E1QD 1KOFA 4MRSA 2ZE7A 3ADDA 3I3SR 5EE0A 1UPTA 2ZU0C 2FOLA 5SZHB 1QZXA 3T15A 2B6HA 4A82A 1AS0A 1WE2A 1AKYA 1FOEB 2ZRHA 4UXIA 4YONB 1JEDA 1UBCA 5JWHA 2O8FA 2CE2X 3N70A 1VECA 4AYTA 5DSZA 4JLOA 4MYCA 5JLJA 4AKHA 4MKHA 3RAPR 4YQFA 2W0MA 2NO7A 1TQ2A 3HWSA 3V9PA 4CVNA 2FU5C 4C2TA 1EFCA 3I1FA 1OW3B 3MMPA 1UM8A 2UVQA 3QOFA 4LY6A 4M8NE 4BLRA 3SJBA 5IRCD 3MRSA 3K0EA 3K9NA 3EZ6A 4JJZA 3O47A 2AL7A 4OQXA 4Q7LA 3H1TA 3TSZA 2F55A 1DPFA 4Z8XA 2WM9B 4JSTA 2J41A 2PT7A 3TH5A 3KTAA 1T5IA 1HY3A 4GRAA 5GJVC 3FHTA 3TGPA 3I92A 4JJKA 3SHFA 3ZIAA 3N2EA 3B1VA 3KQNA 2OBMA 1S0UA 1J8YF 2LCFA 3FFAA 2BIFA 4QHSA 4WOPA 3OEHA 2VF7A 3PITA 4XVUA 2QAGA 3CPJB 5FPKA 5CLQA 3U44A 3CRVA 4NU0A 1XP8A 4ZPXA 2NO9A 3AUXA 3P20A 1T3LA 3VX4A 2ZR0A 3QEOA 5FPYA 5CITA 1VMAA 5E3HA 5CM8B 2GK6A 1GL7A 1Z0FA 1G8PA 1KIMA 1ZIOA 4A8JC 1CU1A 3OAAA 4LHXA 3M6AA 4QGFA 1Q44A 1F2TB 2QE7D 2DY1A 1SKQA 1Z28A 3EW9A 4PHFA 2WJIA 1W44A 1ZUNB 2P5SA 1TX4B 1G18A 3EAQA 2FPLA 1VCMA 1AA9A 4NCKA 1OFIA 1KMQA 3GQBA 2NPIA 1E2GA 1JJ7A 3FE2A 4TMKA 2XJ9A 4HZIA 1KO8A 3NC1C 4RD0A 2IYRA 2A5DA 2GTPA 2A5FA 3BFVA 1PJRA 4MKFA 1TAGA 1XXHE 1KAGA 5J4LA 3BBPA 1JR6A 4S35A 1C9KA 1NVVQ 2NO1A 3U7FB 2LWIA 2V7QA 1OHHD 4LBVA 4NYJQ 1NLFA 5IF9A 2V54A 1XEWX 2ORWA 4GFDA 3B5JA 4PC6A 2CBZA 2F1RA 2EW1A 4RZ3A 4QM6A 5BYKA 5KSZA 5JMTA 4TYWA 3AKEA 3NG1A 4TLCA 4U7DA 2GJ8A 1DAKA 1KO4A 3AF0A 4B35A 1XZQA 2HCBA 2HYIC 2P6RA 2EYUA 4KO8A 3K53A 3AF2A 4QBFA 2ZYVX 2X77A 1JEEA 3EIEA 1KO5A 1FP7A 5JRJA 2JEOA 1X6VA 3RRYA 3ZS8A 2ZVPX 3CWZA 4IW3B 4OK5A 4PO9A 2JASA 2ZIAA 3WRXC 3AP3A 2JIZA 1BH2A 1G6OA 1UF9A 4N0EA 3VAAA 4ACAA 1ONBA 3X1XA 4HB3A 4CYMA 5CYOA 2CVHA 4WA7A 3AKCA 3MD0A 4NCHA 5KNBA 3OHMA 4P32A 4HDQB 2DFNA 3U6KA 1HEIA 5FH9A 5E95A 3TVDA 4OI2A 1WP9A 5TARA 3KXIA 2R2AA 2IS1A 4IFBA 3I61A 2JJ8A 2ZXUA 4IFEA 4R9UC 1GRRA 3GLFB 1JXOA 3BJIC 3GEIA 1G41A 4G5GA 2KI5A 1S9DA 4RFSB 5EUQB 2NTYC 1MRSA 3EZ7A 3EC2A 3I73A 5BXQC 2BWJA 1ZAKA 1E79A 4DLUA 3A4MA 1ZMXA 4CEHA 4RCYA 3SQWA 1N6NA 2RGAA 2X1VA 2IL1A 4O25A 4DHEA 2BBWA 1NJFA 1W2HA 4RFSA 5HE9A 3SS8A 3Q85A 1LV7A 2NIPA 2WWGA 4XWAA 1G7RA 1ZUHA 3WMGA 4I1UA 4Q1EA 3UXMA 4LYFA 5KDLA 1NN5A 5HKKA 3BD9A 2JJ1A 2RHDA 4KSCA 2B92A 2FF7A 2J0UB 3ZQJA 5M04A 1VHTA 3THWB 3SU8A 2VBCA 4A2WA 2AX4A 1RE0A 4NDZA 4JL5A 4PAMA 2JLUA 3NVAA 4HAYA 1FP6A 3IO3A 4ILEA 2WWWA 4JLPA 4OK6A 1ZM4A 4P4TA 3SOPA 4DEYA 2OUKA 1G5PA 2GXQA 1VTKA 1NMXA 4LZZA 3KKQA 4JT2A 3TLXA 5B57C 3TAHA 4IOLA 4K81B 2RGEA 3ICQB 3BERA 3Q8XB 1ZM9A 4TWZA 3A1SA 1T9HA 3NHAA 2IHBA 2HCJB 4M9SA 5SZJA 3FGNA 3T1OA 4DSTA 2CVFA 3ZIAD 2Q3MA 1C4OA 4O2RA 1YKSA 1FX0B 1H65A 4PC7A 5JWRA 2H5EA 4WVFA 3GLGA 1II8B 1IY1A 1ZNXA 4TL6A 4AKEA 3CH4B 1IHUA 3P32A 3MUFA 3PUYA 3UWKA 5HZKA 2WSMA 4KFRA 4V0MA 4LYJA 3RWMB 5CIWA 1WMSA 3K0CC 5E7JA 2WJHA 3CF0A 1M74A 2DHRA 4Q4HA 5EXPA 1S96A 2EQBA 5CDFA 4AI6A 1II8A 4PPFA 1KI3A 1S8FA 5KTYA 1RZ3A 1D9XA 3AVPA 1AZSC 1JR3E 3U4QA 1FTNA 2YV5A 121PA 1N0UA 1XMJA 3V00A 1OLOA 4DDWA 4LJ9A 1F5NA 1WA5A 4Z8YA 2JCSA 2W2VA 4P33A 4P4SB 4TT3A 1B23P 3AEZA 1GNQA 3NBZC 4AK9A 1NBMA 3KUDA 3K09A 3B85A 1TPZA 2FFAA 4M22A 2Y8EA 1RKBA 1F6BA 4EJSC 1XCGB 1KDPA 2QTVB 2Q0HA 2ZI7A 4NP6A 4LSGA 4ON9A 1S3SA 4CZ2A 2QMOA 4URWR 2XEXA 4TMTA 4ZKEA 4DUGD 2DFTA 1DAFA 2GWHA 3AB3A 2F6RA 3CLVA 5EP1A 4AG6A 4ARZB 4YMVA 1MABB 4GMDA 1MT0A 3K9LA 4MITA 4QOSA 4C0BA 2IK8A 2BJVA 1DS6A 2AXPA 3KXLA 3W3ZB 4AC9A 2OCBA 4Q4AB 4K46A 4QKQA 4WZ6A 2OLKA 2ERXA 4D4JA 1L7VC 5JJKA 4XTCS 2QG6A 1YRBA 2WZQA 1XTKA 4IXNA 1Z22A 2AHOA 2P67A 2FX3A 2W83A 5FOSA 4AG5A 1XB2A 1QHXA 3ICEA 4MH0R 4DDVA 4PO1A 3CPHA 1M7GA 4B33A 1U8YA 2V6IA 3D7MA 2W58A 4C0JA 3MWYW 1D5CA 4NPHA 4QXAA 1DADA 2HLDA 1RJ9B 1J2JA 5L8VA 4TSFA 4NMMA 5H8WA 4PHTA 2JATA 2GK7A 4QHTA 3RHFA 3PJRA 4ZO4A 1J70A 1H8EA 2VHTA 4FMDB 5FOXA 3QVUA 2RH5A 1UEJA 1N2CE 2CL6X 1F2UB 2ZR7A 2NPFA 1E9RA 1MR3F 4RKEA 1SVOA 4BFSA 4AKGA 1US8A 4GP7A 1T6NA 5E4FA 1U98A 1NVWQ 1XTRA 2I1VB 2XOKD 2ODEA 2C03A 3CR8A 3A4NA 3SQXA 2NO6A 1F2UA 1Z6XA 4A2QA 3TUIC 1N6LA 3GJ6A 1IXZA 2HF8A 3W8NA 4LJAA 2H57A 4F38A 3MWJA 4MUBA 1W49A 2QN6A 2IF2A 1YJ5A 3T61A 1XBTA 2OV2A 2EYQA 1XEXA 5DH9A 1QHYA 2CL0X 4V03A 4FIDA 1S2MA 4ESVA 3E70C 3I8SA 1TU3A 2JLYA 2LKDA 1NKTA 2O0KA 3QG5A 4M1KA 1GL9B 1KK1A 2VRWA 2YC4C 4WZBE 4TZ6A 1Z0JA 1JNYA 4B3BA 2XXAA 3HP1A 2ZJOA 2PBRA 5DI9A 4ASUD 2OBLA 2ZS7A 4MDFA 1TQ4A 2YWHA 2FE4A 2IXGA 2R6CA 3VFDA 5H1YA 2P5TB 1ZNWA 3GJ4A 1N6OA 4KFUA 3T1QA 3NDBB 2R6DA 4IOJA 3BRWD 4IKEA 3U6BA 1VCNA 4IOMA 5DN6D 1SVSA 3IDQA 4XOIA 2KWIA 1UDXA 4R7ZA 3DMDA 2BMEA 1KI4A 3WXMA 5LD2B 5KUTA 2OAQ1 3AH8A 1OXUA 2XZOA 2ZROA 3PXGA 4DLRA 5J4KA 4DB2A 5K8LA 3N5CA 4DLYA 2V9PA 3QF4A 2AD1A 3OIUA 4HAWA 1U8ZA 3ND8A 3TQFA 1EFTA 3JVVA 4Y0VA 2C78A 1IJFA 1YZTA 1HV8A 2ECKA 4UNRA 3KQLA 4PXAA 4DT1B 2ZE8A 5C1BA 4IEEA 3EG5A 3TE6A 4OYHA 4A9AA 2GBLC 1G21E 2AN9A 5FUYA 1OXXK 3TBKA 4MRNA 3BS4A 2RCNA 3SFVA 3FPAA 3CRMA 2ODWA 2ZRGA 4IDQA 3AUYA 4AD8A 1R10A 2WIAA 1Z0DA 1OJLA 3B78A 2ZAOA 2EFEB 5K8UA 4JL8A 3OIWA 1E4VA 2RGGA 3D31A 3X1DA 2ZRIA 3PG5A 2IA5A 4BWYA 1G3QA 4P0TA 1L4YA 3TSOA 3W6NA 5ANRB 4QL3A 3KL4A 3LO5A 4IDPA 4CT4B 4LHWA 1Q20A 3MCAA 2XITA 2PLFA 4M9XA 5JEEA 2XX3A 2A9KA 2IF0A 5KPDA 1COWA 1YR6A 2QP9X 1KO7A 1ZINA 4QGAA 3ZZTA 2OG2A 1XD2A 2GNOA 4Q4JA 1FTSA 5BN5A 1P72A 1W0JA 4Q00A 3LXRA 3THXB 1R0WA 4URXR 3W8RA 1O87A 3ETLA 1FL9A 2PMKA 2XTZA 3NHBA 2RGDA 3F8TA 3PQCA 2QRNA 4TLDA 2G0TA 2XJ4A 4IXMA 3L2OB 4BECA 5CB6A 3U7GA 1SXJC 3NH6A 4ZCMA 4LBYA 3BH0A 3SEAA 1ODFA 1E9SA 1EESA 1KNXA 3AQ4A 4A8JB 2FEMA 1XPUA 5AJVB 5HPYB 2GCOA 4YXWD 1A7JA 3WBKA 5FBRB 1JPNA 3EARA 2ODBA 1J99A 2QTFA 4I99A 5EE1A 1KSFX 3QPVA 5FOVA 5KPJA 3KQHA 4D26A 4B43A 4BLTA 4RD3A 5H68A 3TVTA 4A6PA 1NMZA 3U3JA 5JHGB 5HTKA 3PUXA 3W5JA 3PENA 4B32A 2YWEA 5JRZA 4DJTA 3AGQA 4LBZA 4C0SA 3RRZA 2J87A 2W00A 2D7CA 2XOKA 4KFSA 2P2LA 4V0LA 1IOZA 3W9YA 1UKZA 5AUPB 4PFSA 2XSZD 3CF6R 4RKFA 2ZJZA 2BEKA 1W0KD 1P7CA 1E4YA 1N6KA 3GFPA 2VIIA 3P1JA 4CEIA 2ZQ5A 2ZRAA 3QXCA 2HF9A 3W5IA 1T0HB 4ESHA 1TEXA 1MRNA 4M4SA 3WYGA 2EFCB 4M1WA 4MGKR 1GP2A 4LJ4A 1IN8A 2VSFA 3W34A 4LPSA 2QRZA 5J47A 5D3MA 2CK3A 2PCLA 3R20A 5JECA 2RGNC 1E79D 1G7CA 1W4CA 2WMNB 1BMFD 2BBSA 3I72A 4C3ZA 4MKGA 2BEJA 2D62A 4M9QA 3DM5A 4M1SA 3ZD7A 3AM1A 3E1SA 3A1TA 2F9LA 5GJWC 4O2LA 1FMJA 2WJGA 2CLCX 3FFBA 2WVJA 2F7SA 4PSKA 1RYHA 3GCGA 4M0LA 5BQ5A 1GNPA 3U5ZB 5DN6A 1A2BA 4HUQA 1NN0A 2F3RA 2QMHA 4LDJA 4OJKA 2GETA 2CCJA 1XX6A 2VP5A 4KYIB 1E94E 1Z6AA 2CNWA 3GEHA 4LHVA 4TYYA 1CJKC 1KI8A 1S1MA 1W0JD 2WPDD 5C4GB 1KJWA 4RY2A 1N5JA 3P27A 1N0WA 4US0R 3PEYA 5HZHA 1HH4A 4XVQA 2N46A 2F1IA 4MYHA 4C0AC 3SE0A 1ZW6A 3T5DA 1E2IA 3R8CA 4LC0A 1P2VA 2WJYA 4U5XA 2BMFA 3KQKA 4UNPA 2R8RA 3UG7A 2F9MA 1G19A 4D6PA 2VHJA 3OFND 2ODNA 5FBQB 4B3GA 4HEJA 1SGWA 3NDPA 4QM7A 1QF9A 3QPWA 4NYJR 4GPTA 5L3RA 1Z6TA 1TU4A 2IYSA 1W4RA 3FMPB 5KNCA 4PHHA 3IILA 1VIYA 4FMBB 5TY0A 3WYAA 4ERNA 2C8VA 1W1WA 1TNDA 5AJXA 2DBYA 2KBEA 2OCYC 4QBIA 4TT3D 1N5LA 2A2ZA 3C41J 3MAAC 1T3SA 3RRMA 1YZLA 2EU8A 4G5SA 1K5GA 4DXAA 2RGXA 1L8QA 4Q7JB 4NE2A 3VTKA 4A92A 2WWHA 4QJ3A 4DDUA 1OF1A 2H8KA 2KE5A 1M1YE 4URYR 4KAXA 1IN6A 5CK4A 2DB3A 3O8DA 2BKUA 1SXJB 3Q5DA 3U2QA 1Y63A 4BLOA 4C4PA 3QE0A 4NCJA 2O8FB 4IDHA 4TMZA 2GRJA 2CK3D 1KI6A 2OXRA 2ZSBA 4FI3C 4DLXA 1F60A 1NMYA 2G9NA 3UMFA 3EA0A 4EPVA 1T91A 5JCZA 2RGNA 1CR1A 1SXJA 3S1AA 4MQBA 5GVRA 4EPRA 3LQQA 1YZQA 1KJYA 1FQKA 5J5CA 4ZIRB 3ZDQA 4JYCA 1Q22A 1U0HC 3I5YA 4LV5B 4LPKA 5HR5A 3TK1A 2F43A 4B71A 2GAAA 1SKYE 3K0SA 1XTIA 2YNMA 4Y0AA 4EIWA 4A8JA 2WJJA 2KB0A 3U60B 3QSYA 4RD1A 4UQOA 4FWIB 4GI7A 4DCVA 2X2EA 4PO8A 3UMSA 4A0HA 3B9QA 2ZRFA 1UDWA 2ZJYA 2Q3HA 3T12A 5JS7A 2DWOA 5FFMA 1LTQA 2FNAA 3ZQ6A 4JVMA 1RVDA 2GXSA 5B30A 1MO5A 4TL7A 1I4TD 2R6AA 3EX7C 4KXFB 4B3DA 3QXJA 3QXXA 3QQ5A 2Z4SA 2ZI5A 5AK0A 4CT5A 2XSZA 3FHOA 1YR8A 1G6HA 2R6GA 1G9XA 5DGXA 3ZVLA 2ZS9A 1HTWA 1I2DA 1KSHA 3OIYA 1CJVC 4QBGB 3EPLA 1X1RA 2G1KA 5B64A 1NN3A 3T1VA 2I3BA 3RWOA 1JECA 1A1VA 4CF7A 1OIVA 2FFHA 2QAJA 2R6FA 1UBGA 3TSWA 5DLQC 2J0SA 4EPXA 3U7EB 2NQ2C 3B9PA 5D3QA 3L8YA 4KI0A 4BZXA 4AY2A 1XCPA 1E0KA 2REBA 4TLAA 2BV3A 2OFOA 3ADCA 1DAIA 2JDID 4L9SA 2GDJA 3GJXC 1ZJ6A 1N5KA 1KHTA 1AKEA 5JZVA 1RRPA 2QROA 3C4JA 1E32A 3H86A 3C16C 1HE8B 3PUZA 4NL4H 1W36C 1L4UA 1DBSA 4KBGA 5GADl 1OE0A 1M6NA 1SVLA 3F5FA 1Q0UA 4O3MA 2VHUA 5HCNA 4JLMA 1CBUA 3KZ1E 4GOKA 4NH0A 2J46A 1J8MF 3TKLA 1GUAA 2IXEA 2QPOA 3EZ2A 1GKUB 3GLFE 2VP6A 4GT1A 1XMIA 4HZUA 3C8UA 3Q7QA 4KU4A 2O8CA 2OAP1 3IHLA 4DCTA 4CRWB 2CCGA 2ZE6A 5EP4A 3NTUA 1TTTA 1L2TA 4MUAA 4ZDJA 2O8BA 3UG6A 2JLQA 1GRNA 2QM7A 1CLUA 4DIEA 2WSSD 3SI7A 4C7OB 4JKYA 2CHVA 1P9RA 3AF3A 1E2FA 1X8LA 4J0QA 5E7MA 4B73A 3SN6A 4D4KA 4POAA 1XJCA 2GVDC 3K0AB 4G01B 4GSYA 2GXAA 2ZYTX 3ZGXA 1FFHA 3IQWA 2ORVA 1T3HA 4Q1FA 2VL7A 4FMCB 4PZLA 3OEED 4M21A 2QTHA 4LJ6A 3U3OA 1Z0KA 1LY1A 2ATVA 1JJVA 3KKMA 5KSOA 2VO1A 1UFQA 2ZRCA 1WBDA 2X2FA 3BOSA 4QRHA 1IONA 4BQSA 2RAPA 3THYB 4IHQA 4OHZA 1JAHA 4NYIQ 1OV4A 4AURA 1NP6A 3IBYA 2O8EB 4CEJB 1G20E 4DZZA 2FFQA 1CRQA 5IHPA 3TIFA 2VP0A 1RC8A 3HDTA 4F4CA 2QMEA 2OLJA 2H92A 3QG1A 3W6PA 1N0VC 4BEJA 4BUJA 4DCSA 1WQ1R 4BZQA 2QENA 1P9WA 1LF5A 3TMKA 4BLSA 1NVVR 4DRZA 4GL2A 4UNSA 2XGJA 1ZD8A 4LHZA 2B7BA 3QIAA 1RRCA 2QL6A 4Z1MD 2FSFA 4PPQA 2CL7X 1SHZA 2RGBA 1DELA 1EFRA 1EFUA 3ZLJA 3LA6A 2IW3A 3VNVA 1ZNYA 1XU4A 2IUSA 4C9BA 2DFLA 1EGAA 2DWPA 1MKYA 5FTKA 2IYXA 2ZYWX 3RANA 3QKSB 4BFZA 4X8OA 2OSBA 2ZI3A 5FPTA 4BFTA 4D81A 3CZQA 3O8RA 4W9MC 3R9WA 1YQTA 3HYRA 4L4UA 3SDZA 3AVUA 2J59A 1V43A 2ZM5A 1W4BA 4TYPA 2H1LA 3TNFA 1CS4C 1KSJA 2HV8A 4LYAA 1IM2A 2I4IA 4EJSB 3D6TB 4C0LA 2WV9A 2PX3A 2PT5A 2GBLA 3DEFA 1LVGA 3DVLA 3KDSE 1Z6GA 4MKIA 4EPWA 4OQFA 3X1YA 3C5CA 4KVGA 4IEIA 1ETUA 1ZP6A 3EWAA 4FN5A 4DUGA 5FTNA 4PANA 1E2EA 2AD5A 2FSGA 4M9ZA 1G17A 2BVNA 2G83A 1ANKA 2WSSA 1W46A 2V1XA 1EX6A 3EC1A 3PFIA 4K8OA 2XZLA 2YHSA 2WKPA 1D2EA 3WHKA 3KKOA 2GXUA 1U99A 1R0XA 3W6OA 4B44A 5JBQA 521PA 4YMSA 1N25A 1SULA 3AVWA 1M7BA 2UKDA 1U8AA 4Q01A 4C2UA 2CHGA 4JL6A 3OEEA 4OQMA 3EPKA 2OE2A 2F1HA 2Z5FA 1NLYA 1GWNA 1TL7C 2OBNA 2OFXA 1Z06A 2PX0A 3B1YA 4LI0A 4BPBA 2HXYA 3HPQA 4E09A 3FHCB 1AZTA 1M8PA 1JPJA 4Q19A 4ZI2A 4JLBA 2QT0A 4I81A 5TDHA 4A4DA 3CRRA 3LNCA 1AQYA 5C2JB 5IK2D 2GILA 5BW8A 4FD2A 1FZQA 3GFOA 3UATA 3Q7PA 2FFBA 4AYXA 1H8ED 2J5XA 3NEYA 2VP4A 2XNDD 5AUQA 1QBKC 3TW4A 5KDDA 3JZAA 4P4SA 3IKJA 1S1CA 2W6JD 3LBHA 3TR5A 1EG7A 3ASZA 721PA 1MV5A 1A82A 4V0KA 2VHCA 2GEUA 2YVUA 2SHKA 2K5UA 3H84A 2VYFA 4I1VA 4A0FA 2AR7A 1NVUQ 1KDTA 3ZVNA 4NBSA 5FL7D 1KDRA 1KI2A 4GMXA 2BCJQ 2C9OA 1OB2A 3K0FA 1Q57A 3VR1A 2JLVA 2O52A 3M0EA 3MLEA 3UKDA 4OHWA 4GBMA 1CJTC 1JALA 1AJEA 3KB2A 4JLAA 2V7QD 4DB4A 1TF2A 5F98A 1UKYA 2W6IA 5GVSA 4C7OA 2G77B 4ZI3A 2X8AA 3LBIA 2V6JA 2GCOB 1ESNA 1CJMA 2REOA 1NKSA 1YZUA 2YZ2A 3K0FB 3W3AA 1W36D 4Q9LA 2HEIA 4D2IA 4EKDA 3FKSA 3RYTC 3H4MA 2RB4A 1QVAA 3E5HA 5EE5B 4YMTA 1WDTA 2BMDA 4M1MA 1NSTA 2IHYA 2ZETA 2B8TA 1DE0A 3GMTA 3LAWA 4OI0A 1CR0A 3AP2A 4L8GA 5BWMA 5TB5A 4B76A 2GZDA 1V5WA 2C95A 5KU1A 1G5TA 1HQCA 1R2QA 4DLZA 4PHGA 4ZDIA 2PLRA 3GLIE 2BM1A 1XXHA 2FMXA 5GJCA 4Q66C 1Z2AA 2IC5A 2W2TA 3QJYA 1CEEA 1OFUX 1XDBA 2XTMA 4QHYA 1E2JA 1XEFA 3EWSA 4KBFA 1K6MA 2YJTD 1G8HA 3BFKA 3DL0A 3QUSA 1EXMA 1YR7A 4B48A 2IYYA 3A1UA 5KDOA 1AN0A 3WNBA 1VPLA 2C9YA 4MYTA 3VQTA 3U3RA 1KI1A 2JJ2D 5FR2A 2ZRPA 4D0GA 2ZI9A 4R71A 2YOFA 4UJ5A 3A1WA 1WB9A 3RC3A 4MA4A 4OL0A 1XEWY 1E3MA 1G3MA 4JVLA 4B74A 1ZVQA 1G7TA 2JDIA 3Q72A 3ZZUA 3GLIA 1JQLB 2WJVA 1Z3IX 1OKKD 4XJXA 4F93B 1NY5A 4Q1AA 1VCOA 4UKDA 2B8WA 3NBYC 1XJ0A 5FOTA 4B75A 4TMWA 5KHOC 2RHMA 4US1R 3AVYA 1VYUA 3Q5EA 1COWD 5B58C 3ZS9A 4IVPA 1UBEA 5A5GA 2ZE5A 2ZJAA 1OH5A 1TEVA 4R2IA 2F1JA 4G5OA 3GLGB 6Q21A 3I4LA 1GRQA 2CJWB 4D4MA 2NO0A 3VU9B 3DMNA 4G0NA 4YMWA 1E6CA 4JBWA 3QF4B 1YZKA 3A37A 3REGA 1ZUIA 5KYKA 5TVKA 1U90A 2QA5A 1E0SA 3VR5A 2VQSA 3AVQA 1R8QA 2CJWA 2JGNA 3HU3A 4B3XA 2IBMA 1XZPA 1FNMA 4DWJA 1FPMA 3KKPA 5KOYA 2YKGA 5L3VA 821PA 5JWOA 4EAQA 4ARZA 4JT4A 1J90A 4JYBA 4TTRA 1KSGA 2YC2C 4ZDKA 2F3TA 1KKLA 3BWDD 2W6JA 2ZR9A 4BFUA 1Z8FA 4HAZA 2ERYA 3PEWA 1E1RA 1PV4A 1QHHA 4FMDF 1T8UA 3LQRA 4BFVA 1G4UR 1XD9A 1G3RA 1RRFA 4IDOA 4D25A 421PA 4LC1A 4Q9IA 2VHQA 2BBTA 1OSNA 1QHHB 3WMFA 1E2MA 1MABA 1TQDA 2GZHA 2MSEB 3CO5A 5EXSA 1YZNA 5LD2C 4JZKA 5FPSA 3JVUA 1KK0A 2PZEA 2FEOA 1E9CA 4JS0A 1VYTA 1HQYE 2RMKA 2DR3A 3RS3A 2WOJA 4W5WA 4GOJA 1X3SA 4V0ME 3UIEA 1LFDB 4W5JA 4PAQA 1F48A 1SVMA 2QP4A 1N3BA 3B2EA 3BGWA 4MDEA 1ZC3A 2OHFA 3GLGE 1Z5ZA 1NN1A 1KY2A 1X8JA 2IYWA 5EXXA 5BN4A 2IYQA 3L43A 2GCNA 1TUEA 3HR7A 4TLBA 4XH9B 2O0JA 4H9GA 1BOFA 3L82B 1H8HA 2EFHB 4EPTA 3A4LA 4DBLC 5AR1A 2QY9A 1A5TA 3VR6A 2QP3A 4DSUA 3EA5A 1XEXB 3CRW1 5BN3A 3QF7A 4DIDA 1AM4D 3B7GA 4OHXA 1BYIA 3CBQA 3U3MA 2A5JA 4W5HA 4Q9HA 3U44B 2J7PD 4JLDA 4G5QA 4JBXA 1G1MA 3NEJA 1U9IC 3QI2A 5DHAA 4A1FA 2WHXA 3J81k 1GZSA 2R44A 3BH6A 4I4LA 3SBDA 4CEIB 1QHSA 3X1ZA 1N6IA 1U9IA 2Q21A 1E96A 4GP6A 1VG8A 4OI1A 1SVIA 3LV8A 2RGCA 4HUQB 1XJQA 3A36A 621PA 4DLVA 4QC2A 2JIZD 1KNQA 3O8CA 2QM8A 1LS6A 3CX7A 5CIQA 3CX8A 4Q7KA 4KCGA 1PLLA 2PZGA 5P21A 3PUVA 5F9HA 3ZH9B 2ZSAA 3EZFA 5G3ZA 1ZU5A 5E7IA 3PUWA 5CYPA 4D0NA 3L0OA 5CJPA 1X8KA 3UK6A 1P6XA 1W47A 3L0SA 4X8HA 3LY5A 4DSOA 1E0AA 3QKTA 4WXPA 3LRPA 1W5TA 5AJYA 1G8YA 2D06A 4B6EA 3DKPA 4NTZA 2NG1A 4KITB 4UJ3A 2J45A 5L3QB 1S9HA 1LW7A 1NSFA 1BYUA 5FUXA 2HXSA 4MRRA 1KJZA 1E9AA 1G3UA 1OYYA 2FZ4A 4KHZA 3W90A 2ZRJA 5EE3A 1CXZA 2GF0A 2OCAA 1T8TA 2QGNA 3SNHA 1KZGB 4Q47A 1E2LA 4GZLA 1WCV1 3G0HA 1PLJA 2ZSEA 3U4QB 2CMKA 2VH5R 3WNDA 2NMVA 2P65A 3CX6A 4OQLA 1MH1A 5C46F 1DOAA 1N6HA 1Z29A 3FWYA 4HAUA 4WBSA 3ASYA 3MJHA 5EJEA 2ZJ5A 4HDOB 2O8EA 1H8HD 2EWWA 2QAGC 3C14C 4D4LA 3GLFA 3GLHA 1P2SA 3QXSA 1M7HA 1R6BX 1CULC 4L9WA 2V1UA 2Z0MA 1JXMA 1K5DA 4MRVA 2GJSA 3U7HB 4LYHA 4QBHA 5EZ6B 4MGZR 3CR7A 4YXWA 3CNOA 3PV0A 1KMHA 1VG9B 1WXQA 2A5GA 3B13B 1N6RA 4MRPA 1AK2A 5C18A 1DTSA 2BCGY 2CHQA 2Z6VA 4XSHA 3KX2A 5HE8A 4E22A 3C7KA 4V02A 3QBTA 1KZ7B 2XNDA 3ZVMA 3S1AB 4NYMQ 2JAQA 2RKOA 5AUOB 4NONA 2R62A 3G82C 2C9CA 3BXZA 4PC1A 1NIJA 1AS3A 4D82A 3DHWC 4ZIRA 3VKGA 3LLMA 3QKSA 5CK5A 2JA1A 3OZXA 1X86B 4Q18A 3THWA 3RC8A 3FMFA 1O3YA 4V0NA 1OPXA 5A4JA 1XTSA 2NGRA 1DO2A 2OFWA 1HE1C 4LHYA 1UEIA 4RFVA 4TLEA 1JB1A 1NBMD 1VIAA 3VR3A 4OI4A 3P4XA 2FSIA 1W36B 4X8LA 4EJSA 4RCZA 3WRYC 3LXXA 4LV8B 4TZ0A 4L15A 1FNNA 1E1QA 2Q6TA 4D0LB 2JLSA 2ZSFA 3CONA 1I4LD 3I32A 1ZIPA 4UNQA 3VX3A 3WP1B 1GKIA 3VHXA 2L0XA 1ESMA 1S3GA 1OIWA 1FUKA 2UZ3A 2REXB 2JLRA 3CB4A 5DI3A 3WP0A 1Z83A 2FN4A 2PMDA 4OJQA 2IEZA 3LVRE 4LV6A 1Q1ZA 3IGFA 3CZPA 1OKKA 1R4AA 3BAFA 3Q9LA 4PTLA 1DG1G 1P61B 2ZVQX 4QGGA 1GVNB 4G1UC 4JSYA 3VNUA 1DARA 3NBXX 1SHKA 5DO9A 4AWXA 2JLZA 2HT1A 4PQRA 2CE7A 2FPMA 2ONJA 4GNKA 1UKVY 1DVRA 1OH7A 1GDDA 1AGPA 3R9IA 4A36A 1IJEA 5BYJA 2ZRNA 3V4RA 4BFYA 2G88A 5FTJA 3O8BA 1IY2A 3NKVA 2AFIE 4HDCA 1OHHA 2WMOB 3X1WA 4L5BA 2DCUA 4M2LA 5CB8A 3R9XA 4TTPA 3V4FA 2VP9A 3T06B 1R0ZA 3M1IA 2GJKA 3TUZC 4XD7D 4R2HA 2G3YA 3A6PC 4R98A 4TL9A 2QNRA 1N6PA 1E9BA 4E5UA 3OIVA 4TSFD 1GL6A 4BZPA 4DCNA 2WICA 2DFKB 3QBVA 4EFMA 2O8BB 1OFHA 2H18A 2MMCA 3VMFA 5FPHA 4QG7A 2IYTA 3KFVA 4LJ8A 1BS1A 2Q9BA 1IAQA 1DO0A 2PEZA 1DG3A 5FOWA 5DE3A 2QE7A 1E1RD 3VR2A 2J3EA 2IS6A 3BC1A 3IO5A 3RRNA 2HUPA 3B1XA 3K0AA 4HLUA 4NHOA 4EFLA 1BKDR 2ANBA 3OE7A 1EFRD 1VG1A 3GFTA 5ELXA 1E2KA 3T5GA 4KFTA 4D80A 1G7SA 1FMLA 3NWJA 2ZUCA 5TXGA 1I2MA 4TMXA 4JBYA 1P4SA 4HLDA 3BK7A 3DKVA 1GTVA 1IY0A 1G8GA 2XZPA 3MSXA 1RPZA 2ASEA 2VPPA 4ASUA 4LCBA 4HB0A 4WXRA 2KJQA 1D8TA 3A1VA 2G0NA 3EIQA 4JVNA 3GJ3A 2ZUBA 4Q9JA 5G41A 3IPXA 3RDPA 4X8MA 2QORA 3UPUA 5JJLA 3F0TA 4BFWA 3R8FA 1VCIA 3MGCA 1ZBDA 5SZKB 2VLIA 3BB3A 1UBFA 4FCWA 2E87A 1X1SA 2WWIA 1YR9A 2V8OA 2EFGA 4PC2A 4ZKDA 3THOA 1PUJA 2IT1A 1US8B 4C0HA 5DYIA 2B7CA 3AVOA 4ACBA 1QDEA 3BH7A 2HJGA 1SKYB 1W5SA 4DLSA 1KAOA 1Q1BA 1KI9A 3KJGA 5EXTA 3RS7A 3SYLA 1XF9A 1YZGA 3LDAA 3NXSA 2CLSA 3PCRB 1Q1QA 2CLDX 1R5BA 3VKWA 3SYKA 4DLTA 4RZXA 2J0UA 4PZZA 4XVRA 3C5HA 1VYVA 4YDSA 3WY9A 2HDNB 2XNSA 3RLFA 2TMKA 2CXXA 2ZEJA 2WKQA 4XWKA 3TRFA 3L0IB 5AUNB 4U02A 2FGJA 3DO6A 3P4YA 4ZCIA 4Q48A 4XD7A 1NG9A 1D9ZA 4FINA 2FPKA 2ZANA 4F4JA 1G3IA 1AGRA 1K8RA 1PUIA 4HYYA 5SZIA 2OXCA 3QPUA 4PX9A 5L3SA 1W7AA 2F43B 5IK2A 2O5VA 4JMPA 4B2IA 4ZV4A 5J40A 4MYUA 1SXJD 2PZFA 2V4ZA 1VHLA 4PR0A 2R65A 1HUQA 3VKHA 3QEJA 1CIPA 5EUMA 4F91B 1GNRA 4BE7B 1U0JA 3GPLA 3E2IA 4WZAE 2QMUA 4QFMA 1G16A 3HU2A 2BOVA 4PZYA 3KJEA 4OHYA 5HKKD 3LX5A 3GLHE 2VF8A 3IUYA 3UWOA 1XCMA 2PJRA 4JVSB 4ZDWA 2GESA 2QI9C 4U00A 1XD8A 4PAOA 3A8TA 3FDIA 2AK2A 4FCVA 3REFA 1KYIA 1F2TA 4H1VA 3RS5A 3PEVA 4RZ2A 4OHVA 5LBIA 2D4HA 1FX0A 4XTRA 1Y3AA 2O0HA 2IWRA 4JLKA 1II9A 1MO6A 2QAGB 3IIMA 1EWRA 3BORA 4OQNA 4LRWA 5JI3E 1IBRA 4Q1DA 3AVXA 4EUNA 1DAMA 1M2OB 3PEUA 4ABYA 1QHIA 1SVWA 1UJ2A 4A0RA 2PJZA 3FKSD 1OFTA 4QGHA 2R9VA 1E2DA 3IPYA 2MSDB 1IQPA 4FMCF 5HCIA 2DPXA 2WKRA 3ADKA 1SXJE 2ZS8A 5AWFC 2IYVA 4TQAA 4FCTA 3RVBA 2OILA 1E0JA 5LB4A 3B1WA 3G5UA 4KLNA 2MMGA 4KJZA 1XD2B 2AXNA 2IYLD 2NZJA 3L0PA 1TUIA 3TQCA 5J4YA 4F92B 2HYDA 3OESA 2QPAA 4NZYA 2WWFA 1QHNA 1GKYA 1GITA 3OE7D 4HZUB 3MG9A 2FV8A 1E2QA 1R0YA 2ZRKA 1BMFA 4E07A 1P5ZB 1RIFA 1MOZA 4UNNA 4BASA 3MWKA 1MO4A 1T5LA 4NCIA 4BGDA 1PVOA 2AK3A 2ZRDA 3WNCA 2CDNA 1RJ9A 2I1QA 1YHNA 4QJ5A 3BE4A 2ZRLA 4Q4AA 3LLUA 1W48A 1MO3A 1D2NA 5K8TA 2ZRBA 4YLGA 2Z4RA 1C1YA 1I4DD 3QXHA 5F2EA 1WBBA 4Z54A 2GAOA 2YOGA 3PIRA 1TADA 2E1RA 3K9GA 4US2R 1AS2A 3P26A 1GFIA 1G64A 1VKJA 2KBFA 1XMSA 4HLCA 5KSPA 1ZCBA 1TF7A 2C96A 2ZI4A 3GEEA 4NKRA 3ZZ0A 1VDZA 2B21A 5FR1A 3IQXA 4TMVA 4BLQA 1NIPA 2BC9A 1NRJB 3EPJA 3THYA 2QQEA 1M34E 1D6JA 1HT2E 1LNZA 2J9RA 5EP2A 5C4MA 1A2KC 5KO2A 2IX3A 1KO1A 2GVZC 2LKCA 4JKIA 4LJ5A 4LWZA 1JI0A 2FSHA 1RW4A 3OFNA 2GEDA 1QG4A 2D3WA 4EPYA 2GA8A 2O8DB 3DPUA 1KI7A 2BJWA 4DEXA 2QZ4A 5AJZA 3L8ZA 4RD2A 3NC0C 1ZD9A 2OZEA 2VSXA 1JR3D 3I62A 4DVGA 2Q9CA 2IWHA 2FDCA 1Z08A 4G3XA 4EFNA 2FJUA 5J4VA 1XNJA 3R7WB 4QNRA 5EQTA 1XMVA 4WIAA 1BO6A 2ZRMA 4Z1MA 3SJAA 1FUUA 1Q21A 4MGYR 4JLJA 3K70D 2PH1A 3TJZA 2BHRA 4JLNA 4G5RA 3OF5A 4IOKA 1OXVA 2A30A 3DZ8A 3R7WA 3TAUA 2GKSA 4F7WA 4KVAA 5J4HA 3CW2A 4TQ9A 4EDHA 1HT1E 4P4UA 4Q7MB 1EFHA 3WBJA 1II0A 1HYQA 1AQUA 3KTAB 2ZPTX 4M1OA 5L3QA 1E99A 2ZREA 3GJ7A 5JJIA 1XRJA 1Z2CA 3DDCA 1OYWA 1HA3A 3EPHA 3PVSA 2C77A 1E98A 1GIAA 3QKRB 1PLKA 1R5OA 8OHMA 4UXJA 1G5RA 2P6NA 3SYNA 3VR4A 4GDFA 1ZNZA 2VSOA 4Q4HB 4B3FX 3A58B 1S4QA 2C99A 3IEVA 1G8FA 3QKRA 3WYFA 3MWLA 4RZUA 4DT1A 5FL7A 3LBNA 1TF5A 4N3NA 5G53C 2IUUA 4A15A 1KK2A 2XB4A 3HYTA 3U3KA 4DKXA 1ZC4A 1KY3A 4AYWA 1DAEA 2OEPA 5KNDA 4II7A 2P0EA 3K70C 3UMRA 4TN1A 5EP3A 1ZM7A 1Z0IA 1KTVA 2QGZA 5B2ZA 3EASA 3I5XA 5DIFA 1P2TA 2V3CC 3Q3JB 1UAAA 3EZ9A 4IDNA 4LJ7A 1CF4A 2BM0A 3K0CA 4Q4LA 1BIFA 3THXA 1WF3A 3RSLA 4BRWA 1GOTA 1NBME 3U61B 2C98A 2H17A 1RYFA 4ZCLA 3GD7A 1KK3A 2WWXA 3B8HA 1OXSC 1ZCAA 1EX7A 1PZNA 4LBWA 5G3YA 2AWNA 3BFXA 3CIOA 2J7PA 1SVKA 2FGKA 1XWIA 4MGIR 3K1JA 2G6BA 3RS0A 1T4GA 5FTMA 3I8XA 1JR3A 1OH8A 2Q9AA 1P62B 1P2UA 2FH5B 1Z0AA 4LOAA 1UKEA 1NL3A 2OO7A 4KV9A 2IEYA 3FMIA 4Q4JB 1R8SA 3UANA 3NH9A 1UADA 2XAUA 4EQ6B 4URUR 4M53A 5KSYA 3CNNA 4BFXA 1NG1A 2VTKA 5TV2A 4YMUA 4Q5IA 3FB4A 4HB2A 1JBKA 2QEQA 3RS2A 2A78A 2ZYUX 1F3OA 1TMKA 3ZJYA 2QT1A 4QNMA 4C30A 4FWTA 3SBEA 4OBEA 4ITRC 4NYMR 4C0QC 2ZI6A 4RSGA 4HLQB 1EK0A 1W2GA 3EIHA 3OEHD 5A0FA 2P6UA 4OK3A 1R5NA 2W6ID 4URZR 3AF1A 1ZD1A 5F3WB 3F3YA 4Q02A 3LH5A 4JIMA 4M1TA 5FL3A 2CEAA 3LD9A 4TTQA 1JQJC 1G4AE 1LB1B 4Q1BA 5JFGA 4L16A 1YU9A 3B60A 2PEYA 4OKSA 1WRBA 5AJWA 2PCJA 3AP1A 2AKYA 5DNYB 4C0KA 1RRGA 1NI3A 4Q9KA 1VG0B 4CEHB 1CRPA 2D74A 2GF9A 3AKYA 4M1YA 4DSNA 4HSEA 2FWRA 3KFXA 5IT5A 3CKLA 3FVQA 1ZM3A 1Z63A 5FI0B 3HR8A 2GCPA 3HPRA 1XPRA 2VP2A 3LFUA 3KJHA 2O8DA 2QUZA 2CNWD 1GSIA 1E2PA 2J1LA 2WBLC 2YYZA 1YRAA 2ZUDA 3BIFA 1P73A 2BKEA 3QENA 1E2NA 4LGMA 2FZLA 2QU8A 2BDTA 1NY6A 4A6XA 4TYNA 3DZDA 3NIBA 4IJMA 1GM5A 2P3SA 3LWNA 3FMOB 1QVRA 5CLLA 1W0KA 3IBGA 3MFYA 5LB2A 3QVVA 2ORIA 1ZYUA 3C15C 4FXPA 3FKQA 4XIGS 4B47A 2EWVA 5CM9C 3FOZA 2JJ2A 1P3JA 2N42A 3N2IA 1NF3A 3KQUA 1XPOA 1Z6YA 4NCNA 3VU9A 4DC9A 5CDFE 2KSQA 4HLUC 4PQFA 2OESA 1DEKA 4DDTA 4AKIA 1NLZA 2G1JA 1A4RA 1J7KA 3IIKA 3RSOA 1FW6A 2FA9A 2J7KA 3QY0A 4TYQA 2JLWA 2WAYA 5G40A 1FQJA 3CPEA 4BEBA 3OAAD 3D3QA 2IS2A 2IYUA 5JCPA 5JEDA 1RFLA 2IXFA 1ZU4A 2A7QA 4S2EA 2QSZA 3DOEA 4A0GA 1YE8A 3T35A 2DWQA 5LDDC 1ZRHA 2C04A 3H0KA 5FI1B 2ZJ8A 2Q3FA 3TR0A 3CF2A 4RJLA 1Q12A 4HI0E 4Q03A 3ONWA 5EZ5A 3ECCA 1QRAA 3GJ8A 2ZAMA 2H7VA 2WPDA 3LW8A 3GLHB 3HU1A 1IN5A 4Z51A 2WTUA 2IS4A 3JZMA 2GZAA 1KKMA 4GZMA 1IN4A 4B2LA 2A3RA 3WMEA 5FOUA 3CH5A 1QHGA 2OCPA 4PSAA 4CEJA 3FTQA 4V0OA 5H70A 1IXSB 3SJZA 1U0LA 2D7DA 4RVCA 2V55B 1DAHA 4N1AA 1GG2A 1OH6A 3RS4A 2EVWX 4KLZA 5CJ2A 3CRQA 3ND9A 4HUTA 1P9NA 2JJ1D 1U2RA 2GHIA 3DOFA 4TL8A 1JAIA 3SFZA 2JLXA 5JSZB 4URVR 2BMJA 3KB1A 2WAXA 3AVTA 1KMHB 2DYKA 5TMPA 2ANCA 1XTJA 2QQ0A 5LPNA 2ZITA 4B6FA 4WW0A 4YC7A 5JSZA 2C2HA 1T0JB 2WIBA 3B82A 3AF4A 3K9HA 1Z47A 1Q3HA 1KGDA 1SZPA 1OB5A 3ZVRA 2N1BA 1U94A 1NNEA 2YWGA 3FYHA 4LUCA 4I1OA 2YINC 3AVVA 1HURA
chains in the Genus database with same CATH superfamily
5L3SB 3H7AA 5FUMA 4IF4A 1SQ5A 4EQ6A 4R0MA 1Q16A 2ZJ1A 3AYXB 1AX9A 3KUUA 1A72A 4FJ1A 3NWBA 4HRAA 4NEGA 4TXHA 3CWQA 4G5HA 1P60A 4P84A 1DFHA 4IKOA 4CMAA 1XJ5A 2A5YB 3KJIA 1J8FA 1YK1A 2MR6A 1CR4A 1C7JA 2I66A 2GJAA 3LPNA 4HB4A 2CF5A 2JLBA 3S2EA 5KMGB 3JATA 2Z83A 2OCGA 1NVXQ 3QVMA 1IXRC 1LF0A 4HNVA 3UEOA 3SC6A 4WH0A 1V48A 1BJKA 1P7WA 2FWAA 3OLCX 4O1HA 4PLFA 3WWPA 3WKBA 4NHEA 3P97A 2WD8A 1EA7A 1L4FA 3R5SA 3T3OA 3CKKA 1RWXA 5KHAA 2FUCA 4O0MA 3O84A 1H85A 1Q0RA 3HTXA 2WWYA 1YTUA 3FZNA 4KI7A 5FULA 5DP2A 5AYVA 2H2FA 4Y8VA 1DC8A 4DANA 3F1KA 3V97A 4B3CA 1RQ7A 1ZGBA 2I33A 3D3NA 2J3KA 2YOHA 4G23A 4AIIA 1QV9A 2IUTA 3TW8A 3IAM6 3SZRA 4RA9B 1DLIA 5ECGC 2X6RA 3KELA 4W8GA 4B3RB 1CP2A 1U81A 1AIPA 4LY3A 2RG7A 2A0UA 3OSZA 2D8MA 3LUCA 1YB6A 3WIEA 5DYWA 4Q1CA 1T9KA 1CEXA 2IZ1A 4Q7QA 2Q29A 3DFKA 4HDNA 2ZTSA 3FY4A 4EUEA 3A9CA 4K28A 4YJKA 5T8KA 3K70B 3O7MA 1TLTA 4MLZA 4MB0A 1EX1A 4RQTA 2XTNA 5JXGA 3QKUA 2WQ7A 4CV3A 4JXKA 4N39A 5DHFA 1WB4A 4OEHA 4RSHA 1A4UA 2IU4A 1JF8A 3HM2A 4WCFC 3V4SA 4OHRA 5KX5F 3WRYA 2ZSDA 2Z43A 3TCXB 3THRA 5FUWA 4ECAA 5AW7A 2JK0A 2SKDA 4DY6A 3Q12A 2I6FA 2V7UA 3ZWMA 3DW3X 3BQ9A 2XB2A 3AJAA 2PZMA 3MMSA 5KZMB 2QBYA 2QPTA 2AFIB 2YCBA 3HYLA 3HJFA 4O59O 4X9XA 1YZVA 2IXTA 3RCBA 1NNUA 2P0YA 4KNYA 2G67A 3CUEF 1AN9A 4DLLA 5CEJA 2FEPA 1FJGB 1WUIS 3VU3A 2OT3B 5G1PA 1KXZA 2O8CB 1FDTA 1Q7CA 4KHPB 3A3YA 1NTRA 2AN5A 1JQ5A 3K6JA 3MEQA 3HJBA 4J1TA 5JPIA 1JJIA 1BXRB 1YE5A 4CW7A 3KKNA 4RW0A 4ZMSA 1FA9A 4PPNA 4QYMA 1L3IA 4BTLA 5A1TA 3ZTYA 4YDHB 3CUYA 3KQVA 4EOGA 5GJBA 4R1PA 4XQ0A 5UKDA 3RTDA 4PC3A 4PG4A 1TC2A 3E0XA 2VWGA 3REQA 3SHWA 1ZIYA 1TQ6A 3OHPA 4V0RA 4IIVA 1C3OB 4D42A 4XDGA 4IVQA 1ONOA 5E8RA 1GAJA 3JALB 1P7PA 4M7RA 2XQFA 4D98A 2FQWA 1E9FA 3VC3A 3ZE6A 4PWZA 1WR8A 2ATXA 5HW0A 4N0DA 4FFDA 1U6IA 2OM2A 2NOAA 3ZWVA 2UXDB 4F46A 3P9CA 4M38A 2YWFA 4NJMA 2X5JO 4HAVA 4BNTA 3UK2A 1B15A 1E9EA 1SQ6A 4MVJA 1E1QD 2PG3A 3CX3A 2I4LA 4GYYA 4HNAA 5HGJA 5K3FB 1UPTA 1JQ3A 3NTRA 2ZU0C 5HKBA 4O2AF 1IJKA 1QZXA 1TTHA 2MR5A 2ZP1A 3IIEA 4A82A 2VF4X 3HJCA 4GI5A 5JAMA 2BDEA 2FMHA 2XMZA 5HCUA 1KTIA 2XD4A 1FOEB 3NRJA 3FCYA 3AW9A 4YONB 3TLYA 1DC3A 1DUIA 2AW5A 3PL5A 1ORTA 3B1FA 1CJCA 1RE1A 1Y1KE 3P45A 1CVIA 2LRHA 4S1PA 4FOLA 4JLOA 3ZE2B 3AESB 4B1FA 4CNBA 4I5EA 5L4LA 2VQEB 4YQFA 5K03A 1UAYA 4EARA 4B6QA 1FSPA 2NO7A 1TQ2A 2P7HA 2QJRA 1PJAA 3CLSC 3IS3A 2FU5C 3IEPA 4O1MA 4BU0A 4CVNA 4MQLA 2HD4A 4C2TA 1EFCA 1QV7A 3EMVA 4LY6A 5EZYA 5E2AA 1OXKB 1QYVA 3QWFA 1JR4A 4HQKA 4GX1A 3DXZA 3N05A 3O47A 3HEAA 2JGMA 4Q7LA 4TM8A 7ADHA 1SOMA 3WSTA 4JSTA 3WE7A 4QYIA 1M10A 3KTAA 1YC5A 3A06A 1HY3A 1V7PC 3KR2A 4GRAA 3HUDA 3I92A 4JJKA 5I7AA 3SHFA 1WB6A 2QZZA 2PBLA 1N7HA 2OBMA 1YJCA 3JAWA 3FFAA 3ORHA 4Q1VA 1KVQA 4HSGA 3VPAA 4P5PA 2VF7A 2X5KO 3KBBA 5LMNB 4WEOA 5ESRA 3PITA 2QAGA 3CPJB 3R4CA 2VTVA 4GYKA 4KRGA 1U4NA 3H7IA 1L7EA 3IQZA 3L0ZA 5HS4A 1U3WA 1XZJA 4O4HA 4IMPA 2O54A 3AUXA 3UC5A 2XVMA 2AXEA 3CISA 4V0QA 5CM8B 4CKBB 4IX9A 1X0VA 1YTLA 4K6FA 1Z0FA 4YK7A 3FTPA 1CU1A 4IWNA 4DREA 4EGFA 4LCJA 4WWHA 2HK8A 4D57A 2F64A 1Q44A 2UVPB 3IJ5A 4MPPA 5T5QA 3ZWYA 3GWGA 4MPJA 1ZRNA 4FW8A 4ER5A 2QX9A 1Z28A 3ZOZA 5LVAA 1W44A 1ZUNB 3DHEA 1IOLA 1EDZA 3EAQA 4UPVA 3I45A 1UCFA 3BFJA 4A16A 1AA9A 3FRHA 3VHQA 1UBSB 1SM4A 4JI2B 1UM9B 2XUHA 3FE2A 4TMKA 4TV8B 5BO5A 3F7OA 3V2HA 4AP5A 2Q28A 4G2TA 1GUDA 5BVHB 2FP4B 2IYRA 2GMWA 1CNFA 2GTPA 2A5FA 2H4FA 2Q1UA 3EVBA 3O73A 1XXHE 3UNXA 4FYJA 2I7XA 4S35A 5DXFA 2NO1A 1RC0A 3JYLA 3LT1A 4FE4A 4Z6KA 3M3PA 1OV6A 4HGNA 1NLFA 4NYJQ 2RH9B 4QRDA 1NONA 3V8MA 4AX8A 1XEWX 1XRQA 2EW8A 4GFDA 4KMMA 4YRQA 2F1RA 2R85A 4QM6A 1V5GA 2BLLA 4MDHA 3LRXA 4TYWA 2VYCA 3M5WA 1ZRMA 1YB7A 1WLYA 4KE6A 4PGHA 4U7DA 2AC2A 4FOTA 3KTDA 3DZHA 3L0YA 4JCOA 4B35A 4POOA 1T5TA 1VBNA 3GH1A 1NQVA 1J7JA 4R8VA 2BFEA 3LOQA 2HYIC 4DBZA 4MS1A 3L4EA 4WN9B 4ETIA 3VRHA 4PRYA 4QDZA 1L5KA 1NU6A 4KO8A 1NW9B 2GLXA 4MWSA 1DKQA 5B5SA 4JOCA 3T5AA 2DUMA 2Z57A 4OHKA 4PRZA 3L6OO 2VJPA 1KBOA 1XZAA 4F1WA 1Y82A 3O5AA 3CVUA 4PC1A 3RRYA 2WF9A 4HNGA 4Y7DA 2JASA 1GAWA 2I8AA 1K06A 2QUBA 2XHZA 4RJKA 1G6OA 1UF9A 4N0EA 1NZDA 4MUEA 1Q2XA 1CZLA 2XOEA 4IHKA 3TLAA 3UK1A 1GUBA 2CLOB 2QRUA 3L07A 4M8KA 1Q2UA 3H5NA 4NCHA 4I5DA 3E6AA 5KNBA 3RKSA 2AMVA 3A9VA 1L5NA 1SOVA 4JQZA 5IF3A 2BHTA 1HEIA 5FH9A 2DKNA 1EUDB 5L45A 3DV0B 4H1HA 4PW0A 1BQ4A 3BD8A 3G2NA 4Q3KA 4IFBA 3CY6A 2IELA 3RUAA 3CLUD 3R9KA 2CZGA 1PGPA 2B8NA 2MYUA 4HRVA 4IFEA 3GLFB 1JIUA 1T34A 2L69A 4N3AA 5EMLA 4AN4A 4TLLB 1G9TA 3N6VA 1MAVA 2X1HA 3RYCA 3KQQA 1TT5A 4GLFA 3OJWA 2NTYC 1MRSA 1UKAA 2HREA 2A6PA 2AV6A 3EJ6A 4KKVA 2AI1A 5HM6A 5BXQC 1QIJA 5TC4A 2JD2A 3KLOA 3A4MA 3WGNA 2RHGB 1N6NA 4ONEA 4GI1A 3SKVA 1PT9A 2BBWA 3NANA 1NJFA 4RFSA 4C5AA 1GZVA 2PGLA 3EEFA 5E1MA 1LV7A 2VZ8A 2NIPA 3ROPA 5C35A 3H4VA 3L6BA 4C4TA 1ZUHA 3QUAA 2WIFA 3BL8A 1NN5A 1GSHA 3VO1A 2FLWA 2OL4A 3ZD8A 4V1CI 3FOCA 2WF6A 2RHDA 5FO1A 2FF7A 3ZQJA 1GG8A 4IIFA 4FT2A 3ONNA 3OZRA 1VHTA 1SUWA 1OTHA 1ULTA 1IQUA 1RE0A 3AFIA 4RZIA 4EB6B 1A9TA 3DHNA 3H8VA 3M49A 4B3MB 4YAIA 3PJDA 2EERA 2FVXA 4Y6PA 3VYWA 4WDRA 2VH2A 3D5TA 4FU0A 4JY7A 1I5EA 4IRXA 1FFXB 1K6EA 1ABBA 1G5PA 2PKQP 5LXTF 4CE6A 1Z4QA 4MNTA 1U8UA 1NMXA 3OOHA 1NJ8A 1P77A 2ATCA 4JT2A 4TVKA 3VU0A 5KKCA 1V8OA 1AUOA 2MT9A 3UAWA 3ICQB 1NV8A 4A2CA 3Q8XB 5GPBA 4B4OA 3SVTA 2HSWA 3A1SA 3F96A 4DG9A 5IFLA 1I13A 3MPUA 1KZ1A 1UUFA 3FGNA 3CMCO 3D0KA 2CVFA 3GVPA 1ZMOA 3ZIAD 2QRVA 5KTNA 3TFOA 1FFYA 2Q3MA 1MAHA 3R3UA 1H65A 5AHKA 1QO7A 5JWRA 1PR2A 1II8B 2YIDA 1WZNA 3PQDA 3H5LA 1VBMA 3PUYA 2OXTA 3UWKA 3V4LA 5JW6A 1NR1A 5JSUA 3RWMB 5C34B 3PKIA 3BRCA 3SZGA 1WMSA 3F47A 3I2GA 3CF0A 3EXHC 2ZYGA 1C50A 1KE2A 3MS4A 3QOXA 4QELA 1EVZA 4PPFA 5IXYA 1NQTA 3BN3A 2FI1A 1IZZA 5CP8A 3SQDA 5KTYA 3LY7A 5PGMA 1JFFA 4KN6A 4OJTA 3ZWWA 4Z4FA 2X8BA 1FTNA 1QO0A 2V7EA 2YV5A 1N0UA 4IGKA 2DQZA 1OLOA 1HMYA 1T2FA 4LJ9A 3V00A 2Q0QA 1L5WA 2HO5A 4OQQA 1O5TA 1SUFA 4MW5A 4YP6A 3I9NA 1KRWA 2JCSA 1Y4SA 1LGYA 3SP1A 1Q17A 3PVCA 4P4SB 1B23P 3O1IC 3G23A 3JRXA 1NW5A 2VBGA 2ZYDA 3NBZC 2E4ZA 3MT9A 4LZJA 4X1IA 3KUDA 5BRAA 3IEIA 2NUTA 4ZHQB 4HF7A 5I7RA 4YIHA 3MS2A 2Y8EA 4DV1B 1RKBA 4JI5B 1J8VA 2Q0HA 4XZ3A 1L7OA 1XU7A 4ON9A 4LSGA 4BVEA 4CZ2A 4URWR 1EXVA 5TPWB 1FYFA 2R7MA 1POWA 4TMTA 3UO8B 1TCUA 1G1AA 1QO9A 1XMOB 2NV2B 1RQXA 2B5OA 3C4QA 3OMLA 1DAFA 3JD1A 1GAXA 2G36A 3OX2A 1A96A 2F6RA 3CZRA 3IUSA 4YCBA 2PZJA 4YMVA 1MABB 2W90A 2PUGA 2JGDA 4GMDA 3HEBA 1K4MA 4MITA 4QOSA 1OI4A 1SOWA 1DS6A 2AXPA 2AG5A 1I9CA 3DBHA 2B99A 3W3ZB 4MWZA 4X3CA 4AC9A 1SURA 2OCBA 1J25A 4MK4A 2AOVA 4Q4AB 4K46A 5F1YA 2JIOA 3DVQX 2EG9A 4C03A 3G6WA 3UWPA 4AJJA 2YUTA 4OFBA 3OLXA 3DBVO 4XTCS 4DNFA 2FUG1 1NATA 5BSTA 5AW5A 3L8HA 1AKQA 4BV2A 5A5FA 3IUJA 2P67A 1QGYA 5CTJA 2FX3A 2FXVA 4YP5A 5FOSA 4AG5A 3DF7A 3ICEA 1QHXA 1V9LA 3QLUC 5EY5B 4B33A 4DDHA 1QX4A 5CG1A 3K9FC 1E8MA 1YAJA 3A3KA 3BHJA 3HM9A 2PQMA 4F2WA 4QXAA 4GYJA 1U5BB 2V0NA 2A9FA 1RJ9B 4L78A 4BGVA 1H4SA 1I2CA 5D1HA 3AB8A 4NMMA 2VA9A 3C4VA 3RRBA 1EJBA 2JRCA 3GT7A 2W6CX 2C07A 2JATA 1J8DA 3SK0A 2HY7A 4QHTA 1WXFA 3VH1A 4B5LA 2EJVA 3BSWA 4FMDB 1EWTA 4H1TA 4MV1A 5FOXA 5AT1A 4CJXA 4EKYA 1MT3A 5B3JA 4FBMA 2A88A 1F2UB 1H2ZA 2CL6X 2NPFA 4RKEA 1SVOA 3HHPA 3KEMA 4KVZA 5AMXA 2XYVA 3PYLA 1D4OA 3EZXA 4F3NA 3RVLA 2XA1A 1VHQA 2BFBB 1T6NA 3D3WB 5KWJA 4YDRA 1XTRA 2I1VB 5GZ6A 3B3GA 3CR8A 5C9ZA 3SQXA 1EWVA 3IQGX 3E1KA 5DXAA 4CIBA 3DB2A 4FYXA 2O07A 3TUIC 3VPGA 5ISMA 1SY7A 1RYZA 3W8NA 3MC1A 4F38A 4D8WA 2HFKA 2FZVA 3MWJA 4IH9A 4MUBA 3PZBA 2IF2A 5THKA 3VVCA 1DBIA 1MFZA 1NJ1A 2BGUA 2EYQA 4CV1A 3THSA 4DIMA 1QHYA 1PNVA 4FIDA 2DSNA 4PAWA 3KZMA 2HWUA 4FOOA 3E70C 3RC1A 4KJXA 2JLYA 5F4ZA 1VBFA 2IHUA 1AV7A 2LKDA 2WYVA 2PWYA 5FPQA 1GL9B 2YC4C 2VRWA 5IWCA 4YUYA 3EVZA 1JNYA 4HDNB 4B6JA 3OZVA 5JROA 4C5CA 5LLDA 2IV7A 5E9JA 1RWPA 2PBRA 1P5JA 2XUOA 1RJGA 5DI9A 4ASUD 3O0TA 4MDFA 5DB4A 3DQZA 1MTZA 3V2GA 1ODKA 3N2KA 2P5TB 2HNKA 1CFJA 4BB9A 1LLDA 5TPZD 2OHVA 5AJUA 2R6DA 1F9AA 3BRWD 1D5WA 1HE4A 3OJLA 4YJDA 5D84A 4DNQA 5DN6D 1SVSA 4BNXA 3IDQA 2NAFA 1D1TA 2C82A 2BMEA 2PPLA 3BWCA 4G1FA 1Y8RA 4X1KA 5DBOA 5AVXA 5CX1B 1J06A 2OAQ1 4FC6A 2XZOA 1OXUA 4RSRA 4RHCA 3EQ7A 3LCRA 5CCXA 1ODSA 2PXAA 4PY2A 3KRTA 4X97A 3IP5A 5K8LA 1K3TA 4DLYA 3U3DA 2V9PA 3LL7A 3UA4A 1GU1A 3ND8A 5KWEA 2JH9A 4HXGA 4EB0A 1HFJA 4PLHA 3BE8A 2VDVE 4CM8B 3JWGA 1GA1A 4PXAA 5EKUA 3HCOA 3LGAA 4R16A 2WD7B 3I9OA 2PZLA 1M8GA 3TE6A 4HVCA 5FLXA 2J08A 2FSVC 3OU2A 4HYQA 5FUYA 5JBNA 2I6GA 3TBKA 4Q39A 2RC6A 4MRNA 4P86A 1W9MA 4HDAA 1JHOA 3TB4A 5BP7A 4ND1A 3INGA 3IKVA 3TPFA 2HEGA 3I1JA 3I0ZA 4IDQA 3CXUA 2MYTA 1YD7A 4BO3A 5FDFA 2OZPA 1NC1A 4UFNA 1Z0DA 5IBRA 3DO5A 2ZAOA 4IDEA 1Y8AA 3EA4A 1QIIA 1XG5A 4K1XA 4YPOA 1MW8X 3JD0A 3KSUA 3D8TA 2IYPA 4ZGBA 4JL8A 4E2YA 3ZDAA 3PC2A 2P2SA 3E7DA 5ECYA 1Q74A 1RLTA 5EIEA 3X1DA 4JT8A 4ETWA 4FSDA 1JSRA 2IA5A 4HQNA 4ZU1X 4PHCA 3P0RA 4P0TA 3TSOA 5B3KA 4RELA 1QM5A 4PN3A 3V6MA 1ZGHA 2C20A 1INLA 4V3BA 2YUIA 3MXOA 4PYKA 5CLIA 2Q5EA 4TX1A 4CU2A 5JFTA 3DD1A 5JEEA 2XX3A 2FFRA 2WJ4A 4O02B 2IF0A 1PCXA 5EHIA 1COWA 1U9ZA 1H42A 1YR6A 2QP9X 4QGAA 2OMKA 3ZZTA 4ZEMA 2CXOA 4KIWA 2GNOA 3C24A 3T4XA 2OBFA 1V41E 1XA0A 4L5CA 4E08A 4ZYUA 3ABZA 3JPYA 3LXRA 1PN3A 4JC0A 2YYSA 2K7FA 2DE0X 1R0WA 2J9ZB 1O87A 2GZ2A 4KUEA 4YRZA 1FL9A 1H6AA 3RJMA 4J43A 3PQCA 1UANA 1QGOA 2RGDA 3F8TA 2EJWA 4TLDA 2II6A 2G5PA 4FHZA 4IXMA 2ILTA 1TKBA 5CB6A 3HYCA 2YYAA 1SXJC 3NH6A 1KY5A 1CY0A 2PGDA 2YL2A 3BTSA 1ODFA 1E9SA 1NRWA 1FBTA 2XYGA 3C3YA 2H08A 2VHVA 3IE0A 3MOIA 3VR5D 2VAMA 3VAZA 2LD4A 4UU7A 4U2FA 4MA0A 2FPWA 5JVDB 2BSQA 1A71A 1A7JA 1M34B 2GN2A 3OTGA 5DFAA 2QTFA 1S89A 1Z5PA 4WJKB 5KPJA 3KQHA 1JUDA 4X7PA 2OGWA 3OZCA 2C2GA 1OBHA 5DHTA 4RD3A 3NT4A 3M6VA 4Z9FA 3G0OA 1X14A 5HOQA 4J9VA 1RYBA 3TVTA 4PZCA 1NMZA 2UYGA 1WLSA 2NTEA 5C37A 2B2NA 1Y80A 2UAGA 3QQPA 1HDYA 4DJTA 1GNSA 4ZVLA 2Q6OA 2AOWA 2PGXA 5AVUA 2NAPA 3BXEA 1B76A 3RRZA 2J87A 2W00A 1FDRA 4XRGA 3DMGA 5CLJA 1IOZA 4DLPA 1UKZA 1FSFA 1I0ZA 1IG0A 4PFSA 2G71A 2E5WA 2XCLA 2ZJZA 4V24A 1AQJA 4GU5A 5JANA 3JAKB 4P7KA 1FMTA 1P7CA 3CNBA 1GGHA 5GAJA 2I7DA 4Z4HA 1NJ2A 3JQ7B 4R8MA 1QK3A 3H2HA 4U6SA 2ZRAA 4DN6A 1UXOA 4BKOA 4EI7A 3AX6A 4CEIA 5LOVF 3DUWA 1TEXA 2X0KA 3OCVA 3ANSA 5F7XA 3AHHA 4IYRA 1XP5A 4DPKA 1T1GA 1VA4A 1CZHA 2O2HA 3IERA 2O9JA 1VGRA 2Y6VA 5J47A 4ME6A 5ALVA 2C9BA 4H60A 3G5TA 4RKWA 3WC4A 2GZ1A 4C4XA 3TOSA 1G5HA 1G7CA 1W4CA 2PBFA 1BMFD 3I5UA 3RIHA 5EHQA 1ZJZA 4B9AA 4C3ZA 4D8TA 4DRXB 3K6SB 4YR9A 3DM5A 5FXMA 3ZD7A 1ZJ5A 1Z37A 3PR3A 3WOVA 2IS4A 1C30B 3A1TA 2Z2IA 3KPVA 1FMJA 2WNIA 5FAXA 4XE5A 3JVIA 5IFKA 3GBPA 2WVJA 1ZZGA 3GCGA 2VPIA 4HDKA 3LQ2A 4M0LA 3HJUA 1YAHA 2FYTA 1UBOS 1BTOA 4FYYA 3U7QA 1ZZEA 2BUAA 4BMYA 2QGFA 2ZTHA 4FPXA 5EWLB 1ZEJA 1M8FA 1RJWA 4RNDB 3H9JA 3OJOA 3P2MA 4WEQA 1DG9A 2QMHA 3WIOA 1NQ5A 1W0CA 3PBKA 3SXJA 3WLKX 4YAJA 4UHHA 1YQGA 4KYIB 1JN0A 1Y3FE 1VE6A 1Z6AA 3GEHA 2DULA 1N2HA 5IAEA 1CJKC 1S1MA 3G8AA 3M82A 4TYYA 3DEAA 1KJWA 2R8EA 4US0R 1EQ2A 1N0WA 3E8MA 4PYMA 1SCUA 2VAWA 3UY4A 3WLAA 4CKYA 4YRSA 5HZHA 3ROXA 5KEIA 3EGWA 3KCQA 4JWTA 3SE0A 2A86A 3F6YA 3I9KA 1OYOA 3P2YA 3R8CA 1VKZA 3QU2A 4KOAA 4E4TA 3C3DA 3CINA 1MO2A 3EEIA 2Z2XA 3ROMA 4LMPA 4EL5A 4GEGA 5IDWA 1QDUA 4YMLA 3PCXA 4MWEA 4B40A 1J2UA 3HCBA 4UNPA 3D0RA 1TM7E 1PFGA 2F9MA 1G19A 1XU9A 2VHJA 4A03A 4ZVOA 1BKYA 2MCFA 3SAJA 4LRYA 2QQGA 1T2UA 4WJZA 2Z8ZA 4LYGA 2HR1A 1XQXA 3MLBA 1IVSA 2A0YA 1U11A 5F78A 4NYJR 1LRJA 1TLFA 5CAEB 1N2GA 1DV1A 2HK6A 1Z6TA 4FC7A 1TU4A 3W5DA 4BO4A 1EUDA 3WMWA 3C3CA 4NZOA 4F9TA 3DV0A 5CCDA 3V3TA 4UULA 5A9SA 5IDXA 2PS1A 4O4IB 3MW8A 4N5HX 4JBLA 5TY0A 4D9HA 3D0OA 3RU7A 1TCAA 1W1WA 5BT9A 5HX7A 3NEPX 1TNDA 2DBYA 2G17A 2KBEA 3IRVA 3LLSA 1KQGA 1C8VB 1N5LA 1KORA 2F90A 1U8XX 3K96A 3NYRA 4KK4A 1YZLA 3RRMA 4OBXA 3RYCB 2JHCA 1L8QA 3PC7A 2NSJA 3KYBA 2R8YA 2H8KA 2PUTA 4MV9A 4S2UA 1IN6A 1DBQA 1TO6A 3O8DA 2B2XA 5EJAA 4WFKA 2XDWA 3I23A 3Q5DA 4JQSA 4LEIA 1CY2A 1TM3E 2QDKA 1ZN2A 4G2NA 4IDHA 2PH5A 3BIWA 4NBWA 1OAOA 1T10A 1KI6A 2EJBA 2H3EA 3FTCA 1VBKA 3E9DA 4HFRA 3SXPA 4AN0A 4ZCPA 4D46A 4EPVA 1HI9A 1VE1A 2BH9A 2GPAA 2OCLA 3MWEB 4U7GA 4EF4A 1CR1A 2F1KA 1SXJA 2IY7A 2OB2A 3W5BA 2PX5A 5I9TA 4CM9D 1TE2A 5H5JA 4CM4A 5JAQA 3LQQA 1YZQA 2I2CA 1FQKA 1X1CA 2YFKA 5J5CA 2VKTA 4ZYLA 3L0DA 5JJ5A 3DOOA 1FEZA 5EJ7A 4IQ8A 4LPKA 1Z26A 2VWHA 3IVCA 3K1ZA 3TK1A 2F43A 2Y71A 3K0SA 1Y6ZA 3AM3A 2J3HA 3L7JA 4L3WA 3R41A 4A8JA 3U60B 2QVLA 4RD1A 4DJJA 5LA6A 4F96A 1UZNA 2XMDA 4WE3A 3BCHA 3AJ9A 3E53A 2WMDA 4ND3A 2ZJYA 5ADWA 1T3GA 3EPRA 3T7TA 2JCGA 1RAEA 2YXLA 3GJZA 5KYXA 1CB7A 3QLEA 1J21A 1R4ZA 1O4VA 1TDJA 4XDHA 4BNZA 2V6BA 1ZR4A 3QXJA 5TQVA 3QQ5A 2XLBA 1KZYC 2IDZA 2Z4SA 2ZI5A 5AK0A 3TGWA 3OQIB 1B42A 3G8DA 3Q0IA 1YR8A 4FXOA 2PZ8A 3PSHA 4GC9A 1XALA 2D1SA 3OM1A 4QICA 3H75A 1U0BB 2ZDHA 5HMLA 2EARA 1HTWA 3DJFA 1KSHA 4B46A 4JH0A 2ZCJA 3DKRA 1X1RA 5JFOA 3WB9A 3UQZA 2AE2A 4HEQA 3WRWA 3K2BA 2NXWA 5ALSA 5THXA 3WLSA 1UBKS 5DX0A 4IGFA 1JDSA 4CF7A 2QAJA 2R6FA 1DTWB 3TSWA 3ZGNA 4EPXA 2J0SA 2NQ2C 1BS2A 3B9PA 4XJVA 4DS3A 4MV8A 2CUZA 3L8YA 3B36A 3NAMA 4M37A 5CA1F 4TLAA 2VRCD 1D2RA 4MR9A 3N2LA 4E15A 3HN7A 1DAIA 4PYRA 3WADA 3H1BA 1F8XA 3N8HA 3LRTA 3G9UA 4MVJP 1XV5A 1YBAA 2DUWA 3PGVA 2VC2B 3EYWA 3EGOA 1N5KA 4HWSA 3ZPXA 4EA8A 1AKEA 4HK4A 2QTRA 3ER8A 3H86A 3WO0A 3QVOA 2QD3A 2YV4A 5HJ2A 2XCTB 3V1YA 4E88A 2G5TA 1QIFA 1A4IA 2HTEA 4GXTA 4H3VA 5JSQA 1X94A 4Y2HA 4U1RA 4O3MA 2OD2A 4ZQBA 4KQ1A 2H1SA 3ACBA 3JV7A 4RWZA 2R96A 1NR5A 1LWOA 2JFWA 3JQFA 1PR4A 1RWQA 4GOKA 1PQWA 4LDNA 4RXTA 1GUAA 2FF5A 5AI0A 4KGZA 1LDEA 2VP6A 3DAHA 1UOPA 2OQ2A 3UBMA 3UV6A 4WZBA 5DWQA 1U28C 3TNLA 1L7AA 3C98A 3IHLA 3OZBA 2FPIB 3A3NA 2I1WA 4DCTA 1EUQA 4HQ0A 4JFRA 3WGYA 2ZE6A 4CRWB 1FQOA 3OF3A 1M8JA 4MUAA 4EBFA 4BJ1A 3LT0A 3CRZA 4GWLA 4D5EA 3FTDA 2Y1DA 1BRTA 4L50A 4UUOA 4DIEA 1YS2X 2WSSD 3GNSA 4QDJA 5JTUA 3VOTA 1P1KA 4C7OB 1JE0A 1Y4ZA 1U6KA 4DAEA 3H18A 4F84A 5GZ3A 3RUPA 5K3EA 2NNWB 2PVPA 2WVGA 3CCCA 1T9GR 3BXPA 4AUEA 1F8YA 2VOJA 1XJCA 3CEMA 4ZARA 4D4KA 5HJ5A 2GXAA 4ZVRA 5MHTA 4FDTA 3PQ2A 5LOVB 1WUJS 4B83A 2C3MA 4IEFB 5AKYA 2ORVA 4N6OA 4F7DA 1TD9A 1VE3A 1OPRA 1Z2OX 1HDXA 2EZ8A 2IHJA 3CLRC 1VZ2A 2B4KA 1NLUA 2QTHA 2QZPA 3IVMA 4C76A 4WBNB 4BDTA 3DVRX 1JJVA 1NKVA 4GIBA 3K6SA 2JBWA 2VO1A 2ZRCA 4O8ZA 1J2RA 1HLGA 1TLLA 3C6KA 3OSUA 2RAPA 1X1BA 3Q11A 4IHQA 2O3TA 3NT5A 4OHZA 4A23A 5AW1A 1GFZA 2ZZNA 1H9CA 1LV8A 1OV4A 4AURA 2PKQO 3UPTA 1U3GA 1R00A 3IBYA 3G1TA 5LMUB 4CEJB 3GDHA 2BEUB 5LQMA 3Q98A 1CRQA 5IHPA 4NOJA 1EZZA 4UHBA 4ER6A 4O2BB 2FMKA 3HDTA 3GOHA 2QMEA 3V48A 4F4CA 3GAFA 4K9KA 1N0VC 3JALA 2HRQA 4MICA 1WQ1R 4BEJA 4BZQA 3ICWA 1ST2A 5EXEA 1JW9B 4RC9A 1JTEA 2COKA 3D6AA 2XUGA 4UNSA 2XGJA 2B7BA 3JQ8B 1WVMA 3OLWA 3O95A 4KTVE 2QL6A 3O91A 3RVDA 3GGGA 4N9WA 1RRCA 2CL7X 3ZDBA 2H06A 5IH3A 5LQNA 2CKMA 1G8SA 3HKBA 1Q5PA 4CM9A 3WWEA 2RKBA 4C9BA 1EBUA 3DXFA 1MKYA 3P2OA 5EJ9A 1Z4NA 1CWUA 1ZK2A 1WD7A 3B5EA 3G79A 2ZYWX 4K9LA 2OSBA 1M0TA 4D81A 1E4EB 4MVJD 3CVYA 2PYIA 5B6IA 4W9MC 3R9WA 1YQTA 5HQTA 1ECCA 2N3ZA 1THMA 3SDZA 2E7ZA 4DQDA 1V43A 2XODA 1FRVA 1BQEA 1MXFA 1P2BA 1BCRA 1TVCA 1V4NA 3QJ5A 4TYPA 4F2DA 1ADGA 2HV8A 3CCFA 3QFTA 2FZEA 3DL7A 4QQFA 4ZT4A 1GQSA 2D8AA 3KYIB 2Q8QA 3SKXA 2WV9A 1DJOA 2FEAA 3M1AA 4HD8A 3HJGA 2PFSA 3F6BX 3L5OA 1QQ5A 3HB4X 4P82A 3DVLA 3OEYA 1R64A 2BONA 2QD5A 4EPWA 2IQIA 4MKIA 3VHXB 1JDVA 3ELWA 4UAUA 1Y37A 4EG3A 1CUHA 2H5IA 4GRDA 3F7TA 4X5OA 4XJTA 1ETUA 1EUCB 3GLKA 4PS0A 2WSYB 5ERYA 5HMMA 1A9YA 1V8ZA 1WY7A 4HGPA 4L7QA 3ZW8A 4PANA 2IZ5A 3F46A 2QX7A 3WLOA 1IBCA 2XCIA 4C2AA 2HWYA 1PZEA 1EX6A 2AVDA 3PFIA 5EJIA 3CHYA 4O4JA 2YHSA 2ECFA 1L4NA 1VB5A 2WD7A 3AOEA 4KXLA 3WHKA 2J6IA 3OOJA 1R0XA 4B44A 4DPMA 5JBQA 4M0FA 4YMSA 5ALOA 1KAHA 2MWMA 1SULA 3JAWB 3WB2A 1PZGA 5LBTA 2R4QA 4L51A 3DOHA 2O2XA 3RJ9A 1T24A 4JL6A 4XGIA 3CLUC 4M98A 1D6MA 3C48A 4UZSA 1DEXA 2XLCA 1ZSNA 3EQ8A 2NNLD 1C41A 1T36A 3ZZMA 1Z06A 1G9SA 4LI0A 5DMXA 1ZS9A 4BPBA 2QF7A 2YWDA 2NZWA 1XK6A 3UCFA 1AZTA 1JPJA 1YZYA 3HBNA 5F5XA 2F48A 2DQ4A 3N28A 4ZI2A 4J0FA 1NF2A 5TDHA 1NDUA 2ZIVB 1R15A 3TIGA 4FD2A 3PL1A 1FLNA 3COVA 4L28A 1P9LA 3E27A 4AYXA 3NEYA 1YGYA 3EB9A 4RIEA 1ZAYA 4IP0A 4DV3B 4JLSA 1L9KA 1VL8A 1RT9A 2X3UA 3JZAA 3N53A 3MWDB 2OV3A 1S1CA 2W6JD 3IKJA 2J0EA 2PTHA 2QRQA 3LBHA 3C2QA 3ASZA 3ET5A 4FX5A 3WLEA 3ZHXA 1J0AA 1MV5A 1A82A 1NBWB 721PA 1PW7A 4NBTA 2YVUA 2K5UA 3GRZA 4A8PA 4C1BA 3ESDA 2DGDA 1XTPA 4O8CA 5KCZA 5ARCA 2V5AA 4WSOA 1KDTA 2PMCA 1EWKA 4QDOA 1KDRA 1KI2A 2C9OA 4JYAB 1OB2A 3ENQA 3K5IA 4G0MA 4E6EA 3JW8A 4KH1A 4GDMA 2VAPA 2A3NA 4TKZA 5CT8A 4JLAA 5KU7A 3I5MA 1RHMA 1UJ6A 5F98A 2B6NA 1U04A 1H2YA 2G77B 1NXWA 2X8AA 4HXFB 3LBIA 6NULA 4IDGA 5H16A 4UHDA 4EDFA 3ZTWA 5JVDA 5JYBA 1FS5A 3BMXA 4UDYX 4BN4A 2G7ZA 4PGGA 3QPCA 3UHPA 1T3TA 1ZQ9A 4MEBA 3RYTC 1EIWA 1O97D 1NVFA 1SZJG 2RB4A 1AXRA 1MB4A 2CNDA 3KU4A 3E5HA 2JAOA 5EE5B 2H2IA 1YJ8A 4LF7B 1WDTA 4MVJH 1R4NA 2VZEA 2BMDA 1FP1D 3FWZA 2VZ9A 3KOZA 4LRXA 2JAHA 1NSTA 3M3HA 4EYQA 2RGWA 4JJEA 1UJCA 2YXEA 3HNOA 1G0OA 2FUG6 2H29A 5TPZA 5GOTA 2OTCA 4OI0A 4L8GA 1WPRA 2DSTA 2FETA 4ARVA 1V5WA 4N0PA 4CL3A 4DLZA 4PHGA 1USKA 1OZ0A 3JAKA 2PLRA 1N1MA 4BO7A 2BM1A 3I1YA 2AFRA 4W8OA 1JZSA 2ABWA 4KMSA 3U13A 4UOEA 2C4UA 1Z2AA 3PYMA 1TZMA 1CEEA 1VL6A 1OFUX 3ESZA 4QHYA 3JCZA 1E2JA 1XEFA 3OPMA 4LF5B 4PYOA 3BFKA 3QNWA 3PDIB 4MJLA 4ARCA 1ZQ1A 3KYCA 1YR7A 1BN7A 4UAJA 3T6KA 2Y6UA 1R0SA 5ALMA 3W7AA 4BP3A 3ZXSA 1MIOA 3KUKA 3V5NA 1KI1A 3E3MA 2DY0A 3LC2O 4J16A 4F60A 1C2YA 1KRXA 2XQIA 6REQA 1ZK3A 2ZI9A 3GAZA 2QQ5A 1M1ZA 3WNQA 2YOFA 4F1KA 1PZFA 5I51A 3GCXA 1GZDA 4UJ5A 3SYRA 4O5AA 1NYTA 2PLNA 2W2NA 2AMJA 4OL0A 3DMTC 3SKYA 4BNGA 1B8UA 1CT9A 1PS0A 2GRUA 3BICA 2QIPA 3KK0A 4GPAA 4BO6A 2Z6AA 1G7TA 5LSAA 4LOKA 3GLIA 3W04A 2WFLB 4MQMA 2O06A 1K92A 4ILKA 1FIUA 2C4WA 4FLFA 5IDQA 1QH8B 1V4VA 4GUAA 2ZUEA 3N8KA 4B75A 5EIXA 1RI1A 1RAGA 1A5ZA 1Q19A 2RHMA 3AFOA 4P98A 1KGSA 3EIUA 2PFGA 5GTDA 1TO2E 2HF2A 3B48A 4M3NA 3RASA 4ENSA 1L1QA 4XX0A 5EIFA 2NXCA 4IVPA 4JOQA 5TRTA 3BMOA 4GOLD 2ZJAA 1KZHA 1XNQB 5K0TA 3G6KA 1X87A 3L0CA 1QRDA 2Y2VA 3K6KA