2VP5A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
191
Chain Sequence
b'TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
molecule tags Transferase
source organism Drosophila melanogaster
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
total genus 73
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vp5A00
4PXAA 1E1RA 5CJ2A 2HDNB 2WV9A 3WMGA 2V1XA 1YZKA 1ZU4A 2C9CA 1FX0B 3W6NA 1E32A 4DZZA 2GJ9A 3FPAA 3F3YA 4IDHA 1N6LA 3L0IB 1N0UA 3AV0B 5J47A 1NBMD 3K8YA 3P4XA 4HAWA 1P9RA 2GZDA 4MKIA 2VSFA 4A8JB 1WBBA 2OILA 4WA7A 1R6BX 4LK2A 1FTSA 3WNDA 3KQLA 3U7GA 4Q5IA 4LYHA 1Q21A 2IYSA 2PJZA 5EZ6B 2D4HA 1M2OB 3L82B 2PT7A 3MCAA 3QOFA 5BYJA 4FCWA 1K5GA 1U8AA 2O8FB 1ANKA 2HT6A 4X8LA 4CGZA 4TMZA 5F98A 5C2JB 1W7AA 3ZH9B 1T5LA 1XXHE 4BZQA 4MGIR 1ONBA 3KQKA 1NJFA 3QG5A 3RYTC 1KNXA 1PUJA 3KKOA 3SHFA 1P2SA 2QE7D 2O0KA 2BWJA 4N1AA 4IFBA 2VIIA 1NLYA 3TK1A 1X86B 2J5XA 2YJTD 3SDZA 1YR9A 3EZ7A 3EC1A 2RAPA 2XXAA 1FQKA 4IXNA 2IXGA 2QQEA 5IRCD 3A1SA 1G41A 4URWR 1TF2A 1SKQA 3B1VA 3L8ZA 4IOMA 4LHYA 4TLDA 3TQFA 1II8A 3AF4A 4GZLA 4JBWA 3V4FA 3IQXA 1SXJA 4A2PA 1FNMA 3CRW1 4RD2A 1X8KA 3LO5A 2QORA 5TV2A 4P4SA 1NVWQ 3DOFA 4Q9KA 4S35A 1XEFA 2KJQA 1SQ5A 4DLUA 4LBWA 5AUOB 5DN6D 2JIZD 2OCAA 3QE0A 3RC8A 2ORIA 2DY1A 3I5YA 1G3UA 2JLSA 5BW8A 3IEUA 4DEYA 4HAXA 1RYFA 3H0KA 5JCZA 1IN8A 2XSZA 5JHHB 1NN5A 2H1LA 2NIPA 5AJVB 3A4LA 1OSNA 1BO6A 3CKLA 1LF5A 1II8B 1ZUHA 4B3BA 4CIDA 4IHQA 4PHGA 1W2GA 1NBME 3PEUA 1XDBA 3NG1A 4KLZA 3BBPA 2IT1A 3IIJA 4JVNA 3SJAA 2NGRA 3AVPA 4PFSA 1Z0DA 1SKYE 3VNVA 2WWXA 3SOPA 4V0KA 3MJRA 2QMHA 4RVCA 3AB3A 4EQ6A 4UNNA 2ZIAA 3VR3A 1COWA 1SULA 4FI3C 2KB0A 3QF4A 1ZMXA 3R8CA 4PZZA 5JI3E 4M9ZA 2WWGA 2ZRPA 5TB5A 4N0EA 1PJRA 4WZBE 3SFVA 3ADCA 5FR2A 4TQAA 2RGAA 5AJWA 3QVVA 3CB4A 4PQRA 1DG3A 3GEHA 3GLGA 1OH6A 4Q1EA 4JLPA 2C9OA 4E5UA 2FNAA 1XD2A 5DIFA 4LWZA 5EUQB 3KKNA 2QL6A 4IVRA 2BKUA 4Q00A 4WOPA 4YMWA 4KFSA 2XJ9A 5C1BA 3O8BA 2V1UA 4P4TA 3LAWA 3SJCA 2G77B 5G41A 4DLYA 2VTKA 4LYAA 1VKJA 1N6RA 4JZKA 1IXZA 3PG5A 2DPXA 1U8ZA 4WVFA 2WSSD 2CCJA 1XZPA 5FL7D 3AVUA 3JZAA 1KI9A 3NIBA 4JLBA 2CLSA 1E4VA 2PEZA 5EP1A 1E1QA 1JNYA 1G8HA 1Z22A 2NZ8A 5EE5B 2IW3A 1YZUA 2OM2A 4PSAA 3KQNA 2ZJOA 3RANA 1BYIA 4I1VA 1XMVA 2B7BA 3LVQE 4DLVA 3RDPA 1NI3A 4JS0A 4YMUA 1W46A 3LQQA 4AG5A 2BIFA 2PMKA 2FPLA 1E0SA 3U2QA 5JJIA 1FQJA 4EPXA 4NMMA 3B7GA 2G0TA 4NPHA 3M6AA 2GJAA 3FTQA 2HUPA 1N5IA 4UQOA 4D4JA 3HU3A 4GL2A 3QKUA 2NTYC 1RVDA 3B2EA 5JSZB 2ZR0A 2Q9BA 4ZKDA 3ADBA 2N46A 3KB2A 1NVUQ 3VR1A 3LW7A 4JLKA 2ZSFA 4TSFD 2HCJB 5EP2A 2IXEA 1MABA 4XTRA 2XOKA 2A2ZA 1DEKA 1S0UA 3EWAA 2GVZC 2BM1A 1QHSA 4Z1MA 4NONA 5FOWA 3PEWA 3IILA 4QBFA 4UNRA 4O2RA 3SS8A 4TZ6A 4W5WA 3I62A 1RRGA 1JECA 2EFGA 2OESA 3FKSA 5FTMA 2PH1A 3KQHA 3OEHD 2KSQA 2EWVA 2WIAA 1UF9A 1Q0UA 1XD9A 3WHKA 8OHMA 1E2NA 4Q03A 4Q4HA 3THXA 4JT4A 3T1QA 1OPXA 2H92A 3R8FA 2BMEA 2XNDA 4ASUD 4ZCLA 2IK8A 2P2LA 2IYTA 4LBVA 5EE3A 4PC7A 4U00A 1XU4A 1E2GA 3AP3A 1G3IA 4UNSA 3ASYA 1UKZA 2ZSDA 4FXPA 3QVUA 3A58B 2N42A 1RRCA 1KMHA 1WE2A 1VG9B 2REXB 2DB3A 4IKEA 4TL9A 4LHWA 4NKRA 5JECA 3CPEA 1KYIA 2FEOA 2IYUA 5CLLA 2O5VA 1IY1A 2ZPTX 1OF1A 2BBOA 1Q1BA 2EFCB 3PITA 1QG2A 4Q9JA 3B1WA 2ZQ5A 3D3QA 4GPTA 3SE0A 5HKKA 1CF4A 2KE5A 1G8GA 4LC0A 4KYUA 821PA 3C5HA 3GJ8A 4G5SA 4JKIA 4ZO4A 3ADDA 2WKPA 2LCFA 2A5YB 3CW2A 3LY5A 5AR1A 2ATVA 3TBKA 3W8RA 3W8NA 1HUQA 3KKQA 3GLIB 4A36A 4Q7KA 3U3MA 2PCJA 4C9BA 4V0LA 1CXZA 2EFEB 3VKHA 2JJ2D 5JHGB 1FTNA 4QOSA 1IJEA 2H18A 4W5JA 4Q9LA 1UKYA 4GFDA 1TNDA 4Z8YA 3ZVRA 4PHFA 3SFZA 2C78A 4TLBA 3X1DA 1R10A 1ZNXA 2CHVA 3O8DA 4IDPA 5EQTA 2CLCX 5DISB 3V9PA 4B43A 5KNBA 2ZTSA 2WPDD 4OQNA 4RZUA 4LHXA 2Z4RA 3U4QB 3VR4A 4BFZA 1XPOA 2B92A 1A2BA 1IHUA 1ZP6A 3Q9LA 4CEHB 3SYKA 5LBIA 3IIMA 1QVAA 2VP5A 1G7CA 4PTLA 1G5RA 1FPMA 1KZGB 4WXRA 3A1TA 3P27A 4G1UC 4L9SA 5D3MA 2BOVA 3A8TA 4QBGB 3T15A 3WP1B 5B30A 4LJ4A 1UBFA 5SZHB 4MRVA 4RD3A 5FOTA 1ZAKA 4JLNA 2YHSA 4JMPA 4BLOA 3GJXC 5L3SB 1HH4A 2CK3A 1TF5A 2ZUDA 1Q3HA 4QGFA 3K1JA 3MGCA 2FSFA 3T34A 1AIPA 2F55A 3M1IA 5GVRA 4LBZA 3LLUA 4PO1A 2JLVA 1J8YF 2E87A 3N70A 1SVIA 2IC5A 1D2NA 1L2TA 1XXHA 2L0XA 2WOJA 4LI0A 4P31A 4TMKA 4DLRA 4WIAA 2IX3A 1Z0JA 1TTTA 4QGHA 2FGKA 3RC3A 1KNQA 3L43A 2BHRA 3MSXA 1DAFA 2ZVPX 4G5QA 4LPSA 4B35A 5KNCA 3LVRE 3CWQA 2REBA 3MFYA 1JR3A 3BRWD 3NDPA 5EP4A 3T1TA 4QM6A 1E3MA 1E0KA 2ZAOA 5AUNB 1E9DA 3BIFA 4IW3B 1CJMA 2NPIA 5DE3A 2QPAA 2ZJZA 4M9XA 1OHHD 2IYLD 2XZLA 3OE7A 4HLQB 3F0TA 1E69A 1ZIOA 2WTUA 1QZXA 2UZIR 4FD2A 3DM9B 3TAUA 5KOYA 3U4QA 3DKVA 1M6NA 4B6FA 3P1JA 4MH0R 5L3QA 2HF9A 4P0TA 3NKVA 1AJEA 1KY3A 2C5LA 3IKJA 2OBMA 2ECKA 1UADA 5K8UA 1QDEA 2IUTA 1KAGA 2ZRJA 4ERNA 5CITA 2ZSAA 1QBKC 1S96A 3U3KA 3THWA 5E3HA 5L3SA 2PX0A 3PUWA 4HLUC 2OT3B 1MH1A 5IT5A 3GLIA 2CJWA 3OFNA 3U3RA 5JEEA 1OE0A 2XGJA 4NCHA 2QP9X 1Z07A 2R44A 2BV3A 5G3YA 2QN6A 2TMKA 4AKHA 2G1JA 1G16A 3K09A 4NU0A 3ZDQA 3AVOA 1I2MA 1EFCA 2WICA 4MYCA 4PSVA 2W6ID 2RGEA 2ZREA 1F2TA 1GTVA 3RS5A 1XEXB 4F4CA 1KZ7B 4NL4H 5FL3A 1S8FA 4ESHA 4IDQA 4BEJA 1WA5A 5F3WB 2CE2X 5C4GB 3IUYA 1UBEA 1E2MA 1U9IA 2EFHB 4YLGA 2PX3A 2X77A 3ZVMA 2FFAA 1WMSA 4Q21A 5DN6A 3D7MA 4E07A 4C0JA 1D9ZA 2VHTA 2ZYUX 3BFKA 4IOJA 1YZGA 2ZI5A 3FB4A 2Q3FA 4XTCS 1J8MF 1S9DA 5DI3A 5FTLA 1WF3A 2ZJYA 1GDDA 4Q18A 1SHKA 1FZQA 4GP6A 3IO5A 2A30A 3H1TA 4KODA 1W0KA 3DPUA 3Q3JB 4FMCF 1EWQA 2OFXA 1JEEA 4G5GA 4OKSA 3SYNA 5H8WA 4J0QA 1TUIA 2GA8A 4N0DA 1DAKA 2QE7A 1L8QA 4BUJA 2NO7A 1XCPA 5KU1A 1P6XA 3CNOA 3I72A 5HTKA 5KSZA 4PC3A 2ZRBA 2OBLA 3GPLA 2CXXA 3A1WA 4QKQA 3VHXA 2Z83A 1OFIA 3B8HA 5GJVC 4E09A 5CLQA 2ZU0C 5KSPA 2ATXA 1SXJC 1ZRHA 4Q7JB 4AKEA 3H86A 1FX0A 1YR8A 1YU9A 4DLTA 1IN6A 4KFRA 1E2EA 4RSGA 4NE2A 3C15C 3K0CC 4QGGA 1KKLA 3E5HA 1LW7A 3NBYC 4RZ2A 2QGZA 1NSFA 1E79D 2ZRMA 1AM4D 2QA5A 3FWYA 2D62A 2P6NA 4DCUA 5C46F 621PA 1MT0A 3ICEA 1E6CA 2F43B 2G88A 3SN6A 4DLWA 3KZ1E 5HCNA 1SKYB 4BE7B 4P32A 1KMQA 2CL6X 4Y0VA 4A6XA 4JVMA 4URYR 4EFLA 1KOFA 2OEPA 1GKIA 1ZUNB 1E1RD 1JJVA 3W9YA 4D0GA 1QVRA 4ZDIA 1AK2A 2CVFA 4KXFB 1LY1A 2NQ2C 4UNPA 3VR5A 3V4RA 3K0AB 3B5JA 1CTQA 1R7RA 2XNSA 1UEIA 1J70A 2NO1A 2J59A 3UPUA 2BM0A 2ZRKA 3VR2A 1EX6A 3SR0A 3FHTA 1G18A 2WVJA 1E9AA 4WAUA 4JLAA 3W6OA 4TL6A 1QF9A 2BMDA 1IOZA 3DEFA 4CW7A 1XMSA 2VH5R 2YYZA 3TSOA 4OJQA 1GZSA 2CHQA 2W2TA 4ZKEA 1G19A 3EZ2A 4YQFA 1E9EA 1QHIA 3KFVA 5BYKA 4MRRA 3VKGA 1Z29A 3MWJA 1X8LA 1A7JA 1MO4A 3P26A 4DDVA 221PA 1BMFA 4PPGA 3DL0A 3QKTA 3BB4A 4Q9HA 4C0LA 2WZQA 4YMTA 2P3SA 4JL6A 5SZIA 521PA 1JPJA 2C77A 5G3ZA 3WMEA 1E94E 2J0UB 2XZOA 2C04A 4ZI3A 4Q19A 1CU1A 4GDFA 3FHCB 6Q21A 4IXMA 4S2EA 3WHLA 1Z63A 5FOVA 1KSFX 4GOKA 2YWFA 3CNNA 1N3BA 1DG1G 1QHNA 4DIDA 2Z5FA 4KSBA 5UKDA 3LBNA 4NTZA 1M34E 1N2CE 3HPQA 1KSHA 4KBGA 2WWHA 1VG1A 2FE4A 4YDHB 3DZ8A 1QHYA 4W9MC 2V6JA 3BE4A 1D6JA 3QJYA 1JAHA 5EUMA 2PJRA 3BORA 4EPTA 4Y0AA 1KK0A 4LYJA 1YRBA 2BMJA 4XOIA 1II0A 4C0QC 4GOJA 4II7A 2RGXA 1X8JA 4ZI2A 4NCIA 2YWGA 4CT4B 3UMRA 1CR0A 3B9QA 3CRRA 3LRPA 3GLGE 3D31A 4TMTA 4DHEA 2R6FA 3RAPR 2CCGA 1OXVA 2UKDA 4ZCMA 2XITA 4RZ3A 1ZM2A 1N6OA 4OJKA 3LV8A 3BK7A 1CRPA 4GNKA 1W1WA 1VYVA 3N2IA 4DIEA 4V0MA 5GJWC 4IDNA 1GRNA 4OK6A 5P21A 2IF2A 4CVNA 1Q22A 5KHOC 1GIAA 4WZ6A 5CK5A 3I32A 5EP3A 4Q4AA 1F2TB 4MGYR 2VHUA 4PSKA 4BFSA 3WYAA 3LBIA 3FKSD 4L4UA 3UMSA 2DFKB 2BJVA 2A78A 3OEHA 1KSJA 4M1MA 4B3CA 2PBRA 3FMFA 4M1WA 5BN3A 3B1YA 3R9XA 5G53C 1WB9A 4HAZA 2GF0A 3RLFA 4URVR 2H17A 4ZDKA 1WXQA 2FSHA 3OAAA 5A4JA 2I1VB 2QPTA 4Q9IA 2JATA 1W5SA 3ECCA 1GWNA 3AGPA 4AKGA 4F4JA 3KFXA 1YJ5A 2GDJA 2AHOA 1G5PA 3BJIC 4TQ9A 4Z54A 2OSBA 4NYJR 3K0CA 1NN1A 4ZCIA 1OH5A 3A4NA 2IL1A 4M9SA 1ODFA 4BFVA 4NP6A 3RRMA 4HAUA 2VP0A 4ARZA 3KXIA 1CRQA 1KI6B 2OO7A 3NVAA 1ZM9A 2QAJA 5LDDC 2WSSA 2O8EA 3HYRA 5IK2D 2V6IA 3HP1A 4A4DA 4HAVA 5EJEA 3T1OA 4NYJQ 4OYHA 1XPUA 1SVKA 3KDSE 2ZAMA 3Q72A 1WDTA 2XTNA 4RD6A 3ZIAA 1VHLA 1TQ6A 2EYQA 3ND8A 4LSGA 4QHSA 1KDPA 3G5UA 4KAXA 3CZQA 5LD2C 4OQFA 2GK6A 3EZFA 2GZHA 1TUEA 3ZZTA 2ZJ5A 4HSEA 4V03A 3K9NA 3ONWA 1KK3A 4DSOA 4C0HA 4B48A 1NMZA 3SC3A 4PZYA 2O52A 4IOKA 1CR1A 2VEDA 4L8GA 2QAGB 3K9HA 1U9IC 4KHZA 2EVWX 3CF2A 2G83A 3CX8A 3GLIE 2F6RA 2MSDB 3BFXA 2GF9A 3AP1A 3NHBA 3RS4A 3A4MA 2QNRA 3JVVA 5B58C 2MMCA 2GXAA 4EAQA 4B3FX 2VP2A 3T35A 1KDOA 1GRRA 2I3BA 2ZUBA 3IIKA 3OESA 2QM7A 2J7PD 4D80A 1OXSC 2Q9AA 1T5IA 1W0JA 4MGKR 4EFNA 1NKTA 4JLMA 4HB0A 4E22A 1E2HA 1VCIA 2ZYWX 3L8YA 4MQBA 1I4DD 4HZUA 4M22A 4XIGS 1II9A 2G9NA 5AUPB 2QAGA 3B60A 4M8NE 2J87A 3KUDA 1Z0IA 5CYPA 1MR3F 1Y63A 1MO3A 1BKDR 3TAHA 3THOA 3IPYA 3NXSA 1NRJB 2ZETA 3JVUA 4BFTA 4B33A 3K70C 3N5CA 1E2DA 4GRAA 1DAIA 2QROA 4FIDA 2JLRA 5CIWA 3LWNA 4HUTA 2VL7A 2ZROA 2ERYA 4GOXA 1XWIA 2D7DA 4IRUB 2Z43A 4KFUA 4PPNA 1G5TA 4YONB 1FNNA 2J7KA 3A37A 2FV8A 2ONJA 2ZRLA 3PCRB 1YZQA 2HYIC 1HT1E 4ABYA 2DFLA 1K5DA 2WAXA 1N5JA 2P5TB 3I73A 2FH5B 4LUCA 1A5TA 5DSZA 3REGA 2VLIA 1JALA 2WWWA 2C99A 2NO6A 3C4JA 2W00A 3OE7D 5EXPA 1CLUA 1GKUB 2O8EB 3K9LA 3SI7A 1UFQA 2C2HA 4BGDA 1Y3AA 3E1SA 3WMFA 5KUTA 1JI0A 2CL0X 3AUYA 3DM5A 1AZTA 2QG6A 3CZPA 3BH0A 3R9WA 3WYFA 1G8PA 2QUZA 1KHTA 2Q6TA 1W47A 3UIEA 3QXXA 1L7VC 1IBRA 3QEOA 4HATA 1N25A 3REFA 2JJ2A 4M1SA 1E2PA 4LDJA 3CR7A 4QG7A 4AYWA 4EJSC 1MRNA 1OW3B 1DAHA 1ZNZA 2X2EA 3THYA 2GVDC 3UMFA 4ZV4A 2JLWA 1HE8B 1AQUA 5FOUA 1AS0A 3QPVA 2A3RA 1W36D 1A4RA 2GWHA 4MDEA 1GNRA 4A8JA 4TYWA 2E9SA 3BGWA 1EFHA 3U7HB 2W83A 1G4AE 3MJHA 3I61A 2GJKA 3K0AA 2Q9CA 1Z83A 1P60A 3UWOA 1ZW6A 2A5GA 2ORWA 4M2LA 3X1WA 3TUIC 1ZM3A 2WSMA 5KDOA 2RH5A 3BOSA 3AEZA 1JR3E 1M7HA 2DFTA 2V3CC 2VSOA 2O0JA 4U5XA 5TDHA 3NDBB 3P20A 5KSOA 1K6MA 1P9NA 5AJZA 1XX6A 1N0VC 1I4LD 4MYUA 1GP2A 3PR1A 2WWIA 3TLXA 4PAQA 1H8HA 1CULC 1DAGA 1G8FA 1P75A 1YZLA 4Q1DA 4EPWA 4KO8A 1KK2A 2IS1A 2GEDA 3FVQA 5FH9A 5E7MA 3FOZA 2R9VA 3KL4A 4QRHA 4JLJA 4K8OA 5TARA 5SZJA 5CB6A 4JBXA 3CPJB 1X1RA 1JJ7A 1T6NA 1RE0A 1TQ4A 3LX5A 1EXMA 3CRVA 1CKEA 3LLMA 4Q48A 5J4KA 2BDTA 2GRJA 4A9AA 2H8KA 3X2SA 2ODBA 2QRZA 3FMPB 3VFDA 2QAGC 4BFXA 1KSGA 3EPLA 3K9GA 4PC2A 1S3SA 3D6TB 1KI6A 2WM9B 1KI2A 1OHHA 5AWFC 5ELXA 3GJ0A 2V55B 3U5ZB 2OE2A 1DO2A 1OIVA 2JJ8A 2WJYA 3GJ7A 3WXMA 4CF7A 4B32A 1E0AA 2QBYB 4LV6A 1CR4A 1VPLA 3Q85A 3W3ZB 1UJ2A 2R62A 3GJ6A 2GK7A 3RS3A 2WOOA 1XTKA 1NF3A 2O8BB 4YMVA 5FBWB 2OCPA 1XCMA 1Z3IX 5DI9A 4HZIA 2JGNA 1X6VA 2ZEJA 2AFIE 2RHDA 2CHGA 3PVSA 3V00A 2ZS7A 4HZUB 2H5EA 1S3GA 4HB4A 4HI0E 3ZGXA 1DAMA 3DMNA 5E7JA 2HEIA 1SVOA 2B8TA 5GADl 3A36A 1T4GA 4HEJA 3BC1A 2WBLC 3IO3A 1LS1A 5GJBA 4NYMR 2HXYA 2C95A 1S4QA 1XEXA 3QBTA 3QXCA 2NG1A 2AXNA 3TVTA 2O8DA 3EARA 1Q20A 4LV8B 1B0UA 4PC6A 2WAYA 4B44A 3EW9A 3PIRA 4F38A 4OQXA 1KI3A 2ZYVX 4FCTA 3Q5DA 4WBSA 5FPKA 2R8RA 1E1QD 1T8UA 4DSUA 3X1XA 4PHTA 2DCUA 2DYKA 3RVBA 2Y8EA 1OYYA 1XMJA 1VMAA 4G3XA 3OEED 1R8SA 5L3VA 4DUGD 2ZR7A 3C8UA 4UXJA 5B57C 3GFTA 2F1JA 5EXXA 1S2MA 1X1SA 1U0LA 3GJ5A 1T0HB 3QI2A 3VHLB 4A0FA 5JSZA 1J7KA 1E4YA 3VMFA 4A1FA 2CBZA 2PT5A 4EJSB 2JAQA 1QHHB 4TMXA 1W0KD 3THYB 3GLFB 3EPHA 1SGWA 5DHAA 1R0XA 2VQSA 4FWTA 1KI1A 4KVAA 4OK3A 3IQWA 4QJ4A 1AS3A 1OXTA 2YWHA 2ZSBA 4JBYA 4R71A 3N2EA 3KXKA 3THWB 1BMFD 1KK1A 1ZCBA 2AKAB 2J46A 3A1UA 2A5JA 4G01B 4P3YA 4X8HA 3RRNA 3TR5A 3PFIA 1EG7A 1AA9A 5A0FA 3TUJC 1SZPA 3ZQ6A 4JYBA 1P73A 1AN0A 1NL3A 2IYRA 2JDID 3K53A 2WMNB 1DO0A 4KFTA 4AURA 4FN5A 2GXSA 4M1OA 2CE7A 4KU4A 1A82A 3CX7A 3QNUA 2ZRCA 4LYFA 1E2LA 3HJNA 2FPMA 3NTUA 3BWDD 1E9SA 4C3ZA 1RRFA 4NBSA 4Q7LA 2RHMA 4LJ6A 3VNUA 4LJ7A 1G6OA 1G3RA 1EGAA 1AGPA 3LFUA 1C9KA 4AYTA 2FSIA 4GMXA 4XSHA 1GL9B 1NMYA 2X1VA 2IXFA 4H1VA 2FDCA 4C0SA 3OIWA 4C2TA 1ZJ6A 4HDQB 1VG8A 1PUIA 4BRWA 2QM8A 1MRSA 1XXHB 2X2FA 3SHWA 1XD2B 2AFHE 2AL7A 4ACAA 2P6RA 3WBKA 1KKMA 4M53A 5DI3B 4F7WA 1FOEB 3W5IA 3FMIA 421PA 5KDLA 2AK3A 2X8AA 4HB3A 1JAIA 1GRQA 4DWJA 3TVDA 2RGDA 1XTJA 1CS4C 2VF7A 1G1MA 3CF0A 1KO8A 4JSYA 5J4LA 1GOTA 3ZLJA 1VTKA 1RFLA 4BWYA 5E95A 2WWFA 2CDNA 3IPXA 2WJVA 5JBQA 1NLFA 1BYUA 1W49A 3IBGA 4GZMA 4LY6A 5G40A 1MOZA 4CEHA 2MSCB 1GL6A 4MGZR 4NCKA 4R98A 2CVHA 2BCGY 3KKPA 3CLVA 1SVWA 1MO6A 3UKDA 3VTKA 2ZRHA 3IEVA 2AD1A 3NEJA 1E98A 4D0LB 2JLQA 2GNOA 3ZYCA 4HUQB 1VCMA 1FMLA 1TMKA 2A5FA 4TT3D 1N5LA 2P0EA 1YR6A 3W3AA 3QPUA 1IN5A 2H16A 4V0NA 5E7IA 4C0BA 1D2MA 4R9UC 4H1UA 1KJWA 4B73A 5TMPA 4YMSA 2QEQA 2WJHA 3CM0A 1XTIA 2G3YA 3DZDA 4D4MA 3PUVA 2FU5C 1OH7A 3NBZC 4L15A 1I4TD 1A1VA 1IM2A 2G6BA 3U61B 2HLDA 1KI4A 3FHOA 1S9HA 4PHHA 2OBNA 2WKRA 3VX4A 3R20A 2A9KA 2EWWA 4KLNA 4LV5B 2YZ2A 3S1AA 2XB2A 2QGNA 4JL5A 4NDZA 5IK2A 2Z0MA 2V54A 5CYOA 1U0HC 2IYYA 2V9PA 4V0ME 2ZJ8A 3EX7C 1FMJA 1IONA 3VR6A 4C4PA 5K8LA 1NMXA 3W34A 2XAUA 2B6HA 2CNWD 4KITB 3SEAA 4D2IA 4R2HA 1OB5A 2CMKA 1HA3A 2FZLA 4TZ0A 1NP6A 5JWRA 4Q4HB 4L5BA 3BXZA 3C7KA 2JEOA 4TMWA 2KBEA 1OT3A 3AVYA 3FMOB 1KJZA 2BJWA 4AG6A 2RMKA 2WJJA 4AWXA 1FW6A 1R5BA 3NEYA 5F9FA 1Z2AA 4TL7A 4DLZA 2DR3A 4GMDA 3VU9B 3X1ZA 3AKEA 3GFOA 2OCYC 3GJ3A 2CEAA 2ZS9A 1CJUC 1I2DA 2O0HA 1Q1QA 4RKEA 4C7OB 5HR5A 2XEXA 3AUXA 1E9CA 4B2IA 3PV0A 1W4BA 4JJZA 4PR0A 5CB8A 3U44A 2ZE7A 3HYTA 4OQMA 1Q1EA 3SYLA 4Q4JB 3Q7PA 3AKDA 3I8SA 1NJGA 1EFTA 1FUUA 1HQCA 1XPRA 1GSIA 4LC1A 2QQ0A 2D2EA 1GAJA 4LHVA 1XD8A 3ZS8A 4YXWA 1LB1B 4MUAA 3QKSB 4UJ5A 1R2QA 5FUWA 1ZINA 4KSCA 2WIBA 4AD8A 2IWHA 1ZD9A 4A0RA 2RGBA 1RJ9A 4OQLA 1P5ZB 3OAAD 3M0EA 2VO1A 4JJKA 1UDWA 1KO5A 1G3QA 5DNYB 3RRZA 3RABA 1Z28A 3LD9A 3CH4B 5FUVA 5JWHA 5CDFE 3TH5A 3OFND 2JA1A 4QL3A 2QTVB 4C30A 3WNCA 3VQTA 4U7DA 4HUQA 4QHTA 1LF0A 1GILA 4LJYA 4Q1BA 4WZAE 2XZPA 4US2R 4TWZA 1OIWA 4URXR 5HE9A 1YE8A 1JQJC 4DDWA 1XZQA 3F8TA 2ZRDA 1GFIA 3K0SA 1KJYA 4PPQA 2ZRAA 4MRNA 3GLHB 1YQTA 2W0MA 5JZVA 2YOGA 3JZMA 3EIQA 4XD7A 3NC0C 4QGAA 4ZPXA 3RHFA 3EIHA 5KYKA 3U44B 4CEIB 1QHXA 1P9WA 4TQUS 3RS0A 1W4AA 1VYTA 4WXPA 4A15A 3ZD7A 1E99A 3ZIAD 1SVLA 2NPFA 1NVXQ 4LHZA 4ARZB 3Q5EA 5J5CA 3I5XA 2J0QA 4XWKA 1LV7A 4LJ9A 1TU4A 2W0SA 3AVQA 3DKPA 3QKRB 3EASA 3KQUA 3KTAB 2F9MA 1Z5ZA 1CP2A 1TAGA 1Q12A 5BN5A 1VIYA 3DHWC 3T1VA 1YHNA 1YRAA 2PEYA 4DB2A 2J0VA 2OXRA 2A5DA 3BERA 4LGMA 1CJTC 3KB1A 5C4MA 2JLZA 1DTSA 1UM8A 2OAP1 3CR8A 2QTHA 4P33A 4WW0A 4M9QA 3K0FB 4MKGA 4B76A 4CRWB 1CEEA 1SVMA 5JRZA 3QPWA 2AKYA 5AUQA 121PA 5FOXA 4LPKA 1E9FA 3SJZA 3U6BA 2GKSA 2KI5A 5ANRB 4B75A 3L2OB 1UAAA 1ZU5A 2P65A 1E2KA 4AC9A 4DCSA 3SBEA 5AJXA 3A1VA 1E79A 4LJ8A 1H8EA 2OG2A 2ZRFA 5FBLB 1EWRA 4LOAA 1OLOA 4OI1A 3IBYA 3VKWA 1EFRA 2OCBA 4B3XA 3UATA 3IGFA 2ZR9A 1H8HD 3AVXA 1C1YA 2AXPA 3MWYW 2JLXA 1ZVQA 2IYZA 3K0EA 4QNMA 3MWLA 5JRJA 2IYVA 3QENA 2WHXA 1F60A 3IHWA 3LXXA 2QRNA 2YINC 5D3QA 3BB1A 1Q44A 1W2HA 1PLLA 2YC2C 3AVVA 1N6NA 2HT1A 1RRPA 2G1KA 2GCOA 2QP4A 4US1R 3QBVA 2O8CA 1U99A 1NBMA 4QBHA 3D8BA 2CLDX 4XWAA 3I3SR 4DCTA 3DO6A 1OV4A 4C7OA 4DUGA 3GCGA 1M7BA 4RD4A 3DOEA 2F43A 2BEKA 2OV2A 1U81A 3C16C 2HXSA 2VBCA 3CIOA 2CCKA 2IS2A 2BEJA 4DDUA 2ZI3A 1ELOA 2R2AA 5TVKA 3LX8A 1IJFA 1IAQA 3TGPA 2IS6A 1X3SA 1IN4A 2FWRA 2BVNA 2J0SA 1AQYA 4D4LA 1WRBA 2QMEA 1FP6A 4ESVA 5FI0B 2ZUCA 2JCSA 2ZJAA 4URZR 1RW4A 2J45A 1Z8FA 3KJEA 1T3SA 4URUR 3QXJA 2PLFA 2ASEA 2JDIA 2J9RA 3GLHA 2AN9A 4M0LA 4NYIQ 3BD9A 3RNLA 3SU8A 1ZD1A 2QBYA 4A0HA 4HDCA 4Q4AB 1OB2A 4AY2A 1P2TA 5H68A 4DEXA 4Q66C 5JCPA 3WBJA 1Z0FA 4KVGA 2ZM5A 1DARA 3RS7A 2PLRA 1SXJD 1XJCA 4TTRA 2IUUA 1D2EA 2FGJA 3FKQA 5EE9A 4HLDA 2J41A 3KJGA 3U3OA 3NBFA 2NO0A 4IVPA 3T12A 4BASA 5KDDA 3E70C 1NNEA 2FMXA 2W2XA 1YZTA 4Q01A 2MSEB 3PEVA 4RFSB 5J4YA 1K8RA 3OIYA 1JBKA 4B3DA 3I92A 3QEJA 4RD1A 4BLRA 2QTFA 4IJMA 2ONKA 2JIZA 1JPNA 4BFUA 1GNPA 3ZS9A 3K70B 1UBGA 4ZDJA 2V8OA 4OBEA 4F92B 3ZVNA 2FFHA 4PAOA 5FI1B 4D26A 5IF9A 3UG7A 4DLSA 4IEEA 4JLVA 1F2UA 1G291 1PLJA 1GNQA 4YDSA 5DYIA 5DGXA 4I99A 2GETA 1TPZA 1XJQA 2HJVA 3NH6A 4JLOA 4EDHA 3B6EA 4D25A 4B71A 3J81k 1FP7A 1G7RA 1E9RA 1PVOA 4MA4A 4BRUA 4TN1A 1TQDA 3OHMA 2ZRNA 1HT2E 3MAAC 4QJ3A 1LNZA 4D82A 2IYXA 4TMVA 2D74A 2AK2A 3HDTA 2F1HA 4ZIRB 1VYUA 1U0JA 3O8CA 1OH8A 1VIAA 1G4UR 3TW8B 2YWEA 3X1YA 4Q4JA 4TLAA 5EE1A 3AVTA 2EW1A 3MMPA 4BLTA 1O3YA 1R5OA 5FBRB 2R65A 5JS8A 1OFTA 2FEMA 4EFMA 721PA 4JSTA 1OIXA 2JASA 3DMDA 1P2VA 4TYQA 1GUAA 1RZ3A 3MG9A 1VECA 2ZS8A 1T3HA 5HZHA 3GLGB 4OI2A 1T8TA 4PPFA 1E2FA 3R7WB 2CL7X 1KIMA 1HEIA 5DLQC 3GFPA 2HLDD 1IN7A 1G64A 4RFVA 1N6HA 3O47A 3GEEA 5CJPA 3S1AB 4LJ5A 4X8OA 4ZIRA 3TJZA 3LA6A 4R2IA 1YZNA 3G82C 3QXSA 4EQ6B 1ZBDA 3AKYA 2Q0HA 5EZ5A 4B2PA 2BBSA 2YKGA 1VG0B 5C18A 1M1YE 1M74A 1G7SA 1DE0A 2NO9A 4W5HA 3RSLA 1XTRA 2E1RA 1R0YA 1ETUA 1TF7A 4C2UA 3KXLA 3H4MA 1OKKD 3SZRA 2ZVQX 3NH9A 1D9XA 2X19A 4DSTA 5DHFA 2NOAA 1VCOA 2OZEA 3LBHA 3CO5A 1NIPA 2B21A 2B7CA 1QHHA 1JXOA 1TQ2A 4BEBA 2GILA 1T3LA 3B85A 4G5OA 5HZKA 2GBLC 3NC1C 3AGQA 1BS1A 1ZCAA 2GCNA 4FW9A 2W2VA 1W5TA 5SZKB 5IHPA 4EPVA 1BH2A 2R6CA 3QG1A 3GMTA 4JVSB 4UNQA 2H7VA 2GAAA 2MMGA 3T5GA 3KX2A 4RZXA 4C0KA 1Z6TA 1EFUA 3EZ9A 4I1SA 4TSFA 3QY0A 1N6KA 2RGNA 4ITRC 4AK9A 1O87A 2XOKD 3CWZA 3AH8A 2Q3HA 4DJTA 4TYNA 4GI7A 2FX3A 4IDOA 4HYYA 2VSXA 3GLHE 2C96A 3EC2A 3EIEA 3QUSA 5BWMA 1S1MA 1T0JB 4LX0A 1DOAA 2J7PA 1W0JD 2EQBA 4QHYA 5DYGA 5FUYA 4I4LA 1C4OA 3ZZ0A 2YNMA 5JEDA 3VX3A 2VP6A 2ZE6A 4B3GA 5JJLA 2ZYTX 4XVQA 3W6PA 2QU8A 1UBCA 1OXXK 4DKXA 2QP3A 1DPFA 2FN4A 4Q4LA 4D4KA 5JMTA 4X8MA 3ND9A 4XH9B 2CNWA 4RY2A 3CPHA 4MITA 3SNHA 3VU9A 4D6PA 1SVSA 4Z8XA 1KMHB 3WRYC 2HV8A 2D2FA 3AF1A 3AM1A 3CNLA 2GESA 3OIVA 4M1YA 4CT5A 1P61B 3EA0A 5JFGA 1MV5A 2ZSEA 3PUYA 4NYMQ 2D7CA 4FCVA 5DH9A 2EU8A 1Z08A 1WP9A 2BBTA 4HB2A 2F9LA 3SQWA 4OI0A 1US8A 3PQCA 3AP2A 2I4IA 1R4AA 1OFHA 3FE2A 3CRQA 1G9XA 2DWQA 5TY0A 1NN0A 4CEIA 1LVGA 3SBDA 4I81A 4IEIA 4IVQA 1P72A 3HR8A 1HURA 2OXCA 4ZDWA 1Z6GA 4DRZA 5LD2B 3TQCA 1FL9A 1KO1A 2FFBA 3ETLA 4QBIA 3TSWA 3U7EB 1XFAA 2PZFA 1DVRA 5EE0A 3GLFA 4NZYA 4R7ZA 4UXHA 1CIPA 1E9BA 4XWOA 1SXJE 4YXWD 2V7QD 2VHQA 2XJ4A 1AGRA 2FZ4A 4RD0A 3GQBA 4TT3A 1XBTA 5FPSA 2RGGA 2LKDA 2W58A 1NLZA 4BPBA 2O8FA 4ACBA 3ZVLA 4M1TA 2RGCA 3I8XA 1N0WA 4A6PA 4HAYA 3FDIA 2XX3A 1XTSA 3W90A 3LQRA 1GM5A 1CBUA 4EJSA 1NY5A 3LXRA 2NZJA 1KO7A 1R0WA 1HYQA 1OYWA 1UKVY 3Q8XB 4XVRA 4BFWA 4LRWA 1HV8A 3QQ5A 4MKFA 1M7GA 2ZU6A 2QENA 2QI9C 1D8TA 4FINA 1XCGB 1QG4A 2UVQA 3HU2A 1U2RA 4DSNA 2O8DB 1E2JA 2XXAB 1A2KC 2XTZA 1AKEA 1CR2A 2XTMA 1Q1ZA 5EXTA 1EX7A 3L0SA 3TIFA 2VP9A 4XD7D 5KPDA 1H8ED 2ODEA 2R6DA 3BS4A 1XF9A 4JYCA 2F1IA 2ZXUA 1N5KA 4I1OA 4K46A 3UK6A 3UWKA 2ODNA 3RS2A 3EG5A 3HWSA 3FYHA 4OHWA 1EFRD 2ZE8A 4MRSA 2JJ1A 3UANA 2FSGA 3U60B 1Z06A 4NYIR 2W6JD 3MWKA 4G0NA 3W5JA 2F3TA 1J90A 2ZRIA 4OL0A 4F91B 2VP4A 2XSZD 4UKDA 1Q57A 2PCLA 3C14C 4AIIA 1GKYA 3SQXA 4MRPA 3UG6A 3RWOA 3U3JA 4I1UA 5BQ5A 4HDOB 2FA9A 3HPRA 4E03A 3B13B 3O8RA 1Z6XA 3QXHA 3T61A 1YVDA 2SHKA 3SJBA 1T9HA 2RGNC 1DELA 4PX9A 1LFDB 2DFNA 1HQYE 1W48A 3LDAA 2P5SA 3PXGA 1NN3A 4A92A 1H65A 4JLDA 3TMKA 1CJVC 4KJZA 5J4VA 2J1LA 2GTPA 1XTQA 4MDFA 3PENA 1G7TA 1COWD 3C41J 4DLXA 3EZ6A 4O25A 4TTQA 5LPNA 3P32A 4CEJB 1U94A 2ANBA 4NCJA 4EIWA 5K8TA 1TEVA 4JKYA 5CM9C 3WNBA 3RSOA 1VHTA 1EESA 2GJ8A 3PEYA 2K5UA 3MLEA 1ZD8A 1KY2A 2PMDA 1LTQA 3KUCA 4MYTA 1KAOA 5BN4A 2ERXA 2N1BA 1NIJA 3KKMA 4TLEA 1NVVR 3FFBA 3TSZA 4XSGA 2R6GA 2ZI6A 3P4YA 3KJHA 4B34A 4A82A 1XB2A 4MUBA 2FG5A 1ESNA 1R0ZA 3QF4B 4QFMA 4PAMA 2AD5A 4YC7A 4F4IA 3THXB 1IXRC 4CYMA 4NHOA 3K09C 2ZJ2A 3LH5A 5CK4A 2WWYA 1G20E 4O3MA 1TX4B 1F6BA 1L4UA 2HYDA 2QMUA 4BFYA 4C0AC 3AVWA 1XEWX 1AKYA 1YR7A 5FL7A 2RB4A 4A0GA 4KCGA 3BH7A 3GD7A 5L8VA 2P67A 5IDVA 2ZE5A 2EYUA 3OEEA 5FTJA 4PQFA 4CDGA 2VPPA 4BECA 1MO5A 4QNRA 3ZJYA 1BOFA 1XJ0A 1KO4A 1RPZA 4GBMA 4D0NA 2OFOA 1U98A 1ESMA 4DBLC 3VAAA 3TW4A 2LWIA 4GP7A 3GLFE 1G17A 2IWRA 5F2EA 1WQ1R 1GITA 1W4CA 4F93B 3U6KA 4P4SB 4FWIB 4K81B 1NG9A 4US0R 4LJAA 1IQPA 2Z6VA 3QKSA 1M8PA 1N6IA 2LKCA 1V43A 2YC4C 5J40A 2ODWA 4Q47A 5CIQA 4A2QA 1G21E 4B2LA 1GG2A 1E0JA 1NVVQ 1UPTA 2IYWA 1NY6A 2GZAA 1NSTA 4RCYA 1P3JA 5KSYA 5HCIA 4UJ3A 4Z1MD 1P4SA 1Z47A 4OK5A 5GVSA 2AWNA 3OF5A 2VF8A 1JQLB 3AF0A 4Z51A 5J4HA 3NHAA 3DDCA 3B9PA 3BH6A 2BCJQ 3BB3A 3CUEF 5AK0A 3B1XA 3PUZA 2HF8A 4QM7A 3H84A 3GEIA 4DB4A 1EK0A 4KBFA 2C9YA 2AWOA 5H1YA 3GJ4A 3HR7A 5EXSA 5JWOA 4EPRA 4BLQA 4DVGA 1NG1A 4XVUA 2P6UA 4RKFA 2ZRGA 1UEJA 2PZEA 3M4YA 3UXMA 4PO9A 3AF3A 2OFWA 3CF6R 1Q3TA 2GXQA 2YVUA 2BMFA 2HJGA 1TU3A 4Q7MB 1KDTA 1WBDA 4H9GA 2O8CB 2B8WA 1TADA 3EAQA 3I4LA 2REOA 3EXAA 2I1QA 3IHLA 1PLKA 1IY0A 4V0OA 4DT1A 1JR6A 2VRWA 5HPYB 5FBVB 1P2UA 2V4ZA 2ZJBA 4MYHA 3TE6A 4DDTA 2RCNA 1KI7A 2PL3A 3L0PA 4ON9A 4AYXA 1QRAA 2OAQ1 3ZQJA 2C8VA 1FFHA 2DWOA 3H2YA 4FMDF 4HLCA 2FF7A 4RJLA 2PZGA 1W4RA 4QC2A 1F48A 5LB2A 2GCPA 1WCV1 2YV5A 3C5CA 5L3RA 2GCOB 2ORVA 2IHBA 5DO9A 5FR1A 3ADKA 2R6AA 4B74A 2DBYA 1RC8A 3A6PC 4OHZA 4TYYA 4GT1A 4N3NA 1F2UB 5E4FA 2IBMA 1XMIA 3EPJA 4P4UA 3CBQA 4TYPA 1SHZA 1BIFA 2FFQA 4EPYA 1KDRA 4XJXA 4OHXA 5A5GA 2WKQA 1TEXA 1RIFA 5TXGA 1ZYUA 3CX6A 2Q3MA 2KWIA 1V5WA 2EFDB 1S1CA 2FOLA 3E2IA 3I1FA 4TLCA 4PQYA 2ZITA 5KO2A 5CM8B 1U90A 5L3QB 3LW8A 2JLUA 4DCVA 1OXUA 1US8B 5GJCA 3DVLA 2QT1A 3Q7QA 1HTWA 5B64A 4Q1CA 4GSYA 4OHYA 5KPJA 3TUZC 1XP8A 4OHVA 1R8QA 3WY9A 2GAOA 3CONA 4EUNA 1W36B 3K0FA 3AQ4A 2QSYA 3NWJA 2IEYA 2WMOB 5FTKA 4W7SA 3CH5A 5FPTA 3G0HA 3AF2A 1T91A 2XNDD 4ASUA 3NBXX 2A7QA 2JLYA 1Z0KA 4O0MA 5FUXA 5JLJA 5FPYA 4TTPA 1JB1A 4JT2A 1XRJA 2QPOA 4ILEA 1F3OA 4RCZA 2GEUA 2J3EA 1ZIPA 2BC9A 3TKLA 2IA5A 5D3MB 4M1KA 2QSZA 1Z6AA 3EA5A 2IHYA 3FFAA 4FMBB 3KTAA 3WP0A 2ZI4A 4POAA 4BZPA 1W36C 1JEDA 3AKCA 5AJYA 1PV4A 2HCBA 3QIAA 1G8YA 1Z6YA 4KI0A 2IYQA 2VA8A 5H70A 5JS7A 1HY3A 4KYIB 4FMCB 3LNCA 3OIUA 5M04A 3PJRA 1P62B 2AX4A 2ZANA 2QZ4A 4JIMA 5HE8A 3ZD6A 4LCBA 3B1ZA 4PZLA 1MABB 4U02A 1RYHA 4DC9A 2IEZA 4MKHA 4A2WA 2BBWA 2XB4A 4Q1FA 1VCNA 2OHFA 4OI4A 1KI8A 1R5NA 1TL7C 2ZI9A 4JL8A 2OUKA 1ZM7A 5BXQC 3BFVA 4EKDA 2VYFA 4PANA 5FFMA 2GXUA 4PO8A 1D5CA 4M21A 2CJWB 4PC1A 3GP8A 1UKEA 4LBYA 4QXAA 1PZNA 2QT0A 2QY9A 3MD0A 1LS6A 1FUKA 2O8BA 1E2QA 3QF7A 4LZZA 1ZUIA 3B78A 3WYGA 1JXMA 1RJ9B 3RWMB 4FMDB 1ZNYA 5FPHA 3QKRA 1ZM4A 1KGDA 5LB4A 4Q1AA 4BLPA 3K70D 1Z2CA 4NH0A 4CEJA 5F9HA 2Q21A 2ANCA 1J99A 2AR7A 1SXJB 2W6IA 2DWPA 1U8YA 1DADA 2F1RA 4O2LA 4DXAA 1HE1C 4AKIA 4HLUA 3ICQB 5FBQB 2FJUA 3T06B 3EWSA 2GJSA 1G3MA 1E2IA 3R7WA 2G0NA 4UXIA 3ZZUA 3PUXA 1W44A 1DS6A 3BAFA 3IDQA 1OKKA 1RKBA 2WJGA 5HKKD 1J2JA 2JJ1D 1MKYA 1OFUX 2CK3D 4B47A 1AS2A 1IY2A 2Z4SA 1ZC4A 2WJIA 1Z0AA 2V7QA 4KV9A 2OLJA 2GBLA 1DAEA 2YOFA 2D3WA 4Q02A 2J0UA 2BKEA 1CJKC 5FOSA 1DBSA 2VHJA 4IOLA 1G6HA 1B23P 1VDZA 4NCNA 3R9IA 5K8IA 4IFEA 5B2ZA 4BZXA 2DHRA 3U7FB 4AI6A 5JI2E 2YOHA 3ASZA 4TL8A 2VHCA 3CRMA 1NKSA 1YKSA 3FGNA 4A8JC 1JR3D 1IXSB 3RRYA 1QHGA 1P7CA 1F5NA 3L0OA 3MUFA 3TR0A 4BQSA 3TNFA 4CZ2A 2D06A 4G5RA 2C03A 2WPDA 4QJ5A 1KTVA 3MRSA 1XEWY 4L16A 2NMVA 2OLKA 3T5DA 1L4YA 2QMOA 2FPKA 1N6PA 2IF0A 5KNDA 2IS4A 5FTNA 5KTYA 1OJLA 4JVLA 1XNJA 1AZSC 2F3RA 2IUSA 4BLSA 4B6EA 3F5FA 2H57A 2KBFA 2RKOA 4DCNA 3QSYA 3HU1A 3WRXC 3TRFA 2UZ3A 2C98A 1E96A 3KJIA 4L9WA 5CDFA 4RFSA 4V02A 5JJKA 4DT1B 1ZC3A 1UDXA 2GEVA 2W6JA 2ZI7A 3B82A 2GHIA 3OZXA 4M4SA 1GVNB 4D81A 3EPKA 1ZNWA 1GL7A 2F7SA
chains in the Genus database with same CATH superfamily
3A1CA 4PN7A 1V5GA 2HDNB 3LX4A 3D8TA 4ZI7F 4A16A 3W6NA 4D9GA 4DZZA 1H6DA 3HLTA 3SWWA 2GJ9A 3FPAA 4M54A 3F3YA 1X9HA 2Q0XA 1N0UA 1O6ZA 2DHEA 2W70A 3S2UA 4TM7A 5DM70 3TZQA 2X3FA 5JS2A 3AI7A 3T7JA 4NARA 1L5VA 5LLTA 4HAWA 3QE9Y 2VSFA 4OY3A 2AA3A 3CH7A 4WA7A 3T41A 3IODA 1R6BX 1CQWA 4MUFA 3U7GA 2LRHA 2G1AA 3PA8A 3RWBA 4XAQA 2IYSA 5EZ6B 4J0CA 4TWIA 5JZ9A 1APBA 1LCIA 2RJNA 1IU9A 1REQA 3AOGA 3BZWA 3E58A 3JARA 3MCAA 5GONA 3WYBA 4HDRB 2GSWA 1ZIXA 2FR0A 1M34A 3D4IA 3G7SA 3EXIA 4TMZA 4DBVO 5C2JB 5F98A 1IHDA 3E9EA 4U5QA 3FM9A 4GOLD 1RKXA 4P98A 4K26A 1VL1A 1NUHA 2QZ9A 1JIVA 2RKBA 2JA2A 2CXQA 3IT0A 1PUJA 3KKOA 4QXPA 3O5AA 2O0KA 3AZQA 5A2GA 1YONA 3LCCA 3P9CA 3OLWA 3WLMA 5BMVF 2AC4A 3W79A 4UM9B 2Q6OA 4JB3A 4D9FA 2QVGA 5HK8A 1N5DA 2JI4A 2PKQP 4IXNA 1Z33A 1ZFNA 5IRCD 1G41A 4HDAA 3B1VA 2I9KA 1RM3A 4KKXB 1I4OA 1II8A 3AF4A 4MPTA 3UOAB 2Y92A 3Q6NA 1JLKA 3VM6A 2L42A 1M2KA 1QDLB 2PM8A 1Z5WA 1C9YA 3BICA 1VBKA 3B3AA 4Y18A 3DLTA 4AQYB 1A0OA 3QQPA 4YIKA 2QORA 5T41A 1ISGA 4RMJA 3F7MA 3UCFA 2VXOA 4D9EA 1G8KA 1NVWQ 2QV7A 3DOFA 5CXSA 1HLGA 4MA5A 4UBLA 3LHIA 5E1MA 4LBWA 5ARDA 3OG9A 4D9MA 4TMFA 2IDKA 1QQ6A 2ET6A 1L8XA 2ORIA 5F33A 3ZHRA 1S01A 4DPLA 5FI5A 4RJJA 2Q2QA 2C97A 1D2CA 1NW7A 1Z25A 3H0KA 4BNFA 2Q3CA 4NK4A 1YKFA 3AHCA 2H1LA 1YDWA 1NNLA 1YIDA 1OSNA 4UU0A 3PS9A 5FI3A 2QSUA 3V8NA 4N65A 1ZUHA 4CIDA 4EB3A 4YYZA 2I55A 4MLPA 1FTGA 4Z5XA 2J9ZB 4W1QA 2OQ2A 3KVVA 4HBGA 4QAQA 1NBME 3SZGA 3WI7A 3ZN2A 2XQJA 2B9VA 5AVXA 2OGUA 1QTRA 3OO1A 2IT1A 3SJAA 4C6HA 2NSJA 4PFSA 1SKYE 2Q7XA 4HEQA 4JUCA 1IN1A 1AK1A 4V0KA 3N0WA 1W5FA 5ITZA 3U09A 1IOLA 1SULA 2G9QA 4F2PA 4FI3C 3QF4A 3ZNPA 1CUHA 1ZMXA 3VTFA 4PZZA 3VVCA 5JI3E 2WWGA 1MGPA 3HADA 2WQ7A 4C5CA 4K9RA 4F9GA 1J5XA 1QYVA 1S7GA 2VKTA 3VOSA 3ENKA 1ZY2A 3LRTA 4KXLA 2PS3A 4TQAA 2IPOA 3D6JA 5AJWA 1O94C 1OH6A 3WGHA 3I6IA 1BX3A 3L4EA 4JLPA 1DBRA 2O5RA 1QK3A 1D1SA 5TC4A 3RTDA 3NRCA 2QLTA 5DX1A 3IJEB 4AY3A 4ZVQA 4CF3A 3M6WA 1FRVA 3G2KA 4Q3KA 2GZ3A 3WLIA 2H5LA 3FPKA 1O89A 1T9KA 5IBQA 2H1FA 2Y2VA 3F5DA 2R84A 2B20A 1Z5VA 2Z98A 1M2FA 3KLPX 3MB8A 2NSLA 4LW8A 4GEGA 1GFSA 1L4NA 1DMSA 5AVOA 2VTKA 3ZHUA 3N87A 2H4XA 4LYAA 4EG3A 4IUDS 3ZVKA 5FYDA 3I5AA 4JZKA 1QTIA 3C45A 1MT3A 1U8ZA 2CCJA 3RYFB 1XZPA 5IJZA 1Q7EA 1Q6ZA 4R4JA 3NIBA 3AVUA 5IPFA 2OMEA 2IPXA 2FPPB 4F4FA 3ZLBA 5BUCA 5EP1A 2W5UA 4A26A 3W5VA 1JNYA 1Z22A 3FWNA 3R24A 5KTSA 4PSAA 3KQNA 2ZJOA 1UJ6A 1ZXLA 3ACBA 3NNSA 3EH1A 4NJMB 3HDVA 4DLVA 3IV7A 3RDPA 4PZPA 3E8XA 5GQSA 5JH7B 1W46A 1L5OA 4FGKA 4N8DA 2G71A 3N8IA 1IK4A 1SUPA 2GZSA 2ODTX 4N3CA 5B53A 1YQGA 4NMMA 4TXNA 1YBMA 1LWOA 1JLMA 2OENG 3M6AA 3FTQA 2HUPA 1N5IA 1OILA 4BIMA 3SK0A 3CSSA 5TGDA 4WFKA 4YJFB 4ZQEA 4C43A 4C20A 1F0YA 3IERA 2G1UA 4AZVA 4E2ZA 5REQA 3NYRA 1YASA 1XTPA 2CSUA 1UP7A 3LW7A 4UDOA 2ZSFA 4X94A 1MA3A 3IDZA 4DLKA 4DJAA 1OTHA 2IXEA 4UC0A 5K3BA 3DVAB 2C5AA 3ZQ4A 5GM2A 1YIAA 2LDBA 4X6YA 4AY4A 5IJWA 1NBOA 2WTMA 1E3LA 3PEWA 2OR3A 3IILA 5JS6A 3DTTA 2CVQA 1M10A 4RIHA 5FBZA 4UFNA 1JECA 3ZTYA 1R16A 3WB9A 2C29D 2WMDA 2H7XA 2NU6A 4RCVA 5KINB 3KQHA 2G28A 1JA1A 1RSZA 1VC2A 4RENA 1DRKA 3RTGA 2VPTA 3HFSA 4MQ5A 2QN8A 3QELA 1WPQA 2IPNA 1F14A 2RKWA 3ZHVA 2MYPA 2P78A 1RS0A 4E5SA 3TCKA 3K3PA 3T1QA 4OPMA 2P5UA 2BMEA 2XNDA 2IK8A 1VXOA 4EVIA 3A05A 1O54A 4M55A 4PC7A 4U00A 3ETHA 1LI7A 2HHHB 4HAIA 5CXQA 3EIFA 4RGQA 1DKRA 1R0KA 1U2GA 7ABPA 3HABA 5K03A 1DJPA 3PYXA 1VKHA 3DB2A 3B7WA 4GBJA 1L7QA 1RRCA 2IZ6A 4LTDA 4FILA 4CCYB 1ULAA 1VG9B 5DHRA 4RM3A 4RFLA 2Z2KA 1HEYA 1Q2UA 1IPFA 2DB3A 4F3YA 2HBRA 3HVHA 2N75A 1NONA 2X4DA 1SPXA 4FONA 4LHWA 3UK2A 5CLLA 4INZA 2C4NA 1GA6A 1SBIA 5CD9A 1MMFB 4JT8A 1IZ9A 2OA0A 1Q1BA 3AO0B 5TRTA 1QG2A 3MA0A 5FX2A 5AI6A 4FCCA 3L7IA 4PZUA 4Q1VA 4BQIA 4AS2A 1KEEA 4EZEA 2HK6A 3D3QA 2NUTB 4P4LA 3N0XA 1Q11A 2AW5A 4KYUA 5ECWA 3CCFA 2ZIUB 2WSYB 3GJ8A 4NMXB 2XDWA 1KP9A 1SEVA 3M1LA 3SF0A 2HU8A 4DG5A 5A4KA 3HVIA 3UGJA 1CUXA 4DIMA 3QEBZ 2YFQA 3OZAA 4FGWA 4MO9A 3W8NA 3GLIB 4ZPJA 1UQRA 2R87A 3TJRA 4I6JA 2CMHA 3DOIA 3F74A 4KNVA 3UTDA 1TM2A 4V0LA 2RARA 4F06A 3OZEA 3USCS 3WNQA 5C3UA 5JHGB 1FTNA 4QOSA 2VJCA 1GLVA 1T2UA 2H18A 2QL7A 1RQNA 3BYZA 5JUWA 4CTNA 1TECE 1BD3A 2C78A 1R10A 2CHVA 3KFLA 3QVGB 2QZZA 4IDPA 4GVXA 2CLCX 5EQTA 1SBYA 1M6VA 3GMSA 5FB3A 1TZCA 2D00A 3I05A 5JQGF 5KNBA 1KH2A 2WPDD 1E5DA 4C76A 1WZNA 5BT9A 4E1AA 1KC3A 3MOSA 4V0QA 4YLEA 4BFZA 4CQMB 1XPOA 4W6QA 2FZKA 1PJZA 2X4IA 2DBVO 3ZBQA 5EWJA 2I5PO 3ZH2A 3ZDEA 5KVCA 1RWWA 1XZBA 3IIMA 2Q1TA 3NNDA 3O6VA 3P27A 1POXA 2ARKA 5D3MA 2VNIA 2VXCA 1QO7A 1U7TA 1CRLA 2P6PA 3LVFO 4QIHA 4AT1A 4M0EA 3WP1B 4W1SA 5B30A 4LJ4A 3GPCA 3HCRA 4WK4B 4AZTA 4UTNA 5SZHB 4YK7A 3ORFA 3ETJA 1ZAKA 1ZAYA 3PHLA 2YHUA 3GCWA 4W1RA 4JMPA 3T0IA 2JB9A 5L3SB 3AEYA 2PWYA 3CT6A 3E9DA 4UTRA 2AXQA 4AJOA 2FSFA 5IN4A 3CMMA 3L41A 3O03A 5ALIA 1KJIA 3LLUA 1OR8A 3A4TA 3DCJA 2DC1A 2E87A 2D1QA 2J85A 1DL5A 1UBMS 4OKNA 1UPAA 3RT1A 1L2TA 4FKZA 2P7HA 4Q12A 2IX3A 2JJMA 4WIAA 3DAOA 2W4MA 4QGHA 4CL2A 1U0TA 2FGKA 4IV8A 1G21B 1KNQA 4XX0B 5CVVA 4J9UE 1GR1A 1QNLA 3Q9NA 4L9RA 5A4MS 3N8HA 3BSFA 4ITUA 2REBA 3NDPA 3TEFA 3BRWD 2PGLA 1YSCA 4LG1A 5IT0A 2ZAOA 3N3BC 4NJOA 2KPOA 5AUNB 4MVJP 3BCRA 2VQDA 2WUWE 3MQ4A 3ISVA 2IYLD 2HL6A 4HHEA 4Y6RA 1Y1KE 4AM8A 1ZIOA 3PLNA 3IPCA 4WLOA 1W9MA 4PX5A 5C7YA 3MTAA 2D4AA 5JO0A 1WEKA 3DKVA 1M6NA 2QB5A 2X0KA 3NKFA 1DUVG 2I71A 3U4QA 1XZJA 3KIPA 4MKZA 4RU1A 2XY4A 4YCSA 4JIGA 3LUDA 4R6XA 3WNZA 3OX3A 2QTCA 1UADA 3P45A 1AHPA 4BTEA 5K8UA 1WCXA 4TS4A 4Z4QA 1BXRB 3DV2A 4UBKA 4MUHA 5CITA 2ZSAA 1EXWA 4EUFA 1EFKA 4ZICA 5L3SA 4WFJA 2IPLA 1HDXA 2OK8A 1YFZA 4WCFC 1MH1A 4O29A 5IT5A 3IURA 3GLIA 2CJWA 4D92A 5T4BA 2PX6A 4UW9A 3FR8A 1PV1A 2HSGA 2QN6A 3LTEA 4H7HA 1K2WA 1QLWA 2GPBA 5I7UA 3Q8MA 2TMKA 3PB3A 3AYXB 3R5JA 5AVRA 2ZJ4A 4NU0A 2I3GA 1H9CA 1U1CA 1I2MA 4MYCA 5EHXA 4QWWA 2A59A 1L5HA 1P5JA 2ZIEA 2RGEA 2XH8A 3PFHA 5B1EA 3U81A 1GPDG 1TO6A 3F78A 4WCDA 3HLYA 5FL3A 2A9QA 2OUIA 2V7UA 5I7OA 1BG6A 5F3WB 1WA5A 1K75A 3IUYA 3C7TA 3DHVA 1E4OA 1E2MA 5B1DA 3UPDA 1EDBA 3HVJA 4RYLA 2F00A 2HBYA 5JLAA 3AFNA 3OKCA 1J0AA 1F2DA 4RH0A 5DN6A 4E07A 4IZIA 1D9ZA 1M6YA 2VHTA 3UZUA 3LCJA 1YZGA 2R5WA 2ZI5A 3FB4A 4FT4A 4DNPA 1J8MF 2CF5A 2DBZA 3T3IA 2CL5A 4QPDA 1EEHA 5CVCA 1VCHA 5FTLA 1GDDA 2Q99A 4Q18A 3FETA 4ME6A 3ZE0B 3IMCA 4IX1A 2XIJA 3IO5A 2A30A 1ZGAA 4LOLA 5GV7A 3U37A 3OJXA 4GMGA 4FMCF 4KAAA 1VL5A 4MV1A 2UU9B 3SYNA 4QUIA 3ENZA 2QRMA 1UMDB 2EJBA 3IQEA 2GA8A 1PS9A 3W2TA 2Z8XA 3V1TC 4RV4A 2ECFA 1R37A 2FP4B 2IZ1A 3CHYA 4P5PA 5MFZA 5KSZA 4PC3A 5FWXB 2VHZA 3ER9A 3JXEA 3T7DA 3TBFA 1SAYA 2ZRBA 2OBLA 1XVTA 1FE8A 1GYPA 1JRLA 1AXGA 1NA5A 2OV1A 3TD9A 2ZU0C 4F85A 1ZRHA 1T13A 1CY0A 4AKEA 1SIBE 3T0GA 5LP1A 1G8AA 4KIJA 1QH9A 3GWGA 4ZK2A 4P7KA 2DKFA 5ALQA 4MV7A 5I45A 4E5MA 2P90A 2OHXA 4KXUA 4QGGA 4BMCA 3NIGB 3WDLA 3ZJVA 1XKTA 3VDQA 5CVDA 3N0TA 5JSHA 2OZPA 1V8PA 1M2WA 1NSFA 4YJ3A 3SOZA 3L0CA 3TGLA 1V25A 3EDQA 3CU5A 3T5TA 4ALJA 621PA 4QPZA 3W6ZA 3WWEA 4YCLA 5ENDA 1P4JA 1V3UA 3UK0A 5HCNA 4MO2A 4BE7B 3ZR4B 1PQPA 3CX3A 1KMQA 4RABA 1C7ZA 4JVMA 4URYR 4AJ9A 1KOFA 1KQGA 3SMQA 4Y9UA 1N34B 4YP1A 1XZFA 2VNSA 1QVRA 3K73O 4XPIA 5C8DA 1YS4A 1U7HA 4ATNA 1LY1A 4UNPA 3ETNA 2JS7A 1TCAA 4RA6A 2XNSA 3C3XA 4ITVA 3RV3A 3AJDA 2J59A 2ZRKA 1N4DA 5I8WA 1WCWA 3P2JA 4U2CA 4U63A 5JDCA 4MVJG 1P39A 2AFRA 2EG9A 3AONB 4JLAA 4MIYA 1TOAA 3UNXA 3W6OA 1T0BA 3T5PA 2WYOA 3MLBA 4TRJA 1NWCA 4X3OA 4B80A 4DY4A 2DR2A 2X23A 3SF8B 4CW7A 4BMZA 1F7UA 2B61A 1QPGA 3DTYA 3TMAA 5B7PA 1ODCA 1B43A 3VR3D 2VNKA 2D8MA 2R3SA 3GJRA 5K3AA 3T95A 3O4VA 3V3KA 2YVKA 4CMEC 4IJ6A 4PIPA 1G19A 4CIXA 2XQIA 1LBSA 4O4LA 2EDAA 4G0ZA 3QH4A 4G63A 3A06A 1ZLXA 1E9EA 3FGPA 5AKIA 5HDQA 4CG3A 2H1HA 3TNDA 1Z29A 4LMBA 4CM7A 4C08A 2V59A 4WFQA 4EYEA 1A7JA 5IM4A 3L7KA 4U6NA 3D3KA 1IUNA 4HK4A 5D7BA 4DDVA 2OV6A 1YA6A 4FP9A 4FFWA 5C1DA 4YMTA 4CMBA 1AGYA 3BB4A 4DZRA 4F4HA 1ULZA 4UFPA 4LC9A 1V8BA 2BEWB 4FE4A 4KNWA 2SECE 3TDKA 3ISJA 1RPJA 4MW5A 5G3ZA 1IWOA 3UHJA 4K8RB 5FWAA 1KAQA 2Z6UA 4ZI3A 1O5IA 1ZOOA 3OKAA 1CU1A 2RH4A 4YXWA 3LC2O 1R27A 3W9UA 5LLDA 1L8LA 3JD4A 4BLWA 2L69A 1XU9A 6Q21A 4B3RB 3S2SA 1M2OA 4IICA 3UYLA 3MJEA 4FFBA 1E4EB 4HH3C 4EM6A 1N3BA 3DAFA 1DG1G 3U3ZA 2MJLA 3KZVA 1KIAA 5JZSA 1W88A 1JN0A 3I8OA 3OJFA 1WBJB 3Q11A 1KSHA 2D0DA 5IT9A 2WWHA 4AKSA 4MQLA 3DZ8A 1UDRA 5IKPA 4ZVMA 2Q3BA 5AW3A 4W9MC 2V6JA 2X5XA 5YASA 1DIGA 5I51A 3K9FC 3NVKI 1JH9A 2IIVA 1THTA 1NBEA 3VKUA 1FVFA 2HSWA 5LU9A 3VSDA 4Y0AA 3IT1A 4LYJA 1SRRA 2E7ZA 1MQSA 3NHPA 4I19A 2BFFA 3AIMA 5DASA 3K96A 1M2EA 3OU2A 2NTVA 1U2TA 4GOJA 4HGRA 2GB4A 4G25A 3JATA 2ZBEA 2JL1A 4WASA 5IDYA 3EMKA 4LNAA 1CR0A 3LRPA 1H2RS 3Q15C 4ZOAA 2WB4A 3G9TA 5ESXA 4QUBA 3GLGE 1ID8A 4GG1A 3OZSA 1X7XA 3RAPR 3E3LA 1AXEA 3UWMA 3DLHA 4ZCMA 1Y5LA 4RZ3A 2JFWA 1KU6A 1W85B 4L8LA 3GVHA 1AHHA 2AI2A 2GX6A 1PVDA 1SK8A 2Z08A 3CRZA 4QVIA 3R5XA 3UXEA 1M2VA 1Z37A 3REQB 4BVJA 3LJKA 3PZRA 4OK6A 3TNJA 1MC8A 3UAZA 4CVNA 1L0BA 5CTJA 1GIAA 2WF7A 2B2XA 2FPIB 3AHEA 4Q4AA 3TM5A 3LP6A 2PL5A 3K2EA 3AR2A 3QX9A 1B8PA 2DFKB 3BWYA 4IH9A 2BJVA 2JFUA 1V8ZA 2QTBA 3FMFA 2BFEB 2HGZA 4DILA 1U5AA 2V45A 5DBHX 1SU8A 4KAFA 5ER6A 3D6NB 3DTVD 3R9XA 4HAZA 1P0CA 3RLFA 4URVR 3HRKA 2P0YA 4OQZA 1XQ1A 4MARA 4RY8A 3WGTA 4BTLA 4ZDKA 4RKWA 3OAAA 5A4JA 5KWIA 2I1VB 1DV2A 2QPTA 2PS9A 3RIGA 2IUFA 1Z8NA 2P2ZA 2JATA 4DIKA 2Q2OA 4F9EA 3UHAA 4YTEA 1X0XA 3R6GA 1XHEA 1UC8A 2GD1O 3ECCA 3LBAA 3PNVA 3AGPA 4NFHA 4AKGA 4H16A 2Q27A 4B17A 5JNVA 4QEDA 1YVEI 3Q87B 4K9MA 1XUOA 4UCWA 3RARA 4EJMA 4KFCA 2IVZA 2GN1A 2IL1A 4O2AA 4BFVA 4COKA 4C4XA 3F5QA 3OOWA 1XZDA 2Y66A 1JDBC 1T6BY 2VP0A 3R3WA 3H0EA 3INNA 3NYWA 4YUZA 4DREA 4KEAA 4R1LA 4KLRA 1EI9A 5IK2D 3WYDA 4LZNA 2QUIA 3JRXA 4G9EA 4HAVA 4UMVA 1YZHA 1HMYA 4ZAGA 3L4JA 4M9CA 4OYHA 2GF2A 2W6NA 1XPUA 4EATA 3SQMA 1LK0A 2XRFA 1RE1A 3IB3A 4HFMA 4NBNA 4BCCA 2EYQA 3ND8A 2P9TA 4LE1A 3S0JA 1DO8A 1V3QE 3W78A 4DV5B 5IAJA 2ZCUA 3G5UA 4IDBA 2F1KA 5KOHB 3RTCA 3DE5X 5EXDA 3NTLA 4UHKA 2YIDA 1BHSA 2EW8A 4YECA 4LOHA 3NRJA 4GWKA 2YZNA 4YV2A 6YASA 1WZCA 3R9XB 4HWPA 2ZJ5A 5K0BA 4DSOA 4DJ5X 3GLRA 4OBWA 3ZBTA 4A23A 3AIIA 2GAJA 5AI5A 3U80A 4KREA 1MF7A 2PSSA 4MIEA 3HTXA 2PWPA 3UJCA 4HT3B 4PZYA 2XQFA 5K8JB 3W9SA 4IOKA 5LUAA 2H1VA 1PZMA 1CB0A 4QU8A 4KHZA 5DXFA 3CF2A 1THGA 3N5KA 3GIDA 4GMHA 3CX8A 1Z0SA 4BLVA 5I7WA 1OYVA 2XWJI 1XSEA 4QU9A 1X3LA 3QPDA 1E77A 1MNQA 3L8GA 1L7OA 2H5JA 3ZU4A 4DQ0A 1KYWA 2GXAA 2E2WA 5B7QA 4M7WA 4YI3A 4D3ZA 4QRIA 1GGKA 1KDOA 2I3BA 1NJSA 2ATEA 3DE4X 3G9QA 4Y2TA 3GCXA 1T43A 4BB6A 2R751 1T5IA 4JX8A 5ALNA 4JGBA 3PNMA 1LLUA 4JLMA 2AI1A 3BF8A 1ZK0A 4ND5A 1L5LA 3KLBA 1UC9A 1E2HA 4MMYB 5AP9A 2YRWA 3L8YA 1VE1A 1I4DD 3ANTA 4HZUA 3UH1A 4MUXA 1W93A 2FN3A 4LWPA 5K0TA 3V4VB 4Z3DA 3B60A 4M8NE 2FEKA 5L7WA 1Z0IA 5CYPA 1P17A 3THOA 1X1BA 1YQEA 3HACA 3NXSA 2Z3VA 2Q29A 2ZETA 3EXIB 3K70C 2FUCA 4WHMA 1P4HA 2I2FA 3SIWA 4A5SA 3WYEA 1TEZA 3IRUA 4FIDA 2M6KA 2G1PA 4WWHA 4ES6A 3TOCA 3NV7A 1JDSA 3D54D 1TIKA 1UT6A 5D3KA 2ERYA 2LDXA 1BWRA 4C0XA 1EUZA 1ZMBA 3GT4A 3I4CA 2WQ6A 5JXJA 1X42A 2H48A 1PP4A 2Z43A 4UMEA 1PK8A 4AP5A 2C0QA 1FNNA 2J7KA 3IAS1 1BVRA 2O3QA 3PJEA 3WAKA 3EXFA 3UICA 5JYEA 1YR3A 2ZRLA 3QIVA 4LYEA 4DQDA 1AQLA 1XC7A 3QYFA 3D6MA 1HT1E 3CTPA 4ABYA 4MPPA 1RHUA 3M89A 3MSCA 4I55A 4ZMSA 5E9WA 1N5JA 1G98A 2BKXA 2OSVA 1PJ8A 2FH5B 4P9NA 2VLIA 1JALA 5FPHA 2C99A 1KBOA 2BTQB 2NO6A 3C4JA 1Y42X 4LISA 4WA8A 4YXFA 3PXBA 3K9LA 5J5AA 1FDRA 3E1SA 3WMFA 3FPBA 5KUTA 4L0QA 5LWQA 3CZPA 2QG6A 1L1EA 3SQNA 4B2YA 4ZTUB 1RT9A 2XUJA 3LOQA 5CBPA 3KLOA 3RC2A 3ZWQA 4EENA 3QXXA 2ONZA 4IKOA 1X1AA 5E3JA 3REFA 1SK9A 2GNAA 3CLRC 4FR5A 1I3OA 4IIUA 3CR7A 3I9NA 3N6XA 4LDPA 4D8WA 4QG7A 3QLJA 1OW3B 2KYRA 4JR0A 1ZNZA 2X2EA 4OA8A 1YQQA 2GVDC 4QYXA 3N76A 2IITA 5KBYA 2JLWA 4IWNA 1MAHA 3JD2A 2WJ4A 5FOUA 1ISPA 1OZHA 3AL2A 4DMGA 5LOVA 1A4RA 2GWHA 1GNRA 1Z0ZA 2A14A 4FTWA 2HDHA 1T2DA 1C3LA 5A5EA 4M49A 5CCBA 1G4AE 5LQRA 5CVJA 1HMPA 3ZV6A 3MS4A 2RE8A 2BGIA 3NI2A 2YBEA 2VLBA 1Z83A 1OROA 4LGYA 1ZW6A 2A5GA 1T9AA 4HNAB 5AHWA 5LYYA 1QANA 2Y0EA 5ALFA 1RJGA 3BHIA 4A0QA 2V9CA 4FNOA 3C3KA 1JR3E 3HNRA 3N39C 3L7BA 2ZWOA 2WJ6A 2PWZA 1PJLA 2QD1A 4NX2A 4XGKA 3ZIUA 2HW8A 3P20A 5KSOA 4LTNA 4BEWA 4KTTE 3T99A 3UJ6A 1U5BB 3K6JA 4Y1EA 3HXKA 1XOIA 1XX6A 4OQYA 4DDMA 1I4LD 3OCYA 4G41A 4MYUA 3TLXA 2WWIA 3T7TA 3PX2A 4PAQA 5IDWA 3RCBA 1P75A 1YZLA 4CKZA 2CF6A 4CE6A 1FJGB 2Q28A 4KO8A 4YJFA 3FF1A 4ZXFA 4WZZA 4DLPA 3SG0A 4EPWA 1GQQA 4EHNA 5L6LB 3FVQA 4WH0A 3FOZA 3ITKA 1EUYA 2R9VA 1NJ2A 2AJBA 3KL4A 4JLJA 3KQWA 2EXXA 1OBFO 4K8OA 2O3TA 3G8DA 4R2MA 3NGXA 5EZQA 4JBXA 1X1RA 3GNSA 3PPIA 4GECA 4WOCA 2X8JB 2W2KB 2PKXA 2YXLA 3LX5A 1CKEA 4R6WA 1WETA 2GRJA 2HSZA 3V9AA 3LPLA 3V7UA 2H8KA 4KR3A 4PICA 3X2SA 4YPOA 2EZ8A 4QOEA 2ERCA 2JVIA 3P2EA 1GQRA 1LBTA 3B70A 1DKQA 1NATA 3ML1A 2NU6B 3OZUA 1K5PA 4Q3DA 1LLQA 4WZBB 3EPLA 1T9CA 4JJAA 4UZFA 4AN0A 1SG0A 1KI6A 4DQKA 2WM9B 4FM9A 1OHHA 1WSWA 3CZ5A 3QVOA 2V55B 1ZR2A 5C8YB 3U5ZB 1NV9A 1UP6A 3QX7A 1DO2A 3H2ZA 2JJ8A 4NHEA 5CUQA 4YRCA 1BDMA 1P2FA 3WXMA 4B32A 3U1BA 5T8KA 4AS1A 5E9AA 2BLNA 3W3ZB 3EQZA 2R62A 2VPYA 4II2A 3S68A 5BSFA 2GK7A 2HBZA 1J1IA 2V3WA 1NF3A 2XQGA 1I1NA 3H9EO 1CY6A 4BDSA 4DYVA 1CFZA 2EBFX 2JGNA 1CUIA 1FPQA 1XDSA 2EGGA 4GC9A 3AJ8A 3HY3A 3PXCX 4YR7A 5F3RA 1S3GA 3A6ZA 3KZCA 5EMKA 1C80A 3OBBA 4MI9A 1CY4A 1DAMA 4FDLA 2AQIA 2Q3LA 3TLYA 2HEIA 1VP9A 4LAFA 4G0QA 4TROA 1FB5A 1LS1A 2CUKA 2JAPA 4WJKB 5KTMA 1U9YA 1R9MA 2HXYA 1S4QA 1D1TA 3QBTA 3QGMA 4NOLA 5I7FA 2O8DA 3GPDG 3KTDA 1SBCA 3GJTA 3EARA 2C8KA 4J0JA 5EYPB 2W2KA 3H65A 3SEFA 4C6TB 3FOWA 2BEVB 4ZJUA 1MZVA 3ILSA 3Q5DA 3VR2D 2ZWIA 4IZOA 2VUHB 3MXOA 2ADFA 3BE5A 5H81A 4DSUA 1UR5A 3H5VA 2XEDA 4RHTA 4FU0A 1EVIA 3L6BA 3CQ9A 4HQNA 1VMAA 1R8SA 4L5YA 1LFAA 4R81A 4EW6A 3MGBA 1JHMA 3UUEA 1YJXA 2O48X 3CRNA 1Y4SA 3L6CA 1DEAA 4JUAA 3DTNA 5CBKA 4F4DA 3GFGA 3AUJB 4FHCA 1T0HB 3BD6A 3U7QA 5GONF 2UDPA 3ZTWA 4E5PA 4EOGA 3VMFA 1TYDE 2OORA 1WMDA 2AV6A 1DBWA 2VYNA 3ESXA 3NHZA 4YRLA 2IDZA 3L7NA 2DLDA 2YH2A 1WXIA 2TMGA 3H5NA 1UBSB 3NANA 1F12A 1N8NA 4Q37A 5I6DA 3GLFB 4D79A 5ERXA 3IV9A 3OZGA 4TXJA 2OD2A 1KEPA 3DFUA 3NOVA 1XNRB 1G8MA 2W6ZA 1DOHA 1AS3A 3IQWA 4IIDA 4QJ4A 5D87A 5DYNA 3N2EA 3H1AA 3KXKA 4R71A 5LMCA 3GGDA 1KK1A 2J46A 2OB1A 4J16C 2AC2A 2A5JA 3TR5A 3C7CB 1U6JA 4F45A 5K09A 3F6SA 4DOMA 1ZL0A 4ALLA 4XKJA 2DJ5A 3OFJA 3S2ZA 3TIXB 3FR7A 1KZ1A 3BRSA 3EVEA 1JQ5A 4GI1A 2O2ZA 2BFBA 3DVSX 4JYBA 2GASA 1C14A 1XU7A 1K98A 2P68A 4NV0A 1L5ZA 4W6ZA 2JDID 3K53A 4OP3A 3IP6A 4CFSA 1B2LA 4JYAB 3C1OA 1G20A 1H23A 4E6EA 2XUGA 3BMOA 3C8HA 4JI6B 3IKLA 2WILA 4C6TA 3NTUA 4YLYA 1SCKA 2FPMA 3ASVA 2UVPA 3KR1A 4W4TA 2P79A 1PWXA 2OC9A 3KT3A 1E9SA 2XDAA 2JAXA 3A27A 3D6UA 3MJFA 1P33A 2VDNB 1G6OA 1K6JA 1EGAA 3OM8A 2P35A 2R66A 4L75A 4LJ7A 4LMAA 5CG2A 1CEQA 4IV0A 1TD1A 1GL9B 2YFHA 4OEHA 1NDUA 3SP1A 4DM3A 2YMPA 1XG5A 4JUFA 2FDCA 4J2HA 4GAEA 2CC2A 3JYNA 3R44A 4HDQB 3H87A 2VRCD 3P0IA 1N3YA 4GLOA 1JA0A 2QM8A 1KMIY 2PTGA 3CO0S 1UJNA 2AFHE 1ZD4A 4RPHA 4ACAA 8ATCA 1T15A 3H2KA 2DTDA 4AF7A 2P6RA 3T3OA 4DIUA 1YCGA 1T4CB 3VTAA 3TD2A 3ETEA 1P44A 2IJGX 2E4AA 4HS4A 4P58A 2W2MA 2AK3A 2X8AA 1E63A 1U4NA 4IJQA 1ZH6A 1B8NA 3ESBA 4HB3A 1CF4A 3KKEA 4HRXA 3LCRA 2WWVD 3L7CA 4KQFA 1PRYA 1XTJA 1H9BA 1Q19A 4S1OA 5C4IA 2R68A 1GXSB 4HWOA 1G1MA 3A0RB 4UBNA 5ETJA 4JSYA 1NV8A 2VH1A 2IHKA 3O4GA 4CPDA 3ZWCA 4P8RA 4J7XA 5CT8A 5IZCA 2CDNA 3WKEA 4WSOA 4D9BA 2IU3A 4LY6A 5G40A 2C2WA 3IBGA 1V41E 4GZMA 1GL6A 5B6JA 1H2AS 1ZD2P 7YASA 3TLEA 5AVWA 5JJCA 2C1XA 2WC1A 3CA8A 4M0DA 3OCZA 2JI9A 1QU3A 3IPRA 3IEVA 2ZRHA 3NEJA 4LDNA 4NY1A 2D1FA 2ZB7A 2E89A 1AXRA 3ZYCA 4AECA 2UUAB 1NTOA 1TMKA 1VCMA 2A5FA 1JT2A 4DWVA 3DNMA 3GB9A 4YV1A 4OSEA 4S04A 3M4ZA 4DLBA 1I14A 4ZODA 4C01A 4LFCB 4J1NA 3QPUA 3U7QB 2P9FA 3NWEA 5ALPA 2H16A 2J31A 2W6QA 2XCQA 4MB2A 4N7BA 4QOIA 1VBFA 3G2QA 2O7NA 4OKIA 3Q1KA 5BN4B 5F2OA 5JNWA 1L4LA 2L18A 1PFUA 3JD1A 3P0RA 1XN4A 3PUVA 1ZQ1A 4G89A 1H2EA 2OD7A 1IJKA 3DCIA 1V16B 1RTTA 5KI6A 2G7MC 4ALKA 2VPWA 1M2JA 2Q5OA 2ZSJA 2WKRA 3R20A 4E2FA 4PVCA 3ESDA 1U0GA 4LV5B 2YZ2A 2XB2A 2NUTA 4CKEA 4GRDA 1DUSA 3F6PA 5C7OO 1V4BA 3OCCA 3T4PA 1NRXA 1I0IA 1T5DX 2NT4A 3DW1X 3UAOA 3EX7C 2YQZA 5B3AA 1MTOA 3A1DA 2C9ZA 4LMRA 3W5SA 4D8VA 3WGKA 4YACA 3HO6A 1NMXA 5KOJB 3F2VA 4B5KA 3C1TA 5AKLA 4L51A 3IEKA 3SEAA 5THKA 3GOHA 2FCRA 1JL3A 4N5IX 3WMRA 4I9FA 3IUEA 4D56A 4BU1A 1OB5A 2GA9A 2FZLA 3GDGA 3QMVA 4E1VA 4X92A 2C2ZA 3DV9A 1BTOA 3D4PA 4L5BA 3BXZA 1EVKA 4RM2A 3JZIA 4TMWA 1NJ8A 3BWMA 4I4TB 2PGIA 4KTVE 2BJWA 3AUKA 1IE3A 4RIEA 3ZOZA 1GPYA 4AG6A 5C5EA 4CLRA 2V98A 1FW6A 5F9FA 3MQFA 3RVMA 2C7PA 4K88A 4DR4B 2JGEA 2J3HA 2YY7A 1NASA 2DR3A 1NKVA 2EATA 1JQEA 3GJ3A 2H63A 1VPVA 1M5UA 3I6BA 3VPAA 2ORYA 1LDGA 2OMKA 2O0HA 4RKEA 1ZL2A 3ABRB 3QOYA 1VA4A 3CKYA 1E9CA 1DMRA 1JAZA 4WLEA 3AW8A 5ALXA 4G65A 2B6NA 1C3JA 1JQ3A 1DSSG 1I8TA 1Q0LA 2Q1UA 4JJZA 1OVGA 1Q1EA 3DDOA 4OQMA 1FX1A 2OCKA 1YDHA 4KRYA 1YUBA 3SLKA 4EUKA 1EFTA 1FUUA 1WTAA 3G1TA 5K6TA 2J9GA 5E6SA 3CEHA 4EFKA 2J5QA 4C3OB 2QQ0A 3UB3A 2D2EA 2XV1A 1GR0A 3K1TA 4G2TA 2XXBA 3DXXA 4OQ4A 4K40A 4XWTA 5FUWA 4KSCA 1SXHA 4LMPA 4IPTA 1XLUA 4MS4B 1J6UA 1ZI8A 4R1NA 5LUBA 2RGBA 1RJ9A 4R41A 1SD5A 3VBCA 2VBFA 1P5ZB 4W7IA 4ZT2A 1QGDA 4KR7A 1LUAA 5HBRA 1RWPA 4JOQA 2CW5A 2ZJ6A 3WIVA 4L50A 4X84A 4ZAZA 1VJGA 4UBJA 3RRZA 5ADHA 2FG6C 3LD9A 3CH4B 4M99A 2IHUA 3U13A 3TH5A 5CDFE 3EVDA 2IU6A 5G02A 2P30A 2QTVB 1SPBS 2DLNA 1V7CA 3BWBA 1TZMA 4JY7A 4KXVA 3WNCA 1DP4A 2Q4TA 4INJA 2YWXA 4MV8A 1GILA 3DA8A 3NBKA 1WQ3A 2V7EA 3FSGA 3E5RA 3NBUA 3NPMA 1BN6A 2ASVA 3QMMA 4IS2A 1T6YA 2EV9A 4URXR 4Q3EA 1XZQA 4MJ3A 2A7XA 3F8TA 4HXYA 2ZJFA 4BV2A 4L4YA 1YJAA 4MRNA 3GLHB 3WBBA 1YQTA 1NVTA 2FQWA 2V6FA 3QWHA 3ROGA 4KPUA 4EKEA 4TSKA 3NC0C 4QGAA 5B2FA 2OXFA 3QU9A 1QHXA 4K6CA 4TQUS 5DBGA 3HKCA 4ND8A 3KQTA 4HPWA 5LZ8A 3I2KA 4AJLA 4QUGA 5JXWA 3ZD7A 1U0FA 2OBYA 2FPPA 1SVLA 2P5YA 3CLUC 2WA1A 3THSA 1GDTA 1ZG3A 3HB5X 3Q3IA 4HGOA 5J5CA 4D74A 3UA3A 5DW3A 1W94A 1HF3A 3C43A 3AR7A 3UFXA 4YREA 4F5WA 2ZULA 3AVQA 3SEQA 3EASA 2R6ZA 3DC7A 3ND6A 4AI6A 1DFIA