2VPIA

Human gmp synthetase - glutaminase domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
196
structure length
187
Chain Sequence
MEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Gmp Synthetase - Glutaminase Domain
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords GMP SYNTHASE
total genus 52
structure length 187
sequence length 196
chains with identical sequence B
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vpiA00
3PQ6A 5SY6A 4BFLA 3NONA 4R7GA 2NV0A 1OX6A 4GE3A 4LGYA 4B2YA 3NOQA 4P5PA 1QDLB 4Y1RA 3UGJA 1PDVA 1R9GA 3MGKA 1I1QB 3NOVA 5JZMA 4K2HA 4WXYB 1G2IA 3NOOA 3SF8A 1BXRB 4N12A 2RK4A 1IZZA 2ZUVA 3KKLA 1P80A 4B40A 1T3TA 5LIRA 3UJNA 1QF7A 3PQ2A 4ENUA 2VXOA 4PXYA 2GHRA 1ONSA 1P5FA 4ZDIA 1CS0B 1OY1A 3CYFA 3L18A 3P9PA 2LXNA 1GGFA 2ZUWA 4HCJA 5BV2P 1CE8B 4Y1FA 2OR3A 4OGFA 3WFZA 4L78A 3TTXA 4AUMA 4ENWA 4P34A 4MTCA 3OT1B 3VU3A 3TTVA 1KWGA 4RKYA 3CZAA 1C30B 3SF8B 4UOQA 1S1MA 1CF9A 3CZ9A 4L95C 1OX5A 3CNEA 3ZJ4A 1N57A 3EFEA 3TTYA 1IZYA 3PQ8A 2V4UA 2VPIA 4E5VA 4ENQA 3F71A 1GPWB 4AJ9A 4ENTA 2RK6A 1OX4B 3R76A 1VHQA 3D54D 1VCMA 3F5DA 1JDBC 2ISSD 3M3PA 4Y1EA 2H2WA 2ZUTA 4B5KA 5JZOA 4AUEA 2YWDA 3N7TA 3TTSA 3NORA 1FYEA 4AUNA 2YWBA 1GPMA 2VDJA 3PQ7A 4L8YA 1FY2A 1T36B 4N0MA 4Y1RB 3MIIA 1QVZA 3ZR4B 4I2NA 1GGJA 3FIJA 3P9SA 3L7NA 3R75A 2R1VA 2WJZB 1WL8A 4P36A 2VKTA 1KEEB 4I46A 1O1YA 3UMMA 3EZGA 5K4AA 3B38A 3P9QA 4P2GA 3TQIA 1KWKA 4OFWA 3P9RA 1QVVA 3UOWA 1C3OB 4B31A 1M6VB 4Y1GA 2YWJA 4L7QA 1Q2UA 1P7ZA 2ABWA 4RKWA 4ENPA 3EJ6A 5SY4A 1OI4A 1IPHA 2IUFA 1T0BA 4OQ4A 4ADSG 4OJYA 3GRAA 4ENRA 1J42A 2A9VA 1PDWA 3L3BA 1PV2A 1QVWA 2NV2B 3B3AA 4QYXA 4LRUA 1P7YA 5IP5A 4UNIA 1QWSA 1SOAA 1GGHA 4JQSA 1K9VF 4MNTA 3L4EA 2R1TB 2W7TA 1VCOA 1KA9H 3PQ4A 2ZUSA 4Y0NA 4BTEA 1SY7A 1A9XB 2D7JA 3NVAA 4AULA 3TTTA 1PE0A 3SOZA 4UOZA 2AD5A 2VRNA 4GE0A 1GGKA 3BWEA 4OIFA 3ER6A 1GGEA 1JVNA 4OGGA 2YWCA 1UCFA 3UK7A 3EWNA 4S0ZA 1I7SB 4ENVA 4QYTA 4BIMA 5SY9A 2R1VB 2GK3A 2ZUUA 4MGHA 4D1YA 1L9XA 4E08A 4ZDKA 3ZJ5A 3PQ3A 5E9AA 3R74A 3PQ5A 4I4NA 4L8WB 4ZDJA 3RHTA 4ZGGA 1KXJA 1GG9A 2R1TA 4B7AA 2FEXA 1Q7RA 1U9CA 2AB0A 3B36A 3CY6A 3TTWA 2R1UA 2XF2A 3FSEA 4P35A 1P81A 4UCFA 1VCNA 3EN0A 4L8FA 4XLLA 4UZSA 5SYAA 3TTUA 1I7QB 3BHNA 5DFAA 4WINA 4ENSA 3OT1A 4GUDA 2RK3A 1OX4A
chains in the Genus database with same CATH superfamily
3VBEA 4LOIA 2VNKA 3GMDA 4M86A 1ULTA 1XXHB 2W43A 1K66A 2RDMA 4O1HA 4B6GA 1UJBA 2D1TA 4G5QA 5A3JA 3N0TA 5JD4A 3IOMA 2ORYA 1YKGA 4DEVA 1N5KA 5JS6A 1FC0A 2V9CA 4OYYA 1AD2A 3R40A 3T3NA 4B32A 4CKEB 3ZQKA 3ASUA 4KGZA 1FVXA 2PRYA 1AMNA 1YOVB 2Z6QA 2O8BA 4WHMA 1G8GA 1P2DA 2Q50A 3BL5A 3N07A 1YIDA 3MT8A 3O7MA 2OXIA 5A1JA 1UBHS 3WIUA 1UADA 1O9GA 2EZUA 2Q4EA 3NNSA 6LDHA 1ESCA 4ZXPA 4YX9A 1C1XB 4QUGA 2GDJA 4I1PA 1J23A 1YJ8A 3IURA 5GONA 1II8A 1H1TA 5ALNA 4DLKA 2DEUA 2AJDA 2OZLA 4XGQA 1U8XX 1K86A 1DAIA 1XD2A 2PPVA 3MWGA 5FCDA 1EM8B 4LJKA 1NVUQ 3K09A 4TLCA 2ADFA 3ZS8A 5CEFA 1Y6JA 4C4TA 2NTJA 3VO8A 1GNTA 3CZ9A 3H1PA 4L95C 4HUTA 2R4UA 3N9IA 4QBKA 4RADA 5KTTA 3UW1A 4EG6A 1M34A 2VRWA 3OAAA 1BAPA 7REQA 3UV6A 3U80A 1KAHA 5IABA 4HKTA 4BQIA 3KLMX 4W5HA 1JWAB 2XVYA 3TRIA 2JBAA 3NHRA 2WKRA 3ELUA 4LZJA 4OQFA 2FVYA 2XAUA 4YJGB 5AKJA 2OSBA 3HPRA 2Q6KA 4Q4LA 3OZSA 2IDZA 5JC1A 2GAJA 2FZEA 2CJYA 3OOYA 2XI4A 2AWNA 1RC0A 1M1YA 2AN9A 4Z7JA 3CLVA 1UC4B 1ZLYA 3LK7A 1NUQA 1SVOA 3NTUA 3FNGA 4MW1A 4D82A 4DCOA 3DOJA 1LK5A 3KYBA 1YE3A 3RYHB 1N6PA 5AXBA 4D9FA 3KSAC 3U7RA 1M2WA 3TXYA 3EZ9A 3SFZA 3DDCA 2JH9A 3V2UA 1QYVA 4G0PA 1Q7EA 3VDMA 2CNWD 4CFYA 2H1VA 2HGZA 1N5OX 4BJ1A 1E62A 3C6XA 4EFNA 3IAM6 3TMKA 2P6UA 3EWSA 2WZQA 4RJTA 4MYSA 1Z6XA 4NE2A 1HC7A 4KL8S 3WBFA 4LX8A 2HMTA 3LRTA 1LCIA 2B25A 4O59O 1JFTA 5LB2A 1HPLA 1O6ZA 3P9ZA 4ZI5A 5LLSA 1SG9A 1D9ZA 3D9QX 2IS4A 2HSGA 1GGHA 3PNQA 2QNIA 2QXTA 1CRLA 4BWYA 1KVRA 2H9IA 5CW2A 2NG1A 4L74A 1V45E 2XITA 1JAHA 2MT9A 3H4VA 4Q1CA 4QXMA 1GV0A 1SHZA 3HRKA 3MAGA 4CLHA 1BU8A 4C14A 5JUWA 2C78A 1FLAA 3G59A 1DBIA 3OIUA 4JR0A 2J9FB 3O9MA 1Y8RA 2FCAA 3PWKA 1FK8A 1ZK1A 2ZB4A 1XLWA 4FOOA 4RY2A 1SQGA 3JVDA 4NCXA 4E1AA 4ZK2A 4MLPA 3EPHA 1PTJA 2FMXA 3FFTA 2P0EA 2QX9A 3SHTA 3UXHA 2ZQZA 3E9MA 4HYTA 1IIBA 5BYAA 2BTOA 3G5AA 4LEIA 2VO1A 4RVOA 3WOVA 4L9AA 5TLSA 1YJXA 3VFDA 1IN1A 1OFIA 3WJ1A 4MW6A 1GG2A 3JVVA 3WK4A 1WNTA 4MMYB 2E85A 4P4TA 4ESOA 1HDOA 1R6XA 3WGZA 4PYIA 4B3JA 4FEEA 3CR8A 3RSCA 3QI2A 4NE9A 3O8NA 2X6QA 4KXYA 2A9OA 1MT0A 3E0QA 3GG9A 3IJRA 3RVOA 2RAUA 3BK2A 1SA0A 4NYMQ 3VH4A 5G3ZA 1KMHB 4XOUA 1ZAKA 1GN9A 3LX4A 4LMPA 4BL5A 4C0BA 3OQNA 1JDZA 2DHCA 2W2OA 5DWQA 3FA2A 4YRJA 3ADBA 2NO7A 1ODKA 1M2HA 1J7JA 5TS2A 4P0PB 2RJ3A 4M0UA 4BJ5A 3IEIA 2K7FA 2FZ4A 4Q1EA 1XNHA 3Q15C 1KAEA 3WRXA 1WUKS 4OUKX 1XQVA 3GEMA 1D7OA 4EVIA 3L7JA 1GGMA 4ITRC 3VU9A 1HFJA 2VDOB 3FYUB 2VYVD 3H19A 1LNQA 1J20A 4B6EA 2IV3A 4B6PA 1P31A 2NU7B 1GEGA 3QY9A 4RFSB 1E3TA 1HOTA 4NDNE 4GPEA 4NABA 4UNPA 4QARA 3UYKA 4CHTA 1ISPA 1J21A 2QJTA 4XJVA 3BG5A 1DL5A 1OZHA 1R4MB 3F0TA 5H68A 4C2BA 1P60A 1UBNA 4Y6PA 3DZJA 1Q1AA 2FSHA 4ESHA 4ANFA 3QW2A 1W581 2IEBA 1J2UA 2P30A 4OSPA 2ZWMA 4I6EA 1Q7TA 3C5HA 2XGSA 4L0CA 5BVGB 5DN6D 4IIYA 3HXPA 5J4HA 1LY1A 4G5YA 4PU0A 3EARA 1CIVA 3R7WA 3UJ8A 1Q2XA 2QD4A 2GLTA 5BUSA 4FE3A 2P4SA 3QLUC 2WUFA 1IY0A 2NU6B 5HYVA 4HGNA 4TKLA 4LXYA 3GJ3A 1FSGA 3GH1A 1PHPA 2C57A 1EVZA 1QYXA 1XL1A 2OGSA 3WYEA 1XF1A 4BEVA 3NAQA 5FIUA 1PL8A 4NS1A 2OK8A 2H17A 3D3KA 3FCYA 2RFLA 3D2AA 3IVRA 2IYEA 4JJ8A 4RVUA 5GV8A 4F2HA 2V74B 1KQGA 3VJRA 2VS1A 1Y7LA 2ZYDA 4UMVA 2NTEA 3EEQA 4BZQA 5JY1A 3ZD7A 4RK6A 5HIJA 3WSVA 4LRXA 2ERCA 2QRQA 1CTQA 3OF3A 1YQGA 3B20A 2WJHA 2JZCA 1ZW6A 2X0IA 5FLEX 1NPTO 1LBQA 1C9EA 2QB5A 1RTTA 1N2XA 3PA6A 4P7BA 1XZGA 5E1DA 4DSAA 3ELWA 1OFUA 2CHQA 3I2KA 4DSZA 1FMLA 3DXXA 1V4NA 3ILSA 3JWIA 1KR5A 3MSCA 4KO8A 2HCFA 2HA4A 2QLMA 4CUKA 3DBIA 3PEFA 3K32A 1R2QA 3N87A 1RDFA 2HA6A 4YBRA 5EHXA 3WL4A 1DBVO 1R8YA 4O4JA 3K1AB 4UM5A 2UYQA 4D8TA 1VPVA 3CLSD 4Q7KA 5LUAA 1ZOIA 4RGBA 5A0FA 3VO9A 3JD2A 5I5EA 2XYGA 2C9OA 4J0DA 3RTGA 2GVNA 3N8HA 4H7FA 5K0TA 4AQ7A 2IXEA 1LZLA 2WWXA 3EG5A 1TTTA 3AU8A 2C96A 4CMKA 2W6CX 3EQ9A 5DCUA 2IODA 1LSUA 1NBWB 2X8WA 1K7YA 4PNZA 2R8XA 5IFKA 1RYDA 4W9NC 1Z4MA 1RM5A 4XCQA 3U1BA 1DZIA 1YCGA 4CUJA 5CEJA 3S70A 1EBFA 3PGKA 4B7AA 4QBIA 1QK5A 2LE0A 1L5HB 1LTQA 2YRFA 2Z5FA 3ILXA 1JLLB 5B4UA 3D6VA 4H0CA 9GPBA 1KTIA 1I7QB 2BGLA 4XIFA 3ZW9A 4ZTUB 1EUZA 5HS4A 4DZTA 1FRQA 1GLGA 5IFLA 1YVPA 4Q9LA 1ZVVA 2WIFA 5HK8A 4IRXA 1WMDA 1NKSA 4IIBA 3S5UA 3MJEA 4WECA 4FSHA 1FF9A 3COPA 1YIOA 5I9BA 1R0SA 3DE0X 2V6GA 3PJEA 5A4DA 2G1PA 1PT5A 3MUOA 5KYVA 3L4SO 4ZFNA 1G2IA 1VPWA 3ND9A 3L7CA 1ODJA 1YRYE 4IZ6A 3UUEA 2FPPA 3VR6A 4DV6B 5IN5A 3BFJA 4Q47A 2W11A 4N6OA 4RQTA 1XEXB 5H83A 2CVHA 1POXA 2FP4A 4HJXA 3SBEA 5E4YA 3FSGD 3A28A 4P84A 3SYRA 4GRIA 2O8BB 1WPRA 4EGQA 4TKUB 4G3XA 4C76A 1XSEA 3PEWA 4E33A 3KJNA 1RHUA 1A2KC 1G41A 3LZDA 4KEAA 1PT8A 2ZBUA 4L3VA 2P2GA 3W8FA 2VJMA 4DJJA 4MP3A 4UUNA 5KJEA 1QO0D 4DIEA 3TW6A 2B4TO 3LYAA 3M6XA 1KZHA 2P35A 3ZIAD 5KUTA 4MO2A 3ZKWB 5KTRA 1CFZA 3QQPA 5ESDA 4CEIA 1P6XA 2KBFA 3ACBA 3MFYA 3I5MA 4YUAA 2ZDGA 3IV9A 1RP7A 4O2AB 5COBA 5SICE 3VR4D 5LQSA 2XDQB 4AU1A 1E3DA 3T41A 4ZV9A 3ILYA 4OQDA 5HBGA 1Z29A 3AOEA 2PQ2A 4FX5A 4E5YA 3FZYA 1S3IA 2H4HA 5IMSA 2ZIGA 2ZWOA 2BHNA 3EFHA 1T3GA 3C4VA 4M1QA 1GZSA 1KS2A 1U8EA 2OOSA 4J0FA 4CIYA 3E9NA 1D07A 2E82A 4JYCA 4PYRA 5EJAA 4B2IA 1A4IA 4G23A 1MTOA 2YBDA 1D2GA 3A04A 5JS2A 1FUKA 4XVUA 1GZDA 2WHEA 3X3HA 3PYMA 4PYNA 3DL0A 1Y7HA 5HQ3B 1VG0B 2V8OA 2XPCA 2AC7A 4PGFA 1GLVA 1NMXA 1Z0DA 2ZROA 4XB2A 2X0EA 1WCYA 4HRXA 4EGJA 5DZSA 4YCMA 1OLUB 3L82B 5E6SA 5BVGA 1HYBA 1T8PA 4QOHA 1T0UA 3RWBA 2X4GA 1TVKB 4PYJA 1NWHA 1Z33A 2BEKA 3DBVO 3HY6A 3QKSA 4PZEA 3EVFA 3U4CA 4DNOA 1P0FA 1T0PA 4KQXA 3CSUA 4MWZA 3KJGA 4IX1A 4B4VA 5ITWA 1YBHA 3SDZA 1DMRA 2VIIA 3DFIA 5E3HA 2O7QA 3IXLA 4BX2A 1G5QA 1SC9A 3JSXA 3EXFB 4MKIA 5CTAA 3WMGA 3QELA 3ZH2A 1MH9A 2EBWA 3IHWA 3U17A 3WNZA 3ZDQA 1UEIA 4CMJA 2FOXA 1IYZA 2KM1A 4DRXA 2MYTA 1B1CA 3P2JA 4DA8A 2VRNA 4PVDA 4P4GA 3A37A 3NAMA 4I9GA 4P81A 2C5AA 2DQSA 3HFRA 2CL7X 4L8VA 1Y33E 4D99A 5MDHA 4V3CA 3MOSA 4JEUA 1QF9A 1G20B 5J58A 2AMLA 2GXQA 2OP0A 4MWCA 3PRJA 4UEJA 4BNXA 2R5NA 3R74A 3CRW1 1NQOA 4R2MA 1H1LB 2FQXA 1L5LA 3SLRA 1FFXB 3WL5A 3LDAA 1L5HA 1XELA 3MPUA 4XLLA 3KXIA 2WJIA 1W36B 2G63A 4ZT4A 1AT1A 1DEKA 2H2GA 1R0YA 4BGIA 3PT5A 3OURA 3PRHA 4XRRA 3TIGA 4QIHA 4TQUS 6NULA 2ACWA 3R77A 1T10A 4C21A 3INRA 4LJ9A 2CBZA 1KVUA 1RZUA 3STXA 3K0SA 3ZZUA 2O57A 2GPTA 1GNQA 2PS3A 2HUPA 2BZSA 3VNSA 3EAFA 1E92A 4O0LA 1NW5A 2B83A 3T1NA 2MINB 5KB3A 4HQ0A 1OFUX 2BOVA 3JQAD 2GLXA 2O48X 2NYVA 4DA6A 1XAGA 2NPIA 3BFVA 5ALPA 1WETA 4TMTA 3T7AA 3WGOA 5ESXA 1EQ2A 2HADA 2LV8A 2O2JA 3KZMA 2P41A 3M6IA 4LYFA 3U3ZA 3D4NA 3WWOA 4E03A 3IE1A 1L4MA 3U7GA 1N1MA 2XH8A 3WL6A 5LP6B 3B2EA 1ULSA 3QE9Y 2JCGA 3KOUA 4E3WA 3QVXA 5JCOC 4J2OA 1T5LA 2H3EA 4AN4A 4LY0A 1M33A 5C35A 5J4LA 4YI3A 1NSFA 2C2HA 3ANNA 4RPCA 2I33A 2ES4A 1QYIA 4OVKA 1MAHA 1YKSA 1SCUB 3WAJA 2YC2C 2IHBA 1PTKA 3F3SA 5CCDA 2J3JA 1B93A 2QORA 3FIUA 5A0TA 1N2EA 1Z39A 4ZZ2A 2F1HA 2GPWA 4YCCA 1D1TA 3H6HA 5ICFA 1MX5A 1A7KA 4JBWA 1AE1A 4A16A 4CF7A 2OORA 4AJPA 2HQ1A 3O3MB 3ZE7A 2R7KA 2XQGA 3F6RA 1P8AA 4A9AA 3OOSA 1ECPA 2FV8A 4NESA 1O97C 1X1QA 2UAGA 2FEPA 3AR2A 3NYWA 2F9LA 4YRZA 2CLIB 4FSXA 4UFPA 4YAUA 4CN9A 2ZQ5A 1LEHA 3A9RA 3G2PA 2BMWA 2PGIA 5AJHA 4LE2A 1H2FA 3UENA 4EYQA 4EZEA 3GZ4A 4IH9A 4LMAA 3HCBA 1Z8FA 3LGSA 3V00A 3R8XA 4B6SA 3HK2A 4B09A 4EYSA 3DKIA 1FFYA 3EIXA 3QV2A 4G01B 4GQAA 3ZXXA 4JBXA 3K1TA 4OYHA 5ECDA 2CXOA 3I9V6 3L1JA 4XFDA 5A62A 5K4HA 4AKIA 3KJHA 1TPYA 2O59A 1N75A 1QVWA 4UHBA 2JFXA 1ZJZA 3MTAA 1NJGA 3I28A 1YR3A 1V5GA 2CUTA 3SS8A 2GYWA 1SQFA 3DHVA 3L4EA 3UY4A 3WKBA 4ZN6A 3HKEA 2HIMA 3MUFA 1U7UA 2NSDA 1FVOA 3MAJA 2JG3A 1N8TA 3K05A 5J5CA 3QA9A 4FILA 3AIIA 1W29A 1P5ZB 1I7NA 3RTEA 4ID9A 3RK0A 4ZZ1A 1M2FA 4KUEA 1YQEA 1DINA 4KR6A 1Z6ZA 1U7DA 4CF4A 1K4YA 3BE6A 1K98A 4NECA 2HNBA 3NC1C 1ISFA 5DI3A 3R7FA 1NRXA 2HIHA 3CZ5A 1EVIA 3TZ6A 3WISA 4BJHB 4WBNF 1C3VA 3OWOA 2WWRA 3RAPR 4CCSA 3O3CA 4OFXA 2OYCA 2F00A 2JD0A 3PQEA 1CC1S 2XQIA 2OCXA 4DR6B 2QE7D 5F7XA 2BFEB 2IW1A 5BN4B 3UQZA 4ERNA 4ZZIA 1NZJA 2ZSEA 3NB0A 4YVFA 2PKEA 2HZ7A 5GQSA 2ZJ5A 2LCQA 3WGUA 5DFAA 3EGDA 2G4VA 1M6WA 4US2R 4BDSA 1UMCB 1R5JA 3D4BA 5EJGA 4JI4B 2DTDA 1Q22A 3AM4A 1A50B 1TT7A 4I3HA 4Q6WA 1JIIA 2N1BA 2YW2A 4M1SA 4JLVA 5LNK6 1IN6A 4ZVKA 4KPEC 4IV5A 1QG0A 1FNSA 3M5WA 4BO2A 1TO6A 4S1VA 5BQPA 4CR7A 1VKHA 1BJRE 3GJ7A 2AR7A 3HDJA 3HWSA 1THGA 3K70B 4PW0A 3L8ZA 3RVPA 4D5GA 5AM5A 2G76A 4IXTA 4NZ9A 1CCWA 2AQ8A 2C07A 2IXDA 3AUFA 4BN5A 4LKOA 5B1SA 1SCQA 3BH6A 2ZYAA 1IVYA 4HLQB 4BB0A 1TE2A 5SYNA 3IBCA 2YVLA 1EJ0A 3DBRB 3FVVA 2ZTUA 1S3FA 3C6YA 4RV5A 2ZU0C 3GHHA 5IHXA 1ILEA 4UEQA 1I2DA 4Z7NB 2QD1A 4RK5A 2BKVA 3CCBA 2H1IA 1OW3B 1WP9A 2MSWA 2QT1A 3C3XA 4KE8A 1F3OA 5LFAA 2BFEA 4MUBA 1PL6A 1WRBA 3PPIA 1E96A 4BCDA 3BGWA 1FIUA 2PS0A 1ORRA 3NRJA 4EEXA 3WBKA 1Y3CE 4Q3DA 2XWPA 2VN8A 1DQRA 3ND6A 3ZTYA 5JT1A 5DLDA 3N2GA 5AUPB 5ENVA 4TV8F 3UTCA 1OLSB 1W1UA 3CWCA 1T0IA 3TR0A 3FVQA 1GPMA 4C3ZA 5JZBA 3LBIA 3SSNA 5KZMB 5ALTA 3FKSD 2V7BA 4RXMA 5EPOA 1ACLA 4NBKA 5DASA 4B46A 3FMOB 1MKYA 1AXEA 3ZZNA 3JTEA 1WA5A 1XTRA 3AKYA 3QH4A 1DADA 5LU8A 4HAXA 2I9KA 5TRTA 1CR4A 4M7WA 4GI7A 1Q1BA 1EZZA 2VSOA 3HCCA 1PZFA 4GOMD 5TJ9A 1DU4A 3SOPA 2F7SA 1CUZA 5J9FA 1AS2A 1Q57A 1Z62A 1VMAA 1PJ2A 3O1LA 3L6DA 5IW8A 5GZ6A 5A9RA 4XYGA 1XCJA 4CLDA 4PHCA 3OZBA 4FYYA 2XGGA 4FONA 3NLLA 3R5SA 4K9PA 3SHVA 4EW2A 4RL4A 2KW5A 4II7A 4TQ9A 1ZS9A 4BNDB 3FPSA 4OQ4A 3EZ2A 2V6MA 4CFZA 1B3BA 3H8SA 2FA9A 1T2EA 1TADA 3M6VA 1XLTA 4LXHA 4IOMA 1SBZA 4DB4A 4MB2A 1RPAA 5J1TB 4NY1A 5JAHA 1E60A 1BE8A 5FTNA 1SUEA 5LQUA 4L5BA 4EKIA 1RQ2A 821PA 2O1WA 1LGYA 1DCFA 3KZOA 1N9ZA 3ZD8A 1P4RA 1WPXA 2DPGA 5F98A 2P9ZA 3L46A 5E6SB 3RWMB 4CJXA 1NQVA 2AFIE 5IG2A 1COZA 4ALNA 3CW2A 3VRHA 5A9SA 5BUZA 4M60A 4Q9KA 1P6UA 4IDPA 4S3MA 2BJHA 3PHCA 3OEHD 3FB4A 3LT4A 1FJHA 1XJ5A 4I50B 4S0ZA 2J5KA 3NKLA 3BX1A 1BMDA 4XDHA 5LR6A 3H17A 1I13A 4A8TA 3QIVA 4AROA 5LQJA 4Q3AA 4D8WA 3EHEA 1KRWA 3ISVA 1UC9A 2FPKA 4YXWD 5HKAA 2IP2A 1I10A 2J9YB 4TUYB 1UPXA 5B30A 1TFUA 2BFPA 3QOXA 3SXJA 4FYVA 4Q3LA 3QLVC 2I1QA 4X93A 3TTWA 1JYFA 1Z4OA 2C9CA 3H1GA 4Q34A 5G41A 5JFTA 2YJZA 1QRAA 3EJWA 4FS8A 3AEQB 4IQFA 3KO8A 4JLWA 5DNAA 3GUCA 1Z2OX 2CNOA 3B53X 1ESZA 5D85A 1DC6A 1E6KA 1OIXA 3MLBA 4YRPA 3X2EA 2PUJA 1KY4A 5JSUA 1NUTA 2OBLA 2X8JA 3E35A 1C7JA 1AHIA 1W6RA 2LCFA 3BAFA 2QTRA 3LM8A 2C2GA 2OLKA 2VLIA 3L1VA 1FYWA 1O77A 2W0SA 1QP0A 3SHOA 2WT9A 1HFWA 2VTVA 1YOBA 3D5TA 5J2TF 4MRMB 1JA1A 3DZKA 3D59A 2Q7DA 1L5FA 2RGXA 2G04A 3FNFA 1NLYA 3M0EA 3WVNA 2VRCA 5IM4A 3V3KA 1PR1A 2A86A 1F3LA 3GU3A 1ZXLA 3L0YA 4V0QA 3DC7A 1H8HD 3G5TA 2RB4A 1XVVA 2C29D 3D2LA 2WTXA 3E2PA 3LG2A 3NIBA 4NEGA 4TN5A 4AD8A 2XBUA 3ELYA 3WHPA 4AICA 2WJPA 5HUHA 2CWDA 3HP7A 4LGMA 4DWVA 4POOA 1E7WA 1A9YA 2HAEA 3SXUA 2R79A 5IDQA 3ZGYA 1FW6A 3WV5A 5KNBA 1J1UA 1EAYA 1NLMA 1SVSA 6Q21A 4K6KA 2CEKA 3U5ZB 4Q00A 4OFZA 5IUNC 2E6KA 3W7BA 1YRAA 2FWIA 3F2VA 4NBRA 4X5OA 1U11A 2Q5CA 3VO2A 3Q6MA 2ZAGA 3BIWA 3BK7A 1MDBA 2RHOA 4KXVA 2Z2KA 4PX3A 3DP9A 3HYLA 1APBA 1AQYA 1KGSA 2FLVA 1GFZA 2QTNA 3QKRB 3HVIA 1E5DA 4LI3X 4EG1A 3EXIB 1ZUNA 1N7JA 2BKXA 2UVPA 3UKJA 3A6EA 5B1HA 4EB8A 4RTSA 4CIDA 2C3MA 1XDUA 1X80A 3QTLA 3DBHB 3HQ4O 4FZVA 3KVRA 3SX0A 1RPZA 1GAXA 3M1YA 1PYDA 3QRWA 4WOPA 5CLLA 1QCYA 2RH8A 3HR4A 5M5BA 1I4OA 2PZBA 4TLDA 1O8BA 3S1AB 4WK4B 1EE2A 7AT1A 4DQLA 1I14A 4YC7A 1SU7A 4B73A 4E30A 3O73A 2FY8A 5FPPA 5CHYA 3GZNB 4ZODA 1QHNA 3CH7A 2Z6UA 3ITDA 2E4UA 3V1TC 1ZCJA 4A82A 1A9QA 3EYAA 2JLVA 1WVMA 1X19A 2JF0A 2CC2A 3L0SA 4UCXA 1OXXK 3T7KA 2ZJ6A 4KFUA 3NS7A 5FULA 4N0EA 3X44A 2Y1KA 4EJSC 1QP8A 1EKXA 2Q5HA 2X1MA 4DEXA 1KDTA 3G7UA 5LA6A 1RKBA 4U02A 4KX3A 3RS2A 1Z0AA 4IF6A 4F4FA 3U39A 2XA9A 3P97A 1NQTA 3QPVA 4MITA 2KLBA 5FBHA 2H4FA 3TPFA 4BRSA 2W6QA 1XZEA 2OHVA 3I30X 4IIDA 3IGFA 3VNBA 4LNUA 1YUMA 2WW8A 4IWYA 4OYLA 1SOVA 2Q07A 1P9LA 2E37A 2GN2A 3TOVA 2DE0X 1ONNA 1EJBA 2GYVA 2LNDA 3FPFA 3GMTA 5EZQA 1A8IA 4A36A 3IIEA 3M6AA 4TN1A 4D3DA 4ZQBA 4Q4CA 1YJBA 1PNVA 1Z0ZA 5LQAA 1GAQA 4K6CA 3GRCA 4RVDA 1C7FA 3DSRA 4ZO9A 1YU9A 4CDNA 3TM4A 5G0TA 5F1YA 2VP9A 5CX4A 2VJAA 1ZICA 2O0JA 4LRWA 1DWOA 3R44A 2IXBA 2ZOSA 3BMNA 3WMXA 3X2SA 3T5AA 3RS8A 1SXJC 1H4VB 2MMGA 2IHYA 2Y9PB 5C7LO 1DUSA 2QJRA 4L72A 4GC5A 1JMYA 2G77B 3PL5A 1G5PA 1GPBA 1QGUA 2D2VA 1DKMA 1DI0A 5EKDA 2CMKA 4KIWA 4WA8A 4ZAYA 3DULA 1I7DA 5F35A 4AB1A 4LF5B 1T5BA 2G4CA 1JZTA 2WK1A 1SHTX 3PHHA 4QU9A 1JG6A 4Y2JA 1QE5A 4V0RA 1Q50A 1PT9A 4DYDA 3GFQA 2WABA 3SQLA 5LNK1 2FFQA 1FMJA 4RHXA 5DN6A 1LSOA 2GPYA 4XIJA 3JVEA 2JFFA 4DILA 4M0KA 1INLA 2BF7A 2P4UA 4PANA 5FOTA 2VZ8A 3JTMA 5T64A 4RTOA 4YV2A 4AURA 3NDJA 2P9QA 1VHDA 3YASA 1DAHA 4EYEA 4E12A 2HYDA 3DDWA 1N2HA 2A88A 1VL5A 5T4EA 5B36A 3DT9A 3TG8A 1BVRA 4LDNA 3EGXB 3MS7A 3ZGLA 3C6MA 1H6CA 3D64A 2BEWA 4OKSA 2I4IA 1XLUA 4UOQA 5BSFA 2FQYA 3B78A 4KIUA 2F3SA 2X9GA 5M7EA 4NFLA 5EE3A 3ZDCA 2G7MC 3LGAA 4OEHA 2C7GA 3HFGA 1TRHA 2HD4A 4PS0A 4ZEMA 4R6XA 2F1JA 4B1FA 2JASA 2UYOA 1JG7A 2ZR9A 1C1DA 2A4KA 3KOXA 5AVKA 1RI3A 2I2BA 4E2ZA 1E1RD 2OCLA 3HKDA 1T8RA 1JHMA 4ZAZA 3EFBA 3CEAA 3LCUA 4I9NA 4A0GA 1BD4A 1XI2A 2I2XB 3CUTA 4JL6A 4JUFA 1VL0A 2W2QA 5AK6A 2P62A 5F7JA 3DQQA 1CX9B 2R11A 1DTSA 3G2JA 4OXNA 1C0PA 4IQ0A 3SVZA 2I55A 1KBOA 4Y2HA 5KNDH 4LQCA 1BKDR 4IKPA 5A9TA 5L7TA 1MO4A 1BHO1 2WILA 3WFIA 4DQVA 2BT4A 4MVYA 3A3OA 4ARAA 1OLSA 2PS9A 3ULKA 2C9BA 2DVMA 5JSKA 3RRYA 4E14A 2J7PD 2Z4TA 3EIWA 3LP6A 4MEBA 4QGGA 2C4HA 4CCAA 1QQBA 1PEKE 3DP7A 1NR1A 3PGMA 4X85A 1Z7BA 1DT3A 5KO2A 4FYXA 3OKAA 3E3MA 3KQVA 5IJ9A 3L84A 3VKHA 3B13B 2C2OA 1RWWA 4N6GA 5I9TA 1J1ZA 1MMFB 1M9NA 4FKMA 4OMFG 3CXRA 1H0HA 3BM5A 4O2AF 3ETCA 3KXKA 4EJMA 1U3UA 3IQIX 4OHMA 4TTRA 4HNVA 3TI7A 1Z35A 1ULUA 2ONYA 2IPOA 3AF5A 2O5EA 4R8MA 2IITA 2YV5A 4GH5A 4RSMA 4QFMA 1DXHA 2H1SA 2GJ4A 2IYUA 3HRIA 3D6TB 2AKAB 3QNMA 3TNDA 2FW9A 4RHCA 4U3JA 2NXEA 5AW1A 2AK2A 2JI8A 1ARZA 1H05A 1VPLA 2L18A 3CVOA 3CZMA 1I0IA 2QLNA 3VPDA 4OQLA 3W1EA 1F7VA 4N18A 3NHMA 4FBGA 3OJOA 2B3DA 2C5EA 4XWAA 3HA3A 1GU1A 3LUBA 1VJDA 2CDCA 3V7WA 5TY0A 2CMDA 4IY1A 1L7AA 2XMSA 4TM7A 2PXAA 4UVHA 3WLOA 5EE0A 3E15A 4EJ0A 1WXWA 1X2EA 3OPQA 5ARDA 5U4XA 5KYGA 1OWOA 4H3KB 1EFPB 1VJTA 4B48A 1P5RA 1DG1G 1TCAA 3U0BA 3NHSA 1SO8A 1ZCFA 4P5DA 3E2MA 3P0JA 4MV7A 1UOEA 4PY2A 2LDXA 3LT1A 4J6EA 3AR3A 4MICA 2WSLA 3UGJA 1U0HC 2CVOA 1PP4A 1HSOA 2C95A 1E4EA 4R1TA 2C4VA 1SVKA 3ZH9B 4TZKA 2Q1YA 5DBGA 2PY6A 1Q21A 4RPJA 2FPPB 1Q3HA 2PM8A 1UKAA 1NBME 2JPDA 3SZRA 1S8AA 3ABQB 1Z7WA 3LCCA 3F5MA 3NM6B 1U3VA 4IDAA 4OBEA 3W7AA 4EYKA 3HXOA 1DV1A 2Q1SA 1MV8A 4HCJA 1D7AA 1DG9A 1UWKA 2ILVA 2O07A 3I76A 1O6CA 3KE9A 3TSWA 1L8AA 4X1IB 2R6DA 2HO5A 2PD6A 4OSOA 4CF6A 2EOAA 2ODPA 4HEJA 2PU7A 3K20A 3ORYA 2F9MA 4HPXB 4IILA 1OILA 2GCNA 2QXUA 2X77A 1RYZA 2FWJA 5DYIA 1I6MA 3N58A 3KWMA 1QAOA 3DAGA 3DR5A 3MCVA 1C8BA 1M0SA 1VRWA 4R71A 1US8B 2WVHA 4OP3A 3RKSA 2EEZA 2WHYA 1QB7A 5G1OA 3Q3EA 2ISSD 3VV2A 5CBPA 3VYRB 1YUBA 3GH3A 4A23A 4DXAA 2XBMA 1II0A 4C7XA 5AVXA 1FDTA 2YICA 1QZTA 2E6UX 3DONA 2D2IA 2YL2A 4BASA 2AUNA 2AN3A 3ACDA 2QVXX 2R8ZA 3OZ7A 2XMDA 3MEQA 1T1JA 2P1DA 2GT1A 1SUDA 2RCYA 2JANA 4WN3A 5EKXA 2X4IA 5E2BA 3HGMA 2B82A 4PYMA 4DJFC 4YMVA 5J2TB 3UFXB 1OGIA 3AEUA 2HI0A 3WB0A 2NVUA 1GHTA 3OEYA 3S1LA 1ZNQO 2WB4A 3BUSA 3GAZA 4RL6A 4TL7A 1TMOA 3QQ5A 5KVQA 2KQUA 2XB2A 5HF8A 1RAGA 3UB4A 3AU9A 4MW5A 3ZE8A 3U7QB 3DFMA 4MXDA 5AJXA 5CM9C 5IC6A 1D5CA 2PT7A 4Z9BA 4NZPA 4AJNA 3QMMA 1RRKA 2B5OA 1B6SA 3NHZA 2IZ5A 1TGVA 4QFBA 4DKXA 5JCPA 4KR2A 2HK7A 4R0NA 4MHTA 4CM7A 1P5HA 5L3SA 2X13A 4N7RA 1AK1A 3AETA 4G5HA 1YVDA 4M1KA 3PENA 4DDVA 4MV5A 3VC2A 4TXLA 3DYBA 4KWCA 4X6YA 2WTNA 3CURA 4LJ8A 2Z95A 2G5PA 3AESA 3EVZA 4M6WA 4LJ6A 1VFNA 3F78A 2XTZA 3GI1A 3S29A 5EJ4A 5AXCA 1MIOB 2CBXA 3BIOA 3IULA 2HK9A 4LE0A 3U3DA 4F4CA 1PEAA 3TSAA 1N6HA 1FFDA 1YVRA 2AYYA 2C9MA 1EWQA 1N0IA 1NW3A 2Z58A 1YB1A 4DA7A 4O4LB 4GMDA 3OUTA 4IJWA 1KE2A 3AF3A 1KOGA 1I1OA 2O1XA 3CKMA 1U7ZA 4OKNA 1L4EA 4OOFA 4HG2A 3RV4A 4RHTA 2QUHA 5D3QA 4HXYA 4NNPA 3C7DB 2HOQA 2GM5A 2JK0A 2JIMA 3C39A 2DY0A 1G3RA 1PFVA 1W85A 3CKKA 1DJOA 1YS6A 4AJ4A 5C8YB 1RJFA 2OCKA 3JVIA 2B1RA 4JYMA 4TKMA 1WMFA 2GF0A 4YUWA 2HL6A 1VKNA 5AW8A 2B8NA 3VKUA 3WHKA 3Q12A 5CURA 3GLGA 4KGXA 1HTTA 3DZCA 4KR3A 3A14A 2VTBA 4W5JA 1JQDA 3A4LA 2IFTA 2WJ4A 3AUTA 4FJ0A 2NZ2A 1V8FA 1BXRB 2HWYA 1YZFA 1MHPA 4LE1A 3GK3A 4AP6A 2H06A 2OPHA 5KKNB 1ZD5A 1IQPA 1JQKA 3A0UA 1ZW1A 4OD0A 2D06A 2B8WA 4ATNA 4CCWA 3WY9A 5L3RA 2OMKA 5KSPA 4O0MA 1BE6A 3IBSA 1I24A 2K7ZA 3N0VA 5JZSA 4GMFA 4CG0A 1GR1A 2QK4A 3EGOA 3TBKA 2EW1A 1Y0BA 1NF8A 1J5XA 3HKCB 1KC3A 4LJ7A 5I8PA 2MSDB 1KYIA 2GJSA 4UNSA 3TRKA 3A9TA 1TQ6A 1QH8A 2AW5A 3F98A 4IEEA 3SJAA 1JDVA 4IINA 1TYEB 1DHTA 4NQRA 3CU5A 3IAXA 4HGQA 4WJZA 1PWEA 4N0PA 2QV7A 3G9QA 3M5DA 4Y1EA 1L1FA 5BR1A 4IGKA 1TFRA 2F17A 3BXOA 4KK4A 2QRPA 1GG5A 3DE3X 3WRWA 4P54A 4J07A 4QYIA 5DMXA 4DIKA 4RENA 1XZJA 3S81A 2VHUA 3T5DA 2FZ5A 4X1KB 4L5YA 1E6MA 2G7ZA 2BI7A 3OG9A 3CSDA 3UWPA 5CD9A 4MVJI 3LY5A 3AR5A 3SQMA 2VSXA 2QTTA 3RJ5A 4D6XA 1AF7A 4MWSA 1KBQA 4TMWA 3H9CA 3Q0IA 4L5AA 4DARA 5IXYA 5CFRA 1E1NA 2DBVO 4TT3A 1VYUA 3F5SA 3JW8A 2P6MA 2QDKA 1H8ED 3P9QA 4NDAA 5AP9A 5AI5A 1CUJA 2P2DA 3N76A 2C4WA 2LWIA 3QU9A 5JJIA 4J90A 1PWZA 2O5CA 3HKDB 3MJCA 2XQVA 2NVBA 3PGVA 1QV6A 2QN1A 4JU9A 5CPBA 3BHJA 1A97A 3OE1A 4BVEA 4YAIA 1C7ZA 2MHCA 4GI1A 5ECWA 2WQ6A 1KF0A 5E9WA 3ZI7A 4AAYA 1D1QA 3GL9A 3T1QA 3QVSA 4UTNA 4EAAA 3MJRA 2DLCX 2IUSA 3MN1A 4DMCA 1U1IA 2DMRA 3AIMA 1LQ2A 1AUOA 1CY6A 5CVJA 1RPNA 3ELBA 4XSVA 3PDIB 3GA0A 4Z9YA 3AHCA 1EG7A 3V8RA 4QLBA 7MDHA 2ZBDA 1TU4A 2CVFA 2QUAA 1VI5A 4GKVA 1M6EX 5EVCA 5FJJA 3DUWA 2WF7A 4R68A 1JS1X 4V2IA 4W1PA 3L4JA 2K2QB 3PLAE 4IFBA 1XTBA 5CD1A 4F6LA 4HLUA 3JWEA 1M34B 4FZ3A 2YYZA 4MQLA 1U04A 5AJVB 3DAYA 3E6AA 3L92A 4FSDA 4XAQA 3S8MA 3KKZA 4DOMA 3I5YA 4LFBB 5GINE 2PYDA 4L4SA 3TTUA 4O3FA 4Q7JB 3VYWA 2VH5R 1E0DA 3DQZA 2ZIVB 4X54A 3JR3A 1E2LA 3AJEA 2GPSA 5BMOA 3L7OA 2PLRA 2H5JA 2PWAA 3HZOA 1NVEA 3FJOA 4PSVA 3ZK8A 3EPLA 1S3GA 2FTKE 3G2LA 1G55A 3I2IA 5AD1A 1IB0A 2WD7B 2WDZA 521PA 1LX7A 2A7XA 1W4CA 1RYYA 4MR9A 3JR7A 3MTEA 5FUWA 3SZMA 1WMEA 3LIPA 1FDUA 1I1QB 2G1KA 2J46A 2P6NA 3D8SA 4IV8A 4N8DA 3WGQA 3DOUA 5KYTA 5HM8A 4NYMR 3QU2A 2W4QA 4NENB 3U6BA 4KGVA 2PXXA 1EWTA 4OGKA 3N6RA 4FNGA 1NW8A 2IXFA 2EIXA 3HN2A 1NVXQ 5IDYA 4IIJF 3TD6A 4GKAA 3H2YA 1PL7A 3CA8A 2R84A 4EENA 1PYOA 3VSDA 3AVWA 3AL0C 5F64A 1D03A 4CEHB 4KP7A 3QUTA 2A9PA 1Y9DA 4K9QA 5ECGC 1GA6A 2OV2A 3TWOA 4P3PA 2O9JA 1W48A 1LQUA 3GLIB 2GKGA 2O2DA 1HYQA 1D2RA 4RGVA 2FR8C 2XF8A 1NSTA 3PD1A 1B42A 1W2WB 5F3WB 4XGKA 5ALXA 1L4GA 4C0KA 3HBLA 3QMVA 1HDYA 1DIBA 1HBJA 3AY6A 1B6TA 3JRWA 3PC8C 4KOEC 3ZVRA 2W2PA 1QJCA 2CYAA 1MO3A 2FWRA 3UMJA 4INPA 1KAOA 2OVBA 1Z45A 2ADOA 2ZJ4A 1HEUA 2PGJA 3LUKA 5HGXA 1RYHA 2UUCB 1K6EA 2AZTA 1KH3A 1RW4A 4ZCRA 1ZKDA 3AVTA 4HSGA 3MJVA 5CT9A 4D0LB 3U4AA 2XKKA 5JO0A 3A0RB 3U48A 5DNCA 1PT6A 1UUFA 3RTBA 4OQQA 1YBVA 8ABPA 5CT8A 4P2GA 2C5HA 1U7HA 1G18A 2G17A 5JU6A 3PFFA 1BFUA 1EI9A 1RCUA 4N41A 3WGJA 4YDRA 1B8VA 1HE1C 1RKQA 2BFDA 2OHHA 3LYUA 4XM0A 1VA4A 3TEJA 1FW8A 1UPUA 3LA8A 2KHZA 4EHAA 2PL1A 3TGWA 3BTUA 4J0EA 1B7GO 3K0AB 2YS7A 2JJ8A 2YWHA 5D00A 1L5RA 3QUAA 2GF2A 1G60A 2PO7A 2A67A 1MOPA 1D6NA 4G9BA 4RVHA 2W48A 2GOYA 4QRDA 4BHTA 1DELA 3IMCA 2NMVA 3GPDG 4U2FA 2NO6A 1N6NA 1N8SA 6CHYA 4EKEA 4MPPA 3A6HA 1GZ5A 2WTBA 4QOEA 3MJSA 4KXNA 3BWEA 5BSEA 1JX6A 4OXXA 3GDOA 4Y30A 3VPXA 3WDLA 2GBCA 5B3JA 1KJIA 3BXZA 1KP3A 2DKNA 3DL4A 3ZZ0A 1OI3A 4DR7B 4J4BA 4KZPA 4LJYA 1Z4QA 1S9HA 1OROA 1YL7A 2O7VA 4X6XA 2DUNA 3DOOA 4WOCA 3ZW7A 4EF4A 1LA2A 1OV4A 1Z18A 5JBIA 2I4LA 3WZ2A 3CPJB 2PKQO 2XTJA 3AM5A 3B70A 2C5LA 3NWBA 4MW2A 5ELMA 1GQFA 2X1HA 2I65A 3FMPB 1U4OA 3HU3A 3W78A 1QHEA 2ZVJA 3AI1A 2DFLA 3L0DA 4FK8A 4CM8A 3HADA 4ZGBA 3USCS 4HEA1 4Y6QA 4F2DA 3PNSA 2FSVC 4NK5A 2JVIA 1E6UA 1JKIA 1NW4A 4IIEA 4KWIA 4V0ME 3K6SB 1TZKA 5IKEA 3S2EA 3RJMA 1TYDE 1F0KA 2DUJA 1F9AA 3C3PA 4N12A 4B4DA 5JI3E 1CUGA 4PNPA 1UBEA 5IJ0A 4QAJA 4IJKA 1N3YA 1EIZA 3BIXA 3EDMA 4XD7A 3ADDA 2PUDA 1YC5A 1Y8RB 1CVIA 2VTEA 1KIMA 1RYFA 4K8OA 4TLBA 4NCJA 2B8EA 4TTSA 2ODNA 3OEWA 4DCSA 4O4IF 3K8OE 4WT7A 3DMYA 5CA0B 3DBOB 4YJ3A 5ALGA 1IM2A 3E27A 4JKOA 3V2GA 1QIKA 5K3FA 2AG1A 5IVIA 3RUPA 1O8CA 3G85A 1OC2A 3PCXA 721PA 4V0SA 3NNNA 3J7AC 1AQ6A 4MR9B 3IAEA 3UHFA 2ZBGA 4PLWA 3VSAA 4OHVA 5AI8A 1T0JB 1O97D 2BM9A 4XX0A 4DRYA 1F8XA 1EK1A 3DCYA 3Q3VA 2ZK7A 4RNCA 5A06A 2X5KO 3T15A 2IKQA 1X8LA 2QD5A 4Q3BA 4KVZA 2ZI9A 1UM9B 4OF4A 2GGSA 3TYXA 3ZD9A 1JHDA 4JUCA 5JDCA 4GW3A 3A7EA 4D6YA 5I8WA 1OT5A 2CMGA 1XCGB 1RAIA 2XNDA 3EEYA 3H1FA 4NR0A 3GA5A 5DSZA 3F9RA 3RRFA 3W5JA 5IAOA 3LVQE 1PZXA 2C31A 4YAGA 5MFPA 1LWOA 2EEPA 3OA2A 3QFFA 4EVSA 4RV4A 2PV0A 5LOVB 2JAUA 2X15A 3H83A 4Q4DA 3AXTA 3EF3A 1CEQA 4J0IA 4IXDA 1EFKA 3WMEA 3V7NA 4F4UA 3I9KA 1NW9B 4LOJA 5DM70 3WV4A 1KI1A 1O95A 2VC2B 3PEEA 3UM9A 5ESRA 4RD4A 4TQGA 5AVVA 1DPGA 3ENQA 2D5AA 3PFIA 4YP9A 3A31A 3RRJA 4WESA 3Q5EA 1K9VF 5A7FA 2C83A 9MHTA 4WLFA 4Y6RA 2EJWA 1A5ZA 2WKQA 4OMDA 1FVFA 2WFLA 2XVMA 5ITZB 2O0HA 2QM3A 1L7XA 2AD5A 4Z7OB 1J2RA 2JS7A 1NKVA 3VJLA 3SIPA 1VSVA 5A5GA 4MUHA 4RH3A 2CHFA 1M74A 2N3ZA 1T2VA 2QL9A 2VZEA 3GCDA 1ZXXA 2P2LA 4RMGA 1NP7A 1RMTA 2F1RA 5EZSA 4LTNA 4ER3A 2QR5A 4GPD1 4UE6A 1V5FA 1AV7A 1I4TD 3H18A 3MD9A 1KDZA 4MV9A 2FPOA 2UYGA 2PTHA 3PQ3A 3GJZA 4NU0A 4MI6A 5HDBB 3GLHA 2JEOA 4YYEA 1PV4A 3IP5A 1FQJA 2ZRBA 3KYDB 4J9UE 4RCZA 3KWLA 3TQOA 1J22A 5KQLA 3COSA 1T2CA 1T8WA 3B7GA 3JCZA 5TE9A 4P7FA 1LF0A 5TX7A 3TBFA 4B6RA 1E2DA 1W5SA 3BRQA 3IOBA 4WINA 2WWVD 2OXEA 4GWKA 1C50A 1OX4A 1ZNZA 3D4IA 3FVWA 4ZTBA 1AOXA 2FSGA 2V98A 2ZYVX 5T8KA 1E1QA 5BNIA 2CHUA 3RB8A 1VOTA 1CUEA 4OU4A 3TUIC 2ZS8A 5FORA 4XQEA 4DABA 4LXIA 4KO4S 3TJRA 1BS9A 4HDNB 3W3ZB 3IQZA 5FEMA 3QX3A 3PYXA 1WB6A 4MRRA 1YZLA 4BBAA 5T4HA 3SMQA 3Q3GE 2WJAA 4TKZA 1J9EA 2YUIA 2JL1A 1KOJA 1Z74A 2HK8A 2RI1A 2VJKA 4PGAA 5EESA 3ADCA 4XPIB 1KJWA 1OI2A 2EFDB 4BPBA 2OK7A 3G9ZA 4TVKA 1S2OA 1KRHA 3T4PA 4FBMA 4F2PA 3SJZA 4OY3A 3QWHA 1GVHA 5GM1A 1C0LA 2W93A 3I0MA 2M6RA 1E7RA 2ZI3A 3T94A 3H3XA 1DRWA 2BBOA 3CQ9A 4FFNA 4LS3A 5L3VA 1H0SA 4HMOA 5I4CA 5C4GB 1DWUA 3IC5A 3DXYA 4RA6B 2PN1A 2GARA 2C84A 2GBLC 4BLQA 2X0RA 2XX3A 3AEYA 1QIGA 1G3MA 1E7YA 3VR6D 3GLGE 4P2BA 1CT9A 2GHTA 2NO9A 4CKYA 2ZCVA 4BKOA 5LBTA 5JOQA 2OGZA 4R3UC 4MKHA 1XCPA 2ALJA 2MSKA 2NU7A 3HWWA 4Q02A 3PQ7A 5YASA 4EUSA 5IDWA 5KPJA 5CCXA 2YN4A 2I78A 3I6IA 4HNUA 2J59A 2AJCA 1L5VA 1QLJA 1SNYA 4I2NA 5JTUA 1POWA 3TLZA 5IUKC 3VR4H 4ACBA 2ZRDA 5CEEA 1TZBA 3F3YA 1QP4A 3R0VA 4EY7A 1VG9B 4OHRA 3GBPA 1GQOA 2ZULA 5EXSA 2QIOA 3CLRD 4FD3A 1PG0A 4GSKA 5E7JA 1FYVA 1A4RA 1Y5RA 1JIVA 4WERA 5EE5B 3VKVA 3K9CA 2PV7A 1OVGA 3NBXX 4UMDA 3F6EX 3PXDA 3M4NA 1U81A 3CNLA 4M9CA 3V8QA 2HYIC 4D4MA 5LYJA 5JPIA 4FHEA 4XCXA 3WMFA 1XRLA 5IC5A 2EGHA 2VNHA 4R3NA 3RYIB 2KS6A 5KQMA 3BMOA 4AJOA 1AM4D 3ADOA 3O4VA 1I0LA 1USGA 4CMHA 2TECE 1SQ5A 1KAQA 1SXPA 4LF7B 1ITZA 2NW6A 2VRCD 5DCWA 4EHKA 4Y0NA 3SX2A 5AUOB 1FRZA 1GQQA 1YFKA 2PRSA 3K35A 3LHSA 4AY5A 4F5EA 4TTPA 5C2JB 1SXHA 2MWMA 3OHSX 2B4QA 3K70C 3AP3A 1VXOA 3UXMA 3OQMA 1BKYA 2BR5A 4AJJA 1K7CA 4KDEA 3IAAA 3ZCXA 4KSBA 4QSHA 3RG8A 4LYHA 2AZMA 3VH3A 3F4BA 2FWNA 1KQ3A 2WIBA 5E9AA 4ZRMA 1FYXA 3PC8A 4BBPA 2PYIA 5JISA 1XNJA 1OYYA 3CY6A 5K8LA 4Y0AA 1SRRA 5IS2A 1JBKA 2E48A 2P7HA 3M6UA 4RIEA 1KOLA 1I4DD 1XCMA 3EIQA 1UBUS 2VYFA 2P5YA 3S27A 2VPXA 2XZOA 2IYAA 1ECFA 1LFDB 2QX6A 1ZJ6A 2NO1A 4LBYA 4YHHB 4KLRA 2GCIA 2EJBA 1V8PA 1ZSNA 4F5ZA 3TOXA 3BSFA 2PS1A 1ZSVA 3I8SA 3K4PA 1V43A 3CIFA 2GTHA 1DAGA 5TJHA 2I2FA 2VP0A 3KKLA 3ZEIA 2REXB 4AM8A 5LD2C 2VDUE 1KYYA 2QLJA 1T35A 3NEYA 3VOBA 1TK2A 4GYJA 5A1TA 5AW7A 3JZDA 5I9LA 2DAPA 1GNPA 2G1UA 1CUSA 1G2QA 1NIJA 5FUQA 1FE8A 3F7TA 4U9HS 3ZD6A 1KJ8A 1UK8A 3R7WB 1PV1A 2JD2A 1G42A 1RWBA 3O26A 1GILA 4HFMA 4L4UA 1GYRA 4RCYA 4C4PA 4RM2A 2QZJA 4GMKA 1U99A 3A6DA 4J7AA 4Z2AA 3RVKA 4AF7A 4WMLA 1DX4A 2MR6A 1UP6A 1OR8A 3DYVA 3STTA 1K08A 4C08A 3UN1A 2H7YA 3R3SA 2K2WA 3GBVA 1LNSA 3B5IA 4G65A 3JU3A 4JC8A 8GPBA 1YAJA 2WICA 3PTZA 2BLNA 1QZXA 5JZOA 1E1MA 4FGLA 3R09A 1WSWA 2GKOA 4WW0A 1NTOA 2YDXA 2DKFA 2AEMA 1W0KA 4PYKA 3QBJA 3FYCA 3P71T 4GR4A 5GGXA 1FUIA 3C4QA 1DG3A 3BRCA 4MR8B 1FB5A 3TLJA 3CEMA 2Z5LA 4RVFA 3ICEA 2XE7A 5PGMA 2EKZA 3WYCA 2OFXA 4HF7A 4F7DA 2UXBB 5GIOE 2G1JA 5TQ2A 3INGA 3U19A 5BQ5A 2PIDA 5AM3A 3OTQA 5T7BA 3PPVA 3UWOA 1KWKA 5C4MA 1PR5A 3LX6A 5CFLA 4NMXB 1XRMA 3BDIA 2G9ZA 1WWKA 2XMQA 1PHRA 3MD0A 5G1PA 3ER9A 1ZN7A 3F49S 2HDOA 3HBMA 3K09C 5E1OA 3IMFA 2FLWA 3DOFA 3ROQA 1YQDA 3QITA 4BLWA 5KQGA 4KBYA 2G09A 2WIKA 1BVUA 2FF5A 4B3DA 4BNZA 4YCLA 2XRZA 4AX4A 2KE5A 4KAAA 5HMLA 4HTFA 3CW9A 1EB8A 3GLKA 3L4BC 3QLTA 1IHXA 4A15A 4HQRA 3JYOA 4YPOA 2XCIA 2E5FA 4YPFA 3A9VA 4S35A 2WYIA 3GMSA 1PG5A 3O93A 4NYJQ 1GL3A 5HRAA 5K0SA 5BWLA 4ALLA 1LTHR 4C0AC 4GXTA 1GA1A 4RHYA 1TCCA 4RO0A 5TMEA 3TL2A 1QIHA 4EY3A 3P20A 1YBMA 2GF9A 4QUIA 3UUWA 4UUOA 2DPYA 5MN4A 3WLLA 1U94A 5JFOA 1B73A 3EASA 4OMCA 5KYXB 4DV5B 1XMOB 4C3VA 3BF8A 4H2DA 3IV7A 1KYZA 2O8FA 2IPNA 1YUNA 1QPZA 5ALVA 2IYSA 4WKGA 4BPRA 3WWYA 1KTVA 2YFHA 3EFOA 4O2LA 5LOVF 2VP3A 3INTA 2NLOA 4N4AA 2I8LA 4W5OA 2F55A 5CCEA 2AG8A 5TF0A 4XOIA 4ZHQB 3P26A 5FFMA 3UMRA 4BDTA 2Q3HA 4Q1AA 2QZSA 3WO1A 2AZDA 2VJDA 5ICSA 1XKXA 1CPYA 1EGMB 1LU9A 2ZM6B 1UZNA 4LF9B 4P86A 5REQB 2ONJA 4CPDA 4FDAA 5DO9A 3KQNA 1EDBA 2AOWA 4H0NA 3OD5A 1QH8B 3VR4A 3AVXA 2R00A 1EDZA 2OCYC 3W3AA 4O6VA 2PEYA 4J49A 1PL0A 1ST3A 3S68A 1E3JA 2AE1A 2RHGB 2G9QA 3N2KB 3OCVA 4JHLA 4OL0A 5DBHX 1U0TA 1EGQA 2W2VA 3OQJA 1LS1A 3OQ6A 1XO1A 3GJ0A 3G2NA 3FD8A 3NO4A 4YRTA 3SJCA 4DBZA 5JBNA 3DQPA 2YZMA 3FSGA 4W1RA 1WJGA 1YB2A 4W1SA 4KV7A 1YDHA 1XMSA 3DZ8A 3RFVA 2AJBA 2CLFB 3TNFA 2PR2A 1DE0A 3FF1A 1UF9A 4FINA 4G84A 4X1KA 5FF9A 3UATA 3EZYA 1RC8A 3FMFA 1K8XB 4H27A 4X64B 2E18A 1NXTA 4BXOB 2QYOA 3BGIA 2BSXA 1KMQA 2D8MA 2SKCA 1W47A 2WU4A 4OB8A 1OFHA 5D3MB 3VV3A 2OZLB 1FNNA 1X1RA 3PPXA 2H7VA 3RS5A 4J2TA 1OXVA 4GT1A 2DSNA 5K6AA 1R6UA 3NBMA 1YFLA 1H3NA 4YALA 1KSGA 3ZE9A 2P5SA 2BSAA 5J3JA 4MI3A 4HNTA 3QKSB 1R10A 1Y5NA 2YXEA 3M34A 1T4BA 1NV8A 4C5BA 3UFBA 4HDSA 1X9IA 5AI4A 2EZ9A 1OC4A 3AT1A 3DTNA 3VI3B 1FFCA 4JLJA 2B5WA 4KACA 2TSYB 4XDZA 4HPWA 7ADHA 3ZUGA 3M2PA 1L4KA 5EIFA 5EPUA 4BWVA 4L7QA 2XUZA 2J09A 2VJOA 3QUCA 4DUGD 2JFWA 2ECQA 3HUEA 2BRUC 3WLMA 2VDWB 1YF3A 1UOQA 5JSYA 5AKLA 2P91A 4JSYA 5EMMA 2VK8A 4KQ1A 3EXEB 2JHFA 4M88A 4PQFA 3DPSA 2YIVX 3OTIA 4PRZA 4F21A 5LQKA 2FMHA 2I6GA 2R6HA 4CVNA 1WB5A 1EX9A 2HWUA 2E4ZA 4FZJA 4GX2A 4OM8A 2RIPA 1CFJA 3TPZA 4Z99A 1GAWA 4EUNA 3TZKA 3RTCA 2XMPA 5BUQA 5LWHA 1E3MA 3LRPA 4P4SB 3P1JA 2GZ2A 2Q8QA 2DERA 4UHFA 5FP0A 1VGQA 2Y77A 4CMCA 4YECA 4E31A 1C9JA 2QW0X 4HBZA 1YHNA 4IOJA 2IE0A 2AF3C 1CY4A 4N76A 2HQBA 1JF8A 4B9AA 4I1UA 2XVZA 5DJ5A 2CXRA 1V1MA 1YVEI 2ZSFA 3EW7A 3JQPA 3O91A 2JCXA 2XIJA 3DPIA 3Q7QA 2HWXA 4L6AA 3VH1A 4E7OA 3BGOS 5JXIA 1MJGM 4L8GA 4NJOA 4IXNA 3IBFA 1CZLA 1L0BA 3VR0A 5EIWA 2AH5A 3BTVA 3EODA 1SXJB 3KU4A 3G9UA 3URMA 4W5TA 4FOSA 4L8FA 5DNEA 4D92A 4DM7A 5BW8A 4IHAA 1O96A 1PR0A 2UDPA 1GFWA 2G5TA 1STOA 2VI5A 2YINC 2DHQA 5CIYA 2H1RA 1QNFA 3EIEA 2ZTMA 3VR5H 1NW7A 2BGKA 1A9SA 4XWTA 4ZHQA 2PFGA 5AW3A 5L53A 2JEZA 1LI7A 1E2JA 5GWXA 4B2YA 1X7GA 5FLXA 3BT7A 2NACA 2TMGA 3KCNA 2BF4A 4X20A 4HTAA 2RGDA 2CLLB 3QUQA 3G82C 1R27A 4JOCA 3OY2A 5K7SA 3MLAA 3UJ7A 2A6PA 3NOOA 4WWHA 3DLHA 5T6MA 3O2JA 1QF7A 4DMGA 2LW7A 2GZ1A 3KIPA 5I9SA 3CMCO 2FQ1A 3A1NA 1SIUA 1AMOA 4L4YA 4LAFA 2F8SA 4O5OA 2HM7A 4MJLA 3WFZA 1HSZA 1G38A 3HJTA 4M1TA 4RDIA 4PLPA 5DBEX 4LOAA 3QKWA 1NJ5A 3U7HB 4TWRA 1XZLA 2GZMA 4Z1MA 3ZY6A 5J4VA 1FP7A 2GXUA 4UUPA 3W6UA 4HUQB 3LBFA 3HUDA 3Q98A 4G8CA 4JDPA 1EE1A 1UP4A 1TOAA 2OCBA 3AVOA 3NWEA 2DCUA 2FUG1 4JT9A 5C34B 2FJUA 3ENNA 4U7JA 4DCVA 1YS2X 3BKXA 3C97A 1YKFA 2PJRA 2O06A 4HAOA 1FU4A 4KSYA 3GVIA 4FNMA 2ODQA 3JD3A 1BDIA 2XGMA 4XM1A 2NQ2C 1NNI1 3WOHA 1SAYA 2FGKA 4DA0A 4L8YA 1D04A 5G0WA 4P58A 3RAJA 1VL1A 2YJGA 2WIDA 3WYAA 4JH0A 5HOQA 1S1CA 1S2GA 2MINA 3TUZC 1A7UA 3LY7A 4Y9SA 1J1IA 4I46A 3R7DA 5DISB 1TQ2A 4LQDA 3B38A 2WEKA 1K5DA 1PGOA 1LLCA 1UZMA 3OZUA 1R0XA 3DFFA 1ICIA 3CRRA 5L7WA 4RY0A 2N75A 3N3AC 3V4SA 3FKJA 3ETEA 1SURA 2IK8A 2VK4A 4Z4HA 2CV0A 1N2ZA 3L6BA 3MWKA 5LZ8A 3MYYA 2VT3A 3WWEA 1D4AA 4I4IA 4BN4A 5EJ8A 1X0XA 2LIVA 4R8LA 5JS1A 2GD2A 2NP6A 2DWUA 3OEED 1RI5A 2GKSA 5JAIA 2L19A 2DQZA 3SXUB 1ECJA 3KG2A 3N2NA 1MW9X 1R12A 3F9IA 1H6DA 1BC5A 3E9QA 1PJBA 4FDMA 3RYCB 3N74A 2ZR7A 4O1MA 3WZLA 1OYWA 4DCJA 2UU9B 1CF4A 2Y1LA 4LYGA 1XVTA 3GRFA 2P9TA 1TPZA 2XT6A 2BKAA 2GK4A 2D1SA 2IHJA 2JJ1D 1E1CB 1KEVA 3HDHA 5FTMA 2HRZA 1P61B 1GGEA 3ON5A 1SN7A 5CLIA 4EL5A 1BTOA 1T3SA 2PMFA 1JKXA 5JWHA 4OBBA 5C7IO 5JDCC 4IWXA 3C1OA 1QHYA 1L5WA 2QSZA 2QX7A 2I34A 1LJUA 3WI7A 4LHSA 4CKEA 2BWJA 4EDHA 4ZDJA 3A70A 3O31A 3W4KA 4Z7QB 5JR3A 4D9NA 5K2OA 5IULC 1F0YA 1YQUA 4DMFA 5DWDA 2XHZA 4UD2A 1GDDA 3FSEA 1FSZA 1JR3D 2OBXA 4XUCA 2QAGB 3N2YA 5BY2A 3B1FA 3P4XA 4FJ2A 4LRQA 4ZAWA 1PR9A 3RS4A 2FRVA 5EG5A 2SECE 3P9YA 3ZKAA 3ZWQA 4QOFA 4FQ5A 1ULZA 3R3VA 4BFLA 1UBKS 1VKOA 2FE1A 4DNFA 1AQIA 1EP3B 2EGGA 3ILVA 4MWGA 1QFSA 4LJSA 3C8DA 1HR0B 3AVVA 5HF5A 3JQ7A 3ZU5A 3NOXA 3RKUA 3VZBA 2H1LA 1KFCB 1OXTA 3IODA 3IP9A 1QHHA 3SGLA 1FTQA 3KJIA 3FVTA 2PZLA 1SC4A 1SOMA 5HEKA 3RJTA 2YS6A 3IDSA 3CNNA 3PR3A 3R2JA 4ISBA 2I91A 1QRUA 1EVYA 3L40A 3A58B 2QL7A 2YWRA 3TRDA 4LX0A 3CVJA 3W9UA 1NPDA 1OT3A 2R6GA 2C9YA 3EZ6A 1R66A 4NH0A 1IZ0A 3KR0A 1VGVA 4V1CI 3KZCA 4E51A 4BP8A 1ZRSA 2I6SA 2Q3BA 4ITVA 3ROMA 3OC6A 2JZNA 4TZTA 2Q3JA 3RBAA 3PPYA 4EHIA 4FNOA 2R8RA 1TAHA 1C0EA 3UH1A 3WKCA 1E5XA 2R62A 4UTVA 1RYBA 1S2LA 2QRLA 5J47A 1VRCA 3S2YA 3K2BA 3UKDA 2Y0BA 3IBGA 2AYXA 5ADUS 2UUBB 2ORIA 5C52B 1HL7A 2FX3A 3OKPA 2WUGA 3R3JA 4OTZA 3WYDA 2ZUTA 1OTXA 1XE3A 2BM0A 5E2AA 2REQB 1Y4SA 2INGX 1RRMA 4OHBA 1UT6A 2CDNA 4B83A 2WP0A 2Q3LA 1RWQA 1LRKA 1W4LA 2ZI7A 1ORWA 3QWIA 4MCHA 1KI6B 4GD3Q 5JSHA 1O0CA 4NPHA 1MJNA 4LPSA 3PHBE 1D0VA 4B43A 4WCFB 1QHHB 4DC9A 3THSA 1DUIA 3ZIUA 3UK0A 4YHBA 3BTOA 3CZQA 5IYZB 4R9UC 2YH2A 4Q9HA 3ND5A 3OLVA 2R7NA 3JQ9C 5JCXA 4DTIA 3B52X 4IHJF 3DMDA 1VL2A 3GJ8A 4XWWA 1U02A 4KQ2A 2G80A 4JELA 1HLGA 4ZOEA 1RNLA 2WJYA 1Y8QA 3WG9A 3NX4A 2Y2VA 1L7MA 3CX7A 3OFJA 1NFFA 2IKSA 2ORWA 4LZOA 2JBWA 1RFGE 4AJLA 1I6LA 1ZMOA 2UYYA 1TJNA 5H5JA 3RK4A 2NVOA 2YFKA 4AX8A 4MPTA 2VCEA 4WJKB 4RTNA 4KMSA 1IJEA 1WOYA 2UVDA 5TS3A 3C1UA 1HTBA 4PBRA 1T4MA 3C85A 3PFCA 3QYAA 3A2MA 1L4YA 1U3GA 2DULA 4KR0A 2PMEA 1N34B 3D8TA 1XJWA 2X6RA 2D0OB 2ZSIA 1K0FA 2P9HA 2ZI5A 3H8JA 1T5OA 3C8HA 4OHYA 5B58C 2BUCA 4G8JA 4DCUA 1M6NA 3NHAA 1Q84A 3VPGA 3TLEA 3ILHA 4ZARA 3HBJA 2PBLA 2YWFA 2Z8YM 4PLFA 4RD2A 3VU1A 1JQ5A 4FMCB 3JALA 4OA5A 4IO1A 5ER9A 1EMDA 3WWDA 2O2HA 2JRCA 3R3WA 3K9LA 3TCKA 3CXUA 3R6DA 1E2NA 3PA8A 5J4KA 3KQHA 4KLNA 1X7DA 4QPDA 2CUKA 1RLTA 1NLFA 1JJAA 4CU5A 2P9JA 4P0QB 3R5TA 3LI2A 3OCUA 4LDQA 1IVNA 2NV0A 3B7WA 4LGYA 2BRUA 2BC9A 4J3FA 4L2IB 2WFAA 4M46A 2I5PO 1PDVA 1Y34E 3DDNA 4QG7A 3VYTB 2DRIA 1UIMA 5ALRA 2VAXA 1SCIA 1AZWA 1L7NA 4MROA 2IXGA 5AVRA 2RK4A 1C81A 1LV8A 4COOA 2RG1A 3FNRA 2AC4A 4NS4A 5G2OA 1H22A 3COZA 2AQIA 4ZVSA 2W6OA 3RSQA 1YFZA 4G5FA 2X5JO 1XNQB 3BRWA 1W88B 4QQFA 2FEKA 1P75A 2QZ9A 1EVJA 2JLYA 2ZJOA 2V3WA 3BORA 5A7HA 1VZ2A 1NVAA 3QVKA 2Q3MA 1F8GA 4WKBA 2FJ0A 2ZZMA 4O4HF 1QC5B 3VUFA 4EYGA 2QMHA 3TLAA 2PXCA 3F6YA 3PX7A 1N2OA 1WVIA 3IEVA 1T9DA 4Z0TA 1K7FB 3E1SA 4E1BA 3GCGA 4OLJA 4OOEA 3A4MA 4WY5A 3HUFA 4V24A 5AUQA 4R1QA 3W0LB 2O5RA 4C30A 2GERA 4LDAA 1RBQA 2BFBB 5BMVF 3W8EA 1IE3A 1ZD1A 4RHFA 4W1QA 5LDGA 4KQFA 3RROA 3AJAA 2UZIR 2HJ9A 2Q9AA 1RWPA 1CQXA 3GZTB 1FFEA 2Q1WA 2GAIA 4NCNA 3TKLA 1QYRA 4C2AA 4RZQA 3UW3A 2CXUA 3WA7A 4AIRA 5LYJB 3CE9A 1G9XA 1SBYA 2H2DA 3G1TA 3KV1A 1TCUA 3I72A 4J1SA 3TQTA 4D0GA 5JXJA 5B6JA 2YX1A 4AZ3B 2HSEA 2EG5A 4FFBB 5DOVA 3WZMA 1PQUA 1RP1A 3T0GA 2VVTA 3ITEA 4UEOA 4YRBA 4ZAVA 2BEVA 5JSZB 1UFOA 4X95A 3JARA 3LC1O 2D6FA 2PDAA 2D5CA 5EPEA 4EK9A 2UZ4A 2OHXA 2GM3A 1XU7A 4FU0A 1AKUA 3CVWA 2HK6A 5EWMB 1LDMA 1L9KA 4DGQA 2X1VA 3R9XB 3TQHA 5KX5B 5I4BA 1P2BA 3JAWB 3I73A 1IY1A 2ZRAA 2ZB2A 3LCVB 4ILKA 4PCUA 5BORA 3CR3C 4TLLB 5L4LA 1U7WA 3WGMA 3G3EA 1T5SA 1PD1A 2FP4B 3C7AA 3DW3X 2Y6UA 4A92A 1LSJA 3M82A 1QM5A 3DJYA 2Y0PA 3NGMA 3RVMA 2QMUA 4CLOB 4UBJA 3ZCUA 2VXBA 1G19A 3G2OA 5IZCA 1IY2A 4HJRA 2GILA 3IAS6 3NBYC 2NNWB 1I30A 2RGNC 4GE0A 5FPTA 4ZEWA 3TKYA 4BZXA 4C3UA 1X7XA 2HRRA 4NZMA 1Z9BA 2C8KA 3BWMA 5BVHB 2IL1A 3ZX5A 3WLNA 4R9RA 5KNCH 3FYDA 5E6UB 4ZAGA 1XROA 3LQFA 2AWOA 3BGSA 1X15A 1JNXX 4YUVA 3A6GA 3IERA 5KSWB 1E3EA 1XVUA 1E3QA 2QP4A 4FOPA 3G17A 1UPFA 3PLNA 3STHA 4CTOA 2EFYA 3GBSA 2VYND 3JYPA 4DLLA 4R1MA 5KYYA 2Q9CA 2V96A 4GYYA 4K9NA 4AW9A 4MHOA 5AI6A 2Q5EA 5I01A 3LT0A 4BZZA 4DLVA 5KWIA 2VWHA 1R50A 4YWJA 5IAJA 4R3WA 2Q1XA 4I1OA 1G7RA 5F5XA 1RM4A 5KMGA 2FPIB 1OX6A 3Q6NA 1FP2A 3TW8A 1FTGA 1QOQB 1XD8A 3QPDA 3WK5A 5DM60 4DEYA 3AVQA 3DB1A 3GNTA 3AUSA 3NHPA 4EECA 3BC1A 1XA3A 3MWFA 3LDFA 4KXQA 1LBSA 2FDXA 2FYTA 3K6JA 4RIGA 3UT0A 4YT2A 3AF4A 3EVTA 2NO4A 3SF0A 1F6DA 4K9DA 5KVAA 3L4KA 1K2VN 3CH4B 2P7IA 1DIHA 1IIRA 1V2HE 5EKSA 3A9CA 2C0PA 3KB2A 3ZHTA 5KTSA 4L5JA 2W0MA 2YBEA 3Q10A 2GJKA 2R8BA 1F8YA 4PQYA 5D5HA 3PGXA 4RGYA 5DB4A 2XNJA 2Z9CA 4GP6A 3A1CA 4W4TA 2XGOA 3HVHA 1G1AA 2QRGA 2AOTA 1I3OA 2X7HA 2OG1A 2PSEA 5FJIA 4KX5A 4F91B 1ETHA 4O4JF 4RK1A 3MZ0A 1DXOA 1O94A 1E0AA 1RWKA 3M4YA 3P32A 4A26A 2ZT8A 2J0QA 3ES9A 3F7NA 4J1QA 1JLHA 4DLTA 3HB7A 3PK0A 1WQ4A 5CXQA 4X1IA 4XASA 1SB9A 5EHZA 2EGUA 1XYGA 4M21A 2RJNA 4JUDX 2CSUA 3AM1A 4C2TA 4JEMA 1FSPA 2ZJ0A 3N6XA 3WMWA 2AOUB 2QR2A 1ZBQA 5IZ4A 4F2WA 4RKEA 3V1MA 1EVEA 3PL1A 3OC0A 4CG1A 3ET4A 4XUDA 1PQWA 1ID8A 1Z7EA 3G88A 3GAMA 4MB6A 2VZ0A 5ED4A 5IEJA 5I7VA 2Y05A 2EL7A 4B80A 1PG2A 1RC1A 4Q37A 2IHNA 4IMRA 2JIBA 1HNXB 2N46A 5EHGA 1UBRS 5K3DA 3PDIA 3A1WA 4ZTZB 4ENPA 1N5JA 1N2CA 3LUDA 3NPMA 5FT9A 4BLTA 1CZOA 1WMSA 2ZCUA 1N5MA 3P96A 3AVUA 1U7TA 3N8GA 2E4AA 1E66A 3O4RA 4G5RA 4TRMA 3N2IA 1V6SA 4N5NA 4PCAA 4N5LA 4QWMA 3ZU3A 3DBLA 4O2BF 3WNBA 4MB0A 1BRTA 1ZOOA 3HP1A 2PX0A 2A5FA 4WZAB 1KSFX 4K2AA 3A36A 3GFSA 1IN5A 1DGQA 1A9ZA 5CA1F 3B1XA 3JS5A 5JQGA 2C88A 2IYPA 3QPCA 2D74A 2HCBA 3AY0A 3EZ7A 1EFVA 3I2YX 3QE3A 4XTRA 5DBFA 2J48A 1R16A 3KL4A 3N7AA 4OKIA 4KNVA 1CUYA 4QYMA 2XNHA 4K3VA 3RVRA 2Y99A 4HNSA 3FNQA 2JLWA 3VTKA 1JRLA 3IRUA 3RDPA 3RRMA 1TUBA 5IXSA 3AHJA 1JSLA 2AI2A 2GK3A 1FLVA 4IDEA 1QBKC 2C3PA 4XE5A 5HF6A 3W3AH 1Q6ZA 5ADHA 4KQIA 3DAHA 5H59A 5CDYA 1JFLA 1RAEA 4ZVMA 4DDTA 3BL8A 1P4HA 5BNTA 1P81A 5KTMA 1ENOA 1VJ1A 1ODCA 4OMUA 4UHDA 3VZPA 1CR6A 1XZBA 4PHHA 4U63A 4ZYVA 5HM6A 5FL7A 1SELA 3PSHA 4R9SA 4EG5A 1O0BA 1FZTA 2JIPA 3I3SR 2F1IA 3KTOA 3WSWA 2YIDA 1TLLA 2AMJA 2CY0A 3ZQUA 2HBQA 4WKCA 4QD3A 4B7ZA 1RZ3A 1UJNA 2HTEA 4HLNA 3L0OA 3DBLB 3D1JA 5DTJA 1OIWA 3LPAA 1ZITA 1PK8A 3W2TA 5BVHA 4QXAA 4M8LA 1TA4A 2P9GA 1QIFA 2WPNA 3DE2X 3PXXA 4Q93A 4RHEA 3U81A 3EDQA 3E8MA 5HQTA 2OSVA 1G4AE 2OILA 1VMIA 3T52A 2O19A 1CD5A 4Y2VA 2LGJA 3OY7A 1Z7GA 2V58A 4BXOA 1WU8A 3H5AA 5C5EA 3H0CA 4OAOA 1OY1A 2RHLA 1XTTA 1Z0KA 1SUCA 4GMXA 5IBPA 4A03A 5GZ1A 4RTMA 3A05A 4UDNA 4WK6A 3GOQA 4Y2YA 3UVEA 2HJWA 1O6GA 2W22A 4DLPA 2FWPA 4GM1A 3ZGZA 1U98A 1PK7A 4BNDA 3CW8X 2A9KA 2BUAA 2I7CA 3OPXA 4OL9A 3BHIA 3A32A 1K1EA 1XA4A 2I2DA 3AP2A 3SJUA 2O8DA 1BXGB 4CM5A 2VUIB 1JSCA 1XR3A 4CKWA 1CVLA 2JNWA 1UH5A 4P3NA 4XIGS 1Z5OA 1Q74A 1ZGGA 3SVLA 4JXZA 4OQPA 2PUBA 3K15A 2AG5A 2QG4A 3HA5A 4JMPA 3DO8A 4NMHA 3R0XA 1L5YA 3WFJA 3HXMA 1C1HA 2NXNA 4HDKB 2HRBA 4TYMA 5FDFA 1E3WB 1ZFNA 3H99A 4EKNB 2FCRA 3FHLA 1U2DA 4YJKA 1C9MA 3GFBA 3K0AA 3AIKA 3C3JA 3EA0A 4II3A 3BEDA 4MUMA 5JG7A 2D5IA 3G13A 4ALIA 4C04A 4J16C 1D3AA 2A1UA 1BXKA 1NXXA 2CFIA 2X3FA 1F2UB 3WIVA 2X6TA 2RGWA 4NCHA 1L8OA 5E7QA 2K4MA 3NKVA 1FJXA 5KAPA 2DJIA 3PDWA 1JKJA 4N54A 2JCBA 2B78A 4W6ZA 3O95A 1YZ3A 3SE7A 3OESA 1CIPA 2VDQB 3F67A 1VB5A 4HMPA 5B1IA 2JVKA 2E87A 2YHIA 1U1GA 4KLCA 2OCAA 1V3VA 4RVNA 4EW3A 3PUHA 2XOEA 3QE4A 4G24A 4PICA 4Y6LA 3KSDO 4J0JA 3FOFC 2E0IA 3SHFA 1W34A 2PH3A 3DUFA 1KK0A 2P79A 1EWVA 2WMNB 4QOSA 5J5VA 3DTVD 4BKUA 3P9NA 4FE7A 4NNOA 1LDNA 5TPZD 3V2IA 1NATA 3B5JA 4BQNA 2OCIA 4IV0A 3WL7A 2OBBA 3PUYA 1C3OA 1JWBB 1FXSA 2AXEA 1M0TA 2IHVA 2R86A 3LJKA 5E3IA 3QNWA 2WSSA 4QLAA 3OPNA 4MS1B 3TXXA 2KYRA 3KC2A 3W3AD 1Q0HA 4G1MB 4B3TB 3TOCA 2X0DA 3PTAA 3RO7A 4U6QA 2G9VA 3ZU6A 3UMBA 4JB2A 1E58A 1QHFA 4QEDA 3H0KA 5SYAA 3KQLA 2CHGA 4MQFA 4L27A 1YD7A 2FN3A 1K4MA 2DBRA 2WM3A 4JUBA 4QXPA 3W2EA 4EB6A 3OPMA 4KDRA 3ELDA 4B3XA 4HYYA 4GLJA 5K8JB 3R6LA 3V48A 3VVCA 1QIDA 3MS2A 3OZFA 1NMZA 3ANMA 4G1VA 1M8KA 1USVA 3EEBA 5IAEA 5JARA 5TMPA 5B6IA 2HT1A 1HE2A 4Q3KA 1LTKA 4IRMA 4RD1A 3MTJA 4Y2RA 4UTPA 3U4IA 3AKEA 1FUYB 3BFPA 1W94A 4OA8A 2ENUA 2QTVB 3GFVA 2V65A 1NMYA 2Z2ZA 1H0KA 2JD1A 2PMCA 2SKDA 2ZRJA 4HH4A 4Q9DA 2DETA 1NIPA 1A0OA 1D6JA 3PZBA 1YZUA 1CUAA 3T1OA 3FPAA 2L69A 3IIMA 3T0IA 2G0AA 2JJ2A 4OH1A 1R8XA 1WDKA 4QODA 4DLBA 4IMJB 2QM0A 2BUBA 5E6RB 4XWKA 1S2MA 1N5RA 1VDMA 2QLBA 3CE6A 4Q01A 4TWJA 3VHQA 3D02A 4XVQA 3VZDA 5K09A 2VHEA 2H3HA 2BONA 2P9CA 2QGZA 3THYA 3RSFA 1BDBA 2FNAA 3ZIDA 4YUYA 4KMOA 4WK0B 1PVOA 3BQNB 1TDJA 1CZUA 4BV2A 4JI5B 5IAAA 3I23A 1YOVA 1YRQA 2BFBA 1UKEA 2P2ZA 2P11A 1EUDA 4BKQA 2IZOA 3A4NA 3Q1LA 3GELA 5I4KA 2JLBA 1QF6A 2WYWA 3NT5A 4GP9A 2ZT6A 2IIQA 3GDGA 4WBNA 1CJMA 5ETJA 4YDQA 5JNSA 1XKQA 4ZJUA 3FIJA 5FXMA 4AMYA 5DM2A 1O7JA 4U7TB 2PWBA 5IJ0B 4ZP1A 3NATA 3BQMB 4FFLA 3AH8A 2P9BA 3F7OA 1MAUA 3GVCA 4XXHA 1VCHA 5ALIA 4AMZA 4S04A 4FHZA 2AOXA 1TF7A 2P3OA 2C92A 4X7BA 1JHXA 1XALA 2UUOA 3M4ZA 5DNYB 2DR0A 4ZQFA 1M6VA 2WWFA 1AG9A 1QFZA 1ZGHA 3G9XA 4QASA 2TRSB 3KWJA 3H3FA 3QWBA 3R5XA 4RF4A 1BU5A 1WBJB 2Y71A 5HJ5A 3EJ6A 5TVGA 5J43A 2CKMA 1R0KA 1XZDA 3N1UA 2G06A 3AILA 5CIWA 1ID1A 2HQRA 1AHNA 3JWPA 2BZ0A 3K7EA 4LISA 4L02A 3IYLW 4PYOA 3ROFA 4DHWA 1UT5A 4MV1A 3D6MA 4ZVLA 2CLOB 1PU2A 5B53A 3G8AA 2H5IA 2EKBA 1J0XO 2QJWA 2VNAA 3WIOA 3DR3A 1NWCA 3KM0A 1LPAB 4KAXA 4PBTA 1G3IA 4NZNA 1FS5A 1V11A 2V5UA 2XMBA 4URZR 5JVDB 2JLAA 4E5PA 1SVIA 4LI0A 4PNHA 4IDDA 1HE3A 4BNYA 1PFYA 3G1UA 3B2NA 3EPPA 1CUIA 4V0OA 2CD7A 3B3FA 3DV2A 5BW5A 4IEFB 1E89A 3SQNA 1Q1ZA 2FRDA 3RTAA 4B75A 2IDMA 5IXJA 1AKTA 1W75A 2XDYA 1VYTA 1T8TA 3AR6A 1BKSB 4ZEVA 3C8MA 4FFPA 1LLUA 3FDFA 5UKDA 1XTUA 2GJ9A 2GZDA 3RFFA 2FXVA 2VDMB 4Z4FA 4RH0A 2PWPA 1JXAA 2XB6A 3EXG2 1ZDMA 4L4XA 1Z0UA 4FGWA 4M38A 2PD3A 3RHZA 3V80A 4AN0A 1X7ZB 1IK4A 1DXQA 1J7KA 1MX9A 1EPUA 3OICA 4GQBA 1NJ8A 4TV8A 4Y3UA 2V1XA 1NYRA 2ZAIA 2D2FA 2XWJI 5DHFA 2C7PA 2Y3IA 4XRGA 3H2KA 3NMUF 3G7NA 3ZCSA 2WB2A 4HADA 4QFCA 2D59A 3LPCA 1XHEA 1GZ3A 3HJGA 1LPSA 3H87A 4GE3A 1H65A 3ENKA 3JQGB 2D4HA 2RGCA 3ETJA 2J8ZA 2W6JA 5FWYB 4XVRA 1NP3A 3P2OA 1NC1A 2XMRA 4PFQA 4Z0HO 4EBBA 1R4MA 3DF7A 3BJMA 1OFGA 3EWAA 3NBKA 4UPEA 1IK6A 4E0BA 2CDRA 3M8KA 4PN3A 4IIJA 5K0ZA 3CYFA 3ICWA 3E7PA 4UKDA 2EP7A 4MYUA 4ETNA 4AUMA 3G89A 2IHTA 2O05A 2C2YA 4GFDA 5DM1A 2GR9A 4WCFA 2JI6A 5AJWA 3EB9A 5HFJA 2Y93A 3ED5A 2OHFA 2JRLA 3U3MA 1UXGA 4BQSA 3JQBA