2VPPA

Drosophila melanogaster deoxyribonucleoside kinase successfully activates gemcitabine in transduced cancer cell lines
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
192
structure length
189
Chain Sequence
b'TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPKVLVLDADL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Drosophila Melanogaster Deoxyribonucleoside Kinase Activates Gemcitabine.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 71
structure length 189
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vppA00
2ZRAA 3F8TA 3K09A 3OFNA 4Z54A 1SHZA 2WIBA 4EPVA 2IXFA 4Q21A 5D3MB 3B8HA 2AX4A 4TYNA 1TL7C 1XD8A 2WPDD 3P4XA 5G40A 3C5HA 2GK7A 2QQEA 3EPKA 4HB4A 5GVRA 3BBPA 4LX0A 2WMOB 2EYQA 2QI9C 1GNQA 3MJHA 3NG1A 4G5QA 5JJLA 5EE1A 3LLUA 1KI9A 2KWIA 4M1KA 4US1R 3ZYCA 3ZD6A 3EIHA 4PAOA 3S1AA 4TL9A 2WWGA 1SHKA 3JVVA 1T5LA 2WAYA 1OHHA 2FSFA 3BXZA 3BD9A 2ZJZA 3FPAA 3O8DA 4B73A 3QBVA 4V0ME 4CW7A 2CLCX 2F1IA 1KI4A 4MYCA 5AJZA 1MABB 1SZPA 1T9HA 2A5JA 3QI2A 3ZVLA 1CU1A 2ORVA 1N0VC 2V8OA 4HZUB 2IUUA 3FB4A 5JLJA 1HURA 1ZNWA 3BFKA 3CW2A 2D7DA 4Q03A 4KVGA 1ZNYA 1NSFA 2ZI5A 3Q85A 4LUCA 4Q4HB 2ZRCA 3ICQB 3DEFA 1XTIA 3FKQA 3GMTA 1KZGB 2V7QA 4D25A 2X8AA 2EFDB 4Q19A 4TLAA 2C5LA 2GAOA 1GKYA 1IBRA 1JJVA 1GIAA 2BBTA 3O47A 1U2RA 4JBXA 3T1QA 3TBKA 3ZIAA 3ZZTA 5LD2C 2R44A 4JLBA 3S1AB 3K0EA 5K8TA 4LJ7A 2QQ0A 1Q57A 1ZCAA 1QG2A 1P75A 2XGJA 1UM8A 1N5LA 1SVLA 1X8LA 1W44A 3K70C 1WCV1 2GKSA 1QHGA 2J1LA 1GWNA 1PLJA 1E2JA 4AYWA 4HAUA 3I3SR 2ZE5A 5IT5A 3R8FA 3KJGA 4ZI2A 3BE4A 3T12A 2FNAA 1T8UA 1Z6TA 2ZSDA 2NTYC 4H1UA 4GZLA 4YDHB 3V4RA 1DG3A 4MQBA 3RHFA 2OCYC 4NKRA 2RCNA 3LFUA 4B34A 3U3RA 1UKEA 1SVOA 2G1JA 2RAPA 3FHOA 5E4FA 3I5XA 4AKEA 5HKKD 4M53A 1H8EA 2PZEA 3ZZUA 2MSDB 3GEHA 2ZSBA 1KJWA 2QM8A 4PR0A 4OJQA 2IWHA 3KQHA 2P65A 3EZFA 5FPYA 2PMDA 3KB1A 4AG5A 3AM1A 1GKUB 2RGGA 4GZMA 2W2VA 1XMIA 3SNHA 5IK2A 4I1VA 4JLJA 1DO0A 1D2NA 1ZM3A 5JMTA 4NCKA 3VR6A 2VIIA 1KI3A 1R5BA 1GRNA 5AUNB 1G7RA 1TU4A 3SEAA 4M0LA 4BZPA 3EPLA 2H92A 5IF9A 3I61A 1E0AA 4MRVA 4UJ5A 3ZZ0A 4HLQB 4AK9A 2ODEA 3VMFA 1QVAA 2ZROA 4B2PA 1ZUHA 1YVDA 4NPHA 1YR7A 2QL6A 4D26A 1W2HA 2NO1A 5BN5A 3KX2A 1XU4A 4LYAA 4A82A 4YMSA 1F2UA 3K9LA 5KHOC 1KGDA 4C2UA 4WZ6A 1P60A 2VF8A 1L4UA 121PA 2KSQA 3A1UA 4Y0AA 1COWA 1MRNA 1E1RD 4B3FX 2WJIA 4FWIB 1QHXA 3ADKA 2E9SA 3BH0A 1OKKA 4JLOA 4QBGB 5JJIA 2ZR0A 3FTQA 1GUAA 2QU8A 4TQUS 3AVUA 1TPZA 4S35A 5CYOA 1T5IA 3AVWA 3TGPA 3DM9B 2HYDA 3CPHA 3KB2A 2PMKA 4M9ZA 1YZUA 5DYGA 2A3RA 3B82A 4B47A 5BXQC 1CR0A 2CVFA 3SHFA 4PPFA 4XD7D 4TZ0A 1TQDA 1E9AA 2WJYA 4QHYA 2Z4SA 1EFUA 1PJRA 4BFVA 4C4PA 1U0JA 3SE0A 2ZSAA 1F2UB 4BEJA 4GOKA 3AUXA 2RGBA 1M2OB 4DCSA 3OE7A 2Q3HA 4JLAA 4OQFA 5J5CA 2XEXA 4IDNA 5JECA 2VEDA 3Q8XB 1A2BA 3I4LA 5JHHB 1WA5A 2W58A 5JSZA 2O5VA 3G82C 5GJBA 4LHZA 4JL8A 1XMSA 3LQRA 3NTUA 1W5SA 2ZJ8A 1VG9B 4KLZA 2CCGA 1US8B 4ZO4A 4B2LA 4TSFD 4TYPA 4M1MA 2PJRA 1U94A 3JVUA 1CJUC 2CK3A 3LW8A 1TUIA 2SHKA 1GSIA 1NIPA 1TUEA 2E87A 3GLIA 4AYTA 2ZSEA 1KI8A 1W2GA 2QY9A 1XCPA 1A5TA 2XSZD 4DSOA 2W6JA 3KFVA 4A2WA 4BLSA 4ZDIA 4JLNA 2J46A 1NBME 1JBKA 1YRAA 3SYKA 4A15A 5J4HA 3L0PA 2ZYWX 2WWYA 2HF8A 3U3MA 1R10A 2WM9B 4HUQA 5FI0B 2FFQA 2ZPTX 4Q7KA 3GFOA 5JSZB 1M34E 1PZNA 2OZEA 2R6AA 1S8FA 4AC9A 2I1QA 5F9HA 2CHGA 2ZI3A 2XTNA 1G5PA 3A1SA 1TF2A 2ZAOA 4LYHA 3SYNA 2GAAA 2W0SA 3HR8A 4HEJA 2XNDA 3Q72A 4M1SA 2OG2A 1D8TA 2C9OA 3GCGA 2C95A 3IPXA 4A8JA 2PCLA 3SU8A 2G0TA 3QKSB 3GLIB 3NDBB 4LPSA 5EP4A 3Q7PA 4BECA 1OXVA 3AVQA 2AK3A 2NG1A 3GP8A 1FPMA 3OIWA 5IDVA 2ECKA 3IBGA 2ZYTX 4OQXA 2ZRNA 3WMGA 3OF5A 2D2EA 1AQYA 4UQOA 4O3MA 4XVUA 4LY6A 4A0GA 2MSCB 4HUQB 1OYWA 4TL7A 4AURA 3SQWA 2JJ8A 1NMXA 4B3CA 4B76A 4NTZA 2ODBA 2JLUA 1M7HA 2IXEA 1IN6A 2Q3MA 2CNWA 3Q5DA 1N6PA 1UPTA 2QGZA 4FMCF 5CDFA 1Y3AA 1SVKA 3LXXA 5TARA 4B74A 1U90A 4LJYA 2GJSA 2EFEB 3VTKA 1OB5A 1ZM9A 4U00A 2GJ9A 3QUSA 1IN5A 2JDID 3LH5A 2BMDA 3ZDQA 4A8JB 4LDJA 1FQKA 4DXAA 4IDOA 1P72A 2WPDA 2YJTD 4B3XA 2EYUA 4Z1MD 1K6MA 2UZ3A 3T35A 3O8CA 5G3YA 1XJQA 1J90A 2G83A 3WHLA 3CX6A 1LF0A 6Q21A 1KK2A 2FPLA 3EZ9A 4BZXA 1G41A 2X2EA 2ZVPX 3SBEA 2J0VA 4TMZA 3B1ZA 3WMFA 4EUNA 1E94E 1GRRA 2OFWA 2VSFA 1KNQA 2PT5A 2VP9A 4HLCA 4R71A 4RD6A 1YR8A 2P5TB 2X19A 2J0UA 3F5FA 1EFTA 1N5JA 4YMVA 3RWMB 5K8LA 2CJWA 3ICEA 1ZC3A 2A5FA 3CR7A 1ZD9A 1OIXA 2JJ2A 4V0NA 5B30A 1G8YA 4C9BA 2WKPA 3ECCA 4B3BA 4P4UA 4RJLA 1KNXA 1E69A 1OE0A 1B0UA 1P9RA 5BWMA 4K8OA 2GTPA 1D5CA 2GXSA 4YLGA 3NHAA 5E7JA 4EQ6A 2IYSA 2OBMA 3EZ6A 3KKQA 2XZLA 1SVMA 4TYQA 3NH9A 3TAUA 2FA9A 4PSAA 4UNQA 2H8KA 1BO6A 3LBIA 2JLWA 4XVRA 1LS6A 3HWSA 1UJ2A 3LVRE 1E1QD 4G0NA 2YC4C 3QXXA 4RD2A 1ZUIA 2GHIA 3K0AA 1P9NA 2A7QA 1E0JA 2EFCB 2W6ID 3NC1C 2RGNA 4QC2A 2QPAA 2OFXA 1S3GA 2IHYA 4ZDJA 4V03A 3EIEA 4ZCIA 2J0UB 1W46A 2CJWB 1CR4A 3CH5A 2H18A 3J81k 1Z5ZA 3U7GA 4G1UC 1FZQA 2J87A 5KPDA 3B1YA 4WXRA 1DO2A 1P2UA 1GDDA 4FW9A 4EQ6B 3TR5A 4IDPA 1JR3D 4V0OA 4BFXA 1GL7A 3AVYA 1XZPA 4A6PA 1W0KA 3KQUA 4BFZA 3OEHD 2H1LA 2YWEA 2H57A 5HKKA 3KL4A 2A5DA 2C8VA 5CIWA 3K0AB 3MSXA 2V1UA 4U7DA 1IN7A 1OB2A 1UBCA 3ONWA 3H86A 4D4KA 4BLTA 3QPVA 4FCTA 1UEJA 1E2EA 2IF0A 4HB3A 1WBBA 1ZM7A 4PSKA 3TIFA 5J4LA 3P26A 5C46F 1Z6AA 4IVPA 4RD4A 1UADA 221PA 1QDEA 4KFRA 3SDZA 1M74A 4GDFA 2WHXA 1KO8A 1N6IA 1II8B 4WAUA 4LWZA 1A82A 4OHZA 3WYGA 2ONKA 2YC2C 1Y63A 4IOLA 4UNNA 1KO4A 2ERYA 1WRBA 4ESVA 5HR5A 3M6AA 1SXJC 1XEWY 3GQBA 3W5JA 3T06B 1JECA 4XWKA 1ZMXA 3N2IA 3ZVNA 3C14C 3GEEA 4P4TA 3X2SA 3GLIE 3GJ3A 1DAHA 2GA8A 1G7TA 2G3YA 4GI7A 3EX7C 3QEOA 4JYCA 1A4RA 3RDPA 2F1JA 2WSMA 2VPPA 2ZAMA 2AN9A 3VU9A 1IHUA 5L3VA 1Q0UA 2B92A 4W9MC 1Z6XA 4IOKA 2HXYA 1F2TB 3QVVA 4MDFA 3QKUA 2QENA 4A92A 3AKEA 1X1RA 1E1RA 2BBSA 5F3WB 2ZSFA 3V4FA 2VLIA 4US2R 1EFCA 4PQRA 3CM0A 2OAQ1 3B9QA 3KKNA 1R6BX 4YC7A 3JZAA 2R8RA 4PANA 3VQTA 3L82B 3RS7A 1AKEA 5KSZA 4WZBE 4EPXA 1XEXA 5DGXA 4EJSC 1NKTA 2GBLC 2BMFA 4JBWA 1GM5A 2WIAA 1Z0AA 4KV9A 1Z0JA 4GOJA 4P4SB 2ZS8A 1T3HA 4XD7A 1YZQA 4M1YA 3BH7A 4MRSA 4EPRA 1W4RA 4BLQA 4EFNA 2I3BA 1G4AE 4DEYA 2OCPA 4HUTA 2C78A 3VU9B 3W3ZB 5GJVC 1H8HD 5C1BA 5J4VA 1E2LA 1E9BA 4LHYA 4V02A 2FDCA 2ZVQX 3K1JA 4N1AA 5F98A 5J40A 3SOPA 4UXJA 3PITA 5CDFE 1NG9A 3QY0A 3LAWA 2EWVA 1VCOA 1KK3A 4Q66C 5EP3A 3CWQA 1FP7A 1CJTC 1T4GA 4TSFA 3GLHA 5KYKA 3HJNA 3CB4A 2F3TA 1XEXB 2NPIA 2DBYA 1RPZA 4QKQA 1R4AA 2YV5A 3DHWC 4I1SA 1AS2A 3RS4A 2CL0X 3MCAA 1NP6A 2BMJA 2XSZA 1B23P 2QUZA 621PA 2FG5A 1MKYA 2VL7A 1ZU4A 3OEED 4R2IA 4RZXA 1CULC 3FKSA 3A4NA 4Q4AA 1GNRA 1AN0A 1FNMA 2PZFA 3PJRA 2BM0A 5KTYA 1E2DA 2P6UA 1R8QA 4C0QC 5E7MA 4BRWA 4GP7A 2VSOA 4IW3B 4FWTA 3CF0A 4IXNA 3TSOA 1R0YA 2IYQA 4DLYA 2V54A 4GSYA 3B1WA 3EAQA 2IL1A 1XD2A 3RABA 4C0BA 1HYQA 2Q9CA 2FOLA 1P73A 1G20E 1G8FA 1PLKA 1VCNA 4ILEA 2QP4A 3QG5A 1LB1B 2QM7A 3X1DA 4GP6A 5FPHA 5FTLA 4JL5A 1OFHA 2DFNA 2BBOA 3REGA 1E9EA 2QP3A 3SZRA 4D80A 1YU9A 2KBEA 1U81A 4BLRA 2XTZA 4IFEA 4TL6A 4LHXA 3VR4A 5B57C 1VDZA 1OFTA 2LKDA 4XJXA 1NLYA 1GVNB 3K70B 2VA8A 1KHTA 1C1YA 1IY1A 4URYR 2CHQA 3QSYA 1GRQA 1CXZA 2A2ZA 1G3IA 3GJ0A 2G6BA 4JBYA 4KODA 4PPGA 3NWJA 3CRQA 1XD2B 2FSGA 4AYXA 4HAYA 1G7CA 3QIAA 1E9FA 2DFTA 4L8GA 2VTKA 4L5BA 4F4JA 2JDIA 4PHHA 1SVSA 2KE5A 2ZR7A 2HLDD 1Q1EA 3DZ8A 2DWOA 2ATXA 1D6JA 2ZRGA 3IHLA 1SXJD 4Q00A 3LNCA 5CJ2A 4QXAA 4Z1MA 3GJ8A 4IOJA 2EFGA 2G77B 4NH0A 5C4MA 1MV5A 3KUCA 1Q44A 4B33A 1CR2A 1H65A 4CT4B 2J45A 4JLDA 1XCGB 4Q7LA 2GJAA 3A8TA 3AEZA 2XJ4A 5A0FA 3W8NA 2XXAA 4MDEA 1OYYA 1T6NA 1XWIA 3EZ2A 3IEVA 3KJHA 1VG8A 3SI7A 3AF0A 5JWRA 2J7PA 3RNLA 4QM7A 3BERA 2XITA 3QQ5A 1E96A 5G3ZA 821PA 3THYB 3KUDA 2NOAA 3R20A 3GJXC 4LJAA 2HF9A 5AK0A 3W6OA 2ZRDA 4CGZA 2XZPA 4LBZA 4MGKR 4OI0A 2FFAA 1NY5A 1UDXA 1F6BA 3WP1B 2ZUDA 4KXFB 3SHWA 4URUR 3EA0A 3MWJA 2ZE6A 3DM5A 2OUKA 2OBNA 5LBIA 2A5YB 4BASA 5H8WA 3AKDA 3HDTA 1DEKA 1VIAA 5DE3A 2XXAB 1RRCA 1P2SA 3ZH9B 1CLUA 3BIFA 3RANA 1KDPA 1NN0A 2HCJB 4UNPA 3TR0A 1NVXQ 1WP9A 1CF4A 3HPRA 2W6IA 4YQFA 1NN1A 4XOIA 2ZRPA 2JASA 2O8EA 3MMPA 2O0KA 2V3CC 2OLJA 4P0TA 4AKHA 4HI0E 5FTMA 3KZ1E 3FYHA 4QJ3A 4J0QA 5TXGA 3X1ZA 4OKSA 3UK6A 5AR1A 1TU3A 2C9YA 3KXKA 2YWFA 3WRXC 4UNRA 5DI3A 3TUIC 1PVOA 3BJIC 1JR3A 4NHOA 3R9IA 2BV3A 1KTVA 5TMPA 1KAOA 1XB2A 2GJKA 2MMCA 2ODWA 4TQ9A 1KIMA 1GL6A 1XFAA 2QPOA 3MWYW 3PEUA 3PIRA 3OEHA 3ADCA 3DOEA 5TY0A 1N3BA 3M4YA 3RRZA 3LW7A 3QEJA 1G5RA 3QF7A 1EXMA 4CF7A 4JVSB 5AUOB 2ZU6A 3TNFA 3DL0A 5E3HA 1ZINA 1W4AA 4F4IA 2O8DA 3A36A 1G3RA 2O8EB 1XX6A 4DCUA 3AVOA 4LBVA 2Z0MA 2NZJA 1JI0A 2C03A 2EQBA 2GESA 2Q9BA 4LCBA 5EQTA 2F7SA 2GVDC 4DUGD 2XX3A 3ETLA 4HZIA 2Q21A 1XBTA 4HAZA 2VBCA 2IEZA 1QF9A 3FHCB 5DI3B 1FTSA 5EJEA 3W90A 4JT2A 4U5XA 3IGFA 1OXTA 1KJYA 2D4HA 1OF1A 2ZJAA 4BPBA 2VO1A 3KFXA 3WYFA 1E2QA 3N5CA 4B3GA 1TAGA 1W4BA 4RFSA 3W34A 1ZNXA 2EU8A 5HCIA 4DVGA 1FTNA 5FPKA 1SGWA 3CNOA 2OM2A 4JZKA 1XTRA 4FN5A 2O8DB 5TV2A 1EFHA 4D0NA 1WBDA 1RZ3A 4Q1DA 3SC3A 4QFMA 1IJEA 2DCUA 4RKEA 2OESA 5H68A 1NNEA 3UATA 4MKHA 5FL3A 1W0JD 4LV8B 2EW1A 3FOZA 3U7HB 1N5IA 4LJ6A 3QBTA 3VNUA 1EWQA 3WBKA 2PCJA 5FOUA 3RC8A 5HCNA 5HPYB 1GG2A 5JJKA 3OZXA 4C7OA 1UKYA 2LCFA 2XB4A 4XWOA 5E7IA 4ON9A 2BEKA 1DAKA 4JVLA 3ZVMA 5EP2A 2WSSD 3TK1A 5EUMA 1G19A 1MRSA 1V43A 4G3XA 2X1VA 5F2EA 5EZ5A 4O25A 4Q1CA 1BKDR 1J99A 1ZD1A 2PH1A 2FGJA 2YHSA 4PPQA 4LI0A 3NH6A 4NCIA 4JJKA 1XPRA 1KOFA 1OJLA 2KBFA 2WWFA 1DBSA 2GXUA 4DIDA 1S0UA 4OK5A 2R6GA 1H8HA 1KMQA 1ZNZA 1AZSC 4QRHA 3CPJB 3RS0A 1U0LA 4TLEA 2IYXA 3NBXX 2ZI4A 4Z51A 5EXSA 3AP3A 2V1XA 2NO9A 3TE6A 2VP2A 3IEUA 4OQMA 2ZI6A 4C7OB 4NZYA 1Z0DA 2GZDA 1ELOA 2R9VA 3LQQA 2LWIA 1II0A 2HCBA 5GVSA 2Z6VA 3VX4A 4BQSA 2NQ2C 4LHWA 1LF5A 4BFSA 4LJ8A 2DHRA 1JJ7A 5AJXA 5EE0A 2VHTA 1N2CE 2BEJA 2GZAA 2JLRA 3OEEA 4K46A 1EFRA 4FI3C 5FL7D 1P2TA 1CJKC 3MGCA 1X1SA 3IQXA 4IOMA 4JT4A 4TMWA 4GMXA 2OXRA 3CNLA 4HSEA 2WJGA 2GETA 2VP5A 1E2MA 1Q3TA 1UDWA 1YZKA 3AF2A 4OHWA 4Q1EA 2WWIA 4KSCA 5E95A 4I4LA 2OCAA 3B1VA 2WKRA 1FMLA 2CE2X 3JZMA 1M1YE 1N6RA 1W7AA 1UBFA 2JLVA 2WTUA 4ZDKA 3SJZA 5SZIA 4M1OA 2HXSA 2ZRJA 3PEWA 3PUVA 1ESMA 2YYZA 4DDWA 1NMZA 3PG5A 2O8CA 1MOZA 1Z07A 4DRZA 2IBMA 1MO6A 2ZRHA 4DLRA 1G3UA 1HV8A 2RB4A 4B44A 2GRJA 1JEEA 2KI5A 3B78A 1T8TA 4JVNA 4PC6A 2FZLA 4RD3A 4NYJR 3EPJA 2O8FA 1RFLA 1XP8A 4BLOA 2IS4A 2JJ1D 1QHHA 2JIZD 3VHXA 2FFHA 4Q1FA 3GEIA 1XJCA 1QHIA 2WWHA 3B1XA 3NKVA 1NKSA 2ZXUA 4LZZA 5C4GB 3BFXA 3ZVRA 1I2MA 2ZM5A 2CL7X 2GXQA 3SR0A 3TKLA 1JXMA 1KKLA 2CE7A 4IJMA 1D9XA 2R6CA 2Z83A 4IRUB 4LC1A 1CS4C 4OQNA 3NEYA 3IO3A 2ZRMA 3L8YA 2IT1A 2TMKA 2HLDA 3GLGA 4NYJQ 2W2XA 1SXJA 1JALA 2FH5B 1JR3E 3LD9A 5EP1A 2VRWA 1G17A 5SZHB 3Q9LA 2F43A 3B13B 1KO1A 3C41J 3NBYC 1YJ5A 2L0XA 2IYYA 5DO9A 2VHJA 1BMFD 1QHHB 2CMKA 2IUSA 5TVKA 3RLFA 2QMOA 5AJVB 1R0WA 3AP2A 2OILA 1E2NA 3D7MA 1MO4A 2PX3A 3QPWA 4M21A 3OAAD 4Q9HA 1G1MA 2JAQA 2X2FA 1TADA 4LC0A 1FNNA 4MGYR 5DIFA 3RRNA 5KPJA 1FFHA 1KO7A 2AD5A 1W1WA 2A9KA 4BZQA 1K5GA 3L2OB 2IWRA 3GLGB 1LV7A 1QBKC 1KI1A 2R2AA 3UG6A 4O2RA 4XSHA 1ESNA 1N6OA 1NVUQ 2CCJA 4KFUA 4QBFA 2GBLA 2JA1A 3M0EA 1PLLA 2LKCA 5JI2E 2XOKD 2Q0HA 1E2GA 2F43B 1J8MF 2GEDA 4W5HA 3TJZA 4D6PA 3KQLA 2H17A 1R5NA 4LYFA 4Q18A 1NVVR 2CHVA 3KJEA 5KOYA 2AKAB 2HT6A 1EK0A 1KKMA 1W36B 5HZKA 1RE0A 4AIIA 4KJZA 2BHRA 1VMAA 2Q6TA 4DB4A 4OHXA 2WMNB 3GJ5A 4JL6A 3AQ4A 3V9PA 4O0MA 4CZ2A 1DAIA 5B64A 1CRQA 2Z43A 4HB0A 1G6OA 1YR6A 2QE7D 5BW8A 4JIMA 5FOWA 4TN1A 4NYMR 1J70A 2GF0A 2IYWA 3VX3A 4DLWA 1JR6A 4B2IA 1QHSA 2ZU0C 4B43A 1WMSA 2ZETA 3QKTA 5B58C 1XCMA 3K9GA 4PO1A 1EX6A 1LTQA 1NVVQ 1CJMA 3GPLA 2JLSA 5FBQB 4EJSB 2PL3A 2EWWA 4B75A 1E9RA 1ZAKA 4MGIR 1HT2E 2QP9X 5JS8A 4URXR 3U60B 1R7RA 2FEMA 2AFHE 3PVSA 4US0R 2J41A 5HE9A 5CB6A 4DT1A 1GL9B 2GCPA 2O8BA 1LFDB 5KDDA 1ZP6A 4YXWD 1KI6A 4PC7A 1RRFA 5DN6D 1DADA 1UBEA 3RS3A 1NRJB 4RCYA 4NYMQ 1DARA 1FX0A 4ZKEA 2IEYA 2CXXA 4YDSA 1Z3IX 1ZM2A 4YONB 2WOJA 4M8NE 5JCPA 2CLSA 3U3JA 2QG6A 2GDJA 2ZITA 4PO9A 3MRSA 5EZ6B 3QG1A 2AHOA 4P3YA 3B60A 1NJGA 4Z8XA 4GNKA 1FUKA 4C0JA 1G8PA 2MMGA 2ZANA 2GCOA 3FWYA 2UZIR 1N0WA 4PAMA 3PXGA 3K53A 4DUGA 1J8YF 4DDTA 5EUQB 4RCZA 5DH9A 4M9SA 2O52A 4TTRA 1KSJA 4R9UC 1G5TA 3IQWA 4JVMA 5FUXA 3MLEA 4IFBA 3VKWA 1XZQA 3C16C 4HATA 1Z22A 4DT1B 3VR5A 4D82A 4XWAA 1DE0A 2O8BB 4URZR 5M04A 2ZIAA 3H84A 1OT3A 4PQYA 1E0KA 1V5WA 1FX0B 1IN8A 3W5IA 2XNSA 4CYMA 2FPKA 3ND8A 1IN4A 1ANKA 1Z0KA 3L0SA 4MYTA 4S2EA 3CLVA 1MO3A 1XJ0A 2QRNA 4N0EA 1OLOA 2FPMA 5DI9A 3GJ7A 3ZS8A 3CONA 1W0JA 1IXRC 2BJWA 2GCOB 1A7JA 1AS3A 1T0JB 3H4MA 1E4YA 1XTQA 3QKRA 4RZ3A 4DZZA 1IQPA 1G3MA 4KI0A 3HPQA 4NP6A 4OBEA 2OLKA 2WOOA 5L8VA 1K8RA 3CR8A 3CUEF 3PFIA 4GBMA 1F48A 2WSSA 2HYIC 1S96A 4AI6A 2F6RA 4WW0A 3TLXA 1DAEA 2GNOA 1RIFA 3U2QA 4OK3A 3DO6A 1GITA 1KI7A 3X1XA 4Q7JB 4TT3D 2V6JA 4F38A 1R2QA 3BB4A 5HE8A 1W48A 1KSHA 4I1OA 4TTPA 3U7FB 4F4CA 5GJWC 1ZUNB 2V55B 1R8SA 5CIQA 3RC3A 1E9SA 2WJHA 3A4LA 3EIQA 2AL7A 4CEJA 3AB3A 3LO5A 2GJ8A 4OI4A 1C9KA 1NL3A 4EPTA 5KUTA 2CBZA 2CEAA 4KYUA 4M9XA 2ZRBA 4TYWA 3QKRB 1M8PA 2C98A 4HAXA 1Z6GA 2RGCA 3RYTC 2O0JA 1DPFA 1E2HA 1KJZA 4PZLA 3F3YA 1GFIA 2QTVB 2YVUA 4XTRA 4EDHA 3FMFA 4EPYA 3RS2A 3GLGE 2RGDA 4ITRC 3W6NA 2X77A 1RVDA 2NO0A 1O87A 3SJBA 1GOTA 4HB2A 1NBMD 1G64A 3Q7QA 4BEBA 5K8IA 4Q4LA 3R7WA 3CF6R 2OHFA 1VHLA 4M1WA 4L15A 2B6HA 3T1OA 4MUAA 1OHHD 1E9DA 1KAGA 2D62A 3IIJA 4X8HA 5L3RA 2IW3A 1YKSA 1AK2A 5FL7A 2HJGA 1P3JA 2ZTSA 3IIKA 3P1JA 4BLPA 4AG6A 1UAAA 2ZJ5A 4CEJB 4OI1A 4JKYA 2GF9A 1GNPA 2QORA 4MYUA 2OAP1 3UMFA 4MYHA 3ASYA 1O3YA 4ASUD 3VFDA 1HH4A 4ESHA 2G88A 2AFIE 4KFSA 4TLCA 1NJFA 2ZR9A 1XF9A 5JFGA 2FN4A 2C9CA 1DAFA 4DHEA 5FOXA 3AV0B 3WMEA 5LB2A 3NC0C 4KYIB 4B6FA 3R7WB 1E2IA 2YZ2A 2YOHA 4OHVA 3WXMA 2QAGC 2A5GA 2J7KA 4F91B 5FH9A 2BC9A 5DYIA 2JGNA 5FTNA 4Q7MB 4LV5B 1DELA 3SJCA 2JJ1A 3WNCA 4G5RA 3QVUA 1NF3A 3L43A 3DDCA 3QNUA 2OEPA 2QA5A 3I32A 2B21A 2D06A 2QAJA 4YMUA 1SQ5A 3CRMA 2ZRIA 1IXZA 2RGAA 1NG1A 4UXHA 1GZSA 4ABYA 4PC3A 4W5WA 1N6HA 3GFPA 3B6EA 3W9YA 3NEJA 1T91A 3BFVA 2W83A 4FCWA 4M4SA 2WJJA 5JRJA 1VKJA 2OCBA 2P6RA 1S9DA 3PV0A 3WHKA 1OH6A 3E5HA 2OFOA 4RD1A 5B2ZA 4I99A 4YMTA 1S1CA 2PLFA 1BMFA 1R0XA 1VCMA 3MJRA 1W5TA 1XTSA 3SS8A 1D2EA 1NIJA 3OAAA 3I8XA 4GL2A 1MR3F 1I4DD 4IVQA 1JAHA 2VP6A 3RSOA 5FPTA 1MO5A 2P67A 5FFMA 4URVR 4I81A 4Q5IA 4V0KA 3RRMA 2VF7A 3I72A 4WA7A 3K9HA 3GLHB 5KSOA 4KO8A 4EPWA 1KDRA 4BUJA 3GLFA 1OXSC 4EIWA 4QL3A 5FBVB 2OSBA 4BWYA 1N6NA 2AWNA 3TSWA 8OHMA 3ADBA 3KXIA 3ZQ6A 4M2LA 3KDSE 4I1UA 5LD2B 3LLMA 4GRAA 2DWPA 4PZZA 4BGDA 3TAHA 2HDNB 1RYFA 4ZCMA 2B8TA 1BYUA 2J5XA 4Q4AB 1DAGA 1BH2A 3THXA 1VG0B 4Q4JA 3DPUA 2FZ4A 3AH8A 2QE7A 2OT3B 4IDHA 1OKKD 1XPUA 1E99A 4A0HA 3NDPA 3D6TB 1WXQA 2I4IA 2ZJBA 2DYKA 3A37A 4E03A 2QPTA 2NO7A 4PC1A 2WWXA 1U8AA 4CEHA 1EESA 3AUYA 3GLFB 2ZUCA 3CRRA 5CLLA 5FR2A 1E3MA 3KQNA 2IUTA 1ZCBA 4TTQA 2IHBA 3U44A 3BWDD 4U02A 5FUYA 2CCKA 1T3SA 1CJVC 2OV2A 3RWOA 1S3SA 4YXWA 3LA6A 5DN6A 4QNMA 3OE7D 2BJVA 2V6IA 1ONBA 3IILA 4OYHA 5KNCA 5KNDA 3DMDA 1CP2A 2VYFA 3WP0A 3THXB 4Q4JB 4AKIA 3K9NA 1XRJA 3TW4A 1VPLA 3BOSA 4Q47A 3QXJA 4MH0R 5TDHA 2BIFA 4OI2A 3QJYA 3CZQA 2ZJ2A 4D4LA 2BDTA 2IS6A 3KKMA 4JLVA 1SVWA 4D4JA 4DDUA 1R5OA 1FMJA 1I4LD 4CEHB 3LWNA 3R9WA 3KQKA 5JHGB 2C77A 4BFUA 2NO6A 5KDLA 4BFTA 4E5UA 1A1VA 1W49A 2W6JD 3U44B 3T1VA 4QOSA 3K0FA 4JJZA 5AUPB 3BK7A 2NZ8A 3SBDA 3TUZC 4G5OA 2VH5R 4MRRA 3K0CC 1XEFA 2BM1A 1TQ2A 3I1FA 5AJWA 2IYUA 3ZLJA 4C0HA 4NE2A 3IO5A 1N5KA 2Y8EA 3NBZC 2ZS7A 3HYTA 3FFAA 2AXNA 2R6FA 3A6PC 1E1QA 4DDVA 1G7SA 2V4ZA 4UJ3A 3M1IA 2RHDA 1RC8A 2D74A 2QTFA 4MKIA 4Z8YA 2G1KA 1NN3A 3LBNA 1OFUX 3IHWA 4TLDA 4IXMA 4NCNA 4KU4A 1XTJA 3CWZA 4KBFA 1KY3A 3WNDA 1AS0A 3U6KA 2DFLA 1TQ6A 4FMDB 2Z4RA 4KAXA 1WDTA 1I4TD 4RZUA 3EW9A 2D2FA 2WVJA 3LX5A 3SJAA 4QGFA 1G18A 5G41A 4L16A 3K0FB 2YKGA 1Z08A 1M7GA 1QZXA 3X1YA 4ZCLA 2VHQA 3VR2A 1OFIA 3B5JA 2FEOA 4DLTA 5J47A 4TMTA 2N42A 5H1YA 4QJ5A 2D7CA 3CPEA 4DSUA 4AY2A 1S4QA 1JAIA 2HV8A 2OBLA 5EE5B 4ARZA 3DOFA 1LVGA 4D81A 3CIOA 1TF7A 2ORWA 4R7ZA 4TT3A 3PENA 3TMKA 2WBLC 1G8GA 1PUJA 4IVRA 2JLXA 2ONJA 4DKXA 1JB1A 3OHMA 2D3WA 2BKEA 4PZYA 2QSYA 1MABA 4NCJA 4HAVA 4MGZR 3AF1A 2P2LA 4HZUA 2VP0A 1Q12A 2ZYUX 2WKQA 4KITB 1G9XA 4Q9JA 1CTQA 3CH4B 2ODNA 4EFMA 2JLZA 1Z63A 2NMVA 1ZVQA 5A5GA 5LPNA 5KO2A 2FSIA 4ZDWA 5KSPA 4Q4HA 1KO5A 4OJKA 5FOTA 3WBJA 2O0HA 1A2KC 4KVAA 5IRCD 3D3QA 3GLHE 5JBQA 3E1SA 4A1FA 1NBMA 3BORA 2REOA 2DY1A 3EWSA 4ARZB 2OO7A 3U7EB 2VHCA 2Q3FA 1EX7A 2BCJQ 5CITA 3PEVA 2Z5FA 3SQXA 4A9AA 1BYIA 1DAMA 1RYHA 4LBWA 5BN3A 4QG7A 4LJ5A 4AWXA 3NIBA 3HR7A 4TZ6A 3O8RA 2JJ2D 4TMXA 3U5ZB 1LY1A 3QXSA 3T5DA 3TSZA 2P0EA 2F9LA 3ADDA 4RSGA 2FE4A 1RRGA 1YZGA 2QZ4A 2WV9A 4ASUA 1LS1A 2WZQA 1XEWX 1VYUA 2BWJA 1XDBA 2QMHA 3K8YA 1LW7A 4FXPA 2HT1A 4QGGA 1UKVY 4NMMA 4OL0A 5CK5A 3C4JA 1AJEA 1S9HA 3GLFE 3TVTA 1W47A 1KK0A 1BIFA 2CL6X 4B35A 3AVVA 4D0GA 2GVZC 3C8UA 4RFSB 5CM8B 2AR7A 4G5SA 3CRVA 1ZC4A 3PR1A 4CIDA 3LXRA 3IUYA 3RRYA 3EWAA 2F1RA 3PUZA 4NCHA 1SKYB 4PQFA 5FTKA 5KDOA 1N0UA 1ZBDA 2QGNA 1S1MA 1VYVA 2Q9AA 1CKEA 3LV8A 3ZGXA 3UIEA 4IEIA 3MG9A 2C99A 2DB3A 1P5ZB 4K81B 3VHLB 2ZREA 2RGEA 3PEYA 1JNYA 2FMXA 4R2HA 3WY9A 4V0LA 3OESA 2DFKB 4RZ2A 1L4YA 3NVAA 5A4JA 2HJVA 3UANA 2XB2A 1D2MA 1X3SA 2BVNA 4LBYA 1ODFA 1W0KD 1XPOA 2BCGY 4II7A 1TMKA 1E9CA 1Q1BA 1ETUA 3FMPB 3ND9A 2E1RA 3WNBA 2QMEA 4GOXA 3B9PA 4GMDA 3D31A 4POAA 2FV8A 1RW4A 1OIWA 2DPXA 3HU2A 1KMHA 4P33A 4DCVA 2QEQA 4LPKA 2V9PA 5UKDA 4BRUA 2NGRA 3QF4A 5G53C 1UF9A 4DLUA 5EXTA 3FGNA 2GEVA 2R62A 3U6BA 4HLUC 1F5NA 4PSVA 1L2TA 3AF3A 5L3SA 1OIVA 3ASZA 2IF2A 4RY2A 2BBWA 2QSZA 3EASA 5K8UA 3BGWA 3EARA 1YR9A 3QOFA 421PA 3X1WA 1HTWA 1QVRA 3N70A 2W2TA 4LYJA 5FI1B 5JS7A 3CNNA 1IOZA 2IYRA 3LDAA 4P32A 4PFSA 4D4MA 3MWKA 2GWHA 2RH5A 1FP6A 3A1VA 1J2JA 1Z2AA 2IK8A 2PLRA 2XTMA 4JLMA 4OQLA 4Q1BA 2G9NA 5J4YA 3TRFA 1KMHB 1Q21A 4QNRA 4CVNA 3QXCA 1ZD8A 3CBQA 4DCTA 4JSTA 5CK4A 5F9FA 3QF4B 1M7BA 4M1TA 3I92A 2DR3A 3DZDA 1P62B 5L3SB 4LV6A 4LHVA 3GFTA 1US8A 5P21A 5JWHA 1NMYA 1P7CA 3IIMA 4JLPA 1VHTA 2KJQA 3FDIA 4QHSA 2ANCA 4RVCA 4DBLC 3EC1A 2FGKA 1U9IC 3R8CA 4XIGS 1HE1C 3AGQA 3PUYA 1W4CA 4HDOB 1Z8FA 2YOGA 4MKFA 2O8CB 3NXSA 4EKDA 5C2JB 3B2EA 4BE7B 2A30A 2PBRA 4QBIA 1FUUA 2I1VB 3P20A 2QTHA 1KSGA 2VHUA 2IYVA 3UMSA 3CF2A 1VTKA 5C18A 2O8FB 1E79D 2ZJYA 3QE0A 1R0ZA 1JPJA 2GCNA 2ANBA 1JEDA 2J59A 3BH6A 3BB3A 3RAPR 1KDOA 4KLNA 2VQSA 3U3OA 1XMJA 1Z83A 1Q22A 2J0QA 1NSTA 4XH9B 3T61A 4OK6A 3K09C 4IEEA 1IXSB 3Q5EA 3GJ4A 3I73A 3TUJC 4DSTA 5CB8A 4RFVA 2IA5A 3QKSA 3KTAA 2JLQA 1X8KA 1SXJB 3CRW1 2FF7A 2J9RA 2QAGA 2ZUBA 4TL8A 4XTCS 3FKSD 3SN6A 4C0LA 1G21E 4E09A 3UPUA 4D2IA 3E2IA 1WQ1R 3K70D 4ACAA 4LOAA 1Z29A 2GK6A 3BRWD 1VECA 1IAQA 2BOVA 1SKYE 4GPTA 2IXGA 2N46A 3ZJYA 1YHNA 3T5GA 4E07A 2PEZA 4X8MA 1QHYA 2AKYA 1XXHA 3L0OA 1LNZA 3P27A 4ACBA 4URWR 1OSNA 2REXB 4B71A 2W0MA 4WVFA 3VKGA 4QGHA 1KY2A 1OXXK 1S2MA 1DS6A 2FU5C 4H9GA 4WOPA 3SFVA 721PA 3KTAB 2F3RA 2CVHA 1PUIA 3LRPA 4A4DA 1HT1E 5HTKA 5DSZA 4QGAA 2ERXA 2QAGB 1G6HA 2QRZA 3PCRB 2UVQA 3UKDA 3T15A 3FMOB 2BKUA 4BFYA 3HU1A 3R9XA 2ZE8A 4P31A 1CEEA 3W3AA 1M6NA 1U98A 1OXUA 4A0FA 4Q02A 4NBSA 4PO8A 3A4MA 3G0HA 2PT7A 4M9QA 4QHTA 2R6DA 5IHPA 4ZKDA 4C3ZA 4DLVA 1XXHB 2RMKA 3L0IB 2P6NA 3I5YA 1FQJA 5JEDA 4G5GA 1VIYA 2B7BA 3H0KA 1EGAA 5L3QA 2C96A 2QROA 1E0SA 2ZRLA 3HYRA 1AIPA 4LGMA 2J0SA 1NY6A 4L4UA 5SZKB 3T34A 2HEIA 4HYYA 4F92B 3O8BA 1BOFA 4C0KA 1Q1QA 1OPXA 4IKEA 1K5DA 4KHZA 2VSXA 4JS0A 3CKLA 2QN6A 521PA 4EFLA 1VYTA 5JI3E 3K0SA 3MAAC 5TB5A 2GXAA 3VR1A 2P3SA 3IDQA 4HDCA 3WYAA 2ORIA 4QBHA 2XJ9A 1KI6B 4KFTA 2J7PD 1CRPA 3EPHA 4MA4A 1N6KA 3VAAA 2AWOA 5KU1A 4WIAA 2AD1A 1U99A 1Z47A 1AM4D 2IYZA 4CEIA 4TLBA 5EE9A 1CIPA 2JEOA 3EZ7A 3H2YA 4N0DA 1DVRA 3WRYC 4B6EA 4LSGA 1TQ4A 3AVXA 4DLZA 3OIYA 3ZQJA 1ZIPA 5FBWB 5AWFC 5L3QB 3LBHA 1J7KA 3A1WA 4DIEA 3U4QA 1L8QA 2F1HA 5EXXA 1UEIA 1C4OA 2ZI9A 1GAJA 4TMVA 5GADl 1P61B 3F0TA 2ZRKA 3G5UA 2PJZA 5FOVA 5BN4A 4JMPA 4TMKA 2JATA 3AVPA 2ATVA 1EG7A 2OXCA 2K5UA 4W7SA 1YZNA 2ZJOA 2NIPA 1DOAA 3ZD7A 3KXLA 4WBSA 1YZLA 4UXIA 5GJCA 1NLZA 4Q48A 4F7WA 2N1BA 4FINA 5FBRB 4NDZA 1Z2CA 2G0NA 4ERNA 2ZEJA 4ZI3A 4FD2A 1CR1A 3MFYA 4CEIB 1E2PA 1I2DA 4OHYA 1OV4A 1HA3A 2WICA 1MH1A 3TQFA 2IS1A 3TW8B 2CLDX 4TWZA 4YMWA 3FVQA 1QHNA 4H1VA 2JCSA 3U4QB 2UKDA 1FOEB 4GT1A 3OFND 1TX4B 1NLFA 1II8A 4X8LA 3FHTA 1G3QA 1U0HC 4PC2A 1ZM4A 2PX0A 1G291 4A2QA 2YINC 4ZIRA 5J4KA 1G8HA 2H5EA 3H1TA 2YWGA 1HQYE 1Q3HA 1VG1A 1SXJE 3K0CA 3KKPA 5JWOA 3TH5A 4Q01A 4PTLA 1WB9A 1KYIA 4PXAA 1IY2A 2R65A 2B7CA 1T3LA 3CX8A 3GJ6A 3A1TA 1F60A 3CO5A 1G16A 1NI3A 1UKZA 4LK2A 3QENA 1Z6YA 4DLSA 1F2TA 5JEEA 4ZPXA 1L7VC 2PZGA 2QT0A 3QPUA 4MUBA 1AGRA 2GZHA 2AK2A 1AGPA 1ZU5A 2FWRA 1YRBA 4UKDA 1TTTA 3DKVA 1HQCA 1WF3A 3U3KA 4ZIRB 2FFBA 5FPSA 1X86B 2V7QD 2EFHB 2ASEA 1IONA 1E4VA 2EVWX 1RRPA 2FX3A 1ZW6A 2F55A 4E22A 4LJ4A 4P4SA 5CM9C 2H16A 3P4YA 5CJPA 4A0RA 3ZIAD 3AGPA 4DJTA 1VCIA 3UMRA 3EG5A 3IPYA 3IKJA 1KK1A 3MWLA 5ANRB 5H70A 1W36C 3W6PA 1JXOA 4C2TA 1X6VA 2HUPA 2CDNA 3FMIA 3UWKA 4AKGA 1BS1A 5LDDC 4PHGA 4R98A 2JIZA 1ZIOA 4D0LB 5DLQC 3DMNA 1GTVA 4FMCB 4LRWA 1ZRHA 4Q1AA 2C04A 4EAQA 2A78A 3HP1A 3B85A 3P32A 3RVBA 1XXHE 4KCGA 5AUQA 2FJUA 1OH5A 4XSGA 1KDTA 1P6XA 2ZE7A 1E2KA 4FMDF 3KKOA 2BMEA 5D3QA 4TYYA 3DKPA 4A8JC 4WZAE 3THWA 1E32A 1N6LA 4WXPA 3A58B 4LJ9A 3BB1A 3E70C 3GD7A 1H8ED 1U8YA 4A2PA 4BFWA 1OW3B 4JSYA 4EJSA 3PUWA 1Z28A 1E79A 1JQLB 1P2VA 4W5JA 3REFA 1IM2A 1UFQA 4V0MA 3PQCA 1XD9A 1ZYUA 3N2EA 1FL9A 3CZPA 1AA9A 5IK2D 2IS2A 2IYLD 3I8SA 3PUXA 3U61B 1ZJ6A 5EXPA 4B32A 5DHAA 4B3DA 1FW6A 3NBFA 5FR1A 1GKIA 1TNDA 1II9A 3TQCA 1OH8A 4A36A 2IC5A 2WJVA 4IHQA 1Q20A 3THWB 4RKFA 2NPFA 3AVTA 4KBGA 4PHFA 5JCZA 2WAXA 3VR3A 1TF5A 3B7GA 1U8ZA 1Z0FA 5BQ5A 1Z06A 1OH7A 2RHMA 1P9WA 3OIVA 4N3NA 3NHBA 1EFRD 2REBA 2XOKA 1YQTA 2C2HA 3C5CA 1QG4A 4JKIA 3AKYA 1HEIA 2P5SA 5SZJA 4MITA 3CX7A 5CYPA 5JRZA 4DLXA 3EA5A 4M22A 4L9SA 1JQJC 2IX3A 4PX9A 1MT0A 4UNSA 1COWD 2KB0A 5FTJA 5EE3A 4FCVA 4DB2A 2B8WA 5FBLB 1QRAA 4Q9LA 3Q3JB 3MD0A 5KNBA 1AZTA 1SULA 3HU3A 1GP2A 1KZ7B 2MSEB 4DSNA 5DNYB 5DISB 2YOFA 4Q9IA 3AP1A 3LY5A 1XTKA 1YE8A 2WWWA 1RKBA 1PV4A 1X8JA 4FMBB 3QXHA 1T0HB 5CLQA 3FE2A 4DCNA 1HE8B 3D8BA 1SVIA 1P4SA 1DG1G 2QBYA 4NYIR 2RKOA 5KSYA 4NL4H 3BS4A 1AKYA 3LVQE 4CDGA 3W8RA 4QJ4A 4C30A 4B48A 5BYJA 1SKQA 5FUWA 2YWHA 2RGNC 3THYA 4G01B 3THOA 3UXMA 1YZTA 4GFDA 4KSBA 2QNRA 4HLUA 1IJFA 3C15C 3ZS9A 2QT1A 4C0SA 1CBUA 4X8OA 1UBGA 4NYIQ 4XVQA 2JLYA 2CK3D 4JYBA 1E98A 1JPNA 3AF4A 4F93B 1KI2A 1HUQA 2J3EA 1Z0IA 4HLDA 1E6CA 2PEYA 2QBYB 5FUVA 5ELXA 4Y0VA 4HDQB 2DWQA 1W36D 2ZYVX 2YNMA 4MRPA 4O2LA 3IBYA 1WE2A 4ZV4A 3C7KA 1EWRA 2GILA 1RJ9A 5DHFA 4QM6A 3AKCA 1D9ZA 1TEXA 3RS5A 2FSHA 4PHTA 2AXPA 4DWJA 3KJIA 3SFZA 1IY0A 4CRWB 1N25A 3UG7A 4PPNA 4MKGA 3FFBA 2F9MA 5AJYA 1KSFX 2OE2A 3TVDA 4Q9KA 3MUFA 4NU0A 2XAUA 2XNDD 2VP4A 1TEVA 1HY3A 2ZI7A 1U9IA 3EXAA 1E2FA 5D3MA 4L9WA 4AD8A 4JLKA 4A6XA 1NN5A 1G4UR 1AQUA 1GILA 3OIUA 5FOSA 2XZOA 3LX8A 2ZQ5A 3L8ZA 1F3OA 2IYTA 2W00A 3DVLA 4HAWA 3T1TA 1XNJA 3UWOA 3RSLA 4DC9A 3VKHA 4PAQA 2GEUA 3BC1A 1RJ9B 2QMUA 4IDQA 2ZRFA 4NONA 3BAFA 1Q1ZA 5HZHA 2H7VA 4FIDA 4CT5A 4DEXA 4RD0A 4C0AC 3VNVA 3V00A 2ZS9A 2CNWD 3I62A 1DTSA 5JZVA 1XMVA 3SYLA 4TQAA 4MRNA 1NVWQ 5BYKA 3EC2A 2RGXA 5LB4A
chains in the Genus database with same CATH superfamily
1V3VA 3T7KA 4JC8A 2FMFA 1K4KA 2AMJA 4GOLD 2RKBA 2HA7A 1N0IA 3GHHA 3SS9X 5D3MB 3B8HA 5DNDA 1XD8A 1ECJA 1VMDA 4GQAA 5AHRA 1RHUA 2QQEA 3KYIB 4YGYA 4RTSA 1QSGA 1N2HA 2ZQYA 3JV7A 2WMOB 4HBZA 4LX0A 4RA6B 4MQFA 1N77A 4HQRA 2JJQA 4WACA 2QI9C 5JJCA 3OM1A 1QX3A 1GNQA 3MJHA 2I7TA 4G5QA 2I0FA 4GBGA 4XI9A 4M1KA 5EE1A 2CLLB 4EF5A 2GS9A 3HGTA 3HP7A 3S1AA 2B8NA 5K3AA 1IE3A 5A6SA 1FXWF 3BD9A 2ZJZA 3FPAA 3TG2A 3GT3A 4V0ME 2WIJA 2H08A 2QYHA 4C22A 5J2TB 1YVUA 4BO4A 1KI4A 4JJAA 1W5BA 1J8DA 1Z7WA 4FYWA 4KPUA 4X7RA 4BATA 4ZYZA 4G5HA 5D87A 4R41A 2JGIA 5JLJA 1ZNWA 4B3SB 5HF8A 2WJAA 2QR5A 2W6PA 3AFGA 3CW2A 1BGWA 4KVGA 4PNHA 1ZNYA 5LKAA 1GGKA 3WAGA 2HQBA 2ZI5A 4LOLA 4W9NC 3VU0A 2Y1EA 5AVKA 4ZAYA 3ICQB 2FR0A 3Q12A 2GPAA 1H3FA 2WINI 4UCFA 4AULA 4NEGA 4BKOA 1DLJA 4TLAA 1ZOSA 2C5LA 3UH0A 5KYGA 2FUCA 3T7IA 3QU5A 4Q4CA 1DI0A 1GKYA 1IBRA 4FZ3A 4UPEA 4IIGA 2BBTA 1PBNA 3TBKA 3UXYA 4JBXA 4HYEA 5KOJB 3P9PA 3AW8A 3L7IA 3CX3A 4ID3A 2C84A 4ZGGA 4JEMA 3K0EA 1XNHA 2BE9A 1PF7E 5K8TA 1JZTA 3FJOA 4CKYA 2F67A 1KEEB 1BWSA 3K72B 1QG2A 3ZGYA 1GZ4A 3H19A 1UM8A 3ELYA 1M34B 3STWA 1W44A 4CFSA 1WCV1 4MR8B 1OWPA 3RIEA 2EV9A 3BAZA 1C3JA 2J1LA 1A96A 1PLJA 1U1FA 4BMPB 1JU9A 2I2AA 4PVCA 4EG0A 1HFKA 4ETIA 4AYWA 3TRDA 5DX1A 3T95A 2ZE5A 3R8FA 3DJYA 3KJGA 2IU6A 4KZKA 1M2FA 1NYLA 1IG3A 1QKIA 1T8UA 1T9DA 3OQVA 4HH3C 4CCSA 1ZEMA 4I5EA 1ZHOA 4TTVA 1VPVA 5ALMA 3ZC3A 4QOIA 4YDHB 4TSKA 1T4CA 4CMEC 2ZBEA 3GJRA 4RV4A 1XHFA 4DEVA 3LFUA 2OZVA 3UC9A 5HQ3A 3L6EA 1MRZA 3AETB 3UB2A 5EMLA 4NZZA 4CM9D 5JPIA 3VKUA 4KMOA 2G1JA 3FHOA 3O83A 1SBYA 3IQDB 3RW9A 3LQYA 4M53A 3W5AA 4JXZA 1WHTA 4UHCA 4YECA 1Q5PA 4JBNA 2CXRA 4OJNA 2MSDB 4I2VA 1NUAA 1BW9A 1DUVG 4PR0A 3NW9A 3THRA 4AN1A 3FY4A 1TQ8A 3DBVO 5G1OA 5FPYA 2RG1A 3KB1A 4JUBA 4KWEA 4TKUA 2W2VA 1E18A 3HCOA 5DBHX 3SNHA 4NBLA 2JIRA 4GXQA 3DMTA 2W8ZA 2X0RA 4I1VA 4JLJA 1DO0A 1LPOA 1RHRA 2M1XA 2PQ6A 1D04A 4RHCA 4X0EA 1B16A 1E3TA 1OZFA 3IP5A 3E9QA 4MKZA 3VR6A 5CT4A 2VIIA 1FF9A 1RAGA 3DD5A 5E7QA 1G7RA 1TU4A 2C0QA 1U0NA 3A1EA 3A1NA 4M0LA 5C1IA 3SEAA 3SICE 5AKIA 3WIOA 3HNRA 5FXMA 4BU0A 3I61A 3AJDA 1A8SA 4QQRA 1EFDN 5GWXA 4Z2YA 5TRTA 1RZUA 3OLVA 2IPMA 4IIEA 1MC5A 2ZROA 1ZUHA 4HRVA 4HWOA 1M33A 4NPHA 3F4KA 3B1JA 2PA0A 3PFBA 4HEQA 1LD3A 1WKVA 4QYXA 5DF1A 2OYCA 1RDFA 3IALA 3Q2IA 3WGYA 4D26A 3A9TA 2ZM6B 3FTFA 5KNCH 1SUBA 4MUYA 2R3SA 3KQYA 4BMSA 5BV0A 4K26A 5LXTA 1N2GA 1P60A 1EVEA 2VF8A 3PQ6A 4LXYA 4WZ6A 5EIWA 1BVRA 2XDYA 4QLBA 5HRAA 1ZOLA 3OQMA 3DO8A 1G0OA 2XYGA 3I1JA 3R09A 3NHSA 4GRIA 4B3FX 1HEUA 2FHSA 2P5YA 3QLVA 1Z2PX 5AMXA 1JSZA 3B6JA 3ABOB 4PYKA 3SIWA 1Y5LA 1OKKA 5HILA 3G6WA 4JLOA 1K8QA 2WSLA 5DKFA 3FTQA 1GUAA 3RH0A 5LQMA 4NCBA 1P19A 3CRNA 2R86A 4S1NA 3AVWA 4DBLE 2GNAA 4JT8A 1RWQA 4EUSA 1NJ8A 1SQSA 1GG9A 2WG1A 3LOQA 3KB2A 2IVFA 3SSMA 2J9ZB 5CD1A 1B8UA 2A3RA 1CR0A 5IUNC 3SHFA 3L4BC 1I3MA 1IG0A 1QVVA 1S8NA 3M89A 4GLBA 2VZ0A 4PPFA 1E3DA 2ZYHA 5FHQA 1GPWB 5SV2A 2Z4SA 4UHFA 4DA7A 1ZI9A 7MDHA 1F2UB 4DG9A 5DWDA 3AUXA 4NG4A 4XWYA 4P0PB 1RSZA 2RGBA 2G04A 3GFBA 1M2OB 4IEFB 4JLAA 3ITDA 1EG2A 1G5HA 4QFCA 1YH3A 2OCXA 1GGNA 4YPFA 1DAOA 3PS9A 3RUFA 3VTAA 1D2CA 1C1DA 3A6KA 2X2PA 2A0KA 3I4LA 4FNAA 1WA5A 4N3BA 4J1SA 5JSZA 5IEBA 2A1UA 3ZDAA 5GJBA 3UJAA 3AK4A 3ILVA 3NTUA 1W5SA 4H31A 2EEZA 2P9YA 4DMLA 2CCGA 5C31A 4QG3A 3KWFA 1R9NA 1NPDA 1AMUA 4WJZA 1LWOA 1NJ6A 2UZ0A 1EQUA 3AOGA 3KOYA 4MZDA 1RACA 2ZJ3A 4RIEA 5CCDA 3UKJA 1CJUC 4B8WA 2H1VA 4Z4FA 1NC1A 1C80A 8LDHA 4B3RB 3KT8A 1LX6A 3KOWA 3NHRA 4P86A 5HIKA 1NIPA 1TUEA 2EZ4A 2OSVA 4ER5A 4AYTA 1KI8A 1N9GA 2QY9A 4WCFC 1RADA 1XCPA 3GZ4A 3KFVA 3IYLW 2WIFA 3B3AA 1C4KA 3SD7A 4A2WA 4BLSA 3WB1A 4ZMBA 4TROA 4JY7A 3T9BA 1ISSA 3SYKA 2V65A 1EKXA 1PL6A 2DKNA 1PS0A 3IPAA 2BAGA 1J07A 1CQZA 3FWNA 3IVGA 4O4HB 1IHDA 1R10A 4HUQA 4XYEA 3FIUA 2FFQA 2HSJA 4I50F 4HDNA 1PVDA 1UXIA 4Q7KA 5M7EA 2TMDA 1QYIA 3GH1A 1PZNA 2R6AA 1N7JA 4DV3B 4AC9A 3PC8C 2D5CA 3ANMA 5F9HA 1J8FA 1J97A 1YTUA 4AY6A 2LP4Y 1TF2A 1K92A 4JQYA 5HMMA 2CMHA 1Y3BE 2NVOA 1WP4A 3HN7A 4WZBA 1JVSA 5IEJA 3D64A 1YRHA 3QKSB 1OD6A 3H42B 4OLHA 1OXVA 2DRIA 5GZ1A 5IDVA 4DYHA 4CDRA 4CTKA 4C14A 1BS9A 4HPWA 4MHOA 3LCRA 2GEKA 4YRKA 3WMGA 4DR2B 4MW9A 4FC6A 3G8CA 4UQOA 2DBVO 4YPVA 4LY6A 4NR0A 3U56A 3AQIA 5CX1A 1OYWA 4TL7A 4W63A 4C4SA 1NMXA 2QV7A 4E88A 4B76A 2JLUA 4H0CA 1OXKB 1M7HA 1FDVA 2PH7A 1AF7A 1WCYA 2PDAA 4EL5A 3IE0A 3FPFA 2X15A 1M8JA 5ADVA 2AFIB 2PX5A 3KRTA 2H7CA 3OZRA 3OJEA 5CDFA 1QHFA 4ECEA 3KSUA 3S8MA 5DLYA 3C3EA 3NUGA 2EFEB 1OB5A 5ALSA 5MF6A 1M0SA 4NDAA 2DPHA 4FFBA 1T2FA 4Q93A 2UVPA 3KDPA 3LH5A 3WGTA 1TEHA 4X3OA 4BNXA 1QCDA 4DV1B 1PP4A 3LZCA 4RPCA 3GT7A 3DZHA 4AF6A 2QMQA 4RHEA 4B3XA 2EYUA 1NYTA 2UZ3A 4OUDB 4G23A 1MLDA 2VTDA 1XJQA 3VYWA 5LR6A 3CX6A 3KVRA 3R3XA 4YCJA 1KK2A 6Q21A 2ZYIA 2JKYA 3EZ9A 3TINA 4AMZA 1ETHA 1UMBA 3FMVA 4QPJC 2VXCA 3KQPA 3SBEA 1R50A 2IZOA 2WWTA 1EGVB 3ZE7A 5BVHB 3DTTA 4UASA 3WMFA 3RROA 1SD2A 4A1OA 2BR5A 4B5LA 4S04A 2OFWA 3NIWA 1X8XA 1H85A 1KNQA 3I04M 5KJ6A 2VP9A 2OHXA 2AUNA 2JFVA 2YZ7A 3I0MA 2BFDB 4XYMA 1MHPA 2X19A 3A27A 3L79A 1EFTA 3EIFA 4XXHA 4ZRNA 2B5WA 5B55A 4DRYA 1Y37A 2ZUFA 1MBZA 1JVNA 2YN0A 1T1SA 4OD0A 4CNQA 2Z30A 4G41A 4HQLA 1OIXA 3R24A 2ONYA 1G20A 3L8CA 5CA0F 1HDYA 3LKZA 5A04A 5L4LA 2VPXA 4NNPA 4RJLA 5I7HA 2YUIA 1I8TA 4FGZA 4OTZA 2FYTA 3OPQA 3UJPA 1D5CA 3BWYA 4FCCA 4YLGA 4CKEA 1NJ5A 2OBMA 3EZ6A 3QELB 1ZIYA 2XVMA 4L07A 4LJRA 5T7BA 3EGXA 1DC5A 2FPPA 4KE6A 3RCBA 1ZI8A 2J8ZA 1VI6A 4PSAA 2V74B 4QUEA 4BNIA 3LBIA 3W5VA 2FJPA 4CQNA 4TS4A 1LS6A 1ECLA 2F2TA 3LVRE 1Q50A 2P35A 4X90A 3OC6A 5HVNA 3I2YX 4RD2A 1ZUIA 5DDIP 1TTTA 2GHIA 1X1DA 2FVYA 4BWVA 4F7DA 3IAXA 3CVVA 1TI7A 2A7QA 2VJAA 2ZFUA 3DT8A 4GI1A 1IUOA 2Z98A 1EFLA 4OXQA 2IHYA 4QC2A 4V03A 4ZDJA 2J0UB 4RS4A 3PK0A 3F1KA 2XNCA 3KSBC 4J76A 3AUFA 3CH5A 2ZZKA 4Y30A 4ZWNA 1J0AA 1JS1X 2EKQA 3BCSA 4MB0A 3U7GA 1THTA 1DT3A 1FZQA 2XB8A 3AYXB 3B6MA 2M1ZA 3M3HA 3CN7A 5FFFA 3K31A 1QVWA 1U1IA 4ZPJA 4FSDA 1RQNA 4FW9A 4RIGA 1XRMA 4IDPA 5IC5A 4Z3DA 4OGFA 3V5NA 3ZLBA 1RHJA 2C20A 1Q1GA 3SQNA 1KH1A 2NXWA 4Y67A 1WW8A 2X0NA 2YXEA 4MVJM 3VZSA 4HDSB 1W0KA 4A6PA 1YQQA 4BFZA 2J48A 4CM9A 3OEHD 4HR7A 2H1LA 2OKCA 1XCLA 2YWEA 4CF3A 3M4JA 2A5DA 2J6BA 1RQ7A 5TF0A 1X1TA 5E1BA 3K0AB 3VH4A 3DEJA 3KWLA 1PJZA 3NV7A 3NAMA 1M2VA 4RPHA 3LT2A 4AS3A 1OB2A 3DMGA 1TXGA 3PICA 1QIFA 2Z8YM 4ZVQA 4EY4A 5K3EA 2P8SA 4BLTA 5GIPE 2EXXA 5FV7A 3AEKA 4C03A 4J1NA 5LJIA 4GGPA 4RPJA 4HB3A 4CR6A 4N3AA 1ZM7A 1CJBA 4DV0B 2X4DA 4G4SO 5J4LA 5C46F 5KVVA 3WICA 1PFWA 4RD4A 1UADA 1TGVA 3E9CA 3MOIA 1J2RA 4OHCA 3SDZA 4LG1A 5AW7A 2O59A 5HF9A 1II8B 4WAUA 4LWZA 1A82A 1Y3CE 2P2SA 3WYGA 2ONKA 2WAOA 4DQVA 4ABTA 1N8KA 4F5DA 2ERYA 1CZRA 3F6CA 3G9XA 3VYUB 5BSFA 2O05A 4ESVA 3M6AA 4UM8B 1XEWY 3W5JA 1JECA 2I7CA 1ZMXA 1RYMA 3N2IA 2VHYA 3C14C 2Q29A 4P4TA 3KO8A 3X2SA 3ZVNA 2R6R1 1SUIA 2NUPA 3GJ3A 3P2IA 4ISBA 4NULA 1H4VB 1TZJA 2DOKA 1CY0A 1JGTA 2EKLA 3E7FA 4WPGA 1USWA 3EDRA 1VSUA 2F1JA 2IEDA 4LYYA 4F2PA 2JFPA 1EFAA 3K2EA 2PIAA 3ETJA 2AN9A 1GJRA 3EISA 4KUHA 3VU9A 1IHUA 3HB5X 4FK8A 3NM5A 4GWLA 5L3VA 1Z6XA 4E12A 4W9MC 2F8SA 2HXYA 2JAWA 2BEUB 3KHSA 3R0IA 1F2TB 1U0OC 2BFAA 1QIJA 3QVVA 4FJ0A 4MDFA 2QENA 4A92A 4DY4A 2M6RA 5LXTB 5T4BA 5ICMA 1MJHA 1B41A 1IHXA 1JDPA 2AOWA 2BBSA 2GCEA 2HGZA 3AHHA 2VLIA 3KQSA 2CJYA 1IDN1 4JMLA 4KUGA 4PQRA 4RH3A 1I4EB 3A3OA 4ZCMA 2CWWA 1A2OA 3C1AA 4IY1A 2WE8A 3RKSA 1PTJA 4YC7A 2R1ZA 2VDWA 1TVKB 3BRCA 3JZAA 3DR5A 4TSRA 3UHAA 5A06A 5JAHA 2WDPA 3VQTA 2PU5A 1J23A 1SBTA 1WUIS 3GQBB 4IYRA 4WZBE 4EPXA 1XEXA 5DGXA 4D9BA 1QFYA 2C57A 3KR1A 4GUAA 1C0LA 3WL6A 2W37A 2XIQA 1Z0JA 3GFQA 3E9MA 1DC7A 3P9CA 1R15A 1YMQA 5EKTA 3BTSA 2I55A 4XD7A 1UXGA 3I23A 4M1YA 2SBTA 4MRSA 4TKVB 3UAYA 3HLKA 1G4AE 5AP9A 2OCPA 2J6IA 2M2IA 1ECGA 1PFVA 3W3ZB 2W6MA 3HC7A 1QPZA 3VRHA 2XUOA 2Z04A 3FJYA 5GJVC 5TT1A 4CF6A 1T9GR 1XK6A 2A67A 4LVCA 5C1BA 4BB6A 1E9BA 1Z38A 1X2BA 3FTPA 3SOPA 3N05A 3C8DA 5GQSA 1NJSA 5CDFE 1YJBA 3LAWA 1V4NA 5FRDA 4G1EB 1NG9A 3K6SA 1VCOA 4UFOA 5JD5A 4XX0B 1KK3A 2NO4A 3AXSA 4LVOA 4Q66C 3TQHA 1Y1RA 1NXXA 4QYSA 4ED9A 1JILA 3CB4A 3AR2A 4EWLA 1LDNA 2A7XA 3SLKA 2O3RA 4MP6A 2DFPA 3JQ8B 3LC1O 4FHDA 1KL7A 2YV5A 3NRCA 3II6X 4I1SA 5TQ2A 4UU7A 3J80A 3MCAA 1E7RA 4MMXB 5G0TA 2EARA 1QO9A 2O5CA 4M89A 3DUFA 1QFXA 3T5CA 621PA 5I9IA 2FG5A 2VL7A 3CJQA 4DDMA 2A9JA 1CULC 3FKSA 2H06A 5A5DA 3PJRA 1FNMA 3H5TA 3LDUA 2BM0A 1PX2A 2EGUA 5LQUA 2RHCA 2QVLA 1MG5A 3N7AA 4HWSA 1P29A 4PZUA 4NJMA 3N6VA 5AXCA 4OCZA 4FWTA 2VDJA 4IXNA 4JFAA 4QBKA 2R8OA 3FF1A 2V54A 1XQWA 3DMYA 4AF7A 2IL1A 1XD2A 3WMXA 2AKEA 3ZJUA 3HKCA 1HYQA 1ENOA 2O2EA 1DHRA 3HI4A 2ZIXA 1G20E 3R6TA 3T3GA 4EH1A 8MHTA 4ILEA 3V7FA 3U16A 2YS6A 5FPHA 3NTXA 5FTLA 5I01A 2BGWA 4JL5A 1OFHA 1XVVA 2DFNA 3EB9A 1E9EA 2QP3A 3I9JA 4ZP1A 4C76A 1MIOA 1W9HA 4RLHA 1B1AA 2I34A 1QB8A 2KBEA 3CMMA 5U4QA 2O7SA 2DUUA 4CQMB 5L53A 1UC9A 3WGZA 5AQ1A 3P9XA 2VLBA 2LKDA 4J07A 1L8LA 3MWDB 2PUVA 1WW2A 4XJXA 3M4XA 3AZQA 2C7RA 4RMNA 4J0EA 1VKOA 3WNZA 2VA8A 2PKEA 1KHTA 2PE5A 3CHYA 2HL6A 2I29A 2UYGA 2HI0A 1C1YA 1P1FA 4DA4A 3DVRX 2DR0A 1GNTA 3GJ0A 4YJ2A 3LCVB 3TF5A 3RV4A 1BCRA 4MULA 2FSGA 4AYXA 1F8UA 1W85B 4HAYA 1G7CA 3TLJA 5AW1A 1XVIA 3IQGX 3BTOA 2WFLB 1E9FA 4L8GA 2VTKA 4YVFA 1OT5A 2P0YA 3ZD8A 2P6RA 1BEZA 1SVSA 2KE5A 3EG9B 2HLDD 1Q1EA 2C83A 2DWOA 2Q0XA 4KFRA 3FOFC 4M37A 3LNCA 4BTLA 5HW0A 3QA9A 1Y8AA 2PKRA 3ORHA 5DCUA 2C2KA 3F3KA 1QV7A 2G77B 4JC5A 1MV5A 4NH0A 1RYDA 1IVNA 1ZITA 2C4WA 2G72A 5CGQB 4B33A 5EFZA 4D9MA 1XZBA 2XUKA 4Q7LA 5HCUA 2GJAA 3W8NA 2XJ4A 3S40A 4MWOA 2J5QA 2PUJA 3VO1A 2BP7B 3K6RA 3OKCA 4K9RA 5TQ0B 5C7LO 1ZNQO 2GZ1A 2K7ZA 1TT5A 1KS2A 2N1MA 2XNHA 3AF0A 3VJKA 3JZIA 1TYEB 3PRHA 4D9FA 4QM7A 3ZGNA 2XITA 2JCXA 4B31A 1RZRD 1Q83A 1MAHA 3EUEA 821PA 1ODLA 3GJXC 2POQX 3EVCA 4IJ6A 2C3OA 4IRXA 1X1EA 5BQOA 2W5UA 3IAS1 4LBZA 4CGZA 2WZCA 4RGQA 5LWQA 3DBHA 3VYVA 2C5GA 4KSYA 5E9QA 2PPVA 4KLRA 5TSDA 4HC4A 2PMEA 1GU7A 2LNDA 3DM5A 4LJKA 1VRVA 1YMVA 2GN2A 4L8VA 4QEKA 2A5YB 2DSTA 1JA1A 4W1SA 4GSKA 1EVYA 3N87A 4F9FA 4NAUA 3OMXA 1R4NA 3V4PB 3ZWOA 3UO8B 1NXVA 3K9QO 4GYWA 1VIAA 4YUAA 1N2CB 3C97A 1I33A 1GKLA 3JYNA 1TJ4A 4ZEXA 3FHJA 2H31A 5KWJA 3F8WA 3PNMA 3KXDA 4G0OA 2HCJB 3GEDA 3LK6A 4JX8A 1WEHA 1DP4A 4HN4B 4V3BA 4RACA 1LK5A 3MMPA 5JAOA 2WYUA 3LLCA 1XO1A 3EXIB 3KALA 1WZEA 4RANA 4CIVA 2V3CC 5LU8A 1DBVO 2DTXA 3ED1A 3NTRA 1O0SA 4N5HX 1X92A 3R8XA 1HDGO 1ZHFA 1J56A 5CDHA 3EF3A 1UODA 4XGRA 5AOVA 4ZAWA 1I6WA 3KXKA 4LTMA 2JPDA 1RWOA 2PRZA 5LQRA 2YMQA 2CJPA 3G5AA 1YS7A 5DI3A 1XCOA 3RSQA 1F0YA 2JGFA 4NHOA 3RC1A 2BV3A 1TECE 3GNTA 3H04A 3L8FA 1GTJ1 4IGFA 2E5FA 4KDFA 4GR9A 5ELLA 2MMCA 5TMPA 4TZ0A 5IVHA 1KIMA 3KTFA 1G98A 1GL6A 3T5MA 5LU9A 2O54A 1VI5A 3JAMA 3OEHA 3ADCA 3DOEA 3D4BA 1F7VA 4KR7A 1JDJA 1N3BA 3OZBA 3FVWA 1EXMA 1Q84A 2HU8A 1YA4A 3OT1A 4AKTA 5LXTF 1P1HA 2ZU6A 4XSVA 3O84A 3ERCA 1ADBA 1W4AA 4RHXA 5CPBA 5H7XA 4F4IA 2O5EA 1N3YA 1IK4A 1U0EA 1QFMA 1IXKA 3MHTA 4QQNA 4FYKA 5B3AA 1SZDA 4U7WA 3ZXXA 3ETLA 5DT2A 1Q17A 1DC3A 1PI3A 1AQ6A 1XBTA 2Q45A 2JI8A 2VJPA 1FTSA 1L1FA 2V5UA 4U5XA 1E61A 3WJAA 1M2GA 1CDDA 4TKZA 5AW0A 1DFHA 3U39A 5JQGA 2D4HA 3PGVA 2O19A 3VR5D 2OZKA 3KFXA 3RQIA 3W34A 4RFSA 1ZNXA 1ZRMA 2XA9A 3GEMA 4Q3CA 1KPHA 4G97A 4R84A 3CTPA 3GOQA 4E46A 3EBLA 3UV7A 1LNQA 3WIEA 5F5XA 4FN5A 3SM9A 3S7TA 3ZJ4A 4C3UA 2K2QB 3QY9A 4YP0A 1PT6A 2AJ8A 4TTIA 5BSUA 4D0NA 1WBDA 2H5IA 1EUDA 4J94A 2X7JA 2QUAA 4PYMA 4QFMA 2DCUA 3VOAA 4DUYB 3RTEA 3AESB 3NALA 5DGIA 3E4CA 5H68A 3R6LA 4ZVTA 5FL3A 1TK3A 1SCAA 1U02A 3FCEA 2XVAA 4LV8B 3U7HB 5HYVA 1PFKA 5CT9A 3UJ7A 1A77A 4DJJA 4BP9A 2IY9A 3L7MA 2ISCA 2BFNA 2VT7A 3OU6A 4KLAA 3MCTA 4MVJH 4UMEA 3RADC 3WBKA 3KOOA 1TUBA 4RPKA 4ZO8A 2FR8A 2JHFA 1C41A 5JJKA 3OZXA 1Y9EA 3OO0A 4QTUB 1G21B 2LCFA 1JQDA 2QYSA 1I6LA 2XB4A 2BM8A 2CXHA 4H3SA 4Q37A 2PGAA 2BFBB 4YJ3A 5AK3A 4JVLA 4WXMA 3EDMA 3GRAA 1OOEA 3BIXA 1SHUX 4UAJA 5EP2A 3O4VA 1YR1A 3WOHA 1G19A 1H1LA 1MRSA 1V43A 4MW6A 4ZEVA 3H0EA 3IV9A 2DCMA 5HG0A 3ZBTA 4PYLA 1ZD1A 3HCFA 4LHEA 1GYRA 3KNZA 2CXPA 2YHSA 5BWOA 3S2ZA 4LI0A 3PZBA 2HJ9A 2YYSA 1OJLA 2KBFA 2PT6A 2GXUA 3GPCA 4HXGA 3E9YA 2ZJ4A 3B3GA 4KXVA 4OK5A 1JIIA 3W8EA 1M2JA 4J0KA 3HYLA 4X9XA 1SZCA 4QRHA 3KOXA 5JS6A 2GOYA 4KYTA 4FIZA 1XN1A 3NBXX 3PC3A 4IIJA 1J5XA 2AJTA 3DLAA 3IE2A 2RGUA 2D5LA 4GOMD 2QS9A 2YN4A 2Z3VA 2Y93A 1WLSA 2V1XA 4L8LA 1O4WA 2IHUA 3JYQA 1JBQA 5LOVB 2P2DA 5F4BA 3OIDA 5DW0A 1EVIA 2RBGA 3HXLA 4NZYA 4WK4B 3IHTA 1IMJA 1ORRA 4XCXA 2WHPB 1NXOA 5G02A 5DW3A 3RO7A 3FD8A 3KJXA 4CR7A 4NZOA 3LJKA 1KR5A 3GK3A 4CV1A 4N48A 1U7TA 2GGSA 2J33A 1M83A 3A6DA 3UT5A 2G09A 2GJ4A 4LJ8A 3V3TA 3ZE2B 3RD5A 1JE0A 2DHRA 4F8YA 2PN1A 3FLAA 4F56A 1NTOA 4BNUA 3WL5A 3WJ2A 1ZH6A 4K46A 1ACJA 1FFSA 1C30B 4NBRA 5AVVA 4FI3C 3OLZA 2REQB 4FHEA 4AZ3A 1VLLA 4ZC8A 3L02A 4JR0A 3DVQX 4TMWA 2XOEA 4RO0A 4GMXA 3IUNA 2OXRA 3MBIA 3OPVA 5EMMA 5I7WA 1Q0ZA 4HDKA 3ZGLA 2WJGA 2GETA 2AOUB 1E2MA 3ICPA 3Q8KA 1Y81A 3D59A 1ZBQA 3MCUA 2VJBA 4A73A 4EI7A 2H3EA 3B1VA 2CE2X 2O6HA 4K9SA 1N6RA 1P81A 3PD7A 1K6IA 4IIYA 1V3QE 4AX4A 5KCZA 2FF5A 2JLVA 3EH2A 3MTBA 4HDMA 2R68A 3SJZA 5SZIA 1H9BA 1XPUA 4FFLA 1NW4A 2ZRJA 1QAQA 1Z0UA 2CFCA 4ND7A 3VPCA 4B7CA 5LZ8A 5I7EA 5ARBA 2YYZA 1J33A 1NMZA 3ID6C 4PWZA 4TXJA 3DYIA 4ALIA 5IASA 4KXMA 1MOZA 4N40A 4DRZA 2UXDB 5THQA 1YULA 2QUJA 2O8CA 3NX4A 5DU2A 2CDBA 4HLNA 5CA1A 2HDWA 3I39X 2KI5A 2H2GA 2WNSA 1T8TA 4YP5A 4PC6A 4R0MA 4G1FA 4YRNA 2VTEA 3GRFA 4I7EA 4ND4A 4BLOA 1MC4A 3E4DA 3OOSA 2J85A 4Q1FA 4QULA 1K5HA 1XJCA 5JCJD 2W4MA 4BN4A 2P9ZA 4WLVA 4C21A 1KJNA 5H83A 2BI8A 4HBGA 5C4GB 3CCFA 3R7LA 2PKXA 3BFXA 3F7OA 1I2MA 2EATA 4NBNA 1JFSA 3SR3A 2CL7X 4AMBA 4ZTBA 3TKLA 1RTTA 1OXBB 3NBKA 4L6IA 3EZXA 1SKBA 2CBGA 2Z83A 3BL6A 4IRUB 3W2HA 4LC1A 2GN6A 4OQNA 2CMDA 3IO3A 2ZRMA 3CLUD 4XGKA 1IN1A 7REQA 2IT1A 2HLDA 3RU3A 2H2FA 3OETA 5LYJB 2W6OA 3EWIA 3H11B 1BZYA 2FH5B 4ODIA 3BXHA 3LD9A 2VRWA 1EB8A 1M6VA 3ICCA 3WJ1A 4DIOA 3O92A 4PSUA 3OQNA 1KO1A 2FKNA 1ATIA 2ALJA 1YJ5A 3GFRA 2IYYA 3C3PA 2FEAA 4UM7A 5DO9A 1TTPB 1QHHB 1BTOA 2B2CA 3O94A 4LOHA 2NVUB 2AEMA 1KVTA 1YSCA 3AY0A 3LTEA 3QPWA 1AE1A 4G0YA 3I34X 3FAZA 5EJ6A 4G5FA 2ZIZA 1L5QA 2Y1CA 3VJMA 3WO0A 4EG7A 4YT4A 1RZRA 2CNKA 4UBJA 2X2FA 4REMA 1UP4A 1AMOA 1TADA 4LC0A 5A5EA 4MGYR 5ALQA 4LSZA 2NZYA 2WVGA 5DXJA 2F3QA 3MRVA 3FROA 3ZTTA 1VYHA 2HSEA 2A9KA 4PZ0A 4M8IA 2Z6UA 4DN6A 3J7AC 4O2RA 2PAFA 5C0OE 1ESNA 4EJSA 1RBZA 2GBLA 5KMGB 1PLLA 2OV8A 4MQEA 4UDYX 4W5HA 1P9LA 1WTCA 3AEXA 3S1LA 4XYLA 5G4KA 1O4VA 1AQJA 3OPMA 3HNOA 4LYFA 4Q18A 3MWFA 1B6SA 3T9AA 4IMRA 3ZK7A 4H3KB 2AKAB 2FSPA 4ZQBA 2IHZA 1EK0A 2HJRA 3P0RA 4F21A 5KVSA 1W36B 2Q6TA 4DB4A 1B2LA 2XT0A 1ODTC 1XI2A 3QWBA 4NZMA 2Q0SA 2WMNB 4FE3A 3N8IA 5BT8A 4RORA 1E1YA 3AIIA 4JL6A 3TRHA 2VUTA 2IUFA 2Z43A 4U2KA 1G6OA 3G17A 1JA9A 4YAKA 2B4RO 4QATA 1ISGA 4E3ZA 2XUHA 5FOWA 3KUXA 4ZVRA 3OPYA 1YDEA 3AJAA 3VX3A 4DLWA 4B2IA 1QHSA 3D43A 4WT7A 4YV1A 2XUZA 4CG2A 1GYPA 1WMSA 2ONZA 2VK1A 5C52B 1JDBC 3Q87B 2IGTA 3FRIA 3WK9A 2BI7A 5FBQB 4B75A 1E9RA 1ZAKA 5T6MA 4DWOA 4DXHA 1EXNA 2B2NA 2EP8A 2GBGA 2BUBA 2GVNA 5I4KA 3U60B 1X9IA 4DQUA 3KFLA 4P9NA 4PGGA 4QWWA 1LFDB 1BXGB 4HP8A 5DBEX 4EY5A 4ZZ2A 1RRFA 1Z4QA 1SU4A 2G36A 1XZCA 4YQEA 3VAYA 1G0NA 4GC9A 5KNDD 1OX5A 1DARA 2BUCA 2QG9A 2X3FA 2CXXA 4ZKEA 2E85A 1ZM2A 4YONB 5AOCA 2CLSA 1JLKA 2HPAA 3U3JA 1O54A 2IYOA 4PO9A 1F38A 5EZ6B 3DXFA 3F98A 3HCEA 3V8PA 3L8EA 1NJGA 1WCIB 5C53B 2Y4OA 2NXCA 3VTZA 1IY9A 1C14A 1G8PA 2DC1A 1WKBA 2GCOA 2MMGA 3FWYA 2UZIR 4PAMA 3PXGA 1MW9X 2BW0A 3K53A 4V3CA 3F96A 4DDTA 1HNXB 5EUQB 1U8FO 3MAGA 4X54A 5DH9A 2NU8A 2ID4A 2CVZA 4JQSA 4D3ZA 1G5TA 2Q1TA 4GZ3A 3X2EA 3G23A 3LFHA 2XXBA 3VKWA 1XZQA 3C16C 1JSCA 3D9QX 5KYNA 4HATA 1K0FA 4QDZA 4WLEA 3VR5A 1DE0A 2GZRA 4URZR 3ZE9A 2O8BB 4IQFA 1ITZA 1BGXT 4I5DA 3CZAA 1OQAA 1YRLA 5KTTA 4H7KA 3ETDA 3EVGA 3C87A 3CJRA 4C2AA 3HZOA 1ZOOA 4DLBA 4CYMA 3ND8A 2TMYA 4N5DA 3NHWA 2HADA 5TC4A 5DM4A 4DY6A 1Z0KA 3SX2A 1TZBA 4S2EA 1RLUA 1HRKA 1N36B 4G4IA 4OX9Y 3U0BA 3EDOA 3O9MA 1ODKA 3GJ7A 1TYAE 2BJWA 1IXRC 3S2YA 3L7YA 4K05A 2RJOA 2UYQA 3IXLA 3NDRA 1AS3A 2AR9A 3GGOA 4MS1A 4NQRA 4P3OA 4Y2HA 2HPVA 1XTQA 2GPWA 1EAMA 2VF4X 3QKRA 3RSHA 2UYCA 3V1MA 2PQMA 1G3MA 5KTSA 4FFMA 2DGDA 4WMLA 4J4BA 2GYUA 5T41A 1HZZA 4NDNE 4NP6A 3WGVA 3ER6A 4KQHA 4GMFA 2QTVA 3P2MA 4JA2A 5H3LA 2ABWA 2CWDA 3ASUA 3A9SA 5M34A 5DOZA 3W77A 3KKZA 5LKRA 4G56A 3ZU5A 1Y8RB 2LGJA 2HYIC 1DTEA 2VF2A 3D3NA 2OGZA 4JP3A 4AI6A 2F6RA 4JASB 2C2BA 2J4CA 3FYSA 1O1YA 4M9CA 4QXQA 1C3VA 1KI7A 4QYMA 4GM1A 2DHCA 3ZBUA 4UTXA 2VH2A 4Q7JB 4TT3D 3LOUA 3LOPA 4F38A 2VUUA 5C8YB 5GOZA 3OIFA 4ROSA 4D3SA 3EDQA 2CV2A 1YXMA 2YFKA 4TTPA 1BVYF 5E3IA 3UJDA 5GJWC 1ZUNB 5ICEA 2V55B 5C8VA 3UFXA 4RKWA 1E9SA 3MMSA 3RC3A 5K8JB 2OVFA 3P0FA 2AL7A 1PR5A 3AB3A 3IVAA 1C9KA 1NL3A 2JI9A 4YAOA 2CEAA 3H9GA 3SR4A 1PQWA 2XH8A 1OR8A 2ZRBA 4M36A 4L3VA 3SF0A 3W2TA 4D56A 4R1UA 4MUHA 3A6GA 5EKDA 2H4YA 3CG0A 2AF4C 1T3GA 4PZLA 5B1DA 2CJXA 4XTRA 5A4IS 3K30A 3B52X 5EVJA 1R16A 2A35A 2RGDA 2OO5C 3QU4A 1RVDA 2NO0A 2XQFA 3HFRA 3PF9A 4Q7EA 5EFOA 1NBMD 4XLZA 1IZ7A 5BSVA 1MX9A 3Q7RA 3PHCA 2CN1A 2FPGB 3O03A 4Q4LA 5I51A 2FSUA 3IDFA 3PYLA 5HFAA 4LRQA 4L15A 2B6HA 4URXR 1L4NA 1OHHD 4MUAA 2D62A 3IIJA 1L5ZA 3O3NB 4R83A 2R7MA 4TXNA 2FEPA 4KFCA 2ACWA 1XLWA 3JATA 1OUMA 4YDQA 3FPJA 1LH0A 3IBCA 4BLPA 4YRZA 1YR2A 4YJ2F 3S7ZA 4C7KA 3OSUA 1AC5A 4IUDS 1ZX1A 3LNTA 4MYUA 3UMFA 1GTRA 4KO3S 1GCUA 1T36A 4AY4A 4K9OA 3DEKA 5FKJA 2G80A 2HNBA 2G88A 4TLCA 5FI3A 2B1RA 5F64A 4C2BA 3SC6A 4BV8A 2FSVA 4DVJA 2C9CA 2IRWA 4UQLA 1GEEA 4DHEA 1NI5A 1W76A 2HSDA 3SX4A 4WRRA 3Q8MA 1T3ZA 3IBTA 5LB2A 5AM2A 4LZWA 3D3WB 3X44A 1KMIY 1QE0A 1NNI1 2AT1A 4OHVA 3WXMA 4Y1RB 1NE7A 2QE6A 1AG9A 2DX7A 3NWEA 4IJQA 1NMEA 2VQDA 5DYIA 1BMQA 1WKCA 5AIAA 1NVTA 5IUKC 4TXMA 1DXYA 1TLTA 2CB9A 4UREA 2WKSA 3SJCA 5K6RA 1RR6A 3CLRD 4G5RA 5BT9A 1M66A 3QVUA 1GNSA 5JCJA 3I32A 1AKQA 2B21A 2D06A 1YF3A 2H1RA 5HEKA 3R0XA 1KA9H 2JEYA 1ZXLA 2MWMA 3CRMA 3WLFA 5B6JA 3Q11A 1NQVA 2RGAA 3BHNA 3OTOB 1LBSA 1P6UA 4HDRA 4ABYA 4K3UA 1QMPA 1WXDA 2HIMA 4U7HA