2VPPA

Drosophila melanogaster deoxyribonucleoside kinase successfully activates gemcitabine in transduced cancer cell lines
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
192
structure length
189
Chain Sequence
TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPKVLVLDADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Drosophila Melanogaster Deoxyribonucleoside Kinase Activates Gemcitabine.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 71
structure length 189
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vppA00
1NG1A 1VYVA 1M34E 1IHUA 2PH1A 3KFXA 4C0AC 1IOZA 1QBKC 2K5UA 1U99A 5FBWB 3AF0A 3QQ5A 1U8AA 1ELOA 1NLYA 5CYOA 5DO9A 5GJWC 3VHXA 3AUXA 3VKGA 2J9RA 2OT3B 2HLDA 1E2MA 2WHXA 3KB2A 1T6NA 4H1VA 1J2JA 1NLZA 3NDPA 1JEEA 1E2KA 4JLOA 2F7SA 3MSXA 3P4XA 4U5XA 3NEYA 1ZD9A 5KUTA 3VR1A 4MDFA 3EC2A 5B58C 1VHLA 4QL3A 2QQEA 3V9PA 221PA 1L2TA 4UNRA 4DLRA 5JCZA 1HE1C 1U94A 2DWQA 3ADBA 4TYYA 2GNOA 3BC1A 4B33A 1XJQA 3B60A 3PEUA 2YKGA 1NLFA 3LDAA 1G1MA 4M1MA 4W7SA 3X1DA 2YC4C 5JHGB 1UKYA 2D2EA 4JS0A 5FOWA 2H5EA 2ZJ5A 3NBFA 4MRNA 1WMSA 3RSOA 3CRQA 4S2EA 4BUJA 1T5LA 4NKRA 2WOJA 2WKQA 3U61B 2BIFA 4S35A 4D4KA 4FI3C 4QM6A 3ZLJA 2XB4A 1Z83A 4M2LA 4JYCA 5KOYA 3DKPA 1IY1A 2GF9A 3CZPA 3GPLA 5CDFE 3C5CA 4QM7A 1T0HB 1XEFA 2KI5A 1SZPA 3MG9A 3ND9A 2E87A 5HPYB 3B7GA 1OXXK 2J0VA 3L0SA 3ZIAA 2DFKB 5SZKB 3OAAD 1FPMA 2O8DA 5KNCA 3J81k 3GLHE 3H84A 1E9BA 2Z0MA 3SC3A 4V03A 1LY1A 1NN5A 1X8LA 1BYUA 2I3BA 2WKPA 1GG2A 1XEWX 2IEYA 5FL7D 1IN4A 4GOKA 2JCSA 4OQMA 3F3YA 2ZI5A 3PV0A 4PHGA 3B9PA 4F4IA 1OYWA 2ORIA 2HJVA 2FEOA 4RKEA 3OEHA 2ZE7A 3B13B 5FTNA 4OQNA 2V3CC 5H70A 1E1RD 5AWFC 4A82A 4DIDA 1PLJA 1YRAA 1G5PA 3OFNA 4LGMA 4UKDA 1ESMA 2ZJZA 3UWKA 3UWOA 3G0HA 3WNDA 3GMTA 2CVHA 1NL3A 4DCNA 1G8PA 2Y8EA 4I1VA 4EPWA 2XITA 5JWOA 4BWYA 1KZ7B 4ACBA 2EVWX 3I72A 4WAUA 3T61A 4B35A 2BV3A 4OQXA 2GXSA 2WMNB 3B85A 5EQTA 4EFMA 4DSTA 5JS7A 2C99A 1YHNA 3B5JA 1RJ9B 1CKEA 4G1UC 1EX7A 2ZSFA 3AF3A 2XSZA 3CWQA 4UXJA 5CJPA 4C0HA 4PXAA 2EFDB 1DO0A 4NYIR 3AM1A 3SBDA 4D4LA 5KNBA 1S1MA 1DPFA 3BK7A 4RCZA 3M1IA 1E4VA 2VSXA 4YXWD 2ZR0A 5CB6A 3WHLA 3RRZA 1N5KA 3AP2A 3LD9A 3I61A 2ERYA 4IOLA 4R98A 3ASZA 4ZV4A 4CEHA 1N6NA 3AVQA 4AKHA 1XB2A 1SVIA 1LB1B 2QGNA 1GDDA 4JL8A 8OHMA 5EE0A 3THWB 2JATA 2KJQA 2A5GA 1E0SA 2GEUA 2JJ2A 3SEAA 5D3QA 1ZW6A 1HT2E 1KO4A 1KMQA 1DEKA 1E94E 4NCKA 4ZIRB 3U60B 4EPTA 3FMPB 2J1LA 4A0RA 1J7KA 4DDUA 4URYR 3DPUA 5JJLA 2J5XA 4QNMA 1HTWA 3NDBB 2IW3A 5HZKA 5DYIA 5FOTA 3ZH9B 2J0UA 4ABYA 4QOSA 2VTKA 2MMCA 3TLXA 3DHWC 1ZINA 3QF7A 1SVOA 1Q44A 3HR7A 3LXRA 4POAA 4DHEA 3QPWA 5IK2D 4RVCA 4Q03A 4HI0E 4QGHA 5JI3E 1EFRA 4IOJA 2XXAA 2PZGA 1KDPA 5BN3A 3OIUA 5IT5A 1P2TA 4PQYA 3SS8A 4BFTA 2YNMA 1TQ4A 2OCYC 1TF2A 1Z3IX 2VQSA 3MWYW 2BMJA 3F0TA 1M2OB 1JQJC 3EZFA 4C3ZA 1LS1A 1UFQA 4MUAA 5KTYA 1JQLB 1G291 3REGA 1I4TD 1G20E 1E1QA 4QHSA 3ZIAD 4AWXA 3A36A 1W0JA 3B9QA 1MO4A 3L2OB 1AM4D 4OI2A 3FE2A 4EPRA 2H7VA 4MKGA 4Z8YA 1CJKC 1QHHB 2YWFA 2R65A 2JDID 2RGAA 4MYHA 3E1SA 3CIOA 4A8JB 1Q3HA 2FOLA 3B6EA 3BD9A 4JL5A 4P3YA 1E2QA 3B2EA 2JJ8A 3EZ6A 5AJVB 5DYGA 2OLKA 2QMHA 1ZM3A 5CM8B 1VCIA 1E9EA 2ZRGA 2OCPA 2CHVA 3P20A 3AF2A 3VR4A 2CK3D 3FB4A 1W48A 2FE4A 3KJGA 2XX3A 1BKDR 4QHTA 4Q00A 4FCTA 3SE0A 2JLXA 2GCOA 4PSKA 2B7BA 3IPYA 2OE2A 4PSAA 3GLHB 2ZU6A 3A1WA 3BB4A 5HKKA 4QKQA 3I4LA 1XPOA 3EAQA 1X6VA 2HCBA 3LQRA 4Q4JA 5FPHA 1UKZA 2IF0A 4GL2A 1H65A 4LC0A 1RYFA 2GJAA 5CB8A 1S0UA 2F3RA 1VHTA 5FTJA 3WXMA 1OV4A 4JKYA 4URXR 1DOAA 3TBKA 1IONA 2YINC 1JR6A 3FPAA 3X1XA 3W3ZB 2EYQA 1F2UA 4F91B 2RGEA 1OXTA 2JJ2D 5FR2A 5J4KA 3LW8A 3QXSA 1P9WA 2OXRA 5FTKA 5J5CA 3TMKA 1G9XA 4TLDA 4WOPA 4XTRA 4LOAA 4B48A 1AQYA 2WVJA 3E5HA 2ZRMA 5TB5A 4HUTA 3R7WB 3UMFA 3EIHA 5GVRA 2QAGC 4RY2A 2RH5A 2ORVA 4Q9HA 3AUYA 1W46A 4F7WA 4L16A 2W83A 2FSIA 1D2NA 1WRBA 1XNJA 2GCNA 4HATA 3VHLB 4JT4A 4B71A 2ZYVX 3FMOB 3JZAA 4E5UA 1KHTA 1X1RA 2W0MA 4TL9A 2G9NA 2UZ3A 1U9IA 1GNRA 1U0LA 3U7EB 4A9AA 2P6UA 3TIFA 4QBHA 1XJCA 5BN5A 4UJ5A 4IKEA 2AHOA 3IIJA 4DEYA 1EFRD 2ZJOA 2O8DB 3M0EA 1SVMA 1KI9A 3AKEA 2YOFA 4JLKA 2VIIA 3VX4A 2V6JA 4ERNA 3V4RA 3MWLA 1CEEA 2V6IA 5EXSA 2JIZA 3Q7QA 2ZTSA 2AD1A 3LLMA 1QHXA 1XXHA 2IUUA 1ZD1A 1BOFA 2WJHA 3AVUA 3SQWA 4Q1FA 1DVRA 1XZPA 4RD0A 5TV2A 4LI0A 4LPSA 3FMFA 4HZUA 1W0JD 3ZVRA 4C0BA 4A2WA 3D8BA 4JZKA 1QZXA 1QVAA 2QT1A 3CF0A 1BO6A 4M21A 2VP4A 3Q9LA 4KITB 1NKTA 5EE3A 1Z06A 1ZMXA 1E9DA 2Q3FA 2UVQA 1P62B 4B3XA 5FTMA 1OLOA 3T35A 1XTIA 2ZVQX 3OE7A 3KTAA 3LWNA 2G88A 3SI7A 1OKKA 2WWXA 4LK2A 4A0FA 2JEOA 2KE5A 1MH1A 3H1TA 1E79A 1YVDA 1WCV1 2V7QA 2ZS8A 1Q22A 3BBPA 3WYAA 3EX7C 1P2VA 4ZKEA 3X1YA 3IDQA 2HUPA 1U0JA 1KJWA 4MGYR 1KIMA 4A1FA 3LQQA 1N6KA 4IDHA 3S1AA 1AKYA 2RKOA 2QTFA 1RRFA 2C96A 4QJ4A 5LB4A 2FZLA 4HZIA 3PJRA 4FINA 4LV6A 3Q8XB 1U98A 4ESHA 5GADl 4R2IA 4CEHB 5HKKD 2P6NA 3SJCA 1E2PA 3RWMB 3IIMA 4LJ6A 4HSEA 4GFDA 5FOVA 1ZM4A 1Z2AA 3NHAA 4A2QA 2X1VA 1GNPA 2ZE5A 3BAFA 4CVNA 3CRW1 3NEJA 1R0WA 3TQCA 2FN4A 1TPZA 4QGAA 2BEKA 2C95A 3THXA 4BRWA 3CPHA 3UIEA 4B2LA 5TVKA 1KGDA 4LYAA 4KJZA 1QDEA 2VP5A 4YMWA 3K9NA 4MRSA 1GKIA 3EIQA 2ZRLA 3HJNA 2J0UB 5AUQA 4GI7A 2FNAA 2ZETA 3E2IA 4NTZA 3CH4B 5DN6D 1GITA 3T5GA 2PMKA 3QKSA 3IIKA 5C4GB 4ASUA 1RRCA 2XZPA 4OYHA 4ZDKA 1TU3A 1W7AA 3D3QA 1CIPA 2O0KA 3NH6A 4DJTA 2F9MA 4IOKA 4KYIB 4LBVA 1W36B 4J0QA 2XXAB 2FG5A 3I5YA 2EQBA 2ANBA 4LHWA 2VP9A 3T06B 1Z63A 2OFXA 4CEJA 4EAQA 2WMOB 2ZE6A 4DUGA 4CZ2A 1XDBA 3I8XA 4HAVA 5EZ6B 5L8VA 1ZUHA 2CNWA 2IK8A 2YC2C 4PAOA 3VTKA 1G7SA 2VHCA 4A6PA 4O2RA 1AS3A 4TTPA 4NCNA 5EXXA 1RYHA 2RAPA 5LD2C 4JKIA 4KU4A 1ZNWA 2YZ2A 2NO0A 1E2EA 1U81A 2JIZD 2PBRA 4KBFA 4I1SA 1HV8A 3SYNA 4XSGA 1R5OA 2GEVA 4MGIR 2Q9AA 3DZDA 2ONKA 3QOFA 4MQBA 3T1TA 1C4OA 1WP9A 4D0LB 4UNNA 4GSYA 2AFHE 1T5IA 3HPQA 4NONA 1L8QA 2CL0X 2X19A 5KDDA 3OE7D 4OQFA 4BLTA 1E2FA 2PZEA 2D74A 1M7HA 2QL6A 1FX0B 3FHOA 4JLMA 1TQ2A 1G8YA 5KSOA 3PUZA 4CT4B 5AUOB 1HE8B 1TEXA 3DM5A 5DH9A 1AGRA 2G83A 1PLKA 4KFSA 4DLXA 2P5SA 6Q21A 2HEIA 2ZM5A 3FFBA 3FKSA 4LJ8A 2CE7A 2EFGA 2CBZA 2VHTA 1G7TA 1HT1E 4Q4JB 4IDNA 2IWHA 5JWHA 5LD2B 1GL9B 1N5LA 1RFLA 2DFNA 4Q9JA 2IYXA 3D6TB 4ZDIA 3C4JA 4MRVA 3SZRA 5FOXA 3PXGA 1WQ1R 4EPVA 1E98A 2X2FA 5J4YA 2WV9A 5JS8A 1ZC4A 4NYMQ 2W2XA 3QF4B 5EP3A 1CULC 1F2UB 1P5ZB 3TR5A 3REFA 1JBKA 1B0UA 1W4BA 1WE2A 2Z83A 4PO9A 3X2SA 2NPFA 3GFTA 1YZLA 1XTQA 4UQOA 4TYQA 2NZ8A 3LH5A 3GEIA 1DAKA 5GJBA 5FBLB 1Q12A 2QP3A 1CJUC 4MRRA 3KB1A 3KKPA 4QBIA 1Z29A 1RE0A 2GXQA 3U6KA 1CR4A 2IT1A 4K46A 2FEMA 2EYUA 1CJMA 4KODA 2NO1A 1ZC3A 2IS4A 1N5JA 1IXSB 3UKDA 1HYQA 2NTYC 1AQUA 4P4UA 2RGXA 4DBLC 2GHIA 1E32A 2YWGA 1BMFD 4PC3A 3LA6A 3KL4A 1MO3A 1WA5A 3K0AA 5KPJA 4LHVA 5EE1A 2CDNA 3QEOA 4F38A 3KQUA 3HWSA 2FFQA 4C0JA 4B6EA 2B8TA 1Z2CA 3ZVMA 2BBWA 1XXHB 4EDHA 721PA 1FTSA 1FNNA 1NIJA 3QPUA 4TMXA 2JLQA 3NWJA 5J47A 3TGPA 1UBEA 2HJGA 3LW7A 4HZUB 2CLDX 2GZHA 4M9XA 3ZVLA 1II0A 3CO5A 2BMEA 3NKVA 4TL8A 5JHHB 2XZLA 2NG1A 5DE3A 1GZSA 4UNPA 4KO8A 2NQ2C 3P32A 2C77A 1CRQA 2ATVA 3KKOA 3KTAB 3FKQA 4PR0A 1KZGB 3THYA 1KTVA 4KLNA 1XPUA 1M6NA 2OM2A 1SXJE 3CNNA 2IXGA 5E7MA 2FPKA 1GAJA 1EGAA 2BVNA 1Z07A 2OESA 1TMKA 1J99A 2B8WA 3TUIC 1WBBA 5FPKA 1S9DA 3THWA 3VAAA 3I62A 2BOVA 2GETA 4LBYA 3PUXA 1YE8A 4X8LA 3S1AB 2FPMA 2Q9BA 2VP0A 5C1BA 1RPZA 4P4TA 2O8CB 5HE8A 3K8YA 3D31A 3EC1A 2XJ4A 4RD6A 4Z51A 1QVRA 3UPUA 2LKDA 2P67A 3ZVNA 1L4YA 2JJ1D 4EPXA 1J8MF 2D06A 1XTJA 4URVR 4AY2A 5FFMA 1G3RA 3L0IB 3P27A 1XF9A 3U3OA 1G8GA 2GK6A 3AQ4A 2IHBA 1MR3F 2XOKA 4IXNA 1KSHA 1EFTA 3BFXA 5IHPA 2CE2X 4JJKA 3ZD7A 2ZANA 1JI0A 4QC2A 3THXB 3SR0A 3U7GA 4I99A 4WZAE 1KI2A 4JLVA 4F4CA 5GVSA 2ZPTX 3KUDA 2W0SA 2IUTA 4QNRA 1TF7A 2ZI3A 2QSZA 4US0R 1NVXQ 1KYIA 2ODBA 3V00A 3IUYA 2W58A 3W3AA 1OHHA 2QI9C 1CF4A 1ZUNB 4D81A 2YV5A 2D62A 2OFOA 3QKSB 3ZS9A 1KDRA 2H8KA 3SU8A 1LVGA 1SHKA 4X8MA 3UANA 4DLUA 1VPLA 1QHHA 3OIYA 4JYBA 1FQKA 2VO1A 4C0SA 1JJ7A 3DDCA 3CONA 3KZ1E 2I4IA 5SZHB 3KXIA 4CEJB 2N1BA 1VG1A 1P6XA 4LC1A 5IDVA 4BFSA 4Q1BA 3GD7A 4Z1MA 1OH7A 1KO1A 3C15C 1EXMA 5L3RA 4ZCLA 5LBIA 1L7VC 3BWDD 3K70C 3C5HA 3TUZC 5JI2E 3BORA 2CMKA 5B30A 4GOJA 4L9WA 3LX8A 1KJYA 5CDFA 3PQCA 2W6JD 4GZLA 1F3OA 2RGDA 1E99A 3PUWA 2PL3A 5IRCD 2ZUCA 4ITRC 3VNUA 4D80A 2WICA 2ATXA 2ZSAA 3U3KA 5JZVA 3GLHA 4B34A 1SXJC 4RD1A 2YOHA 5FOUA 2OCBA 4HAWA 4V0MA 2Z4SA 1E0KA 4ZI2A 1J90A 3WHKA 2BCJQ 3ZS8A 4EFNA 4Q7KA 3FHCB 4AKIA 1RKBA 4RZUA 2ZRPA 4TT3A 2G6BA 2O8BA 1VTKA 1ZRHA 5DLQC 2F1HA 2F43A 2ZJBA 2XB2A 2IS6A 2GAAA 3ZYCA 4OJKA 1N25A 2WSMA 2J0SA 2G77B 2KB0A 4DLSA 4WA7A 4YMTA 5HCIA 2Q0HA 3N70A 1NIPA 3R7WA 4US2R 4Q7LA 4BZPA 4DB4A 3B78A 1C9KA 2EWWA 5KYKA 4MYTA 4BLOA 1TX4B 1T4GA 1UDWA 2R6GA 2ZYTX 1K8RA 4WW0A 2QTHA 4HAYA 1YR9A 5HTKA 3GFOA 1FNMA 4BLSA 1G7CA 2X77A 4V02A 5C2JB 1JXOA 2PJZA 1JB1A 2QE7A 2HT6A 2FDCA 1GL7A 3O47A 4M22A 1QHNA 2DR3A 2ZRIA 4P4SB 2C98A 2VRWA 2EW1A 4LRWA 5D3MA 2FMXA 1M1YE 1ZBDA 2D7DA 4G0NA 3NXSA 2ZRKA 1PUIA 2UKDA 2P3SA 3QY0A 1F6BA 3EPJA 1G5TA 4QJ3A 4LBZA 2AWOA 1VECA 1X3SA 2XAUA 3WP0A 1P7CA 2GESA 5F2EA 5ELXA 4V0ME 3CB4A 4Q21A 4Q4LA 2QGZA 4RFVA 2C8VA 2ANCA 1R6BX 3MJRA 2FFHA 3RDPA 2O52A 3F8TA 1XPRA 4IOMA 3TH5A 2DPXA 2QAGA 3K0AB 2X8AA 2DHRA 3R9IA 5DNYB 1ZYUA 5G40A 3DMDA 3WBKA 1G17A 1VYUA 1GRRA 1IXRC 4GP7A 2RCNA 3U44A 4MA4A 4Y0VA 1PJRA 3FMIA 3TE6A 1OFUX 2R44A 3PCRB 4WZBE 1S4QA 1DAEA 2RHMA 2RGBA 5CYPA 2W6IA 2CLSA 4JLDA 3VNVA 2WWGA 3KQNA 4Q02A 2V4ZA 4AG5A 2PEYA 1Z6GA 1G16A 4LPKA 3THYB 4PZLA 5AJZA 3GFPA 4TTRA 2G0TA 2HLDD 3UG6A 4YDHB 3LBHA 5BWMA 5A5GA 2IXEA 1EWRA 2GKSA 2O8FA 5C4MA 2QQ0A 1SKYB 5CLLA 2ZR7A 2PJRA 2JAQA 4EPYA 4B2PA 4G5GA 4B3GA 3OEEA 1X1SA 5JCPA 1UBFA 1GNQA 5FTLA 4CIDA 1MRNA 1N6PA 1TEVA 2OFWA 1ZM7A 1NN1A 1ZCBA 1T9HA 3HR8A 1NN0A 3U3RA 3FYHA 5JEEA 2KWIA 2ORWA 1M7GA 1KMHA 1MOZA 4ACAA 2PEZA 2WAYA 4JLPA 3QPVA 1M7BA 1G64A 4IDOA 4O3MA 1U0HC 5FI1B 3A1TA 1OFHA 4YLGA 3GJ3A 4LCBA 2O0HA 4C30A 1OH6A 2CCGA 5FBRB 2GJSA 5DSZA 2I1VB 3SJZA 2ZYWX 4DVGA 4NL4H 3A1SA 3RWOA 1LV7A 1GILA 4TN1A 621PA 1G5RA 3KJEA 3GP8A 1Z0DA 1KI3A 1X8JA 1XRJA 2ZS9A 2QMOA 2BM0A 1IAQA 3K0SA 3CRVA 4LJ4A 2OAP1 1DS6A 3EZ2A 3MD0A 1XFAA 2D7CA 3L8YA 3LBNA 4IEEA 4BFUA 1QF9A 2EFHB 1JEDA 4C0KA 4MDEA 4US1R 3PFIA 1F5NA 4Q1CA 5EZ5A 1KI7A 2QPOA 2VHJA 1P72A 3I8SA 3L0PA 1YKSA 1N0WA 3IHWA 5A4JA 2Q3HA 3NC1C 4LV8B 4NU0A 5E7JA 5B57C 1W1WA 1NKSA 3AGQA 4PC6A 3OEHD 4ZPXA 3EA5A 4DLYA 1G3UA 3SFVA 4FCVA 2YYZA 2HXSA 4IXMA 4URZR 1S3GA 1PZNA 3BH7A 2WJVA 3LRPA 3AF4A 4HYYA 4DLZA 3OFND 4IDQA 3RVBA 2ZSEA 4XVUA 3K9HA 1XTSA 1GIAA 2J7KA 4AC9A 3EPKA 4B47A 3W6PA 2WOOA 2ZYUX 1FX0A 3KJIA 3O8BA 4AIIA 2RMKA 1XD8A 4KI0A 1ZAKA 2OUKA 2OZEA 3TSZA 1GRNA 5AUPB 4Y0AA 5F3WB 1A5TA 5FUWA 4OKSA 4XJXA 1S9HA 4RKFA 4Q9IA 3TVTA 4GDFA 2XSZD 3IBGA 1P4SA 5BXQC 4L15A 2ZU0C 2IBMA 4TSFA 3U2QA 4OJQA 3U3JA 1KJZA 3ZZTA 1W44A 4BLQA 1HEIA 5EXPA 2O8BB 2WJJA 1NJGA 1SVWA 4L4UA 4BZXA 1ZP6A 2F43B 1Z08A 3QF4A 1KDOA 2PX0A 4C0QC 1R0XA 4PFSA 4JBYA 5E4FA 4N0EA 4DT1A 2VBCA 2WPDA 1EFHA 4YQFA 3NC0C 2Z6VA 2D3WA 2B7CA 4TYNA 3CKLA 4M1WA 5L3VA 2IL1A 2BBSA 1UKVY 2BHRA 1XCGB 2B92A 4DSNA 4E09A 1G41A 4GRAA 1VG8A 3ADCA 4A0HA 3JVUA 4M0LA 1YR8A 4PHFA 1K5DA 4EUNA 1KO8A 3BIFA 3C16C 2RGNA 1II9A 1H8HA 4Q19A 2OBNA 4M1TA 4TQ9A 1ONBA 1Z0JA 3U3MA 1MABA 2QM8A 2OHFA 1XWIA 2JGNA 4IVQA 3QVUA 4HB3A 5D3MB 3O8RA 4FD2A 1EK0A 1R8SA 1CRPA 3K0CA 3L8ZA 5IF9A 4DLWA 1HQYE 1VIYA 5JRJA 4MRPA 1W36D 3QBTA 5SZIA 2ECKA 1LS6A 5BW8A 4BPBA 3AVYA 4UXIA 3O8CA 1TF5A 4DSUA 1DAGA 3IO5A 3I5XA 4Q1AA 1JR3A 3RS2A 5LDDC 2D2FA 3I3SR 4JVLA 2ZRFA 3CPEA 3GQBA 1E1QD 4EJSC 3A8TA 4HAXA 4RZ2A 3QXXA 3QVVA 1UADA 2QG6A 2DWOA 2QAGB 5J4HA 3TSWA 1NY5A 4KCGA 1OYYA 4QHYA 2WKRA 4G5SA 1KK2A 1T3SA 4YC7A 1HUQA 3LVQE 1MV5A 3U44B 3GJ5A 4XIGS 3RHFA 5KU1A 4XD7A 4JVNA 1KK3A 2P5TB 3QXJA 5BYKA 2JLZA 2F55A 1FW6A 4C2UA 1E2LA 3GJ8A 4I4LA 4Q47A 4OI0A 2ZI6A 1TAGA 2QT0A 3KQKA 3AVVA 2MSCB 2O8CA 5FPTA 1E0AA 1D8TA 2R6FA 2HT1A 4PO1A 4KSCA 1UEIA 2BMDA 3WRYC 2ZAMA 2JLUA 1U90A 2W2TA 4GP6A 1ESNA 3OIVA 4M4SA 4F4JA 3SJAA 1TNDA 5EUQB 4BFWA 3R8FA 4OHWA 1DAIA 4L8GA 1N6OA 4FMCF 5CK5A 4CGZA 4JLBA 4GMXA 3M4YA 4FXPA 2CVFA 1OFIA 2QZ4A 3B1WA 4B3BA 1A4RA 2D4HA 1R8QA 3IO3A 2GJ8A 3Q5DA 5TXGA 2O8FB 4R71A 4HDOB 2WIAA 3WYFA 5EE5B 2ONJA 3QXHA 1JR3E 4HB4A 2QN6A 1OW3B 1RIFA 2B21A 1F60A 2WWHA 2AXNA 3BB3A 3EA0A 4Z54A 3A4LA 2R6CA 3DOEA 4G01B 2JLWA 3ICQB 4ZCMA 1ZIOA 1HQCA 4R7ZA 4PPQA 2QBYA 2IYVA 4JBXA 1G19A 3DKVA 2KBFA 1OE0A 1M74A 3OESA 1KKLA 1KMHB 2Q9CA 3AGPA 3FGNA 3QSYA 2JLYA 4DB2A 1NBMA 3H2YA 2FGKA 4HLDA 1EX6A 2NIPA 1NMXA 2DYKA 4MKFA 3L43A 1XTRA 1W2GA 4DCUA 4OHZA 4TQUS 4JLAA 2OEPA 3AVXA 3PVSA 4RZXA 2IHYA 3MWJA 3MFYA 2BBOA 2RB4A 4NYMR 4PHHA 1P2SA 1KO5A 3BERA 5DIFA 1TUEA 1US8A 5EE9A 3THOA 1YQTA 5C46F 3PEYA 2BDTA 2BJVA 2GILA 3ZJYA 1GP2A 1G7RA 3T34A 1Z47A 1S8FA 2Q6TA 5JJIA 1E2DA 2WWIA 3RC3A 3WBJA 1CJTC 3DL0A 4JLNA 2REBA 3UMSA 5DI3A 1ZNXA 2FSGA 2P6RA 1GM5A 2XNDA 1E9RA 1S96A 1GFIA 1TQDA 2NZJA 4KAXA 4O0MA 4PPNA 4D2IA 1KO7A 2V1XA 1VKJA 4QGFA 4GBMA 4LHXA 2QENA 2VPPA 4M1YA 1CP2A 1MKYA 4NPHA 2QUZA 1K6MA 2YVUA 5EP1A 2CEAA 2IS1A 1AJEA 2WIBA 3LNCA 1CR2A 2J87A 2GJKA 4TYWA 2FJUA 4JVMA 3GLFE 1YRBA 2ZUBA 2QMUA 1R4AA 1XMSA 1KNQA 2XTMA 3KJHA 1NMYA 1OKKD 2VYFA 3DOFA 3N2IA 5TMPA 1KI6A 1NBME 4Q18A 1E79D 5TY0A 2V7QD 3BH6A 3NIBA 1IJEA 1CS4C 2RGNC 4X8HA 3EARA 2I1QA 2ZS7A 3KKMA 2QNRA 3RS0A 4LJ5A 2WJIA 1ZM9A 4IVPA 3RRNA 2HYDA 5FBVB 4IFBA 4LBWA 3TNFA 5HCNA 1UJ2A 4ZDJA 2QEQA 2XTZA 4A4DA 1YJ5A 4OI4A 1P3JA 2NGRA 2J45A 2P0EA 3K0CC 3QEJA 4G5QA 4OBEA 1D6JA 1YZUA 3U7HB 1E3MA 1JPJA 3PR1A 5GJVC 4K8OA 5DHFA 3W6NA 2CXXA 4P32A 3KKQA 5E3HA 2DFLA 1DAFA 3QJYA 4PX9A 421PA 3IBYA 4W9MC 1VG0B 4DT1B 1SXJA 3CX7A 4KVGA 4Q7JB 5BN4A 4B3DA 4P4SA 4ZO4A 2QPTA 4BLPA 3EPLA 4LYFA 4TWZA 4HDCA 4Q9LA 1A7JA 3KQLA 3W6OA 2XZOA 3ICEA 1CR0A 4LHZA 2CHGA 2V55B 1SHZA 1I4LD 2G1KA 3GLIE 1E4YA 1E0JA 2XTNA 3HYRA 1I4DD 1HA3A 1RW4A 3CUEF 5EXTA 1E9CA 2VSFA 1MABB 1E6CA 1YZNA 2VF7A 3NHBA 3KXLA 4BZQA 3HU2A 3KFVA 3GJ0A 3Q5EA 4ASUD 3VR6A 3W90A 4TYPA 3T1QA 4JMPA 4KFTA 4A36A 2QORA 3EWAA 3AVWA 1UAAA 3TSOA 1N3BA 4I1UA 1JXMA 4IJMA 1D2MA 2AD5A 4MKIA 4DUGD 1VMAA 2CNWD 4G3XA 4B74A 4TMZA 2FX3A 2J46A 2GEDA 1ZM2A 1DG3A 2GBLC 3CWZA 3LY5A 3W5IA 1P61B 2WSSA 2GAOA 4I1OA 4KFUA 4LUCA 4PC1A 3T15A 1JAIA 3EIEA 4HB2A 4DKXA 2HXYA 5J4VA 3GCGA 3RANA 3A6PC 1Q57A 3CM0A 5KHOC 3HDTA 2DCUA 4NE2A 2E1RA 4BASA 4Q1EA 1OSNA 1OPXA 4W5JA 5HR5A 5KDOA 3G5UA 4PO8A 4TZ0A 2A7QA 4RD4A 5HZHA 4MYCA 1GRQA 4KYUA 3AF1A 1P73A 1BYIA 3VMFA 2ZRCA 1W0KA 4PSVA 1GVNB 2QRZA 4NZYA 5CLQA 2CL7X 1CLUA 4MH0R 3PENA 5G3YA 3AB3A 1E69A 1EG7A 3P4YA 4WXRA 1EESA 1G3MA 4B2IA 4L9SA 1PV4A 1LF5A 4FMDF 1U8ZA 2O8EA 2IWRA 3FKSD 4DDVA 1O87A 4HEJA 4E07A 4B75A 4GNKA 4MGZR 1A1VA 4FWIB 3X1ZA 4R9UC 1KY2A 1N6HA 2ZI7A 1LW7A 1U2RA 1Q1QA 2AWNA 4BLRA 3SQXA 2UZIR 1E2IA 2H1LA 3GLGA 2G1JA 2R6DA 4AKEA 3BOSA 1VG9B 4JSTA 2C2HA 3ZGXA 2GA8A 2ZVPX 3IKJA 3VX3A 4MUBA 2JLVA 1W5SA 1S2MA 3A4NA 2QBYB 3QKRA 1N0UA 4ARZA 4UJ3A 2C9CA 1UBCA 1UEJA 4BEJA 1Q3TA 2A5JA 1UPTA 2WBLC 4JT2A 3PUYA 4D4JA 5JJKA 1O3YA 1TQ6A 2VEDA 2ZITA 2ZI4A 4Q4AA 3SHFA 4ZDWA 1LFDB 1RZ3A 1T0JB 4ZI3A 4CEIA 2Z5FA 1SVSA 2IYZA 1AIPA 4TMTA 3PEVA 4MITA 3SBEA 1D9ZA 4BFXA 4CYMA 4DEXA 1KSGA 3CBQA 4M8NE 3AEZA 4HLUA 4FMCB 3OAAA 2ZRHA 3RAPR 2JA1A 1US8B 3RYTC 5JEDA 5F98A 2QROA 3C41J 3Q7PA 4K81B 1CBUA 5KSZA 5FL7A 3RS3A 1E9SA 3ADDA 2NO9A 2DBYA 5CITA 1NP6A 2ZE8A 1DELA 2ZQ5A 5FPSA 4AG6A 4B44A 3LLUA 4V0KA 5DI3B 1Z6YA 5K8IA 4FWTA 4URWR 4C9BA 1HY3A 4A2PA 4DDWA 4D82A 4NYJR 3GLGE 1TADA 2VL7A 5JWRA 1V5WA 1GKUB 3LFUA 1II8B 5F9FA 1IQPA 2A5YB 4C4PA 3KQHA 2VP6A 2DWPA 4WXPA 1XMVA 1Q1EA 1E9AA 2R62A 3W8NA 4BEBA 1YZGA 3H86A 1GL6A 3AVPA 4L5BA 3SFZA 2GK7A 2RHDA 1XJ0A 2LWIA 1NSFA 1W4RA 1VIAA 3MLEA 3ZD6A 3AP3A 3N2EA 4DDTA 4KFRA 1FOEB 3C8UA 2J59A 3QIAA 1KI6B 4DLTA 3WRXC 4YXWA 1H8EA 1SVKA 2ZREA 3VFDA 1SGWA 1R2QA 4FMBB 2C5LA 4AK9A 2ZRJA 5EUMA 2P65A 1W0KD 2PZFA 2IYUA 1JECA 3K70B 1N0VC 3ETLA 1EFUA 5G53C 2HYIC 4B73A 1KAGA 4BQSA 1FUUA 3UATA 1DADA 4QRHA 3QKTA 5H1YA 3HU1A 3IEUA 4TL6A 1WDTA 1GUAA 3I32A 5DHAA 5FBQB 1Y3AA 2ZRBA 4PAQA 2XOKD 2ODNA 1ZNYA 4GMDA 4Q1DA 4ZKDA 1SXJB 2HV8A 1T3HA 1AZTA 4XWAA 3LAWA 1KNXA 4KHZA 1KSJA 2W2VA 2IYLD 3QBVA 5IK2A 4ESVA 4C7OA 4RSGA 4G5OA 4NYJQ 2N46A 5B64A 5JFGA 2J7PA 3UMRA 1N6LA 4IVRA 1OHHD 4QJ5A 3VU9A 1AZSC 5FPYA 2BBTA 3WY9A 3ZQJA 5CK4A 3PUVA 5AK0A 4Q01A 3K9LA 4HDQB 3IPXA 2NPIA 2OO7A 4NCHA 4OK3A 2R8RA 4Q5IA 3RS5A 4O2LA 2PMDA 2O5VA 2ZRAA 2H18A 1E2GA 3RNLA 2IX3A 4B3FX 1S3SA 4KLZA 5CIQA 3LX5A 1ZJ6A 2FWRA 2H17A 2JDIA 5FUXA 4JL6A 3EZ7A 4Z1MD 5H68A 4DCVA 1JALA 1OT3A 1P60A 4NBSA 2ZAOA 3A1UA 1PLLA 4XVQA 1MT0A 3G82C 5P21A 2G0NA 4QXAA 1XD9A 2E9SA 2ODEA 1NMZA 3TQFA 1VDZA 4JSYA 3DM9B 1X86B 3RRYA 5JECA 4PZYA 2QSYA 2GRJA 5K8TA 1DG1G 3PEWA 3SYLA 3MMPA 1KI1A 3PITA 3FOZA 3VR2A 3IEVA 2FZ4A 1AS0A 1FQJA 2CK3A 2TMKA 2GWHA 3HYTA 1FTNA 4RJLA 1JJVA 5FUYA 2AKYA 4IHQA 2ZROA 1LF0A 3L0OA 3Q85A 1E2NA 5ANRB 1MO5A 3K53A 3T5DA 2ZXUA 3CNOA 4EJSA 3K09C 3LVRE 4D4MA 2YWEA 4PANA 4Q4HA 2C03A 2WWYA 2ZJ2A 3U6BA 1I2DA 5KO2A 2R6AA 5H8WA 2PCLA 821PA 1FMLA 2F9LA 3BJIC 3MWKA 4TT3D 3U5ZB 4HLUC 5G41A 1OF1A 2C9YA 2A5FA 3QXCA 1H8ED 3K1JA 4RD3A 5AJYA 5DGXA 4Q48A 2O8EB 2AFIE 1UBGA 1IN7A 1AK2A 3K0FB 4UNSA 4XWOA 3WNCA 2ZUDA 4D26A 5LB2A 3GLGB 2QP9X 3KDSE 2FSHA 3B1ZA 3TAHA 2CJWB 3VR5A 1NJFA 3NVAA 1Z5ZA 4D6PA 1KSFX 1VCMA 5L3QA 2XJ9A 1VCNA 2WJGA 4BECA 2XGJA 4LJAA 5HE9A 1AS2A 2F1IA 1XCPA 3QKRB 2AL7A 5CM9C 1Z0IA 3GEHA 5KSPA 3N5CA 3V4FA 4ARZB 3W34A 4A8JC 1Z6AA 1JNYA 4TLCA 2QP4A 1D9XA 1G8HA 2QE7D 2PLRA 3AKYA 3SOPA 2EFCB 3BB1A 1OIXA 3EG5A 3GJXC 2C04A 4Q4AB 2WTUA 1ZVQA 4U00A 1T91A 2F6RA 4R2HA 4U7DA 4CEIB 2IYWA 4TL7A 3UG7A 2CCJA 1L4UA 2G3YA 4FMDB 2V9PA 1IN5A 1PUJA 1N6IA 1OXVA 1ZNZA 2J7PD 5J4LA 2FV8A 1AA9A 2WAXA 3WNBA 4M9SA 4WIAA 1NN3A 5DI9A 3LBIA 4MYUA 3DMNA 1KI8A 4M9QA 1NRJB 3ZDQA 4YONB 4NMMA 4TLEA 2PLFA 5KPDA 1A2BA 2WWFA 2IA5A 4OHXA 1D5CA 4DSOA 3CPJB 4PC2A 1R10A 1NVVR 4LWZA 3UXMA 4LSGA 1R5BA 4AYXA 2O0JA 4NYIQ 3VR3A 1Q1BA 4LZZA 3BH0A 1ETUA 3I1FA 3WMFA 4BFZA 5EP2A 2BMFA 4PQRA 3TUJC 2FU5C 4FN5A 4NCIA 4HLCA 2HDNB 5FR1A 2EU8A 3L82B 3KX2A 1ZUIA 4I81A 1YZKA 2W6ID 1JPNA 4IEIA 4PQFA 4N0DA 4W5WA 4CRWB 5GJCA 3LXXA 1XTKA 2LKCA 3RSLA 1KOFA 4OHYA 1GOTA 4KV9A 4A6XA 2LCFA 4F93B 2X2EA 2VSOA 4RFSA 5KDLA 3CF6R 2FA9A 3OZXA 2QA5A 5EP4A 2KBEA 1OIWA 1Q1ZA 1FMJA 1RRPA 1ZU4A 2OAQ1 2OILA 2OLJA 2OG2A 3R8CA 3T1OA 3OEED 2N42A 4PTLA 4QBGB 3C14C 2ZI9A 2WZQA 1YZQA 1G18A 3QKUA 1DAHA 4HUQA 1DO2A 3I92A 2V8OA 3EW9A 4KSBA 3CR8A 2VHQA 1W47A 1Z6TA 2IYRA 2FPLA 1OB5A 1G4AE 3IQXA 1FP6A 4P31A 4UXHA 1YR6A 3U4QA 2GF0A 3FFAA 3OHMA 3RLFA 5JSZA 1IBRA 1NY6A 1ANKA 3ONWA 1UM8A 3IHLA 4EKDA 1NVVQ 4LJYA 3CR7A 2CL6X 4E22A 1D2EA 4CW7A 2H57A 2WWWA 3A58B 4LDJA 5DN6A 1LTQA 4C7OB 4OHVA 4PHTA 4N1AA 1G3QA 2GJ9A 5L3SA 1KAOA 2FFAA 2MSEB 1FFHA 3JZMA 4LYHA 1OIVA 2ZEJA 3SDZA 4AYTA 5KNDA 4AYWA 2IYQA 2IYSA 3T12A 3VU9B 4KXFB 1UF9A 4NHOA 2FSFA 4JBWA 3B1YA 1F2TA 2OBMA 1NSTA 4IDPA 1KKMA 1R7RA 3W9YA 2XEXA 4KVAA 4M1SA 4TQAA 4V0NA 4C0LA 3CX8A 3TW8B 3K9GA 4URUR 3B1XA 4EIWA 3CW2A 3WYGA 1J8YF 4JJZA 1SKQA 3JVVA 2A3RA 1FL9A 2MSDB 2AK3A 3VKHA 1Q0UA 2V1UA 1UKEA 4EQ6A 2VA8A 3CZQA 1Z0KA 3OIWA 3WP1B 1KDTA 4AD8A 2BM1A 4H9GA 5SZJA 4TZ6A 4RZ3A 3FTQA 3LO5A 3W8RA 3EXAA 3KUCA 1E9FA 4MKHA 1FUKA 1OB2A 1W4AA 3NBYC 4CF7A 1BIFA 2IXFA 4JVSB 1AGPA 3ZQ6A 3EPHA 3R9XA 2ASEA 5E7IA 4X8OA 3H0KA 4GPTA 4QG7A 4OQLA 1SULA 3ADKA 5JRZA 4GOXA 5J40A 2QAJA 4B32A 1K5GA 5AR1A 3BXZA 4EJSB 2CCKA 1NF3A 4GZMA 4Q4HB 2GBLA 4TSFD 3DEFA 5A0FA 3RABA 1NI3A 3BFVA 1P9RA 2PCJA 1Z0FA 3ZZUA 4FCWA 4OL0A 2J3EA 2ZJAA 4D25A 1XU4A 1WB9A 2VLIA 1G3IA 3SHWA 3BFKA 5AUNB 1W36C 3K0EA 2KSQA 2AR7A 1COWA 2QMEA 2SHKA 1IN8A 4NH0A 5UKDA 5FOSA 2OV2A 1CU1A 3GLFA 1OXUA 3RRMA 3GJ6A 2Z4RA 2BCGY 3R9WA 2WPDD 5AJWA 4DCTA 1QHYA 1Q20A 1E2HA 3IGFA 1XEWY 2DFTA 3TK1A 1IJFA 3OF5A 4D0GA 1V43A 2Q21A 1ZCAA 4LY6A 1XXHE 4BRUA 3MRSA 1XD2A 3H4MA 4QFMA 4TTQA 5FI0B 5L3QB 5F9HA 4BFVA 2ZJYA 4Q66C 1GWNA 3RS4A 5DISB 1GSIA 2B6HA 1G6OA 3TW4A 3W5JA 1H8HD 1OJLA 1R5NA 1AKEA 5JMTA 1KK0A 3FHTA 2ZRDA 4DCSA 4BGDA 4HLQB 1P9NA 3ZZ0A 4IRUB 4BE7B 1G8FA 1A2KC 1NNEA 2DY1A 3HPRA 2OCAA 4P33A 4PPGA 2A78A 1VCOA 1XEXA 5FH9A 3MUFA 2R2AA 2ZR9A 1XBTA 1SVLA 1W49A 1BMFA 4U02A 2HF9A 1T3LA 5E95A 5BQ5A 1CTQA 2BC9A 2IC5A 2BWJA 1JR3D 2A9KA 1DAMA 4NDZA 3QG1A 2GZDA 1KY3A 1II8A 2VF8A 5CIWA 2QTVB 4XTCS 4F92B 4XOIA 2FH5B 1QHSA 4DC9A 3AVTA 3BGWA 4PC7A 4A15A 3GLIA 1P2UA 4XH9B 1N2CE 4EFLA 3CH5A 2R9VA 2C78A 1DBSA 1EFCA 1VYTA 2VH5R 3A1VA 2IYTA 3CLVA 2XNSA 4B6FA 2ZSBA 4YMUA 1R0YA 1W5TA 2AX4A 3BS4A 3BRWD 1DE0A 1FZQA 1S1CA 1XCMA 3GJ4A 5TARA 4PPFA 4XD7D 3ECCA 4KBGA 1Z8FA 3KKNA 5LPNA 2FFBA 2A2ZA 4QBFA 3B82A 2QY9A 2WJYA 2QU8A 2RGGA 3LV8A 2A5DA 2EWVA 1RVDA 2IYYA 1XZQA 3DO6A 4TLBA 1DARA 1TU4A 3CRMA 4OK6A 5G3ZA 3SJBA 1G4UR 3EZ9A 4NP6A 4DWJA 3IILA 2Z43A 4AI6A 4RFSB 4A0GA 2YHSA 4DLVA 2YOGA 1RC8A 2H92A 3CF2A 4RCYA 2GXUA 3Q72A 4M9ZA 2GCOB 4LJ7A 3NTUA 1N6RA 1TUIA 1QG2A 3WMGA 3NH9A 1U9IC 1WF3A 2JJ1A 1TTTA 1Q21A 1SQ5A 3PG5A 1T8TA 4M53A 4BFYA 3HU3A 1G21E 1G6HA 2V54A 2IS2A 4HUQB 2FF7A 1WXQA 1HURA 2MMGA 1COWD 2FGJA 3R20A 2F1RA 1OH8A 2JASA 1KK1A 3ND8A 2Q3MA 2ZRNA 2QRNA 4XWKA 4C2TA 4Z8XA 3CNLA 1YU9A 2GZAA 4M1OA 1UDXA 3U4QB 3Q3JB 4AKGA 1OXSC 1NBMD 4B3CA 3EASA 5K8LA 1NG9A 3SNHA 2BKUA 5JSZB 2RGCA 5AJXA 4DZZA 2IEZA 4II7A 1W2HA 2AK2A 3TAUA 1HH4A 2WM9B 1T8UA 4ILEA 4NCJA 2A30A 5JLJA 3TR0A 4XSHA 1TL7C 3A4MA 2GCPA 4TMKA 2REOA 2VP2A 1OFTA 1IXZA 4XVRA 4DRZA 5L3SB 2IUSA 3AH8A 2HF8A 4HAUA 4Q9KA 1QHGA 3FDIA 2NOAA 4A92A 3UK6A 4DXAA 2BJWA 1U8YA 2J41A 2GVDC 1F2TB 4N3NA 3AV0B 4O25A 1MRSA 3DZ8A 4JLJA 3QUSA 3P26A 4WZ6A 2XNDD 2HCJB 5FUVA 4ZCIA 3NG1A 1XP8A 1JAHA 2NO7A 3U7FB 2AKAB 1KI4A 3T1VA 3QE0A 1E96A 2PT5A 2W6JA 3P1JA 3B1VA 1R0ZA 1X8KA 3C7KA 4M1KA 3BE4A 4V0OA 4EQ6B 121PA 3CRRA 2YWHA 1ODFA 2GDJA 3M6AA 4OI1A 1W4CA 3WMEA 2F3TA 4IFEA 4CT5A 2OSBA 4YDSA 1RJ9A 1OH5A 4B76A 1IM2A 2H16A 2QPAA 4WBSA 3RS7A 2NMVA 1Z0AA 3HP1A 1LNZA 1MO6A 2GTPA 3NBZC 1YR7A 3A37A 2J0QA 1EWQA 4QGGA 4TMWA 3E70C 3GJ7A 1F48A 4OK5A 2P2LA 4LV5B 3AKDA 1B23P 2YJTD 4RD2A 4V0LA 3FVQA 3K0FA 4FW9A 5CJ2A 2EFEB 3FWYA 2BKEA 1NVWQ 2W00A 3K70D 2OXCA 4LHYA 2CJWA 4HB0A 3B8HA 2JLSA 1IY0A 2PX3A 3O8DA 3NBXX 4H1UA 5FL3A 4CDGA 2GXAA 5EJEA 5KSYA 2CHQA 3EWSA 3SN6A 3QENA 4ZIRA 2REXB 3VQTA 1QG4A 4LYJA 3TVDA 2IF2A 2OBLA 3VKWA 3GLFB 5TDHA 5M04A 1QHIA 1PVOA 5C18A 1SXJD 1FP7A 1QRAA 2JLRA 5K8UA 4DIEA 3K09A 4LX0A 2NO6A 3KXKA 1BH2A 4PZZA 2C9OA 1XD2B 2QM7A 1CR1A 1CXZA 3ASYA 2ZJ8A 3PIRA 5BYJA 3TRFA 3RC8A 3MJHA 1WBDA 1DTSA 2DB3A 4Q7MB 3QI2A 1ZD8A 1E2JA 1I2MA 2F1JA 1CJVC 4WVFA 4AURA 1Z6XA 2ZIAA 1A82A 3MGCA 4HAZA 2AN9A 3F5FA 4LJ9A 2PT7A 4GT1A 4FIDA 1NVUQ 3D7MA 3MAAC 3SYKA 1J70A 5B2ZA 1IN6A 1XEXB 2ODWA 3GEEA 4TMVA 3TJZA 4JIMA 4D0NA 3QG5A 1ZIPA 4ON9A 4PAMA 4YMVA 2BEJA 1E1RA 4IW3B 2ERXA 3MCAA 4B43A 1ZU5A 4A8JA 2CLCX 3CX6A 1SKYE 1P75A 1BS1A 1Z22A 1Z28A 3AKCA 2AXPA 5JBQA 1IY2A 1N5IA 1M8PA 1Y63A 1C1YA 3I73A 3TKLA 4E03A 4P0TA 3AVOA 1GTVA 1RRGA 1AN0A 2WSSD 4TLAA 3X1WA 4W5HA 2VHUA 1YZTA 3GLIB 1XMIA 2GVZC 1GKYA 3AP1A 3QNUA 4G5RA 1XMJA 2L0XA 4MGKR 3DVLA 521PA 2ZSDA 4YMSA 4UNQA 3IQWA 1XX6A
chains in the Genus database with same CATH superfamily
1NG1A 2V58A 1NXVA 1THMA 4TMYA 3CUUA 2C2YA 4B09A 1U02A 4HDRA 4MHOA 1P4HA 4ZYZA 4XYEA 2QSJA 5FBWB 5GJWC 1ELOA 3QNWA 5DO9A 3ZWOA 5FV4A 1U2PA 5CVEA 3I9LA 2ZJ7A 3I1JA 3VKGA 2WM3A 1BDHA 2YN0A 2HLDA 1K6EA 3EISA 3KB2A 3KYDB 1K08A 3VH2A 5B4TA 5BQXA 3ZDCA 3G7SA 1W0CA 1QB7A 4JLOA 1TQHA 4RDIA 1RKUA 4W1SA 3GA0A 2R2GA 3NAZA 2YVKA 3P4XA 3NEYA 4D44A 1ZD9A 5KUTA 3KETA 3I0MA 3VR1A 5AVRA 1O94D 1USIA 2J9GA 3WNZA 3P9RA 1W8DA 1YI0A 5EJGA 2I80A 2IZZA 2OWEA 4TXNA 2B3TA 3BHMA 4QXOA 1I3KA 1TB4A 2NYAA 4UNRA 1IZ9A 2HFKA 4TTSA 3L0YA 1MAWA 3V4VB 2WKSA 4HYTA 1DC8A 3HVJA 4B33A 2RG7A 3B60A 3IAAA 4TYMA 3QM1A 2YKGA 3LDAA 1RXWA 4QWWA 3X1DA 1TO1E 3LC2O 1WZCA 2O7VA 5JHGB 4F3CA 1AU9A 2D2EA 4I4IA 1ND5A 3V2HA 4BJ1A 1G0NA 2H5EA 5JD4A 3CZ9A 2X13A 4EHHA 1DRVA 1YRYE 4IHKA 4MRNA 3WL5A 1WCIB 4S2EA 3B3FA 1U2GC 1T5LA 4EHNA 4NKRA 4EHDA 2O48X 2GS9A 4YY3B 2AGVA 4EUFA 2NM0A 1UBUS 1XXLA 1Q16A 4K1XA 3EXHB 4NG4A 1SBYA 4D4KA 4NZPA 4MWDA 3ZLJA 3FR7A 4QM6A 3E48A 4GLJA 5K5EA 1B14A 4J49A 1IY1A 3B12A 3TQQA 1P9OA 3CZPA 5E0OA 2XVMA 1D3AA 3C5CA 2PRKA 3QU4A 1RRMA 1XEFA 2KI5A 1SZPA 1T4CA 3FIJA 3MG9A 1OVGA 1U3GA 2E87A 4G1BA 1MPTA 2XDYA 3P9PA 3P9XA 1AHHA 3B7GA 1M73E 4PO3X 3U37A 2DFKB 2FMTA 1NUUA 3IOCA 2FHSA 3F2VA 3MUNA 3GLHE 3OAAD 3H84A 4P82A 4XW2A 3ENWA 3T7AA 3SC3A 3J81k 5BRNA 3TGLA 2TECE 1TCUA 3H17A 1V7CA 2WKPA 4OAQA 2OYCA 2OECA 4OQZA 1BMTA 1PSWA 2CXSA 2JCSA 2JAPA 4GOKA 4KWIA 3PV0A 4OQMA 4F4IA 2AC7A 2DBRA 2FEOA 2HJVA 1FFWA 2ORIA 3OEHA 1TEHA 4KWEA 5JPCA 3BUSA 3HDQA 1L1FA 4DR2B 3EBLA 5IULC 3L4BC 4OQNA 2IY8A 2ZWIA 1XVUA 1MZPA 4C0WA 1E1RD 4YAOA 6REQA 1VLVA 4A82A 3ILXA 1YK0A 4LGMA 3GT0A 4HYQA 3UWKA 2FPGB 2QTZA 2ROQA 1Z74A 2VP3A 4JA0A 3RRJA 3ZHZA 1VSQA 1M2VB 2GXAA 2D1FA 2XUPA 1DPGA 1P4JA 4XGKA 3KWJA 2B1IA 4DCNA 1XN4A 2Q5EA 2FPWA 2Y8EA 2WFAA 3PKZA 5CNJA 1QVZA 1U8CB 3CUWA 5F3DA 1KZ7B 2Y0PA 1BE0A 3T61A 4WAUA 2XNCA 4I9UA 5JS7A 3BGVA 3BXEA 2PUJA 2C99A 3JD1A 4G23A 4M0FA 5CVUA 1EX7A 1ZN2A 3PUJA 3AF3A 3L1IA 3NS7A 2ZJ4A 5DBGA 4C0HA 1THTA 3HRIA 5DBEX 3SBDA 4V3BA 4D4LA 4XM2A 1S1MA 1DPFA 5D1HA 4EO7A 5L7WA 1J25A 2XLBA 5CB6A 3G2NA 3WHLA 4MWEA 1PWZA 3T38A 4CM7A 3ITDA 5KTTA 3I61A 2YHIA 2O06A 3ASZA 4XCVA 3AVQA 4BATA 4ZV4A 1OBCA 3FX2A 1QU3A 3PRJA 4JKOA 1QAQA 1W19A 1XB2A 3O3NB 3GFGA 1UBTS 1GGVA 2AH5A 2O9JA 3BHIA 1UMCB 2PH5A 5I7VA 4Y2GA 4MGHA 1C1XA 1IB6A 2GRAA 5D3QA 1E9VA 1ZW6A 1EP9A 1P29A 2RG1A 3BA1A 4O5OA 4AZ3B 5E1DA 2ZJ1A 4BKMA 4B9EA 4EGAA 2QZPA 4NCKA 1X13A 4WN9B 3WWPA 3ZU6A 4BPRA 4CMGA 4WJLA 1N34B 2D1TA 1GPWB 2YRFA 1GA1A 1ZONA 3KR2A 3IP1A 1NX9A 4DDUA 5JJLA 4O1HA 4TVKA 3UAGA 2XRMA 3O83A 4E6EA 1UZLA 3E22B 3QSGA 3F6SA 1XZAA 4HDKB 1DJPA 4E2WA 5HZKA 5FOTA 1YVEI 4M98A 4EG1A 5IBCA 4QOSA 2VTKA 4BJ6A 3CZRA 3IUBA 1TPYA 1OGJA 1Q44A 1XAGA 1MOQA 1QGZA 3AOEC 3HR7A 3LXRA 3QPWA 4POAA 4FIZA 4E21A 5ES4B 1W29A 2CY0A 1PFWA 3DEIA 5JRDS 4HI0E 4AQYB 4QGHA 5TPZA 4GOMD 2QXYA 1EFRA 4EATA 5HUQA 1EVYA 2PZGA 4HAOA 5BN3A 2GH1A 2PRYA 4OCZA 5IT5A 1N7GA 1MPXA 4BFTA 4CM4B 1UQUA 5DLEA 2OCYC 3W05A 4LF7B 2IU4A 4RH1A 4XFJA 3MWYW 3GMSA 4YALA 4BTLA 1O0SA 3EZFA 2PFGA 3G5AA 3GXBA 4MUAA 2C4WA 5KTYA 3TOZA 1I4TD 2EF0A 3OPMA 4DLPA 1W0JA 4Q37A 2NU7B 1UOPA 3VMMA 1F2DA 2XUJA 1EFVA 2H7VA 4MKGA 3PL1A 4N6NA 4OU4A 1H23A 5JAPA 5KSWB 1YJBA 5J63A 4N5DA 4MYHA 2RGAA 4O4LB 3VC2A 3PTAA 1Q0LA 2P9GA 3A4YA 2JLBA 5GIOE 4K87A 1Q3HA 3B2NA 3GCDA 3IIEA 1NQOA 1E2QA 3B2EA 3KNZA 5AJVB 2OLKA 5I7FA 1ECCA 3OO0A 3L7BA 4LS3A 5KKAA 1ZM3A 3BAZA 3SZGA 3JALA 2XTAA 1GXSB 3ZD9A 3KQTA 1GQ2A 1Z12A 3AF6A 2ZRGA 2OCPA 4ARBA 3STYA 3T9BA 4WDQA 4CG1A 1JKJA 3IPCA 9GPBA 3K6SA 2J9YB 3AF2A 3VR4A 3CKYA 3LC7O 2P30A 2F3PA 3HCEA 4BZWA 2RAFA 1SVUA 4TXLA 4ZXFA 2C9ZA 1BKDR 4NATA 2GM9A 4AXXA 5KOHB 4O59O 1BCSA 2OSVA 3DUFA 1V39A 4N6OA 3F4KA 3QE9Y 4Z49A 1IL0A 4BO3A 4BO1A 3DVAB 1QYRA 2B7BA 2OE2A 4PSAA 3ED5A 3A1WA 3EWNA 3I4LA 4MQ4A 4HDNB 1XPOA 4HBGA 3ZN2A 2FY8A 1P1FA 4Q4JA 1X39A 2OBYA 1WB6A 2B99A 2YRWA 1Z5NA 3ORHA 4ZO9A 4IDDA 2HHLA 2J3LA 1DUVG 1S0UA 3GFRA 4D5GA 2C29D 2FK8A 5FTJA 3WXMA 2Q5OA 2AG6A 1DKOA 1OV4A 4Q3DA 4URXR 1DOAA 1PDOA 3S70A 3TBKA 4TS9A 1KVRA 3FPKA 4YCDA 2B4KA 3BCHA 3V8PA 1FSPA 3DMPA 1JR6A 1AT1A 2HIMA 1AK1A 4G67A 4RF3A 3OZAA 3AU9A 2EYQA 1F2UA 4H7DA 4CBVA 5KJ1A 1BHJA 3V8BA 2WTBA 5GM1A 4V1CA 4LDPA 2I2FA 3VR5D 4DM4A 4G9BA 1OXTA 2DHCA 3BMNB 2JJ2D 3G5TA 3G2HA 3LW8A 3TEMA 2OXRA 1RBQA 4L3OA 2WHYA 3IL2A 1G9XA 1AQYA 4QYIA 3R8XA 2ZRMA 4NFHA 4DOMA 1JTVA 2P8JA 3OMWA 3R7WB 5GVRA 4RY2A 4R1NA 3E9EA 1VFPA 3WGVA 4IQFA 2A9QA 4PZPA 3PNPA 5BR7A 4MWSA 4MPJA 4N76A 3AUYA 2WJ3A 3WL6A 4F7WA 3BMQA 1GEEA 1PQ4A 2ZAYA 4XE5A 3DJYA 2RE8A 3A26A 5ESDA 1EXNA 1YDHA 2GCNA 3HVKA 1MTZA 4HATA 5HG0A 4B71A 1KP3A 1ONNA 4E5UA 2CNDA 4TL9A 4H3SA 3HKDB 4HNQA 1EA7A 2UZ3A 3LOPA 4JNKA 3TXAA 1GNRA 2E18A 4G5HA 4A9AA 2P6UA 2OCIA 2ZXFA 4WY2A 3CCCA 2YIMA 3CV3A 4EW3A 1BVRA 3JAKA 5BN5A 3JQDA 1UBOS 4XWGA 2AHOA 3G7NA 3PWZA 4H6WA 1FIUA 5SYMA 2O8DB 1NHWA 1SVMA 3NCTA 1VLMA 2Q1WA 2VIIA 4BUCA 5BO5A 4FEEA 4KUEA 4E33A 3MWLA 1CEEA 3D5EA 3NYRA 4J1NA 4QIHA 4CTOA 4DV2B 4W9NC 1WXGA 5CA1A 1BOFA 4BMPB 4M0PA 1C1HA 4C6TB 3COVA 2VF2A 2FW6A 3G8YA 4M8LA 4LQDA 3ZW8A 3R44A 2H11A 4Q1FA 3KEFA 3PR3A 3WAKA 2F1OA 3U49A 4HZUA 4C0BA 2JGAA 2JH8A 1X7WB 3CZAA 4RLFA 4M21A 3VR3D 1PX0A 2UYHA 2C2MA 4DIMA 3C6YA 3Q9LA 1NKTA 1TYZA 1CQIA 3ICVA 1Z06A 1ZMXA 4WUVA 1ESEA 1P62B 4X00A 3BJRA 5EQJB 1XTIA 3T35A 3KTAA 3MXTA 1WLYA 2G88A 5JDCA 4P3PA 3SI7A 2Q0XA 1T0BA 4XRRA 5D01A 2NVBA 5JNWA 2JEOA 3A6DA 2ZXEA 3FSEA 4R51A 4JP5A 4B45A 5C5DA 2FLVA 3BBPA 1F2VA 3JYNA 3QUAA 1Y3IA 4MV9A 3QU7A 3N6RA 1P2VA 3IOEA 4ZKEA 3X1YA 3ZCXA 1RVV1 3EXFA 1KPHA 1NA5A 3JATB 2D54A 2P7HA 4L76A 3ES9A 1JIKA 5TMEA 1KJWA 3N86A 2R751 1N6KA 4AFNA 5ICGA 2RC5A 2W8ZA 3WLQA 3OKPA 1AKYA 4CL0A 2RKOA 4WCFA 3FAZA 3V9AA 1RRFA 4QQKA 1E1YA 3LUCA 1PX2A 1BN7A 1YDMA 4HZIA 2JPDA 3BE5A 2UUBB 1U98A 2GD1O 1I33A 1N2CA 2Q27A 3HEMA 3MTAA 5GADl 3USZA 1TVEA 4MS1A 3AERA 2V5AA 4PIPA 3R7BA 3W79A 4X95A 5HKKD 4IUDS 4QGSA 5IXYA 3RWMB 1WXIA 5L51A 3IT1A 3NEPX 1DFIA 2C2OA 3E0QA 1YCDA 4R3NA 3DO5A 2I6GA 2X1VA 1GNPA 1GU7A 3BAFA 1CRZA 1FDRA 1I5OA 1WY7A 3LG2A 2I7CA 3ONEA 4LKRA 5ALOA 1R0WA 3HJGA 1HL3A 1RWOA 4KQHA 2CNBA 4CETA 5EHXA 1GGKA 5KBYA 4GKAA 3THXA 2I54A 2WJPA 5MN5A 4C2AA 3UIEA 5BOSB 4K86A 4F11A 2AMLA 3IT3A 4ER5A 4BHTA 1QDEA 3LCRA 2CJXA 4YMWA 3K9NA 2GUWA 4MRSA 3HJNA 2ZRLA 3DWFA 1J2YA 5AUQA 4PLZA 3OZ7A 1JDJA 2AG8A 4IF4A 1EFAA 2HZ7A 2CVQA 5JASA 1NU8A 4NTZA 4OEHA 1ZUNA 2X7JA 3SLRA 5JAHA 5ARBA 3W4JA 1UFOA 1O08A 2QYHA 2JZCA 4EGCB 5C4GB 2C5EA 3L0DA 3R0XA 4ASUA 3PE6A 4J3JA 3GMDA 2ZSUA 3QWHA 5MN4A 1PJCA 3ONVA 1C8VB 4I55F 2PLWA 5KNDD 2FG5A 1VE6A 3W5BA 3EWIA 2JGEA 1ZVJA 1SCUA 1DT3A 5FA8A 1H2HA 1DKNA 1Z63A 3D8UA 3OSUA 4CKZA 1WIWA 3AFHA 3WDSA 2WMOB 1I14A 3LY7A 4EAQA 3U56A 4CZ2A 1XDBA 4HAVA 1QQ7A 4F97A 5L8VA 3BA6A 2CNWA 4FE4A 1RC0A 1PSDA 3VTKA 1UFKA 2VHCA 2XYRA 1DQYA 1CUDA 1T5DX 1PFYA 4P4GA 4RE6A 4QUIA 4IDGA 2P0AA 3ROGA 5EXXA 1ULTA 1XRQA 1QOPB 5LD2C 2IX9A 2MOKA 2VDKB 2OV3A 2WYUA 2QLJA 3C5VA 4HUJA 4EVQA 2IZ7A 3PJEA 4F1WA 1XCJA 1U81A 2JIZD 5HS4A 4XPZA 4Y9SA 2YX1A 2JFXA 2EAUA 3BKXA 4KBFA 3SPXA 4DVJA 3NVKI 1RI1A 3TI7A 5ALXA 4RM2A 3U4DA 2O6HA 2GEVA 2P9QA 2PO5A 4MGIR 2Y0EA 3SDBA 2E7ZA 1TT7A 2ONKA 1CJSA 3QOFA 1QFXA 1R37A 1RPNA 3PPVA 4FR2A 3RYFB 1O58A 5AXAA 1WP9A 3ZWYA 3R3ZA 4DCGA 3KYBA 4UNNA 2AFHE 1X80A 4NONA 4EARA 1RPAA 2X19A 3OE7D 1BDIA 4D92A 1XQ6A 1ZBQA 2D74A 1AK9A 1SD1A 4JQSA 4COOA 1EFPA 3AI2A 4CR8A 3PUZA 4CT4B 2HA7A 3VNAA 3DM5A 1M76A 2C0CA 4C04A 1AGRA 2V4MA 3ORFA 1Z6ZA 4KFSA 5KTKA 1SCDA 4FC7A 4HDSA 4B46A 1P31A 2IH5A 3RLIA 3GDFA 2FPOA 2VDMB 3BDVA 1MZVA 4C7OB 4OLJA 3VC7A 2PZBA 3WIUA 2CBZA 2CFOA 1SHTX 4X3CA 1HT1E 4GEGA 4YLYA 2ZIGA 4CTMA 4IDNA 1XZJA 4P7KA 2NXNA 4PYLA 4QEZA 1RFLA 1LLDA 2DFNA 1VGQA 3BXHA 5BMOA 4AUNA 2VK8A 1L5NA 1ZWKA 3SZRA 3WIEA 3JS5A 1XVIA 3ZLVA 1HNXB 2EJWA 4UBLA 4PE5B 4QSHA 4DANA 1F38A 2Q0SA 4EG7A 1ZC4A 3TR5A 3TLKA 1VCHA 1JBKA 3G02A 4KPUA 2VQDA 2Z83A 5EG5A 1IVYA 3MTJA 3GFTA 3HUEA 4QXRA 3LXUX 3WV4A 2GPJA 2AUTA 5LCXA 3GEIA 1SIOA 2IKSA 3K9WA 1U0BB 4KQFA 3KB1A 1L5KA 4ER3A 1YUBA 1KMIY 2DLNA 1XVAA 3U7QA 5C8YF 3T52A 4GAEA 2EYUA 2MWMA 5HA5A 4YLEA 5HFJA 1U63A 1EB8A 1DFHA 4KODA 4CKEA 1FNSA 5FNVA 5IM4F 4J4TA 2PANA 3OUZA 1A7KA 3LQKA 3UKDA 2ZPUA 1HYQA 4JP2A 4CU5A 2G70A 2F4NA 4ZVMA 3ET5A 4JR1A 3VU3A 4YRIA 4DN6A 2MYNA 2YWGA 1JWAB 3D6HA 3K0HA 1KMCA 1NJSA 4AG3A 2H54A 3ORYA 4E7PA 1WA5A 3D2BA 1SD5A 2J4DA 5EE1A 1CDDA 4MO2A 4YI3A 4RKQA 5AKZA 3UJBA 1HC7A 1G2QA 3N0TA 3NHPA 2FFQA 4B6EA 1SURA 1GAWA 1Z2CA 2AW5A 1XXHB 5DNUA 1H9CA 1MAUA 2PKCA 3DWGA 4I5EA 3WLPA 2EOAA 4FYIA 3QPUA 2A0UA 2HLPA 2DKNA 3I6MA 3NWJA 4XI9A 1BHSA 1M8FA 2QS9A 3SC2B 3QWFA 4CFSA 3ZVLA 4CQMD 4YN3A 2DERA 3VR0A 4ZOQI 1UMBB 3A0UA 3CX3A 3CO5A 5EGNA 3SVLA 3MZ0A 3UJCA 1LC0A 3MJSA 4P7JA 4UNPA 5SICE 2NQ2C 4U2BA 3T3DA 4CMEC 4RXTA 3GQVA 1ZIDA 2C77A 1CRQA 5D3KA 1I1OA 3VDMA 2FMFA 1XDUA 2GFHA 4PR0A 1UXKA 4DYHA 3G9XA 4HNTA 3DV2A 3L4SO 2NUBA 2WAAA 4L73A 2PR7A 3CNNA 4IUYA 3JAMA 1XPUA 5ELLA 3GN2A 2BVNA 2XRYA 3V8NA 1O6FA 4WN3A 1TMKA 5HGXA 1B73A 1JAXA 3T1HB 2AI2A 1E1CA 1WBBA 4LJRA 2VVTA 5F1KA 3RTCA 2VPZA 4QJBA 2XMBA 2M1ZA 8ATCA 2ST1A 2FPMA 3DV9A 4M9UA 1ZK3A 3UK2A 4BVKA 1AMOA 2O8CB 3QLUC 4XM1A 3KHUA 4AN4A 2QLTA 5MDHA 4NFLA 1PT6A 3KJZA 1V37A 4OJTA 2I2BA 1JU9A 1WP4A 4WNAA 5BSEA 3FETA 3HCFA 1NMEA 3WFJA 2CL5A 3TM4A 1GFSA 3T1YB 3ZVNA 1JIXA 1H2WA 3D0RA 3I2IA 4KTVE 1U5BB 3IB3A 3O03A 4O2AA 2F3UA 5J23A 2OL4A 1H42A 3BTVA 3GN1A 4RK1A 4Y9TA 5FFMA 3OTIA 3DCJA 6ADHA 1G8GA 2GK6A 3GOQA 3QMWA 4IQ4A 3UJ3X 2XOKA 2B4TO 1KAMA 1KSHA 1ZZEA 3G8DA 2VBGA 3NOVA 4HH3C 4RACA 5KSPA 4BMCA 5IHPA 3MQFA 1GFZA 3CTPA 1KVQA 3LQFA 3SR0A 3KQQA 3A9RA 4B31A 3K4PA 3U7GA 4I08A 4OMDA 4JLVA 3GLRA 4QDZA 3UK7A 1PI3A 5MFPA 4X6UA 3KUDA 3TNDA 4MIYA 3P94A 4GG1A 1QORA 2IHTA 2X8JB 3R5SA 3V8VA 2ZI3A 2PTHA 4RNCA 7MHTA 2GKOA 2FN3A 3BDAA 3GEPA 3NT2A 5THKA 1KYIA 2ODBA 2RD2A 4UVHA 2J3QA 4BE9A 1P0MA 4QU5A 1Z5VA 4M88A 2YV5A 1U3TA 2NWQA 1YIAA 2OFOA 4OLHA 3B7WA 3DTTA 2AB0A 2PS1A 1BG6A 3SU8A 4D4IA 2Q6KA 2A57A 4P3OA 4KN9S 4PSDA 3T0GA 3SK0A 3T8YA 2ET6A 3L07A 3WRVA 1LSUA 5K9ZA 1OX5A 4HVAA 4LOLA 2O3SA 2PUDA 4NBNA 4D4GA 4CEJB 1YA4A 2I4IA 5G0UA 4QQNA 3RVKA 4NENB 2YMQA 4BFSA 5IDVA 2V65A 4ZZ0A 1UC8A 3GD7A 4GO1A 2VDUE 4Q1BA 5D7NA 4ARIA 1PNOA 1YT5A 3AI7A 3E1KA 5L3RA 3NYIA 4ZCLA 4LDRA 3SZOA 4B6OA 3GJRA 3LKDA 5K7SA 4V2IA 4MULA 1X7YA 5F23A 4G56A 1RIIA 1HFEL 5B30A 4GOJA 3OT1A 3RBZA 2BR5A 4RL6A 4C5AA 5ARCA 5DM4A 5ESRA 2IIPA 3FCSB 4EB8A 3LX8A 5CDFA 2I33A 4RTPA 4QRIA 5LIRA 4DUPA 1WR8A 3KZCA 3BK2A 1J2UA 2ZUCA 4E4TA 4L4RA 3EQZA 3V8EA 2WICA 2ZSAA 3BBLA 2IKQA 4RZQA 1Z2DA 3ACCA 3L9XA 4ZAZA 2ZBEA 2CWDA 2Z9DA 1KXJA 1NUQA 3KJXA 4RPGA 1CNMA 2QG4A 3ROEA 1TJ4A 4YR7A 1G2PA 3ICPA 1M2KA 1NW5A 1E59A 4DIOA 1R6XA 1I6WA 1KORA 2Z4SA 2Q99A 4P7BA 2ZOSA 1ZK1A 1J90A 3TGWA 2Y76A 2AR0A 3EODA 5KAMA 4LDZA 4N7BA 1LV8A 2RHBA 3QTLA 4RZUA 3ZJ4A 4TT3A 3UT0A 3Q8LA 4Q39A 2BGWA 3B20A 3FFWA 3E9QA 4JDUA 3EEQA 3TFOA 1XV5A 2IYEA 4LHEA 2XB2A 5HKAA 2F67A 5COQA 2C2GA 4OJKA 3WHIA 3SF8B 1N25A 4ND4A 3QEMA 4JCCA 4QYWA 2FPRA 1PT5A 2G77B 3IR6A 2KB0A 3K05A 5TF0A 2HMUA 3WDMA 2HBRA 2ZUFA 3WOVA 4PN7A 3O8QA 4Y9RA 2C9DA 4CM1A 3GA5A 4DLSA 5HCIA 3NBUA 5DNEA 4CKCA 4US2R 2G08A 5DGTA 3X0DA 1CB7A 1VLJA 4BZPA 5KYKA 4I1IA 2O5RA 3DXZA 1XL0A 2P8SA 3AHJA 3H99A 1U4OA 2YY7A 3PF8A 4AXBA 3WLAA 2PA3A 2HRCA 4WW0A 5IMBA 4EDFA 1V47A 4OHRA 3W1WA 2XECA 1WO8A 2X5JO 1Z17A 1ECLA 2I6QA 2WSLA 3RTBA 1NBAA 2XQIA 1C7ZA 2O50A 3GRFA 1NJ5A 2OYSA 1JB1A 2G6TA 3IMFA 3RQIA 5K4GA 4EAAA 1E5XA 2HN9A 3DDHA 1JDZA 4LRWA 1H1LA 1M1YE 1T9CA 4ZCTA 1G8AA 4PCAA 3F67A 3M8KA 4MHTA 1CF2O 1PUIA 2JA2A 2UKDA 2P3SA 3QY0A 5BVGA 3NHKA 1DG9A 1SUAA 3QI7A 2CUZA 2JIPA 5TC4A 3FY4A 4UBKA 1VECA 3WP0A 3I9KA 3ZY5A 3TPZA 1O7JA 1N0HA 2QZJA 3ZE7A 3CB4A 4Q21A 3QWBA 2X2PA 4EWLA 1MOPA 5I7WA 3N05A 4Z2AA 1C14A 4KX5A 4JWKA 3ZXXA 5LLSA 1OC4A 3PUIA 1BDMA 3GLTA 5DTQA 5EJAA 3UC5A 2BFOA 2XRFA 4FDUA 4RPKA 4B3HA 1TDJA 2QAGA 3K0AB 4G0ZA 2DHRA 5EYPA 3TAXA 4BJ3A 4DQUA 2HW8A 1MMFB 3KEQA 1ZYUA 4IG9A 2JL1A 1LLCA 3DE3X 4GW3A 1VYUA 1V26A 3PDCA 1GRRA 1Q0SA 1IXRC 1OU0A 2V7VA 5J59A 4RSMA 2P2DA 5A9TA 4WZAB 2PJDA 4PSCA 4KIUA 4LRYA 1OFUX 3DEYX 3OPVA 3PCRB 1S3IA 2ID9A 4UBOA 2E5LB 2H0AA 2RHMA 4F71A 3WAGA 3AJEA 1MHTA 5CYPA 2GEBA 2CLSA 4JLDA 5L7YA 2WWGA 4MWOA 3OZRA 4L8FA 4RVDA 2Q2OA 1ILEA 5IZCC 1WPRA 2X0IA 4DA0A 5KU7A 2A7XA 4PZLA 4J7UA 1G20A 5AW5A 3RRBA 2O8NA 4GYJA 4TTRA 4RQTA 2NVUA 3EN0A 3NP7A 3LGXA 3SEFA 2LIPA 5LLTA 3E9NA 1I4OA 3TXYA 1I80A 3LBHA 5AJHA 4B81A 5BWMA 5A5GA 3DYIA 5AW7A 2IBTA 3AWIA 2QQ0A 3S5UA 3RE1A 2ZR7A 2BI8A 4EPYA 4GC5A 2DPMA 4G5GA 1QTQA 3OEEA 4G0VA 1UBFA 2DBQA 1SUDA 1I32A 3SC4A 5FTLA 5LYJF 3CRNA 3RARA 5ETJA 5AW0A 1BWQA 3OCYA 5DWDA 1JG4A 4G9GA 4NEGA 1V11B 2OFPA 5LZ7A 3V7FA 3W9UA 1MB9A 2TMDA 5JEEA 2ORWA 1PWXA 2JRCA 2O57A 1M7GA 3OU7A 2IEAA 2J9FA 2C4MA 4BNNA 2ODQA 3KWLA 4YRPA 2HHHB 4ACAA 2PEZA 3IT0A 1QH8B 3X3HA 3QPVA 3PFCA 2XD9A 2GX6A 4POOA 2IYPA 3TLYA 4O3MA 1U0HC 3QV2A 2LRHA 4YLGA 1OFHA 3WL3A 3D0OA 4YJHB 4C30A 5BR1A 2CCGA 2XUOA 1JGTA 1QAMA 4U9UA 4D7AA 4ND3A 2GJSA 4WLNA 4REMA 5DSZA 2ZYWX 4DVGA 4Z53A 4NL4H 4MJ7A 1IM8A 3UB3A 621PA 4N49A 4QPPA 1Z0DA 1NNLA 3V4ZA 1XRJA 3HBJA 1DL5A 3CG0A 2QMOA 5K6TA 1F8GA 1H2YA 3BICA 3K0SA 4OQPA 3CVUA 1U1FA 1T2NA 5CNMA 4RS3A 3RUFA 3U0VA 3L8YA 2VPXA 3FPCA 2H4XA 5BUQA 3F96A 1RJDA 4TTAA 3TL6A 4L2IB 3NKLA 3AYXB 4YEDA 1X7ZA 3TZLA 4HTFA 5IP5A 4IH1A 1XCOA 1Y6JA 2QRPA 4B8WA 2RHLA 4Q1CA 2C5GA 4US1R 1QU2A 2VHJA 1P72A 3R3YA 3NATA 4YJ3A 1O2DA 5A4JA 4QTTB 4YB8A 2PXCA 3IAM1 4LV8B 5B57C 2O7NA 3K7EA 1HE5A 1GTL1 4TOIA 5ALFA 4DILA 1DBVO 1JZQA 1ZXXA 3DZHA 4XB2A 2QTTA 2NN3C 3UJ8A 3G2QA 3OG9A 2HXSA 5EPEA 1S3GA 1RNLA 3ISVA 3LM8A 4BVFA 3AF4A 3KHKA 3W7VA 3D3KA 3P2JA 1E20A 3H8WA 5IKXA 1VOTA 2ZSEA 1E3WA 4XVUA 3K9HA 1XTSA 2J7KA 1JZSA 1YASA 1WG8A 3W6PA 3TNYA 2ZYUX 1J5XA 3JQCA 5L6MB 1NMSA 5DW0A 3QEBZ 2JG3A 3K9BA 4C1NA 5CLIA 3H6KA 3A10A 3K1YA 4D42A 1XD8A 4KI0A 1ZAKA 1HRDA 2IELA 5CFPA 1PGQA 2WMDA 4H3KB 1A5TA 3O75A 3QWAA 1F3LA 2PT9A 3RG8A 5EJ2A 3VPXA 2YUIA 3TVTA 2XYQA 3QRWA 4GDFA 4WKPA 2IW1A 5TRTA 5BXQC 3GWZA 5KNBD 5KJFA 2IBMA 1FRFS 5H3HA 4XSVA 4TSFA 3UH1A 2YWJA 3U3JA 2JFPA 4KQ6A 3WE7A 1BJTA 3ZZTA 1FRZA 4LJLA 3HEAA 4Y2PA 2VDWB 2WJJA 5DTJA 2VF5X 2WAOA 2VI5A 4P6VF 1KDOA 2PX0A 3D4LA 3T0IA 4PLCA 4C0QC 2B4QA 1RI5A 2RHOA 4JBYA 3JVIA 5C81A 1YRWA 5BVHB 1MD9A 5H80A 3ROKA 2PLNA 2WPDA 1P3DA 4LWOA 1EFHA 1E3DA 2Z6VA 3BSWA 1CHNA 1FCJA 2GN8A 4WZBB 4EYQA 4M1WA 5LKRA 4PLVA 4J16A 4ZRNA 5CR9A 2IL1A 2BBSA 1UKVY 2BHRA 2WTEA 3HGQA 3LCUA 2WU8A 3DAYA 4MMXB 4OB7A 1G41A 1NGSA 4GRAA 3DL7A 4TQGA 1E7YA 3JVUA 3SXPA 3K6RA 4EHBA 4MX8A 3RVQA 1K6JA 5KYXB 3CUTA 4LGYA 3N2NA 3BIFA 4FHCA 3VR5H 2WY2D 4D3XA 4J7CA 3DNMA 4YV7A 2IOFA 2PX5A 4H6XA 3U3MA 1LEHA 2NTEA 5H16A 4F9TA 1T10A 2QY6A 1RWXA 1QIEA 3M2PA 4MWTA 3WISA 2D2IA 4IVQA 4JASB 3QVUA 3C1OA 3H5NA 1OTHA 5D3MB 3O8RA 2Q4OA 1EK0A 4IGAA 4PBRA 1EM8A 3TCXB 1R8SA 1RHKA 1S2GA 1WU7A 3E6AA 3K0BA 1VIYA 5JRJA 2SKEA 1IOVA 5SZIA 1LS6A 1XDDA 3ZHVA 3V6LA 3LIPA 1TF5A 5JALA 1DAGA 2E6KA 3IO5A 1JA9A 4LF9B 3K8OE 4CM9A 3CC8A 3O1JC 1PQUA 5F7OA 2CJPA 2JW5A 3OZIA 4JVLA 3MJDA 1D1PA 3CEMA 1E1QD 5JYEA 4RZ2A 4DRYA 3T7KA 4X7PA 1X70A 1RI3A 3E18A 2QG6A 2DWOA 3NM4A 1RJWA 3OZWA 4B4UA 4BV2A 2C59A 2BHSA 2AJLI 2X86A 1JZTA 1NY5A 3ZGLA 3PCTA 1BSVA 1BOOA 5A3SA 3NHFA 1KK2A 5DBIA 3JQFC 1HUQA 1KYVA 4D41A 4UOZA 8ADHA 1MV5A 1QK4A 4CCWA 3T5PA 4A23A 3EZGA 4R8VA 4PQGA 2O20A 2Y71A 5CVVA 3ORQA 5IH3A 3RHFA 3NUZA 1KK3A 1KFBB 3BWVA 4W1PA 3MRVA 3OWHA 2P11A 1T2FA 2E4AA 2JLZA 4C2UA 2P40A 1E2LA 1RRKA 3OH8A 5KOJA 3F3KA 2E2WA 4YFVA 4EABA 1UINA 2ZI6A 1TAGA 2QT0A 4EELA 3JZDA 2PUFA 4OI0A 3CVYA 1E0AA 4B6RA 1PT9A 3HFGA 2R6FA 2PKXA 3VHQA 1QDUA 2HT1A 4KSCA 1UEIA 2ZAMA 1TJ3A 3MTDA 4BFWA 1W35A 3RUDA 2AZMA 1A9YA 5HIKA 1PWHA 1DAIA 5F9MA 1N6OA 2ZPAA 4DIKA 4CGZA 4EUKA 2E5WA 2CVFA 3V2IA 4JOSA 1PBTA 5L3ZA 1A4RA 3AEKB 1R8QA 2ZW9A 2Z30A 2O8FB 3VVBA 1ICIA 3P71T 2HV9A 1T9ZA 3DDUA 1QPBA 2ONJA 3G3EA 4C6SA 2WWRA 4F2PA 1KQGA 4CL8A 2BZGA 1OW3B 1ZOLA 2UZAA 3CNHA 3KJQA 4U2EA 2VJBA 4KO4S 3L7YA 4QARA 3NWOA 2CBGA 4FHZA 2FP4B 2CD9A 2LW7A 3R5JA 5B5SA 2I3AA 4JBXA 1QJCA 5CTJA 1Y1QA 4G26A 4E14A 2FQWA 3OESA 3UJDA 1P7WA 3L1KA 1USWA 4D4HA 2V0GA 1KMNA 2JLYA 1W5FA 2JGFA 4DTCA 1WUJS 4HLDA 1EX6A 3V3KA 3HRKA 4MKFA 2EX1A 3L43A 3PQFA 4QQ8A 1XTRA 2G25A 5LU8A 1CDOA 1ZK0A 3LHDA 3NB0A 4I3FA 3JWIA 3B1KA 1HK7A 2GD0A 3OHSX 1H6CA 1CLEA 2FR8C 4F12A 3AVXA 4N3BA 1DJOA 1DMRA 3IQHX 4DG8A 4PHHA 3U48A 1L5VA 1TUEA 2O2XA 1MQ9A 2MU1A 1PYOA 5D84A 2Z04A 1EI9A 2RHTA 2VNAA 4RVUA 2V5UA 4FFRA 1E2DA 2P5UA 3MWDB 4M0KA 4Q3NA 1TTHA 4JU8A 1LSOA 2D0OB 2REBA 2Q62A 3QHAA 5LYJB 1LNQA 3PQ4A 2MYUA 2E21A 1Z3CA 2P6RA 2FW1A 4PLYA 1QRSA 3ZTWA 2DPLA 3IMKA 4TPKA 1TT5A 2QYSA 2XNDA 1HWYA 4IICA 2HNBA 2AC4A 3JQ8A 4UAJA 4WMLA 2AQIA 4GSKA 1BJKA 1EZZA 1KO7A 2V1XA 4QGFA 5HIMA 4XX0A 3NOQA 1GUFA 2VPPA 4M1YA 4P34A 4ROSA 5REQA 1G2OA 3RRXA 4C05A 1QJ4A 2YVUA 3OOWA 3WB9A 3BD7A 4H7PA 4QZVA 1EX1A 1XU7A 2ZWMA 4HQ0A 3O3OB 4I5DA 4DLBA 4BNHA 4AJ9A 2GJKA 4N48A 1DCMA 3L7JA 2PVPA 4RK7A 1ZXLA 5M7EA 2ZUBA 3KJHA 1KNQA 1CP3A 1U6JA 1V16A 1AURA 2VYFA 2J9XB 2W93A 2YW2A 3A0RB 3EIFA 2PYDA 1WEHA 3H1EA 2DR0A 3IAFA 1E79D 2V7QD 3SR3A 1QH1B 3AQIA 4NBVA 1IJEA 2WQZA 5TPWA 2EIHA 2I1QA 5F51A 2O2ZA 2ONCA 2QNRA 4M87A 1NE7A 5JR3A 1A88A 2BONA 3EH2A 5B3JC 1XR3A 1ZA1A 5ILQA 1NP3A 4IFBA 1XCLA 2QT9A 5AI9A 1FFBA 3TNFA 4CMCA 4QDUA 4UU1A 1TGYA 1Q0PA 3I4FA 5CEJA 1PKEA 1NVFA 3K0CC 5A3JA 4A8HA 1IEVA 1YZUA 5K6RA 1JPJA 5LP6A 1M67A 4AY4A 1NVBA 4W6QA 5ESWA 4R01A 2ZUVA 5GJVC 4LF6B 3CTMA 3NEAA 5B6PA 4P32A 3KKQA 1UT5A 2NADA 2OXTA 5E3HA 4CI9A 3DEZA 1T26A 1YK1A 1YSCA 3HXQA 1WW3A 1VJTA 1Z4JA 4JAVC 1YGYA 4TM7A 2QOEA 3LQ1A 3VYSB 1VG0B 4BP3A 2BKVA 3X2FA 3JY6A 1SXJA 4JQZA 5JU6A 4HO1X 2XNJA 1IVNA 3EYAA 4ZO4A 3FTEA 1BCRA 2A1IA 2QMYA 4BLPA 4XR9A 3EPLA 3DC7A 4HDCA 2WZDA 4JUDX 3ILVA 5IDQA 2ADOA 3EGWA 4HWRA 2PO7A 4DA6A 3KQLA 1CR0A 1EQAA 4LHZA 5LVAA 1GGNA 2FDXA 3KR0A 3AESA 4EUEA 1I4LD 5KX5A