2VPPA

Drosophila melanogaster deoxyribonucleoside kinase successfully activates gemcitabine in transduced cancer cell lines
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
192
structure length
189
Chain Sequence
TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPKVLVLDADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Drosophila Melanogaster Deoxyribonucleoside Kinase Activates Gemcitabine.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords DEOXYNUCLEOSIDE KINASE
total genus 71
structure length 189
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vppA00
3R20A 1TF7A 1KMQA 4R2IA 1QG2A 1O3YA 1DTSA 1RC8A 3U7GA 4HYYA 3C15C 3S1AA 2W6JA 4NE2A 4Q9IA 3W6NA 1KSGA 1C9KA 1T0HB 4FINA 4MYTA 4XSHA 3U4QB 3C41J 5HPYB 2IUTA 2KBFA 2WSSA 3QKRA 1RJ9A 5FH9A 1H8HA 1HUQA 1OFTA 2ORVA 4PR0A 4CW7A 5KDOA 1RE0A 1TX4B 1VG8A 3B9QA 5CIWA 2H1LA 1DAGA 4JLAA 1B23P 2V8OA 2QBYB 4DUGA 4Z8XA 1KY3A 2HYDA 2CK3A 3H1TA 2HCJB 1OIVA 3CIOA 4TLDA 3V4RA 1N0VC 2BM0A 2ZRIA 1XEXA 2JEOA 2QROA 2Q9CA 2NZJA 4KFRA 4B2PA 1W49A 2MSDB 2J0UA 2WIAA 3EWSA 3GFTA 3EZ2A 1I4DD 3IPYA 3G5UA 3KDSE 2ZI3A 4IRUB 1G3MA 4KV9A 121PA 4AKEA 2WTUA 3ND9A 1E9RA 3QOFA 3G0HA 2ZVPX 1P60A 2QRNA 2A5GA 2VBCA 1G19A 1E2LA 2ZETA 4KFUA 3QPUA 2IHYA 4O0MA 3TIFA 2ODEA 4DCVA 2VHTA 3K70B 3BJIC 1ZM3A 3NC0C 1SXJD 2YWHA 4HLUA 1E94E 3TH5A 1S3SA 4V0KA 4DEYA 2CHQA 1RVDA 4OJKA 1ODFA 2ZTSA 1L2TA 1MRNA 5FOTA 2JIZA 4IVRA 3OE7A 4B3XA 3QIAA 4CEIA 4TT3A 2EWVA 1W5TA 3U4QA 2VP4A 3NDPA 3DZDA 5FUVA 4KLZA 1G17A 3VQTA 3OEED 1JI0A 3PXGA 5AJZA 1EFTA 1FMJA 5KSYA 4F4IA 1P62B 2ZRMA 5KPJA 3O8RA 3CR8A 4KO8A 4MA4A 1RRFA 2GJ8A 4M22A 1PUJA 3BIFA 2IWHA 3ADKA 3IEVA 4E22A 2OCYC 3HR8A 4D26A 5JSZA 4IW3B 2QT1A 4TTQA 2R6AA 3Q7QA 2WWWA 1QVRA 2R6FA 1PUIA 2P5TB 3TAHA 2FPLA 2H18A 5G3YA 1OLOA 1WRBA 2AFHE 4EFLA 1NN0A 2JLUA 4XWKA 3BB3A 4JVSB 4L8GA 3RNLA 4WZ6A 4B3BA 1MO5A 2JLWA 3IHWA 2AXPA 2J0SA 1XFAA 1SVLA 2AKYA 1S2MA 1KIMA 2FMXA 1G7RA 4WIAA 3GLIE 4DLVA 3GLGA 3M1IA 2O8BA 4ZCLA 2V7QA 2GILA 1XU4A 2A78A 3Q5EA 4JKYA 4QJ4A 1YE8A 1YR7A 1YZTA 1W36C 1SHKA 2I4IA 4P33A 1YZGA 2BKEA 1OYYA 2BBOA 3FHOA 4PC2A 2J7PA 4M9SA 3ZIAA 1ZCAA 1GL6A 1E9FA 1VTKA 2VHCA 5F9FA 1Z0FA 2FSGA 1LF0A 3PIRA 2IYLD 1KK0A 2OFWA 2PL3A 3E2IA 1V43A 2ZR9A 4JYCA 1U99A 2HDNB 2JAQA 5KSPA 3NDBB 1KSJA 1CRPA 1PJRA 2BOVA 4Q47A 5J40A 2ZQ5A 2GZDA 2WKQA 3IIKA 5EJEA 4HUQB 1NP6A 3LWNA 2QMOA 1II8A 1Z6XA 4B33A 2Z4SA 4Q19A 1DPFA 2J7KA 1AGPA 4ASUD 2P6RA 2X19A 1E1RA 1J8MF 3GLGE 1AJEA 2JASA 3SOPA 3ZLJA 4KODA 5DHAA 2YINC 3Q72A 4ACBA 5KYKA 3KQUA 2ZI4A 5E3HA 1XXHE 4TYYA 3GP8A 1DEKA 2DBYA 3AVPA 3EIEA 3N2EA 4LOAA 3THXA 1ZNYA 4RZ3A 5HCNA 4ARZB 2E87A 2JDIA 4X8MA 4O3MA 5LB4A 2PT7A 1CJKC 3A1VA 2IUSA 5H1YA 1FP7A 2YOHA 5FTLA 1AGRA 1DS6A 1FUKA 1AIPA 2O8BB 2XNDD 3LD9A 3D6TB 4F91B 2QGZA 1L4YA 1ZW6A 4GOJA 3GLHA 2WAXA 5JS8A 5D3QA 1OB2A 4S35A 1RJ9B 1HE1C 1W0KD 1JXOA 1Z6GA 1E0KA 3OAAD 5CDFE 2QM7A 2P6UA 4RVCA 2JCSA 4ZDWA 5G53C 1G9XA 1UEJA 1E32A 1W4RA 4LC1A 5DI3B 4HAWA 4A0RA 4A36A 1UADA 2C9CA 5K8LA 4AG5A 2H16A 3AF3A 1G291 4V0ME 1ZIPA 1KAOA 1GL9B 3T1OA 2WSSD 3I8SA 3NC1C 4X8LA 3TNFA 2ZRJA 1I2MA 4F38A 2WMOB 3LV8A 3HPQA 1Q3HA 4BFSA 1NIJA 2W6JD 3PV0A 4Q01A 3AVTA 1CF4A 5FTMA 2XTMA 1R5BA 4TYWA 2KWIA 5HCIA 3VR5A 4EAQA 3PFIA 2CXXA 4L9SA 3TSOA 3IO3A 3CO5A 1OV4A 3B60A 1U8YA 5B2ZA 1E9CA 4HAVA 4NDZA 3OHMA 1I4TD 2Z4RA 2GZHA 4BZQA 1YZLA 2J1LA 4UQOA 2BM1A 2GJ9A 4Q66C 5CJ2A 1OPXA 1S1CA 3KKPA 4B3CA 3NBYC 1QG4A 3KTAB 1UBCA 3R9WA 2QUZA 2ZRCA 2WWHA 5IT5A 3A36A 1ZYUA 1W0KA 2KJQA 5C4MA 3Q5DA 3AM1A 3QUSA 3DL0A 4RFVA 4WXRA 3DM5A 4A8JA 3WNCA 3EW9A 1VCNA 2XTZA 2ZR0A 3VFDA 4A0HA 3RRMA 2W2XA 2PMKA 3GFPA 4MGYR 3DEFA 1CULC 1KO4A 5B64A 4BECA 4M1WA 4A82A 3NEYA 1BOFA 1U8AA 2QORA 2QAGA 1RKBA 1G7TA 1GSIA 2FH5B 5FTNA 3FOZA 1UDWA 4R9UC 3GJ4A 2ORWA 4FN5A 3SFVA 1RPZA 4TQUS 1N6OA 3QPVA 2Z5FA 4EFMA 1ZUIA 4C3ZA 4EJSC 3TGPA 3G82C 4L16A 1P2SA 2XNSA 4C7OB 3PUYA 2PEZA 4M1TA 2ANBA 5FFMA 2CLSA 2PLRA 4DSUA 4OK5A 1CP2A 3AB3A 4CIDA 4JL8A 1G3UA 1YZKA 4FWIB 3UWKA 4KBGA 2ODWA 2FSFA 4RCYA 3BBPA 4Q4JB 4EJSB 1YZNA 4U02A 1XNJA 3H2YA 3WBKA 2VH5R 2IYWA 3B8HA 2W0SA 1HTWA 4AIIA 4OHYA 2O8EA 4IFEA 4W5JA 2KSQA 2LWIA 2ECKA 2QPAA 2NPFA 1F5NA 5GJWC 4LJ9A 1G18A 3KZ1E 3V9PA 4PQYA 2CL6X 2OM2A 1TQDA 3PUWA 4US2R 3F0TA 5D3MB 3GLIA 5JWHA 1NBMD 2RMKA 1G6HA 2VA8A 4M9XA 4FD2A 5KDLA 1G7CA 1MR3F 3H0KA 2VTKA 3O8CA 1U0JA 4XH9B 3QVVA 1M6NA 1DELA 1WQ1R 3OESA 4JZKA 3W3AA 5M04A 4DLSA 1I4LD 5H68A 5C46F 4L5BA 1CU1A 5IDVA 1HE8B 4UXIA 4P4UA 2GRJA 4TL7A 4Q1AA 4ILEA 4OQMA 5L8VA 1HQYE 3QEJA 1M7HA 5DI3A 3I1FA 1KKLA 1IN6A 1A1VA 3X1DA 4RKFA 4TZ0A 4A9AA 4GP6A 3IQWA 1KI6A 4D81A 2BCGY 2GCNA 3CZQA 3KQLA 4QBHA 1LTQA 1E69A 1Z28A 4I4LA 4QHYA 1VG9B 4TL9A 4IDNA 4US0R 2ZS8A 4LJYA 1IAQA 1DAMA 3AKEA 1JNYA 3WRXC 4BFZA 4Q1FA 8OHMA 1OFIA 3SJCA 3LLUA 1N25A 1NVXQ 4IOMA 4LJ5A 1NRJB 3FE2A 2BJVA 5DIFA 1TEXA 1G21E 3BFXA 3MGCA 4JLDA 3UANA 5E95A 2XB4A 3QNUA 2OAP1 1U9IC 4P0TA 5LBIA 3PR1A 4PANA 4DEXA 4CEHA 2JJ1A 3P1JA 4O25A 4QGFA 2VSFA 2XZOA 3BOSA 4Q9KA 3QJYA 3SI7A 1J90A 3K9NA 5GJVC 1IY2A 3KXLA 2XOKD 1KJZA 3U3RA 4QHSA 4YMTA 4G5QA 5FUYA 1SXJB 1TMKA 2J3EA 5JJKA 5DN6D 2G6BA 3JZAA 4TTRA 2WOJA 1TNDA 4OHXA 4TSFD 2JJ2D 5AR1A 3W6PA 3KQHA 1FOEB 1E1QD 2D3WA 1UF9A 2GAAA 2YNMA 1DAKA 2F55A 3WXMA 3EC2A 1HT1E 4QG7A 1QBKC 1YQTA 4OKSA 2RGDA 2FSIA 3PCRB 3DM9B 4ZIRB 5AJVB 3I73A 2XGJA 3O8BA 2BVNA 4GL2A 1TADA 4NYMR 1P2UA 4JVNA 1MOZA 1R0XA 2UZIR 1EGAA 1OYWA 3TMKA 5HR5A 5K8TA 3ZZTA 1ZM4A 4W5WA 5FUXA 3LRPA 2G3YA 4CEIB 1NG1A 4UJ3A 4GI7A 4JJKA 3MJRA 4FXPA 1Z0JA 3TAUA 2X2FA 4F4CA 2FEMA 4D4KA 4EPRA 3X1WA 2NQ2C 1S9HA 3P26A 1J8YF 2OFXA 1FFHA 1DVRA 2GXSA 2ZE7A 3PENA 4IDOA 5HZHA 3OZXA 1W36B 3KJHA 1NVVR 4HATA 4H1UA 5L3VA 1NKSA 3SFZA 2B7BA 4BFXA 3CONA 3AF4A 3K0AA 4N1AA 1QDEA 2OLJA 1Q57A 3B1YA 2HF9A 3B82A 1ZNZA 4ASUA 4CF7A 4QJ5A 4K46A 4OYHA 4LI0A 4US1R 2FJUA 2WKRA 4D2IA 2N46A 3I92A 1S9DA 4HB4A 5EP4A 5G40A 2ZYTX 1M2OB 1UAAA 1F2TB 2BEKA 2IEZA 3BERA 4BGDA 4S2EA 4QXAA 1E1QA 2EFEB 1E9DA 2R6CA 5FTJA 4B47A 5B58C 2BHRA 3RAPR 3H4MA 4K8OA 4C0BA 5B57C 2C95A 1AN0A 2VF7A 2O0HA 4KVAA 5JECA 2JLVA 2REXB 3C16C 3U44B 3W8RA 2G0NA 1ZM2A 2Q9BA 3CM0A 4JBXA 4QHTA 5SZIA 3ADCA 3WNDA 3CWZA 4DXAA 1Z47A 4LJAA 2Y8EA 3FWYA 3EARA 1VHTA 2QMEA 3UMSA 2YJTD 3GEIA 3BAFA 5CJPA 2F9MA 4NCJA 4YMWA 2RCNA 1CBUA 1CJMA 2IXEA 2OE2A 4Q7KA 1JPNA 1COWA 2FX3A 2VL7A 4GT1A 5FL7D 1IXSB 2UKDA 1YRAA 2WKPA 2CLDX 3VAAA 1QVAA 5FBQB 4C0QC 4JLOA 2CHGA 4C0LA 1FPMA 4HB3A 4TN1A 1NI3A 821PA 3K70C 3TVDA 2IXGA 3RHFA 2AK2A 1Y63A 3SR0A 1GZSA 4ZV4A 1KO8A 2C99A 4LBZA 2GVZC 1E2KA 3SJZA 1WB9A 2EFCB 4RD4A 1U94A 1R5OA 3N70A 3PEVA 1XTSA 3T1QA 4LBVA 3T5GA 1ZP6A 1G3IA 5JLJA 4TMTA 721PA 3GJXC 3D31A 4BRUA 4DB2A 1VKJA 1MABB 2QTVB 1ZU4A 2WJVA 3Q3JB 2PJRA 4HLCA 4XTRA 3FMFA 4HDQB 3RVBA 3DDCA 2ZJ2A 1XTRA 1DAEA 2HLDA 3LLMA 3Q8XB 3IO5A 2FZLA 4OQFA 2JIZD 4C2UA 4A2QA 2HJVA 1PV4A 2QZ4A 5D3MA 3GLIB 1FUUA 1LY1A 2YYZA 2AD5A 1G8PA 2RAPA 5KNBA 1E2GA 2FGKA 3QBVA 4EQ6A 5J4LA 4DZZA 3VKHA 4BE7B 3K8YA 2G1JA 5EXXA 1CRQA 5AUQA 4JLPA 4AWXA 5JZVA 1GIAA 1R0YA 1K6MA 1SULA 3GJ7A 4DCSA 3AVYA 1OKKA 4JJZA 1QZXA 3U3OA 1BYUA 1E9AA 1KI7A 4PSAA 3SYLA 2ZJZA 2D7CA 4EKDA 2CVFA 4AYXA 3U44A 2PCJA 3U3KA 1XMSA 2ZRHA 2RGNC 1E9EA 2CK3D 5DH9A 3KUCA 2O8CB 3DZ8A 1G3RA 2A5DA 4UNNA 2A2ZA 3EPJA 4NMMA 1GVNB 4JSTA 3I32A 1GNPA 3SS8A 2WWGA 5AUOB 3L0OA 1LVGA 1G1MA 1XMJA 4URXR 2FFBA 2ZJAA 1YR8A 4OQNA 3MCAA 2OEPA 4B48A 4BFWA 3CRMA 2FGJA 1OB5A 5JJLA 3VX4A 2B21A 1OXUA 5TVKA 5TY0A 4H9GA 5FI1B 4C4PA 1D8TA 1CEEA 3MFYA 2VEDA 3C7KA 3HJNA 4LYJA 4V0MA 4M8NE 4NCIA 2P2LA 4HAXA 5LDDC 2DFKB 5FBVB 5LPNA 5EP2A 3MG9A 4FI3C 4ON9A 3I61A 1ZM9A 2R2AA 4NYJQ 4BLPA 4RY2A 2X8AA 3QKTA 2G88A 4KCGA 2BJWA 2GJKA 2PEYA 4A2PA 5FPSA 2EW1A 2J41A 2ASEA 1V5WA 2P0EA 3R9IA 4DSTA 5IF9A 4MRVA 3TJZA 3WBJA 1A7JA 3GFOA 2X1VA 2ZE6A 5FTKA 1SQ5A 1FX0B 3TW4A 4PZYA 3TR5A 2HLDD 3B7GA 1IN5A 2ZSFA 2JA1A 1KDRA 1XPUA 2OO7A 1NL3A 2AR7A 2GK7A 3GEHA 4O2RA 4D4MA 4P4TA 1OH6A 1CR0A 3AGPA 1GTVA 1TQ6A 1KGDA 1XDBA 3ZQ6A 2O52A 2YKGA 4TMKA 2B6HA 2B8WA 1ANKA 4A2WA 3T5DA 1XEWX 4JT4A 2FZ4A 2W0MA 3CNOA 4QM6A 1T4GA 1QHSA 1OT3A 4TSFA 4LHWA 3VNUA 1G41A 4I1SA 1HURA 2XX3A 3BXZA 5AJWA 3MWJA 1KOFA 2V1XA 4FW9A 1M7GA 3HPRA 2WJIA 2Z83A 1NBMA 3WMGA 3QXCA 1NG9A 3LAWA 1GKUB 4KFTA 3IDQA 3TW8B 3V4FA 1SXJC 2IYTA 2J0QA 3ZZUA 5JCPA 4PO9A 4LJ7A 1VCMA 1OH5A 3BK7A 2KBEA 2O8FB 1N0WA 1FW6A 4RSGA 2IYSA 3SJBA 3EIHA 4AG6A 2OUKA 4H1VA 5JHHB 2IS4A 5CLQA 1EX7A 3Q85A 5CIQA 3MRSA 1UEIA 5KSOA 2FFHA 3CBQA 4XD7A 2QBYA 3LX8A 1CR1A 2YV5A 5SZJA 1J70A 4LC0A 5LB2A 4JSYA 5FBWB 1SVSA 1Q12A 2O8FA 4P31A 1VYTA 4PO8A 4Q5IA 2HV8A 2NO7A 3ZVLA 1TF5A 1XEFA 1OXSC 2IK8A 2KI5A 4Q02A 4POAA 1BS1A 4ACAA 3THYA 4C2TA 1OXXK 4IOKA 1KDTA 4KLNA 4LZZA 5L3QB 1M74A 1JAIA 3KFVA 2XXAB 2ZU0C 1ZNXA 1NVVQ 2C78A 3FHTA 4LHXA 3EZ7A 3SQXA 4LDJA 2R8RA 1UPTA 4CYMA 4EPXA 5FBRB 2J9RA 5HZKA 4HDCA 4UNPA 3K09A 4ARZA 1Y3AA 4NYJR 4QNMA 1U8ZA 2CL7X 3MMPA 4Q4JA 2XEXA 3GJ3A 3AVOA 3SU8A 1LW7A 1U0HC 1MO3A 3BH0A 3D3QA 3CPHA 4B2IA 1OXTA 4BZPA 1CJUC 2A3RA 3UATA 1ZD9A 1VYVA 3B1VA 4MKHA 1Z2AA 1G7SA 1SKYE 2F1RA 1XD8A 4LJ4A 1DBSA 2ZJYA 2ZRGA 2IYUA 2QL6A 3WRYC 1XCPA 4QKQA 3ZDQA 5DNYB 3W90A 1SVIA 3UWOA 1DO2A 2J7PD 5JRJA 1W36D 5KNCA 4GBMA 3FB4A 1P9NA 1VCOA 3P4YA 4M21A 1CTQA 3DKVA 4ZKEA 1Z07A 1NF3A 1WCV1 2XITA 1XTJA 3OF5A 5HTKA 3EASA 5JI3E 1T0JB 2P6NA 4EUNA 3SHWA 2FNAA 4IVQA 2GBLA 4B34A 4TMZA 4LJ8A 1Q1ZA 3CPEA 4DUGD 2ATVA 2YC2C 2G1KA 1HEIA 3AKDA 1W4BA 3GJ0A 3VR4A 4DLUA 4AK9A 4BWYA 4CZ2A 2CDNA 3WY9A 1U90A 4UKDA 1BKDR 5FBLB 4Q9JA 1KI4A 4P3YA 4TLEA 4DBLC 1QHHA 1KO5A 3R7WB 1W46A 5GVRA 2CBZA 1NJGA 1XZPA 1VG0B 4GOXA 3KXKA 1S0UA 2QNRA 2CE2X 3L0SA 3WHKA 1D2EA 3K0CC 1NMXA 1AK2A 2BEJA 3NWJA 4CT4B 1R0WA 4TLBA 3AVUA 2O8DB 1YZQA 2GXAA 3W6OA 2C04A 4GZMA 4IFBA 1ZM7A 4AYWA 3MWLA 4GZLA 1OKKD 5HE8A 5BXQC 2V9PA 4CGZA 1WF3A 1ZBDA 3CNNA 3B1ZA 1F6BA 3VHLB 2F1IA 2ZRKA 2QQ0A 2EVWX 5JWRA 3RLFA 2AWNA 4XOIA 3W3ZB 4D0NA 3B6EA 1BMFA 1DAIA 2W6ID 2EYQA 4MQBA 3P4XA 2H7VA 4D0LB 1XD2A 4G5RA 3M6AA 2FPMA 2H5EA 3CX8A 4M53A 4PHHA 1N5LA 3PG5A 4DIDA 3VTKA 4RD6A 5JEDA 3L0IB 2EYUA 1RRCA 4B74A 1EFUA 1P5ZB 3BC1A 3THWB 2FN4A 2HT6A 3QXJA 2FU5C 1Q1BA 3QPWA 4MGKR 2IS2A 5C18A 3EPLA 3QBTA 3GJ6A 2G9NA 6Q21A 1KMHA 4HI0E 3IHLA 4V03A 1FP6A 3I5XA 3LA6A 1RRPA 3MUFA 1ZUNB 2D2EA 5FOSA 4NTZA 3ZVMA 1TEVA 3IIMA 3W5IA 2WMNB 4R7ZA 1RFLA 5FPYA 2LCFA 5SZKB 5TARA 2ZXUA 3I4LA 4L15A 1G8HA 3BB1A 2WICA 3KUDA 2QM8A 4WZBE 5G41A 2R6DA 1OHHD 2VLIA 5JCZA 2XZPA 4TQAA 5FOWA 1JR6A 4URVR 1U98A 2ZREA 2QTHA 2F3RA 1NN3A 4JBWA 3TE6A 5BN5A 4WOPA 1Z22A 2GJSA 3N5CA 2XNDA 4LV6A 4D4LA 4NBSA 2CVHA 2WJHA 3SN6A 4R71A 5L3SB 3EG5A 2BBTA 3A1WA 3DMNA 2RH5A 1JXMA 1N6NA 5GVSA 1CJVC 4RD1A 2ZYWX 4Z1MD 1WDTA 2ZUBA 1GRRA 2A9KA 3KJEA 3AUXA 2D62A 1XP8A 2GF9A 1L8QA 2JJ8A 2Z0MA 5EXTA 1Q22A 4V0NA 5C1BA 3L43A 4JBYA 5FL3A 3EZ6A 1KK3A 3OIVA 521PA 1JJVA 3OEEA 4QJ3A 1KI2A 3PEWA 2CJWB 3I62A 1XJQA 2IYVA 4TZ6A 3KL4A 2WV9A 4HUQA 1W44A 1KI1A 2ZAMA 1EK0A 4QC2A 4P32A 3K9GA 2ZI9A 3AP2A 3RS7A 2IL1A 5HKKA 5KU1A 1COWD 2CCKA 3WMEA 4MUAA 1GILA 1KJYA 3TUZC 1R0ZA 3LVRE 2ZVQX 1BMFD 1H65A 1AKEA 2QAJA 3VMFA 4DSNA 5JHGB 5JMTA 3NHAA 3T1VA 4ZO4A 1W1WA 3AQ4A 3RANA 1ZD8A 2IYQA 3B2EA 4XD7D 4C0SA 1XPOA 3I3SR 5GJBA 1GUAA 1P72A 3W5JA 1LS1A 4DIEA 5KUTA 5L3SA 3QF4A 4GP7A 2L0XA 2XJ9A 2BBWA 4IDHA 5AWFC 3X1XA 4NKRA 3FYHA 2NO9A 4C0KA 2ONJA 1SVWA 2ZRNA 4AC9A 1EX6A 4PX9A 2REBA 1KSHA 1OHHA 1GITA 4LY6A 4G5SA 1KO1A 3IKJA 1EWRA 4UNRA 3GQBA 5EE9A 3ZZ0A 2NPIA 1Z5ZA 4TYQA 4GDFA 2QAGC 5J47A 5J5CA 1HY3A 1JEEA 3ASYA 1R6BX 1F60A 3I8XA 2OBMA 3A4MA 3U5ZB 1UBGA 3BWDD 2J59A 2OBLA 1QF9A 1TUIA 2AHOA 2QMUA 4LX0A 4LSGA 2RGCA 1IY1A 3RC8A 3A6PC 1GP2A 4ERNA 5J4VA 2DFTA 1JQLB 5BYKA 2ZJ8A 3IQXA 5CB8A 3QSYA 2D74A 4M1MA 2EWWA 3SDZA 4M2LA 1GL7A 4PHTA 4DC9A 3ZQJA 5K8IA 4BLTA 3U2QA 3CRVA 4URZR 2W6IA 2BMDA 2QE7D 5BWMA 4QNRA 1VMAA 4Q9HA 2O8DA 2HEIA 2I1QA 3A8TA 4MGZR 3GLFA 3RC3A 4FCWA 4M1OA 4A0GA 4QOSA 4DRZA 1L4UA 2IWRA 2ZSEA 1ELOA 1MKYA 1OIWA 3CRW1 2FSHA 5CYPA 5AUPB 4DJTA 4N3NA 4A1FA 1NIPA 3LVQE 5TXGA 1E96A 4JVLA 3R7WA 1YRBA 1AM4D 4DDTA 2P5SA 2AXNA 3NBZC 1XPRA 4ZCMA 1XBTA 1H8EA 3TBKA 3KQNA 1HV8A 4GSYA 2ANCA 1NLYA 4KI0A 2VO1A 2F6RA 1P3JA 1E2JA 4OK6A 4WBSA 1JALA 4ABYA 1N6KA 4A6PA 3C5HA 3HP1A 1H8HD 2Z6VA 4FIDA 2JGNA 4XWAA 3ZYCA 4OQXA 1ZMXA 5F98A 2ODNA 1UKVY 2A5YB 2OXRA 2GCPA 2QMHA 2WAYA 3A37A 1D9ZA 3B5JA 3KX2A 4OJQA 3WYFA 3ADBA 4I1UA 1N5JA 2CEAA 4MYCA 2WWIA 1S8FA 1HA3A 2NG1A 2RGEA 3QKSB 1SVOA 3AEZA 1N5IA 2QPTA 4EDHA 5EXSA 4EFNA 2DR3A 4CDGA 4RD0A 2F3TA 4L9WA 4MYUA 4JLBA 5J4KA 2H57A 3CB4A 5LD2B 4M9QA 1JAHA 1BIFA 4TMVA 1CR2A 2BV3A 3FTQA 4RD3A 1Z6AA 1E2QA 3DMDA 4LYFA 2QP3A 4G1UC 3PUVA 1KDPA 1XEXB 2IYYA 2K5UA 1F2UB 3AVVA 1ZU5A 4V0LA 1UM8A 2X2EA 2C9OA 4LYAA 1D2MA 2B7CA 2WPDD 3KKNA 2VQSA 4UJ5A 2YWFA 4MDFA 3KXIA 2XTNA 1T3LA 1AQYA 1W4CA 4AKHA 3UK6A 3F8TA 5FPHA 1N0UA 2YC4C 1G20E 4YMVA 1EFRD 1K5GA 3S1AB 2P65A 1ZC4A 4CVNA 2WJJA 1XCMA 4R2HA 3PITA 3LQRA 4F92B 1GDDA 1YJ5A 2YOFA 2FV8A 2C5LA 5FR1A 2GWHA 2A5JA 4D82A 1J99A 3VX3A 1SKQA 4V02A 2Q9AA 1G5PA 1EFRA 1KK1A 4EPWA 5DI9A 2NMVA 1XF9A 1PZNA 1HH4A 4PTLA 1GKIA 5CYOA 2HCBA 2CNWA 3TUJC 4DLZA 4LPSA 1T6NA 2AN9A 1Q21A 1IJFA 2J0UB 2WWXA 3GLGB 1IN8A 4PQRA 3LBNA 2BWJA 2REOA 4BRWA 3M0EA 4DLTA 1Q20A 1T5LA 2PMDA 4HSEA 4PXAA 3AV0B 4M1SA 4BEJA 2C9YA 1IHUA 2QRZA 4Q4AA 1KMHB 4IOJA 3NHBA 3RABA 621PA 3VNVA 1YU9A 3BH6A 3CR7A 3NXSA 4FCVA 1GRNA 3QKUA 4G3XA 4PAOA 2C98A 3K0EA 3ETLA 2VSOA 4D80A 1X8JA 2YZ2A 3R9XA 3THXB 1NVWQ 4B71A 4EJSA 3WP1B 4RD2A 4R98A 1G64A 3O8DA 3DPUA 3SBDA 5KNDA 1LS6A 4N0EA 3EX7C 3K70D 1CLUA 4EPVA 2VPPA 1RYHA 1D9XA 4IOLA 4PZZA 4QGAA 4YMUA 1DADA 5CITA 1SVMA 1Z0KA 2BMJA 2J87A 2E1RA 2F7SA 1E2NA 3AGQA 4MH0R 3VU9A 5TMPA 3K0CA 5EQTA 1ZAKA 3EAQA 5AJYA 3RS5A 4B44A 4PAQA 1G8FA 4YMSA 1D2NA 3U60B 3EA5A 4BFTA 2IA5A 1U0LA 4G01B 1IM2A 4KBFA 1A82A 1F2UA 3EXAA 5CK4A 3REGA 3SHFA 2I1VB 4FCTA 4B6EA 3FKSA 3SEAA 2QY9A 1KY2A 4TMWA 1N3BA 3CUEF 4MRSA 4LHZA 5ANRB 3QENA 5DO9A 4YQFA 1E79A 3OE7D 2UZ3A 4DDUA 5AUNB 3IBYA 5KDDA 3GLFE 1MO6A 4NONA 2JJ1D 4A15A 4CT5A 3ZS9A 1G4AE 3WHLA 2V6IA 4B3DA 4F4JA 1BO6A 2UVQA 2XJ4A 2DHRA 1XMVA 4URUR 1KZGB 2NGRA 4XVRA 2IYRA 1TL7C 3PEUA 2F43B 2VP0A 2GNOA 1N5KA 1PLJA 4QFMA 3MWKA 1S96A 1G6OA 2JLYA 1E0SA 2J5XA 3B9PA 1ESMA 2WZQA 1Z06A 5BQ5A 1WE2A 2DPXA 1JECA 2J0VA 1TQ2A 2KE5A 2YHSA 1E79D 3HYTA 3ONWA 4OI4A 1E1RD 2P3SA 3CF2A 2QENA 5H70A 1P7CA 1RYFA 1NVUQ 1XXHB 4DCUA 2VF8A 2ERYA 2VHQA 3EZ9A 3NBFA 3QG1A 4YDHB 3BRWD 3BE4A 2B8TA 5CM9C 1R8QA 1TUEA 5FOXA 5HE9A 4TL6A 1UBEA 3ND8A 1KJWA 2ZE8A 3AVWA 3X2SA 5EE0A 3PJRA 1AZSC 3PUZA 1VPLA 1K8RA 2AD1A 2X77A 2PX0A 2CCJA 1TPZA 4HDOB 1XXHA 5KO2A 3B1XA 2JLQA 3BS4A 4ZI2A 3OAAA 1FZQA 1U2RA 1FNMA 3KJIA 3K9HA 5JS7A 4DCNA 2QSZA 4D25A 1E4VA 2O8CA 1KK2A 2VYFA 2WJGA 1CR4A 3QF7A 4ESVA 3FVQA 5FR2A 2XOKA 5G3ZA 3GJ5A 3VR1A 3B1WA 1G8GA 2GZAA 2R9VA 2V6JA 4U5XA 5KOYA 4O2LA 2ORIA 2W00A 4HEJA 4BLOA 2F9LA 1N6HA 4KSBA 1DG1G 1W0JD 4KYIB 5C2JB 4OHVA 1E2MA 5L3RA 3ZJYA 1NN5A 1GAJA 1MV5A 4KITB 1WA5A 1E98A 1J2JA 2GA8A 4NU0A 2PZFA 1X6VA 3FFAA 3VR2A 2A5FA 3GLHE 3ZVNA 3LFUA 2OFOA 2Q6TA 2CMKA 4MRPA 4Q1EA 4I99A 5BW8A 1S4QA 3HWSA 1FNNA 1MRSA 2VRWA 4UXHA 5JBQA 3SZRA 3K0SA 2QU8A 4I1OA 2OZEA 1JPJA 4JT2A 1FQKA 4II7A 2CNWD 1SKYB 2ZUCA 4MKGA 5JWOA 3NH6A 3IEUA 5DSZA 4WW0A 4WXPA 5KPDA 1EFHA 3P32A 4ZDIA 2C8VA 5DYIA 2GBLC 2C96A 1IN7A 3HU2A 2ZROA 3QG5A 5EZ6B 5TDHA 4C0HA 2JLRA 1RIFA 1JB1A 3VKGA 5EP1A 1NN1A 3A58B 3LH5A 1SXJE 3NVAA 3CPJB 2DCUA 2W2VA 5KHOC 1ZUHA 3QVUA 5JRZA 3DOFA 1XTIA 3ZH9B 4DT1A 3T34A 3EC1A 1HYQA 2AFIE 3B85A 2ONKA 4MRRA 2WWYA 2O0KA 1OW3B 2Q3MA 3A4NA 2IF2A 1Q3TA 2C2HA 3TUIC 5LD2C 2Q3FA 1Q44A 5JEEA 3FKQA 1IXRC 1OFHA 4EPYA 4C30A 1E9SA 1X86B 2AK3A 3EA0A 4PC6A 4W5HA 3L8ZA 2LKCA 3BD9A 1E4YA 4YDSA 4WVFA 1N6PA 3K1JA 1OE0A 1PLKA 2HF8A 2QPOA 1KHTA 4BZXA 4JMPA 5J4HA 2FDCA 2V1UA 4Q03A 2OHFA 3RWOA 4C9BA 4AKGA 4GMDA 2IC5A 4MUBA 4M1KA 4HZUB 4Q4HA 2GVDC 2N1BA 1DO0A 1II0A 3T06B 5KSZA 3SYKA 1PLLA 3DO6A 4B35A 1LV7A 2A7QA 1EFCA 2VHJA 3X1ZA 2FPKA 2GF0A 4PHFA 1ZD1A 2SHKA 221PA 2QT0A 1S3GA 1F2TA 1QRAA 4KU4A 2RGBA 3EIQA 2C03A 4Q4HB 4OHZA 4B73A 4YXWA 3UG6A 3IUYA 5FUWA 1TU4A 2Z43A 4JL5A 1P61B 5FPTA 2BMEA 1Z29A 2AKAB 1GG2A 2HYIC 2OCPA 1P6XA 3AKYA 4MRNA 4XJXA 3C14C 5E7MA 1WXQA 2IF0A 3A1TA 3D7MA 2NZ8A 4PC3A 2O8EB 2IUUA 1YHNA 3LW7A 4G5OA 4PHGA 4EPTA 3QXXA 1NY5A 4DKXA 4DLWA 2PLFA 4NYIQ 2ZJOA 2IXFA 2FG5A 3LO5A 5DHFA 5TV2A 3ICEA 1R4AA 3UXMA 5KTYA 3T1TA 1E2EA 1TF2A 5E7IA 2ZANA 1W2HA 3Q9LA 2GEDA 4UNQA 2JLSA 1G3QA 2H92A 3F5FA 4DT1B 1LNZA 2ZI6A 2ZRLA 4M9ZA 1G5TA 4IKEA 1XB2A 4LYHA 3L82B 3GLFB 4OI1A 2WBLC 3BH7A 3GCGA 3FGNA 2GCOA 4PAMA 5EE5B 4URWR 1LB1B 1ZC3A 3QQ5A 4LBYA 4DVGA 1AQUA 4DDWA 2F43A 3AH8A 5EE1A 5DGXA 4LV8B 2B92A 5EUMA 1X1RA 2PZEA 3IBGA 3VR6A 2OESA 2WJYA 4BQSA 4Q48A 3K09C 3ICQB 2CHVA 1IONA 4PC1A 1JR3E 1B0UA 1KTVA 1E6CA 2MSEB 5DN6A 2QTFA 2PBRA 2OBNA 1Z6TA 4QM7A 1Z08A 4Y0VA 1T5IA 1US8A 1P2VA 1A5TA 2OG2A 1VIAA 1QHYA 3AF0A 1JR3D 4QRHA 4DLRA 4TWZA 4YONB 4MKFA 3M4YA 5CLLA 3SYNA 1XRJA 1G8YA 1YVDA 2GJAA 3E5HA 3OFND 3ECCA 4HB2A 5FI0B 2EFDB 1R7RA 3CX6A 5CK5A 4LUCA 4RZUA 3U6KA 4DLYA 3LNCA 1Z0DA 4ITRC 4NCNA 2I3BA 1MABA 2JDID 3RS0A 4Z8YA 1Z0AA 2IT1A 4YLGA 3TQCA 2QSYA 2MMGA 2OT3B 1CXZA 3E1SA 2G77B 4BFYA 1AS2A 3A4LA 3EPKA 4KAXA 2RGAA 5P21A 1RZ3A 4N0DA 4RJLA 3U61B 1K5DA 4E5UA 4C7OA 3REFA 5UKDA 4PO1A 2WOOA 4YXWD 1P9RA 2V55B 3QXSA 3CF6R 4Z54A 4ZIRA 1MT0A 1D5CA 4WA7A 2WHXA 3QKSA 1ONBA 4IDPA 5H8WA 1W5SA 2QGNA 4OI0A 1M1YE 4GMXA 2DFLA 5F9HA 1E0JA 1N2CE 3QY0A 4BFUA 2FEOA 3ZS8A 3NH9A 1HT2E 2ZU6A 1XCGB 3K0AB 4BPBA 4LV5B 4OK3A 3K9LA 2VP9A 1F48A 4JLVA 5FOVA 1EXMA 1SZPA 2IW3A 3SE0A 3CRRA 3ZIAD 4Q9LA 1HQCA 3F3YA 2QQEA 1JEDA 5A4JA 2FE4A 2ZRBA 1XX6A 3H84A 1GRQA 3MWYW 3CF0A 3KB1A 4AURA 1P73A 1UKYA 4FMDF 2V7QD 4Z51A 1KZ7B 4NL4H 3LY5A 4PQFA 3QXHA 1N6IA 2DWOA 1Z6YA 4PSKA 3U7HB 1NBME 2MSCB 1KNXA 3FPAA 2DY1A 1FL9A 1A4RA 1UKZA 3KKMA 2GETA 2QP9X 3KKQA 3BGWA 1NNEA 3U7FB 3DHWC 2WM9B 3AKCA 4A6XA 5DE3A 1WBBA 3IPXA 2WWFA 3MJHA 4DHEA 4B3GA 1XTKA 4BFVA 4XIGS 2NOAA 1KI3A 1M7BA 3PUXA 5K8UA 3RS4A 1KI9A 5AK0A 3VHXA 1TAGA 1ESNA 1Z8FA 2O5VA 4PPGA 5A0FA 3SQWA 2Q0HA 4P4SA 1ZCBA 1X3SA 1AKYA 4XWOA 2D7DA 4JLKA 4KFSA 2V4ZA 2ZSBA 2IS6A 2H8KA 4PPQA 2BBSA 2GXUA 3PQCA 5DLQC 1C4OA 1E0AA 3UPUA 4JKIA 4EQ6B 4AKIA 2D2FA 2ZEJA 1CJTC 1OH7A 1EESA 4JS0A 2ATXA 3TK1A 2QAGB 1KO7A 1WMSA 3TSZA 3UKDA 3RYTC 1UDXA 4P4SB 1W48A 1R2QA 2FOLA 1AS0A 1NSFA 3B78A 1D6JA 1TU3A 2WIBA 4W7SA 1BH2A 5EUQB 2XB2A 1X8KA 4QGHA 2EFGA 3L0PA 4HAUA 1E99A 3C4JA 1VDZA 1SXJA 2BC9A 4A92A 3NG1A 5JSZB 1L7VC 3U6BA 2QG6A 2ZR7A 3CNLA 3FKSD 2QN6A 1JQJC 3LDAA 1M8PA 1DOAA 2CLCX 2OCAA 3WP0A 3AF2A 3VKWA 3DKPA 1E2PA 2PH1A 4JIMA 3RRNA 1T91A 3ZVRA 5CB6A 4JVMA 1II8B 4ZDJA 2GDJA 4HLQB 2PJZA 1FX0A 1SGWA 2JJ2A 4W9MC 4WAUA 4DLXA 1ZVQA 4IVPA 1ZNWA 1NMZA 4K81B 4ZDKA 4JYBA 3J81k 3KQKA 4CRWB 1GWNA 3ADDA 5DISB 2ZS7A 1EWQA 3CH4B 1YR9A 4GFDA 3SNHA 2JLXA 1SVKA 4L4UA 4FMCB 3RSLA 1T9HA 1LFDB 3WMFA 1KYIA 4G5GA 1N6LA 3V00A 1TTTA 5JJIA 1M34E 1Z3IX 3B13B 3FFBA 5GADl 3OIYA 4I1VA 4HUTA 4MDEA 2ZYVX 3LXXA 3DOEA 2HUPA 4Q21A 2HT1A 2LKDA 2ZPTX 3AP1A 5AJXA 3K0FA 1GKYA 1WBDA 3QI2A 2JATA 1KDOA 4JLMA 4C0JA 3W34A 3GEEA 3RS3A 5A5GA 1J7KA 2PCLA 2NIPA 3DVLA 2QI9C 2ODBA 2GCOB 3NIBA 3P27A 3GMTA 4FWTA 4NCHA 4M0LA 2ZSDA 5BN3A 1IN4A 2GESA 1NKTA 2ZYUX 4HLDA 4TLCA 5HKKD 2ZS9A 4ZKDA 4DSOA 4JLNA 3RS2A 2OSBA 3AUYA 2BCJQ 1Q1EA 1NMYA 2CE7A 2J46A 4GRAA 3P20A 1QHXA 2BMFA 2QEQA 3CLVA 3CWQA 3RRYA 3N2IA 3AVXA 2D4HA 2A30A 4KXFB 3I5YA 3VU9B 1DG3A 4F93B 3KFXA 1R5NA 5EZ5A 4M1YA 2XXAA 4TT3D 5IHPA 1T8UA 4M4SA 2P67A 4TTPA 4B75A 1ZIOA 4OHWA 4Q18A 2ZITA 1O87A 4LJ6A 1P75A 2QA5A 3W9YA 1AZTA 2R6GA 3QF4B 4TMXA 4TYPA 1W2GA 4B2LA 2GAOA 1YKSA 2GK6A 4Q00A 4Q7MB 4CEJB 2R62A 4MITA 1CIPA 5J4YA 3IIJA 4IEIA 1W7AA 3LQQA 4ZI3A 4KSCA 1UBFA 3TLXA 3OIWA 4HLUC 3FDIA 3UIEA 4UXJA 2YVUA 1ETUA 1OFUX 2VP6A 5TB5A 2IX3A 1F3OA 2DYKA 4CEJA 5BN4A 3THYB 1EG7A 1OF1A 5EP3A 4LHVA 1FMLA 1YZUA 3BFKA 2WSMA 4V0OA 1ZJ6A 3U7EB 1RRGA 2NO0A 2Q21A 4PPFA 2QP4A 1GNRA 4PFSA 4HAYA 3GPLA 1Q0UA 1E2IA 5DYGA 3NTUA 4QBGB 1E2FA 4OQLA 2ZRDA 3JVVA 1FTSA 2CL0X 2E9SA 1C1YA 4UNSA 3PEYA 1UKEA 4LPKA 5EE3A 2IS1A 1NY6A 3FMPB 4QBFA 4NHOA 1IOZA 2OV2A 3TQFA 3ZGXA 1IY0A 3QKRB 4A4DA 1MO4A 4XTCS 1XMIA 1QHGA 1T3SA 3VR3A 2VSXA 2BDTA 3D8BA 3LBIA 4J0QA 1UJ2A 4LGMA 1JJ7A 1VG1A 1DAHA 3MLEA 4GPTA 4Q7LA 1GFIA 4LRWA 1NLFA 1XD2B 5SZHB 3R8FA 3RDPA 2RGNA 2W58A 4A8JB 3EWAA 3OEHD 4I81A 4CEHB 4U00A 2PX3A 4HB0A 3MD0A 4GOKA 2YWEA 4Q7JB 5JI2E 4B76A 2TMKA 2GXQA 1US8B 1XJ0A 2FWRA 1KNQA 2FA9A 4B43A 1X8LA 2XSZD 3AVQA 5CDFA 3JVUA 2ZRAA 2IYXA 3CKLA 4KHZA 1PVOA 2GEVA 2DB3A 2Q3HA 2H17A 1KSFX 4XVUA 4IXMA 4LCBA 1U9IA 4QL3A 3LW8A 4AY2A 1R10A 2RHDA 2VP2A 2GKSA 4NH0A 3ZD6A 1A2BA 1LF5A 3U3MA 1P4SA 1UFQA 4Q1DA 4F7WA 1XEWY 3IGFA 3IILA 3QE0A 1KAGA 4B6FA 1VCIA 3WNBA 3H86A 4LHYA 1OJLA 2HJGA 2FFAA 2W2TA 1BYIA 4A0FA 5L3QA 1WP9A 4BLSA 2C77A 2DFNA 2OAQ1 4YC7A 1Z2CA 4RKEA 3MSXA 2JLZA 1AS3A 4NP6A 2NTYC 3WYGA 5BYJA 4E03A 2RKOA 4E09A 2MMCA 4E07A 2FFQA 3LX5A 3HYRA 3NEJA 3LXRA 1T3HA 2GEUA 2OCBA 2VIIA 4A8JC 3UG7A 3GD7A 3JZMA 1G4UR 2R44A 4BUJA 1XJCA 1U81A 1XWIA 4RZXA 3X1YA 3KB2A 5F3WB 1IXZA 1IQPA 2G83A 2XZLA 2RB4A 2BKUA 2IBMA 4XSGA 3C5CA 2PT5A 1QHIA 4RFSA 1Z63A 1Z83A 1GOTA 2IEYA 3ZD7A 3FMOB 1VHLA 3UMFA 4LK2A 2ZAOA 4DDVA 3BORA 1CKEA 4ZCIA 4EIWA 4ZPXA 2G0TA 2NO6A 2VP5A 4Q4AB 3SBEA 4AD8A 1KKMA 1GM5A 2O0JA 1IBRA 2ZRFA 2ZM5A 4PSVA 4ESHA 4AYTA 2PZGA 4LWZA 3ASZA 3AF1A 2F1HA 2OXCA 2J45A 2ZI5A 4Y0AA 2QE7A 4BASA 4IJMA 4D4JA 4FMBB 4IHQA 3CZPA 1XTQA 3GJ8A 4FMCF 1RW4A 4KJZA 1SHZA 3CRQA 3A1UA 4TL8A 1GNQA 1II9A 1YR6A 3R8CA 3I72A 2EFHB 2FF7A 1JBKA 1QHNA 3T12A 3T61A 3Q7PA 4XVQA 3TKLA 2BIFA 4G0NA 1QHHB 3KJGA 3W8NA 3NKVA 2DWPA 1P2TA 4OI2A 5IK2D 5IK2A 4NYIR 1NLZA 4QGGA 1ZINA 3WYAA 4NZYA 4PC7A 1DE0A 1OH8A 4IDQA 2HXYA 2V54A 3SJAA 2ZJ5A 5E4FA 1W47A 4TLAA 3FMIA 3RRZA 4X8HA 3SC3A 3C8UA 4KVGA 2W83A 3PVSA 4URYR 2YOGA 1AA9A 1G16A 1S1MA 2AWOA 1NSTA 4D6PA 1DARA 4IEEA 2CJWA 4RFSB 2AL7A 4BLRA 3THWA 4HAZA 3LBHA 2ZI7A 3A1SA 2F1JA 3U3JA 4Q1BA 1N6RA 4DWJA 1W4AA 3K0FB 3E70C 1TQ4A 1G5RA 4B3FX 1X1SA 3KTAA 4HZIA 2ZSAA 1OIXA 2ERXA 5GJCA 1E2HA 5FL7A 4OBEA 2V3CC 2RHMA 3T35A 3KKOA 2ZUDA 1W0JA 3TRFA 2ZE5A 2IHBA 2EU8A 1XD9A 1JR3A 1VYUA 3RWMB 2D06A 1A2KC 2DWQA 3RSOA 4JLJA 3THOA 4U7DA 3L8YA 3BFVA 1OXVA 1KI6B 2GTPA 2CCGA 1OSNA 1R8SA 2HXSA 3GLHB 4LBWA 4WZAE 3HU3A 4Q1CA 4NYMQ 4Q4LA 1CS4C 4NPHA 4BLQA 1E3MA 2RGGA 4KYUA 2WVJA 3O47A 3EPHA 1H8ED 1E9BA 3TSWA 4IXNA 4D0GA 4AI6A 3FHCB 2GHIA 1VECA 4QBIA 5CM8B 4DCTA 2NO1A 4PPNA 4C0AC 3CH5A 3UMRA 4FMDB 4RZ2A 5FOUA 5EXPA 2AX4A 3K53A 1FTNA 2EQBA 2OILA 3CX7A 3T15A 2XAUA 421PA 5B30A 1XZQA 4TQ9A 3NBXX 4HZUA 3TVTA 1DAFA 3HR7A 3OIUA 1E2DA 4OL0A 2ZJBA 2KB0A 1I2DA 3AP3A 5E7JA 4RCZA 3QEOA 1Z0IA 5IRCD 5ELXA 3HU1A 3L2OB 4X8OA 1MH1A 1Q1QA 5C4GB 2VHUA 3MAAC 4MGIR 3OFNA 3CW2A 3HDTA 4JL6A 2N42A 4MKIA 1ZRHA 5FPKA 2OLKA 3EZFA 5F2EA 2IYZA 1VIYA 2WPDA 4GNKA 2XSZA 2ZIAA 4PZLA 1T8TA 3BB4A 1KI8A 4Z1MA 4TYNA 1P9WA 4MYHA 1NJFA 1IJEA 2RGXA 4BEBA 4DB4A 5JFGA 1FQJA 4NCKA 3OEHA 2R65A 4B32A 2YWGA 2ZRPA 3TR0A
chains in the Genus database with same CATH superfamily
3R20A 1CJBA 4P5EA 3LFTA 4P82A 1V7CA 2VBGA 1IL0A 2ET6A 2WU8A 3C98A 2ID4A 3CX4A 3I04A 3O74A 4U4AA 2WJPA 1D1SA 3VR3D 4LJLA 4LE2A 4EX7A 2APJA 3I4CA 4K9KA 1NC1A 2XE7A 3B5IA 3BRSA 4HYYA 2PPLA 4B3HA 2YFKA 1QPGA 2W6JA 4NE2A 1OLUA 2G40A 4QO8A 3CXUA 4EUHA 1KSGA 3O90A 4MYTA 4XSHA 4YQZA 3C41J 1F4LA 2EKZA 4MIKA 1L9XA 2KBFA 3DE6X 1G9SA 3QKRA 5IBRA 2ORVA 1G2PA 5KDOA 1RE0A 1TX4B 1VG8A 4CMEC 3GF4A 2VYNA 1LRKA 4LECA 4YPVA 1A27A 1KAMA 4Y9RA 1U5AA 1DAGA 1EGHA 1GGEA 1WY7A 2GFQA 2Z2XA 4ICIA 3M9WA 2QBYB 4TLDA 1R50A 2JI8A 5T67A 4BO0A 4QA9A 3W7AA 1LWNA 2HA6A 3IPAA 5HK8A 1L6RA 2JEOA 3GLKA 4WK2B 4KFRA 1A7KA 3AHFA 3G1UA 1W49A 2J0UA 1KHHA 2WIAA 1I4DD 3V2IA 2ZI3A 5G2OA 3ZY2A 2MR5A 2XA2A 3ND9A 3ZHXA 1RU3A 2ZVPX 1P60A 3F6RA 3TMYA 3QPUA 4U2DA 4DCVA 1HDOA 2VHTA 4H17A 4ZVSA 1DOZA 5FOQA 3K70B 1Y1PA 1SXJD 4RQTA 2YWHA 5ICSA 4J3JA 4IAOA 4GDMA 3TH5A 2PKQO 4EHLA 1I1NA 1XHEA 5CW1A 4DEYA 1HL3A 2V6GA 2W6OA 1RVDA 4OJKA 4QU5A 1UKCA 2AUTA 1E8NA 3AJ8A 3L6RA 5H9VA 1L2TA 1MRNA 4B3XA 4Z7JA 4BX0A 1T2VA 1GL3A 1KYYA 4TS4A 2K6GA 3QIAA 4N3CA 1T2CA 1O58A 4M37A 2H4WA 1QHEA 2W2LA 3OJWA 1SY7A 4YUWA 2WM3A 1N2GA 3NDPA 4H0FA 4H3KB 4HS4A 4IF6A 4YI3A 4D9HA 3BTSA 5F1YA 4U7PB 5KHAA 3BEDA 5TVGA 1G17A 2IHTA 1HMPA 3II6X 3R0VA 4I5DA 1JI0A 5AJZA 2HJ9A 3BHJA 2WNIA 2P8SA 3O8RA 2A58A 3CR8A 1ZLYA 5CU7A 4PZDA 4MA4A 1H2BA 2GPTA 2UYCA 2GJ8A 2PRYA 2OGUA 3FOCA 5KYXB 4B09A 2DH5A 2AE1A 3HR8A 1V5GA 1F6DA 4RYDA 1QGDA 3A2LA 4XWGA 1TB4A 3ELDA 4PX5A 2JKYA 5FO1A 1U2ZA 2PRKA 3Q7QA 2R6FA 1PWXA 2P5TB 5FFNA 2H18A 3JWEA 5DIZA 2VAVA 5G3YA 5JJIA 2AFHE 4D42A 3QYJA 2JLUA 1XAIA 2G9UA 3L07A 1AE1A 2NQTA 4L8GA 1AMOA 1O0BA 2R60A 2IU4A 1PO7A 1WCYA 3GFVA 4Q4DA 3VDMA 1HSZA 1C0IA 1WMEA 2AXPA 1XFAA 2OHOA 3GDHA 3A4IA 3BVPA 4LYYA 5ICCA 1OTYA 1ZZEA 5YASA 4PGHA 4QBKA 3GLIE 3AEKB 5K3SA 3ZI4A 3M1IA 5LNK1 3WDSA 3P2YA 4Z4FA 2A78A 4QJ4A 4HH0A 1I9CA 4BGIA 1GYRA 1MAHA 1W36C 1SHKA 2I4IA 1BROA 2E4ZA 2EX0A 1DJLA 2NUAB 1E62A 3FHOA 4PC2A 1Z2PX 1D6MA 3DNMA 4M9SA 3X3HA 1UBKS 1GL6A 1ZCAA 1E9FA 3JQPA 3JSXA 2R87A 1N3LA 3OCZA 5F9FA 3PFWO 1A50B 2VH2A 3KD2A 3E2IA 3U31A 2VDMB 1NBHA 3OZEA 5TQ2A 3ZNQA 1A0OA 4JP2A 1BN7A 1CDOA 1CRPA 2W22A 2D2IA 3W2EA 2BEWB 2QL7A 3MWEB 4ZQGA 4A73A 5A05A 3AHIA 3IQIX 2VXBA 4HUQB 4LA4A 2QJFA 3ACCA 3HVRA 2NLOA 1NX6A 1DDOA 4JJGA 1CY4A 4B33A 5HIAA 1X13A 4Q19A 1DPFA 3UFBA 4MV0A 3ZWCA 5JRDS 1MRZA 1UXJA 3QKWA 4RA9B 1J8MF 4FGKA 4RLQA 1FP1D 1KYWA 3KNZA 3MIIA 1PD0A 2XI4A 1Z62A 3N7TA 4BJ3A 3IBFA 2JASA 3CF4G 4CV0A 4Y6LA 3IXLA 3ZLUA 4ACBA 1XO1A 2JBHA 2NZXA 1RXCA 5E3HA 4F9EA 1VLLA 1DEKA 3OBIA 5C34B 2V7WA 4YIHA 3EIEA 3N2EA 4TKUA 1XQ1A 1ZNYA 1YFJA 4ARZB 1KH2A 2YN0A 4PVCA 3HI6A 1FS6A 3MJEA 4ITUA 2PT7A 3A1VA 5EKXA 4XYLA 4AUEA 1PJAA 1ZPDA 4B1FA 1AGRA 5BUZA 5JR3A 4NXMB 3LD9A 1Y5IA 3D6TB 3OOHA 3SY8A 1ZW6A 4YROA 2C3UA 3C2QA 3QVMA 5TPWB 4S35A 1FJHA 1M8FA 1HE1C 5DOZA 1JXOA 1UBRS 5LLSA 5C1IA 3CX3A 5BNFA 1YSCA 4H08A 2V0NA 4LFBB 3PR3A 3T3EA 4DG5A 2AQ8A 1EK1A 4LRXA 3CZ9A 4LI3X 4YJ3A 1UEJA 4NATA 3NVKI 2BRUA 2VATA 4HAWA 1RQGA 2HI0A 1FP4A 4S1PA 1BGVA 2JH3A 3N2LA 2H16A 3AF3A 3IQZA 5TS2A 1CQWA 2QZ9A 4H3VA 3TS1A 1KAOA 3NTLA 1V37A 1XCOA 3C3MA 3I8SA 3MHPA 3GARA 1CRZA 2J4FA 3NC1C 4X8LA 4U6SA 4UOQA 2HMVA 3PRJA 4CMGA 4JJ6A 4RTKA 1NIJA 4CF3A 1CF4A 1ISJA 5IAOA 3H8WA 3SYTA 4IG4A 1JQ3A 5B3LA 2Q4TA 2X4LA 1GPNA 3MQ4A 2CXXA 2DQSA 3P71T 3KCNA 2PAFA 4BO1A 1AXEA 1LLUA 3B60A 3M89A 4J75A 3A70A 3Q3EA 4DMRA 4Z4CA 5A9SB 1ND5A 1PEDA 1E6EA 1VOTA 4CCWA 4LRTB 4JN6B 2GZHA 4UUMA 3PL5A 2J1LA 4UCFA 1FQOA 3ANMA 3KKPA 1K7EB 2XADA 2HGSA 3NBYC 4B3CA 3KTAB 1UBCA 4OBWA 1IH8A 3LWDA 3H9JA 3QV1A 2F8TA 1J1IA 1VL1A 1M6VB 4QZVA 1A5SB 1KORA 3DOIA 4H0NA 5EYPA 5C4MA 4QARA 1GQQA 3BPSA 3LZCA 4EEKA 1FFBA 3AM1A 1Q7TA 4JBIA 1Z0SA 2FCAA 2IYPA 3DBLB 2JKVA 3UC5A 3W04A 1IHDA 2ZR0A 4UBJA 1P44A 3N2ZB 2GZ1A 2JZOA 2W2XA 1THMA 1P2DA 3OM1A 3GFPA 4MGYR 3RG2A 3N8IA 3F5QA 2W6ZA 3DEKA 1DJNA 4M1WA 3NEYA 3V7NA 1U8AA 3T1HB 2Q5IA 2IH5A 4D8XA 1GSIA 3BGDA 1T2UA 2PS9A 1UDWA 4R9UC 4BQFA 5CUQA 3KU1A 2GCEA 4MOWA 4YQYA 1J2YA 5J2UF 1RPZA 2HDHA 1N6OA 4K6MA 3T3DA 4BTEA 5K6TA 1N3IA 1OFUA 1DFHA 2Z5FA 3DFIA 1BCSB 5JSYA 4C3ZA 4AF6A 2XNSA 3FAKA 4OB7A 4TS3A 5LP6F 1DWPA 1BHQ1 2NSJA 4LJKA 1IM5A 2WNSA 4DSUA 3IAHA 5LMNB 4OK5A 4G5YA 4HVAA 4JL8A 4X1KA 1S7GA 2XWSA 3UWKA 4RIFA 4KBGA 1H1TA 4MX8A 3FVWA 4WE3A 1LTHR 5GPBA 5CH3A 4FILA 3TLKA 1YZNA 3C7CB 4U02A 1XNJA 1FVXA 1XVTA 3J80A 4AIIA 3B8HA 2W0SA 4GNRA 5LMCA 3KYCA 5CVUA 5FV7A 3FZQA 1NP3A 3O4IA 2H1FA 3E3OA 4GGMX 3GAZA 4IFEA 1EXDA 1E1NA 1G18A 1MGOA 2V9ZA 4EZBA 3O2QB 4J90A 5G1NA 2C5FA 4QEDA 16PKA 4HEA1 2OM2A 3BN3A 1SH7A 4Q7EA 5D3MB 1QOQB 2QVZX 3I1YA 3FB1A 5JWHA 1C1DA 2ZWIA 4FD2A 3M2TA 1XL0A 2CXSA 3O8CA 3GRUA 4ZHQA 2OQRA 1AK9A 3HLTA 3DMFA 1M6NA 1Q0SA 4DM7A 3WJ2A 4DLSA 3GDFA 1JN0A 1G5FA 4I6EA 3X1MA 4K05A 4L5BA 2M9MA 2B8NA 5IDVA 3IUPA 4UXIA 4P4UA 4OTZA 3ISVA 5BQOA 3BWVA 1UR5A 1M2NA 2FUEA 5L8VA 1NM5A 1M7HA 3FUCA 1E6KA 2NSLA 1HO3A 3DZCA 3TI7A 4CNBA 4DOMA 5BORA 1OFGA 2YZMA 1K89A 1YWGO 4QDTA 4RKFA 3WQHA 4E14A 1QCCA 2ZTLA 3IQWA 1LEHA 4NRDA 3S7ZA 1OTXA 3UF0A 5CCBA 1HYEA 2BFFA 3CZQA 2LV8A 1FYWA 2O2YA 1U8CB 2IE8A 1LTQA 2VJBA 4R7TA 1ZHOA 3JY6A 2IPNA 1D3AA 1VG9B 1QJ4A 4KFCA 3UUFA 2Z6AA 2F17A 2FUCA 4EY5A 2QX8A 2A4MA 5KYYA 1L7QA 1VP3A 2J48A 2QTCA 2Z8YM 2FI1A 4LJYA 1POXA 2AZTA 2XCRB 3M6XA 3A6FA 4QOHA 4FSXA 1E3WA 4HNRA 3WRXC 4BFZA 2BGRA 2ZSUA 4DW8A 5BN5B 8OHMA 3F73A 3U4HA 2W2NA 4RZSA 4FXOA 3NP7A 1UANA 3C1UA 4LJ5A 4A8PA 3OQMA 4FMPA 3ZCRA 2BJVA 5DIFA 4REOA 4ER7A 4OLAA 2QN8A 3BFXA 2J6BA 3UANA 1IWPB 1Z2NX 2C20A 1GNLA 2XB4A 3QNUA 4ANFA 1U9IC 4RUKA 2QUBA 4L8YA 2JCXA 4YPFA 1X70A 4MW7A 4CEHA 2JJ1A 1R0LA 3G8DA 1VXRA 3HC7A 2X0KA 2C8LA 3BOSA 3I39X 1JIVA 1LI5A 3WA7A 2XKJE 3G2PA 1J90A 3K9NA 4MW6A 2XB6A 2FX5A 3V46A 3V8NA 2ESRA 2PXCA 3DZKA 3EXFA 3OCXA 1E66A 1EDDA 1S2IA 8LDHA 5FUYA 5JJKA 2A88A 2M2IA 3LP8A 3LC1O 2RD2A 4IQ4A 2G6BA 3JZAA 2G80A 3LG2A 3A6DA 4FYIA 4KEAA 4P6VF 4KVFA 4TTRA 1PS8A 5ESRA 3TQTA 4EUFA 1ISSA 1TNDA 4WX2B 3RS9A 1PV1A 2FR8A 2JJ2D 4HMQA 4LKOA 4HC4A 1Q50A 3WYNA 4KR3A 2FPWA 3VM6A 4NS4A 2BZ1A 2PN1A 3TD2A 1UF9A 4E1BA 1EP3B 1SD5A 2PGDA 4YIKA 3FJ1A 2JGLA 1OLXB 2VHWA 5J63A 2RGDA 1CB0A 4EA7A 4RMIA 2FN8A 2ZYHA 2IHZA 4LN1A 2F9FA 1CRWG 1KMIY 2UZ1B 2R7KA 2Q41A 3R3VA 1T2NA 4NBWA 4BUZA 5G0SA 4CM1A 5K4HA 3N8KA 4DPMA 2D6FA 1XVLA 4JVNA 1VLQA 1RWBA 1TJ5A 3EZXA 2BM9A 2UZIR 1Z4JA 5GZ1A 1M2FA 1EX1A 4IO1A 2PWYA 5K0BA 4OLBA 1EGAA 1NW3A 4NH4A 5BNTA 2ZFUA 5HR5A 5K8TA 3L8EA 4S24A 1NRWA 3LRPA 4C87A 4Q3EA 2DPLA 5EIBD 2R8PA 4GI7A 4JJKA 1E6WA 3R3WA 1M2VB 2X2FA 3AERB 2BEVB 3D81A 5M04A 4EPRA 3IRVA 4Q05A 3L05A 1E5QA 4CTNA 2FFJA 2NQ2C 5KTMA 1J8YF 2DQZA 4XYBA 1UWKA 3H75A 2KQUA 2RBKA 1D4AA 1RI1A 5BRJA 1T4DA 5K0LA 1KMCA 3HSYA 2HHLA 1YQQA 4JUCA 1RP7A 3KJHA 1NVVR 4G1BA 4YJKA 1WUIS 1F9AA 1HG0A 1NKSA 3U49A 4W5NA 4HQ6A 5HQ3A 1B0PA 4RQUA 2WNHA 3K0AA 3RIMA 4AX4A 2Y68A 3B1YA 1PFWA 3SXJA 1RBQA 1PNRA 1NBAA 1NVKA 3ZOZA 4QJ5A 4PYKA 2AXQA 4TLMB 1QJCA 5CMLA 1E4EA 4E94A 4XW2A 2WJ3A 3VH1A 5EIFA 3KQQA 1M2OB 2BEKA 2XQJA 3N0VA 1PGOA 4EW3A 1A4IA 3BERA 2BY4A 5DZSA 4QXPA 3HO6A 1VMEA 2P6PA 1EG2A 3WSTA 4B47A 5B58C 3FBTA 1WUJS 3RT7A 5K4AA 1W35A 2C95A 3HJRA 4GYYA 2VF7A 4KVAA 3OQIA 5ALIA 5EL0A 5IDWA 3QW2A 2JLVA 3W8RA 2C2KA 3GFFA 3HY4A 4QHTA 1U6IA 4DXAA 3PICA 3OQOA 4Q37A 1BXGB 3FWYA 4Y2PA 3GAAA 4B80A 1VHTA 1IHXA 1A77A 2XH8A 2JGAA 5CJPA 4UDXX 4E4TA 4JFAA 1M8JA 3GGGA 4OFBA 3G9TA 5HMLA 1NASA 2RCNA 4S1NA 3ROGA 1IRXA 1TW2A 1W1UA 3PE6A 1Y1LA 2XGGA 1GGVA 1CJMA 1HKUA 2E7ZA 2IXEA 3F7NA 3HB0A 2J30A 3MB5A 4QXOA 3J7TA 3ETNA 1M2WA 2QNBA 4X62B 3H2KA 1COWA 3GRZA 3MWGA 4Y18A 4GT1A 4RL4A 2OP0A 2XVMA 4QEKA 4MDYA 2BISA 2GEFA 1YRAA 5IN5A 4DBZA 1E5XA 1QVAA 3ZHYA 2FP3A 3LECA 3IVCA 3C3DA 3OTQA 2YJZA 2IZZA 4G9EA 4LQCA 1RQ7A 3H2BA 4L8FA 4TN1A 4G4GA 4DLPA 821PA 1SG0A 2H4JA 3TVDA 1JHPA 4N5NA 1UXHA 4NESA 4CMEA 4BZZA 5B4VA 3SR0A 1GZSA 2H9AA 1J7JA 3CZ5A 4ZV4A 1C0EA 2AKEA 3SJZA 2QVYX 1L4HA 5DTQA 3G7UA 3MS2A 3MT9A 4GKAA 3HHEA 1NR7A 3OY2A 2JHGA 3IT3A 4LBVA 3T5GA 1ZP6A 3CUWA 3H3FA 1T2EA 5FNVA 2CVOA 3I37X 4G0WA 4TMTA 1YZ3A 1RTKA 3D31A 2AFIA 2W6QA 1NBIA 4DB2A 4HX9A 1VKJA 2YVQA 1MABB 1JFFB 3F9IA 3KQWA 4M6WB 3ABOB 2PJRA 5JNWA 1UC5B 4AP9A 2QLLA 2JGDA 4CR7A 5B6PA 1DAEA 5DHQA 4LF8B 4KO2S 4LXUA 1HC7A 3GY0A 1PBTA 2KHZA 1AQIA 1WZIA 1XZIA 3T7KA 5A04A 2PQ2A 2HJVA 1PV4A 3A7DA 1J5EB 3GLIB 2V6FA 1FUUA 4I50F 2E2WA 3H4IA 4YAEA 1OWPA 1TYEB 2IV2X 2RAPA 3LYAA 5CH8A 5KNBA 2FSSA 3QE3A 1HDZA 4OD0A 3P0JA 5J4LA 1QFZA 5H02A 1Q0PA 1HRDA 4FDMA 5ESDA 4AAYA 1KP3A 3WIDA 3MUNA 5IFLA 1U0NA 1AKNA 3GN2A 2J9YB 5EXXA 1CRQA 3OA0A 5AUQA 4JLPA 5JZVA 5I7FA 2IUEA 3I2GA 1EVKA 2IIVA 2R7LA 3I9OA 3K3PA 5BQPA 2Q29A 3GJ7A 5KJEA 3AVYA 1OKKA 5GAJA 1O97D 3R5TA 1BYUA 1KI7A 1NFQA 2MSNA 4LYGA 3SYLA 5IM4F 1YUMA 2D7CA 2GN9A 5I9SA 1N9GB 2X0EA 4DAOA 1TFRA 3KPWA 1L7DA 1MAUA 1XMSA 3DV0A 4WECA 1Q5PA 1E9EA 1YMVA 3P7MA 1A98A 1DKQA 5ALDA 2PWAA 1E7YA 5BSTA 2JCYA 4NMMA 3FZYA 1D7OA 3V4OA 2HY7A 3WDMA 3SS8A 4KUEA 2DERA 3S2YA 1GCOA 1JDJA 4R2KA 4HVLA 1LVGA 3EVGA 3LF1A 2FFBA 3DF9A 3P2KA 3LU1A 3C5VA 3P19A 1H5NA 4HEA6 1RI3A 1BSVA 1QIGA 4EZEA 1D5WA 3CRMA 4QPDA 1GPBA 2X7JA 4O2AF 1OB5A 3PC4A 1EUDB 3M6UA 4O5OA 3SQMA 2NYAA 5FI1B 1NW9B 5K3FB 4C4PA 1CEEA 2UZ4A 3MFYA 2VEDA 3HJNA 1WDLA 2C88A 1VL0A 4EHJA 4V0MA 3O8OB 3R40A 2PBLA 2VZLA 1ZL2A 2H7CA 2P2LA 2YW9A 3CUYA 2PSHA 3G9UA 3JATA 4MB2A 5A7HA 4DR1B 1JDVA 2DFKB 2GYVA 4M76B 4OOFA 3BE5A 5I6DA 1LPMA 3ER6A 2VSQA 2TECE 4WASA 4DCPA 3L0YA 4DQVA 4OEHA 3TZQA 4FI3C 4BMVA 1P1CA 4GM4A 3VVLA 1GPLA 1LW6E 1RJGA 3GJRA 3ZY3A 4ADSG 1DBVO 4QDKA 2G88A 4KCGA 1QYVA 1NJ1A 4MIYA 2XECA 1RCUA 5IBPA 2X0FA 3HCEA 3KSZO 4A2PA 1MB3A 3EQZA 3EZLA 3HYNA 3PA8A 3AM5A 1XN4A 5CA1F 3OICA 3WWCA 3ZVKA 2VLBA 1C7JA 1W59A 2FAXA 2OHJA 2Q4EA 2X1VA 1SQ5A 3GFOA 3M9XA 4CV2A 3TW4A 1H2HA 4PZYA 3AO0B 5AOCA 1GPUA 4EMSA 1KDRA 5HUQA 4GMGA 4MINA 1O6BA 4D4MA 4UZEA 4G8BA 1QAOA 4RXUA 2R7NA 4ZVQA 3AGPA 3C1AA 1IATA 2WF6A 4HUJA 2E5WA 3OOEA 2WT8A 3DEHA 1W0CA 4HDKA 2VJLA 4K5QA 2B98A 2O52A 5ER9A 4UZSA 5GIOE 5ARBA 4TMKA 2YKGA 1RWPA 5ADWA 1NUSA 2Y1OA 4CM3A 1QUEA 1XEWX 2AYXA 2UUAB 2YVKA 2FZ4A 2W0MA 3CNOA 1VI5A 1T4GA 4QM6A 3N75A 4LOJA 1XZKA 1ZO8A 4FN4A 4NJEB 4F8YA 4TSFA 3VNUA 4GXTA 4I1SA 1P4GA 4IDGA 2IZ6A 4XFDA 4DA4A 3D54D 3CN9A 5HBGA 4B81A 1G38A 1JQKA 1M7GA 3HPRA 3ZWWA 5BSKA 1ISGA 2PGNA 3ZK7A 4WCFC 1TZKA 1UPFA 3LTEA 4V0SA 4AZ0A 5C5CA 1NG9A 1Z16A 5HBRA 3LAWA 4UMEA 1LFAA 1CY1A 1R5JA 4UHEA 5D6NA 2NUPB 3IDQA 3O7WA 3V4FA 1QLWA 2O14A 1C30B 4X64B 2J0QA 1H42A 4PRLA 5CD1A 4LJ7A 1VCMA 4ZZ2A 1N0WA 2J6IA 5ITSA 1WWKA 3UJ7A 1E1YA 4AG6A 3V2UA 4ZA2A 4H1VA 3AEYA 3CPSA 4L6AA 4JP5A 2OK7A 2I87A 1X94A 3L7IA 3MRSA 1UEIA 3N28A 3Q3GE 1XQ6A 4JVOA 4BNYA 4YCCA 1ATZA 1T5OA 2QBYA 3P9KA 4I5EA 5DCYA 3O8OA 3OZUA 4I0WB 4C76A 3MD9A 3INTA 2A92A 3HADA 2HV8A 3GUVA 5HOQA 1IXKA 1VA5A 1XEFA 2VNHA 4I9GA 4OQXA 3CH6A 3TFWA 1QS0B 4Q02A 1BS1A 5KX5F 5LP6A 4FM9A 4AS2A 4LZZA 1KDTA 3JAKB 4KLNA 2XXAB 1D6NA 1EFPB 2RIRA 4UEWA 2ZU0C 2XCIA 1N57A 2PT9A 2C78A 4JB2A 5LUBA 4NHEA 3FBWA 3SQXA 2R8RA 1UPTA 3C7AA 1PRYA 3DQPA 3WL4A 4EPXA 2GD6A 3QVTA 5DFAA 4UNPA 2EW8A 4ARZA 1O6ZA 3RVDA 1MX3A 3OUUA 3UT5B 5I4CA 4W6ZA 1U8ZA 1B0ZA 4QTUB 2G5TA 3PNKA 1SO8A 1XV5A 1Y3BE 3S2UA 3K2EA 1XFDA 3BQNB 1HYHA 4FHGA 3FNHA 1LVHA 4UMVA 2C2OA 4P8RA 1AUVA 3W7VA 3U62A 4RTLA 3DLIA 4MKHA 1Y7PA 4MAFA 2BF4A 1G7SA 4IFIA 1XD8A 3UT5A 5JAUA 3HFSA 1TXGA 4KIFA 1DBSA 1RWVA 3EUWA 1X7XB 4QXQA 1ODLA 4KPUB 4UVHA 3CLHA 4EO7A 4ARIA 1ZBQA 4FFNA 2DQ4A 4QKQA 2LP4Y 2ZIGA 3UWOA 2J7PD 2R8YA 2QU7A 4HDNB 4KACA 5JRJA 1W36D 1PNVA 1PR1A 4MV8A 3R7DA 3EN0A 4CIYA 2J09A 4X60A 4LC9A 3K1ZA 4ZKEA 1NBWB 4DMUB 2ZWVA 2QIPA 5B6IA 4YHHB 1XTJA 2ZT5A 2JRLA 2XZDA 3OF5A 3FF4A 1SZDA 4FYJA 4RXMA 1LD3A 2NN3C 2Z04A 3FTEA 4TMZA 2VNAA 1Q0RA 1Q1ZA 1K7XB 1P9LA 3CPEA 3D8NA 4M54A 4UW9A 1DJOA 3HE3A 2Y1EA 4DUGD 2IX9A 1ZJWA 1W4BA 4CFYA 3GJ0A 3I01M 4HT3B 3A9WA 4DLUA 2I54A 1GPDG 1MW9X 3I52A 4CZ2A 1FRVA 2DJ5A 1RP1A 2OL4A 1PJSA 3NAQA 4LEIA 4OYRA 4WRRA 2X86A 3CKMA 5BMVB 4FBGA 1KO5A 2O7SA 3R7WB 2FZ5A 1W46A 3LI2A 3WMWA 2I2FA 1JKMA 2OHXA 4L0MA 3GD5A 2WAMA 4XWYA 2R1TB 1J0CA 4B7AA 1NM5C 4JLSA 1AV7A 2VZ0A 4BEVA 1X9GA 1AQLA 1ZW1A 4POOA 3E18A 2VJAA 1JHUA 1I80A 3I09A 4BVHA 2XR1A 2W2PA 2RONA 3UJDA 4HGRA 2O8DB 3AL3A 4CTOA 3W6OA 1P77A 4B4VA 4IFBA 1JFRA 1CZHA 4V39A 4DLLA 2YXLA 4TKZA 5KNBH 2DETA 3ZDCA 2BGWA 4NZOA 3WHIA 4WFIA 4CMJA 3OY7A 4Y2HA 2Q3CA 2OBYA 1Y1SA 2F3QA 2XKBA 5HE8A 1L5KA 5BXQC 4MVJE 1YC2A 2HHAA 4FEYA 2WB2A 4HXYA 5AM5A 3ILHA 3QVLA 1BU8A 2HLHA 3UXYA 4M7OA 2ZRKA 2RIPA 3VHLB 4X7MA 2QQ0A 3O4VA 4FK8A 1OC2A 4XWWA 2R79A 5AK4A 1KDZA 2BTQA 4A6EA 3IAM6 5ALUA 1U9CA 5LQUA 3U4MA 1KYZA 4WN9B 1YB7A 3RHSA 3B9BA 3M6AA 1F8GA 5KKNB 1ENYA 2MINB 4IIHA 4PHHA 1N5LA 3DG9A 1BDMA 4WHMA 3S0JA 3VTKA 5JEDA 2QDKA 4MPTA 3C5WP 2P4HX 2QNIA 5H0IA 2HT6A 4MLZA 5K0ZA 1Q1BA 2Y1LA 2EQAA 1UJBA 3GGPA 3JQAB 4U6NA 2HB6A 5C18A 1UKBA 1WUTA 4MS1B 2J5QA 3GJ6A 1MGPA 1FSFA 4HI0E 4TPKA 2FF5A 2YJGA 3GA5A 4YP9A 3OM9A 4LKRA 4C6TB 3PF9A 3U5TA 3MUFA 4RF4A 1ZUNB 1OBVA 4NTZA 1TEVA 1V1RA 4ONEA 3W5IA 4Q3CA 1CUCA 3UAXA 4D02A 4Y6OA 3R0XA 3EA4A 3I4LA 1JKJB 3N07A 1J56A 4GU5A 3KUDA 4JROA 4CNQA 3LTNC 2BTOA 1BCRB 5G41A 1W19A 2QXYA 3PTLA 1Z5VA 2VC2B 4RX1A 2R6DA 3WO1A 3ZE1B 4RTSA 3ISJA 3P9CA 2NZWA 2LDXA 1L5HA 1DKPA 3W4IA 3F6BX 2C5HA 4XVHA 1WU8A 3UYLA 1NA5A 1OU4A 1PAUA 2CC2A 2YBDA 4QWMA 3PFKA 5GV8A 2IH4A 1U2DA 2A9JA 3ETHA 4FE7A 4WOPA 1O6GA 3OJXA 2V74B 1YV9A 3L18A 5LCXA 3RYHB 4NBSA 1JV2B 3LZ6A 1XVVA 4BQPA 1X92A 2CVHA 1WDWB 4R71A 2BBTA 3E8XA 4PINA 1I4WA 2WZCA 3K6KA 1CJVC 2ZYWX 3TEFA 3T94A 4ILKA 5F7OA 4DHWA 3UHOA 3FVTA 1WEHA 3NHFA 1BWQA 1X9IA 1XCBA 2GF9A 3CLUC 3KS9A 4NEHB 3RGGA 5FWYA 4ZOLF 2Z0MA 1RABA 3LPCA 3HO8A 1ZVMA 4N7MA 1Q22A 4V0NA 5C1BA 2HL6A 3EC7A 2PVSA 4KHPB 4WEQA 3ZU6A 1D0IA 4JEMA 3UJ9A 3A32A 3WLSA 1QANA 4C14A 3OEEA 3UT6A 4QJ3A 4RY0A 5DT9A 3PEWA 3C1TA 2IYVA 7ABPA 4NABA 3PEEA 2ZTHA 1Y34E 1C1XB 2EL7A 4M7PA 4MO9A 1F3LA 1GYQA 4E21A 1KI1A 4RTNA 3ETEA 3ITEA 1L9KA 3VZBA 4TXMA 2ZI9A 1XZMA 2IL1A 1U0TA 1YCGA 3KKEA 1GQSA 2I2DA 3MT7A 4ZT5A 2IUUA 1MO2A 3WMEA 1JSZA 3R9KA 2YL2A 1KJYA 1UZMA 3HDYA 3TUZC 3LVRE 3OZFA 3PC8A 1BMFD 2BUAA 2V5AA 4G84A 1SOWA 4DSNA 5JHGB 4M83A 3T1VA 2V7BA 3AF6A 4YR7A 2AOVA 4N18A 3P0IA 2ZDHA 2AC4A 2L69A 4HFMA 1FNSA 1R4ZA 3RANA 3VTAA 1Q17A 2IW1A 2IYQA 3SE7A 3SX4A 3BCSA 4GC9A 3MCZA 4UMFA 4C0SA 3SPXA 1XPOA 3G68A 3I3SR 3O38A 3UFXB 5GJBA 3E8MA 1XHFA 2CMHA 2XOXA 3AUKA 3LRTA 4FGLA 4C88A 1QGUB 2JFNA 2Y92A 3GRAA 2DECA 4NS1A 3ELUA 3L1IA 3AB7A 2XJ9A 1Z33A 2REQA 3LLSA 3P0RA 1ZONA 3DCNA 5AWFC 3FYHA 3X1XA 5JD5A 2NO9A 1EVIA 1NRIA 5TT1A 5AXAA 4KGXA 2ONJA 3EEYA 1SVWA 1ZRSA 3NEAA 4K3VA 2FUKA 4UFNA 5HILA 4AC9A 2O8FA 2P9TA 4MLPA 4AUNA 3F7MA 3LWBA 1A8UA 2CFOA 3JAWB 3HYSA 1RM3A 3EGEA 3VGPA 5I7UA 1Z38A 1EWRA 4UNRA 1BMDA 4HNUA 2PUJA 4L3WA 4N40A 2QTMA 1Z5ZA 3K32A 2NV2B 4H6VA 2QAGC 5K2OA 1DEXA 5J5CA 2PZLA 2FRDC 3DHNA 1O7JA 3ASYA 2Q7OE 4AMGA 3ED5A 1SG6A 3U5ZB 1QK5A 1UBGA 2Q0QA 3D7NA 4CUZA 4QVGA 1VKHA 3HNPA 3SWWA 2HSEA 3JD3A 1ZL0A 1IY1A 2ZBRA 3B3QA 5D5PA 5CHYA 2FETA 1PN3A 1PS9A 5FHRA 4C22A 4Z4HA 2Z2ZA 4X00A 1T8YA 3NHWA 4NV0A 5C5IA 1BZYA 2I7DA 2NO4A 4IIUA 1YR1A 5BYKA 4GLLA 3PGA1 1QGED 2R96A 5CB8A 3R0QA 1CVIA 2DWCA 3DOOA 1BXRB 2EWWA 3W9UA 1K6JA 3FDZB 1GL7A 4PHTA 4J94A 3ZQUA 5IVPA 2YH2A 2ZYRA 2HNKA 1LDBA 4N0QA 1Z74A 4A0SA 1HDYA 1JDZA 1FDUA 1QMGA 1CETA 2CWDA 1T3GA 4YRJA 5BWMA 1DXYA 4Q9HA 4D9NA 3A8TA 2I1QA 4MGZR 1VMDA 3AG6A 4JEUA 4JT8A 4CUJA 2P1RA 4RHEA 5K8CA 2WHEA 4CM7A 3VJMA 4M1OA 4A0GA 3GLFA 2IWRA 4RHFA 5HP4A 1MKYA 2N1MA 3PNVA 2FSHA 2C4KA 4O2BF 3U1BA 4LXIA 2GT1A 3DO8A 4GR9A 1LX7A 2P8JA 1YRBA 3H99A 1D2CA 1AM4D 3G2JA 4DS3A 4DDTA 4X1KB 4EATA 3NBZC 3AJ9A 1B00A 1QZZA 4Z7OB 4DCOA 1I6MA 4V24A 4S1WA 1CB7A 1YASA 1DIAA 4RE5A 1K0FA 4YALA 5A7GA 2HA5A 3WWZA 2ZYIA 5CHEA 5A3SA 4B79A 4C4AA 1I32A 2B78A 3TXXA 3BSSA 3CZ4A 3MPUA 4KI0A 2ANCA 1B43A 3ZR4B 1W93A 3NETA 3ZWPA 5ADHA 5CVCA 1U1EA 2QPLA 2GYYA 5HEKA 3IVMA 4ZN6A 1P81A 1H8HD 3LUJA 4FIDA 2CJFA 3IMCA 4XWAA 2CYAA 3ZYCA 4ZAVA 4EGSA 2QMHA 4CMIB 2QX7A 1YFLA 4Z9YA 3TNJA 3HFRA 2CEAA 2OQIA 4N47A 3K0KA 1TC1A 1G2OA 3BWBA 2RGEA 3K2BA 2QTGA 3AI7A 4QUKA 5B1YA 1VSVA 4JI5B 1VSUA 4EFNA 4FZ3A 4CDGA 1UAGA 2J5RA 1F0YA 2V45A 1UK6A 1Y8RB 3HMKA 4O4HA 5J4KA 4B2YA 7MDHA 2HPHA 1PR9A 3CB4A 5KTRA 2FJPA 3E7FA 3HNOA 3PP8A 3VHRA 1KQOA 3TLZA 5GM2A 1CEYA 5EXEA 4WOBA 3KELA 1X39A 3A4TA 3VNAA 1PGNA 1Y7LA 2ADFA 1Q6ZA 3EIUA 3GZNA 4M87A 4N3GA 3DMDA 1E2QA 4LYFA 2QW1A 3D4PA 4L22A 5DCWA 4G1UC 3PUVA 2ZAGA 5BQ3A 2FZCA 2K5UA 1H9AA 4C0XA 5IYZA 1UM8A 1AQNA 4GW3A 3DMPA 4C4OA 1T3LA 1AQYA 3IQDB 2Y1GA 3NHPA 4AKHA 5JY6A 3P9NA 1CZUA 1TIBA 2FW8A 4XEUA 3EG9A 4WQMA 1DC7A 1ADYA 3D6VA 4LGCA 1F1BA 1K5GA 3D6FA 3NZEA 4NK4A 3S1AB 2PSEA 4RVSA 1C8VB 3DW1X 1JFSA 3PITA 3AYXB 1PJ8A 1GDDA 1YJ5A 2YOFA 2C5LA 4Q6WA 4GZ5A 5I5GA 2A5JA 1LC0A 1CZRA 1QBGA 1T35A 3MYRA 5IC6A 2N9UA 4YX9A 1J99A 3KT8A 4IIJB 4E5KA 1RR6A 2GD2A 2HJSA 2P4UA 4G4SO 5TMBA 2DC1A 1NVGA 1UC9A 4DN6A 4XLLA 2V6BA 1SAYA 2AG8A 3JQEA 4XIYA 2R68A 4DG8A 2HUNA 4R0MA 1N8SA 4ZJUA 5HXAA 1SOMA 1NZJA 1MV8A 2HCBA 4BVJA 5J23A 2EGUA 1XMXA 2HHHB 3WIEA 2O06A 3TUJC 3UHAA 4CLRB 3QVWA 4R7GA 1WSAA 2AN9A 5ALTA 1XA3A 3OU2A 4MW4A 3RIEA 3HL0A 5KVCA 4PQRA 3JZDA 3LBNA 3QI7A 3ZPXA 3VNBA 1UMDA 2VNKA 4HGQA 4ND7A 1G21B 3KJNA 4M1SA 4YCAA 4BEJA 2C9YA 2QRZA 2XGSA 4Q4AA 2P4SA 4R3NA 3NHBA 4KPFC 1T4CA 2JIPA 2OFPA 3PWSA 5FI3A 3CR7A 4JQSA 1HNNA 4G3XA 2AW5A 4PAOA 1ZUWA 2C98A 3ETLA 4JHXA 2VSOA 3BMXA 3V8EA 4D80A 2ISQA 3R9XA 4TKUB 5E1MA 3OPNA 3NLLA 4ID9A 3TLJA 1RE1A 4EJSA 1ZOIA 4YO8A 1AHHA 3DPUA 4F46A 2HR1A 1LS6A 2CLIB 4N0EA 1IUOA 3WMRA 1H1DA 3NHYA 3WWYA 2NYRA 3BDVA 3R6TA 3DULA 2ODQA 3GYGA 2OO5A 1G0NA 4YMUA 5CITA 2GMWA 1MAVA 4PX3A 1Z0KA 5L53A 2E1RA 4PRKA 4BWVA 4RA9A 4GVPA 1ADGA 1ZMBA 2A7XA 4GM0A 3FGZA 6GPBA 1PT6A 1B1AA 2ENWA 9ATCA 1NW7A 1CP3A 3SHQA 5B1IA 2CYCA 4B0OA 4XQ0A 1TKAA 1Z68A 1DAOA 5LP6C 2AI2A 2LVBA 4H4EA 4LS3A 1G8FA 3GNLA 3U60B 2JW5A 4BFTA 2IA5A 1V48A 2MSWA 1IM2A 3N2YA