2VPQA

Crystal structure of biotin carboxylase from s. aureus complexed with amppnp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
447
structure length
447
Chain Sequence
KKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLNIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKAEMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGFRMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEEAPSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVTEMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLAPGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIPFHIKLLNNDIFRSGKFNTNFLEQNSIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Evidence for Substrate-Induced Synergism and Half-Sites Reactivity in Biotin Carboxylase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords ACETYL-COA CARBOXYLASE
total genus 146
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature ec 6.3.4.14: Biotin carboxylase.
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain
A PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain
A PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2vpqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2vpqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vpqA01
4MA5A 5D8DA 4YAKB 4EA9A 3N8DA 1C30A 1B6SA 2YZNA 4O4JF 3RUPA 1EYZA 1GLVA 2W71A 5C1PA 3R23A 4MV4A 2DZDA 4WD3A 4FU0A 1M6VA 2R82A 3I12A 3WO1A 1GSAA 5KKNB 2R86A 4O4LF 2R7LA 4MA0A 2DWCA 4O7ZA 4FE2A 4IIJF 1EZ1A 3KALA 4YBZB 1Z2OX 1WR2A 4M99A 3BSSA 2V59A 2Z04A 1UC8A 4MV8A 4O7SA 3U54A 4C5BA 3E5NA 2ZDHA 1E4EA 5LYJF 1A48A 2FPIB 3VPDA 1JKJB 5JH7F 1T36A 1AUXA 4O7LA 2GPWA 3HO8A 4FFNA 1KC7A 4M9UA 2FB9A 3ORQA 4MV3A 5HBRB 3HB9A 2YZLA 2C00A 3LWBA 2R7NA 2YS7A 3N6RA 5J2UF 5GONF 2YZMA 2R87A 1CQIB 4C5CA 2CNUA 4EA8A 4EGQA 4HNVA 1Z2PX 4YB8B 4FGRA 5LOVF 2W6QA 3AW8A 4MV7A 3R5XA 2VQDA 2YYAA 3VA7A 5J2TF 3UFXB 2R6FA 1ULZA 1JDEA 3MWDA 2YL2A 1KJQA 4Y8VB 4ME6A 5C8YF 5LXTF 4O81A 2FPPB 3OUUA 1BXRA 5BPFA 5CA1F 2GQSA 3ETHA 4C5AA 1VKZA 3BG5A 4I50F 3RV3A 4WBNF 3WO0A 4M9CA 3VPBA 4EAAA 3QFFA 2YW2A 4DIMA 1JLLB 5JVLA 1AUVA 4ZI7F 2CNVA 4O2BF 4DLKA 3AX6A 3K5IA 3U9SA 4MV1A 3MJFA 4IWYA 3G8CA 1BNCA 3VOTA 5BPHA 3ETJA 1KBLA 3BSWA 4FFLA 2W6ZA 1UC9A 1DV2A 3JZIA 1OBDA 2NPOA 2CQYA 4NYEA 3DF7A 3SE7A 2YS6A 4YJ2F 4O7TA 3JZFA 4XYLB 2FP4B 4QSHA 4EG0A 4O7WA 1A9XA 1Z2NX 3TIIA 2W6OA 4HR7A 2R85A 2YRXA 4O4HF 1VBGA 3R5HA 4O83A 1SCUB 5KX5F 5FNVF 5DMXA 1PK8A 2HGSA 2R84A 1W93A 1M0TA 4FFMA 2GQRA 1I7LA 4TUYF 3HBLA 3TW6A 2SCUB 3U55A 3V4ZA 3U9TA 5H80A 1VBHA 2XD4A 3R5FA 1GSOA 2ZDQA 2VR1A 5I47A 5CA0F 3NUAA 4L1KA 2V58A 1PX2A 2I8CA 3MWEA 1GSHA 2YRWA 2Z02A 2J9GA 3KAKA 4J6EA 3GLKA 1KJ8A 5LA6F 4YJ3F 4HQ6A 2NU8B 2PVPA 3WNZA 1GGOA 2NU6B 3BFPA 4TV8F 2R7KA 4ZHQF 2PBZA 4MV9A 4FFPA 2WYOA 1OBGA 4EABA 5JVDF 2P0AA 3G8DA 1EHIA 1DIKA 4M98A 4E4TA 1EUDB 5LP6F 2QF7A 4I4TF 4FFOA 4O7VA 4RZQA 3K5HA 2OLSA 1KJ9A 2YZGA 4YAJB 2I87A 4ZOLF 2I80A 5IYZF 3TINA 5JQWA 1IOVA 5BMVF 2V5AA 1KEEA 1M0WA 2VPQA 1B6RA 2NU7B 1CQJB 4IZOA 2W6MA 3TQTA 2DLNA 4GGMX 4O2AF 1W96A 2CZGA 3ORRA 2XCLA 1EUCB 3Q2OA 3VPCA 5HV6A 4I55F 2YWVA 4O86A 5CB4F 4XYMB 1DV1A 4O82A 1I7NA 2R7MA 1CE8A 2PN1A 1IOWA 3Q1KA 5CAEB 3OUZA 4TV9F 3RFCA 2NU9B 1C3OA 3TIGA 2CNQA 4XZ3B 4XX0B 3JRWA 2W70A 3KREA 3V4SA 1CS0A 4MV6A 1JDBB 1KUTA 4IWXA 4EGJA 1KJIA 5C1OA 2GLTA 2VHEA 3GIDA 2DIKA 3VMMA 4IHJF 5JQGF 5K2MA 4ZQIA 2IP4A 2W6PA 4MAMA 3BSYA 2X0SA 4EA7A 2HJWA 2W6NA 4HNUA 3KAJA 4FFRA 4HNTA 2GPSA 5EZYF 3JRXA 1KJJA 4O4IF 2ZDGA 1E4EB 3RV4A 3K3PA 2FPGB 3R9RA 4O7RA 2NUAB 3LP8A 4O84A 4O7YA 2QK4A 4O7NA
chains in the Genus database with same CATH superfamily
1MENA 2MJLA 4N01A 4IO0A 2XX3A 2C58A 5DO9A 5D00A 4UOEA 3VYVA 4F93B 1YRLA 3WJ1A 2AYXA 3TYXA 5CCXA 3ZI4A 4X92A 2I2WA 1ZRSA 4P5PA 1EINA 5DGAA 3G9ZA 4TL6A 1Z0IA 1RW4A 4G9GA 4WESA 1YS4A 4DV0H 1ADGA 3D6AA 4DIBA 2XCOA 5LKRA 1VIYA 2R5NA 2X4IA 5BVHA 3ICWA 3FNBA 1B23P 1DQSA 1KIAA 4MV4A 1PT9A 2A0WA 1N5JA 4LQDA 3WGQA 4AZ3A 5JLAA 2Z6VA 2A30A 1XTQA 2BMVA 1ZHQA 1E96A 4JUCA 1JDTA 4BKRA 1H4TA 3FUWA 1ORVA 4PZ8A 1FC0A 3HWRA 3ZHQA 3AV0B 1S68A 1A77A 4LJ6A 4NFSA 2LTAA 5A3SA 4QHSA 2Y1FA 5FA5A 5I3ZA 4BWVA 1DBQA 2ZSBA 1B0ZA 2YBDA 1RLTA 3DZJA 4PVDA 4WHMA 4MLCA 2GZSA 4ROSA 1GRNA 3VYRB 2R93A 5TMEA 3O9MA 1SUPA 4DLRA 3EBLA 2AN4A 4IWNA 5CU7A 3S2GA 4IIJF 1PAUA 3PHIA 4BNDA 1E7RA 2Z4SA 3EW7A 1Z13A 2SBTA 3FPLA 3HJRA 4YB8A 5BVHB 6NULA 2XCRB 3WP0A 1RXUA 4Y6LA 1XF1A 4RJ2A 4EY8A 2OBXA 2QTHA 3TQFA 2W42A 4QUEA 3JQ7A 4R98A 1E1YA 1JKIA 1N6NA 3JQBC 3CKMA 3LL7A 4EJSC 3GLHA 4AZWA 1G41A 3BRWA 3DV0A 3LUFA 4C5BA 2ZUVA 1PRYA 2QQ0A 3OPQA 1Y8ZA 2W00A 2GK7A 3OESA 4AURA 3LDUA 1DHRA 1J22A 1RAGA 1YTLA 2C9DA 2XKAA 3TVYA 4J2HA 1YI8A 2W2MA 3U9LA 1YL7A 1PD1A 4DV6H 2BKXA 4MP6A 3IEXA 3VYWA 1SOWA 1ZAKA 3Q8WA 2UZ0A 2WTAA 4Y3UA 1SBNE 1JL3A 3LDFA 3A9TA 2Q6OA 1UK7A 1UZAA 2XYGA 3GH3A 3TZ6A 3PR1A 4LGYA 1SCJA 1O5OA 3C3AA 5K3DA 2RAVA 3AUTA 1YQGA 4BRUA 2BMWA 3PCXA 3UMSA 5EE1A 4MV5A 3UWPA 1I14A 2CJYA 2PRYA 4KODA 1XHEA 2WUWE 3I9MA 3GD7A 4J3NA 3UHOA 3PW2A 2HC9A 1U2DA 3HEMA 3PU6A 3QUQA 4FQ5A 5IJXA 1OMOA 2QU8A 3LZDA 2ID7A 2IYLD 2DULA 4I4CA 1QK5A 4L75A 1ZGJA 1W88A 2FSPA 2ZUDA 3BXFA 1EFRD 2XYQA 4M1WA 3I64A 3M9XA 3VR6D 4U8GA 1P29A 3QQPA 1H1DA 4UBJA 1QO0A 1Z34A 2OC4A 4ACAA 2FW7A 2JLBA 4JI8H 2FPWA 5CBKA 1RE0A 2QU7A 3QGMA 1S1MA 2PV0A 3BN3A 5FTKA 1IU9A 4U1RA 5KI6A 3ZUPA 1KSFX 4HX9A 4JCOA 1IQPA 1D0SA 3ZJTA 4F9TA 2HA0A 4CIYA 3CLSC 3LG2A 3V9AA 1EQ2A 4CL3A 2DPIA 2RB4A 4DRXA 1DADA 3W5SA 2E3JA 3SHQA 4CODB 4GDMA 3IAFA 3CSDA 3CX8A 5F52A 1R8XA 3U1TA 3GJ3A 4TOIA 1SOUA 3QNUA 1L6IA 2A0XA 1V8PA 3ABIA 3P5BA 1RWWA 4QYSA 1WB4A 1AQIA 13PKA 4TL7A 3LL4A 3ZHVA 1IBLH 3ZCPA 3FB1A 3OTHA 1XNQH 1C4WA 4CNQA 3TWOA 1U0NA 2YOFA 3UAVA 3F73A 3U31A 1XDZA 4PRZA 3I1IA 1DNPA 5JZBA 4FLFA 2OGZA 1A7AA 3EWNA 4JXUA 4S2UA 3UFXB 3IA7A 4ZRDA 4PHTA 4RO0A 3FGNA 3GUYA 4ENWA 2OHGA 4I4IA 1TUGA 3M5PA 1RI1A 3B3FA 7REQA 1G64A 1TJ4A 3WB1A 1Z4QA 2PY6A 2ZRPA 3IT1A 3JU3A 2GZRA 1N1MA 3LTNC 5K8CA 1WBJB 1KDVA 4ECUA 4EKIA 1KZ4A 2WJPA 3J81k 1JHPA 5DN6D 3DPSA 3MFIA 1C1HA 1J1ZA 2OO5C 1ZSYA 1I8TA 4W7HA 2W2VA 2WICA 2GQSA 3CV3A 1RLJA 3MUNA 3L8GA 3O4FA 2YCBA 1JHQA 1KY3A 2IYQA 3HOYG 4RH1A 1SK9A 3VR6H 4E31A 3B36A 4EBCA 1ZCBA 4RH0A 4UDNA 3RD5A 1G42A 5HKLA 3KYHC 2ONCA 1Z33A 1E6UA 1VYVA 2YJTD 1E2IA 2WB1A 4LYGA 3NTUA 3UFXA 1CUUA 3WXMA 5I4BA 3QVGB 1Q7CA 1ECLA 5DYGA 1P2DA 4BY7G 1U7HA 1HE5A 2FRDA 4TQSA 2IPLA 3PX2A 1E92A 3RG2A 1R6VA 3CEPB 4C87A 4OQNA 3ERCA 4MYUA 3V3TA 3FGPA 1KMIY 4ZVMA 1CUDA 2XCAA 2IYXA 4DLKA 4GYJA 2C2HA 3K5IA 3L0YA 2OESA 3PITA 1JHDA 2VJPA 1UDAA 3IHKA 4OEHA 5KNBA 5IAAA 3KT0A 3QTBA 4EF6A 3DFUA 3EPGA 1JHUA 3LOPA 3M1IA 4YMLA 5AJXA 3ZV3A 3PJRA 3BAFA 3A9RA 3HYRA 4R7RA 1ZW6A 4WPGA 3DBLA 5LZ8A 1UKZA 5F1KA 1CJBA 4LOHA 3BA8A 3QBJA 4I6EA 3ROEA 1GM5A 1R8SA 4CIXA 3SF8A 2FQWA 1K3FA 1Z4LA 3OZFA 3NVKI 3BF8A 3PLRA 2Q7OE 4EUSA 3O94A 1UM8A 2V9PA 1Q44A 3CH5A 3KXDA 3ZDBA 4LY9A 4Z3OA 1VAJA 3IV6A 1EIZA 4Y2XA 3R9XB 3CPEA 3SE7A 3O0TA 4K9KA 4YCSA 5ES4B 1F8XA 2QSUA 3QYPA 2GYWA 3FPEA 3MINB 3THWB 1W35A 2EFYA 3W7VA 1Z63A 4YI3A 1QHXA 2UVQA 2X6RA 5EJ5A 5EXSA 3IUPA 2NZ8A 3IIJA 5F3DA 5BMVA 4FGZA 4OSEA 4IXTA 2X9VA 2QWXA 3P1JA 1KOLA 1VYUA 1JTEA 1XA4A 2V4RA 2Q4EA 2VYCA 3KJXA 4KWCA 4LE1A 2QE6A 3HC7A 4TQ9A 4BX0A 1KEKA 2XXBA 4RZIA 1M0SA 2BFPA 3DBLB 2O5VA 5ED4A 4FEAA 3NXSA 1M0EA 5FNZA 5TV2A 4A15A 4JXZA 5C53B 3EH2A 4MWTA 3PA6A 3REOA 1V5WA 1SUSA 3R5HA 3GLIA 4MTCA 4DSTA 4FGSA 4J43A 3OZSA 3NXKA 3ZBPA 4AMUA 4W1QA 3U3ZA 2BEVB 4YRLA 2O0JA 2G3YA 2IS1A 2PFSA 3BULA 4XSHA 4D0GA 1Y8RB 1DHTA 4U7FA 3L79A 4JLVA 1J97A 1W0KA 2AR0A 4DCNA 1CUJA 3UK0A 4IUYA 3HNRA 2VUIB 4PCLA 5JDIA 3THWA 2PG3A 4BBJA 4TLEA 5IEJA 2QXTA 1I7LA 1NVFA 1QC5B 1UR5A 2QW1A 4LYDA 4M2LA 1U9IC 1TE2A 4MVJI 5DW0A 3RBAA 3GZNA 3ANSA 1V1RB 2SCUB 1TCCA 3MTEA 4KRXA 4X91A 3RUEA 4DARA 4J29A 4E4YA 5J4KA 5JSUA 3OQNA 5GJBA 2QLFA 2G1UA 1KY2A 4B85A 3ZHSA 2HF7A 5K8JB 3V4FA 1EXDA 1XCJA 2PSDA 4FYVA 4MGIR 3HJCA 2VR1A 1COZA 3EVEA 1W5BA 1EVYA 4RD6A 2Y0PA 1OREA 2ZSDA 1MC4A 1A2BA 5ILGA 2DABA 3RUIA 1VBNA 4AX4A 4D4GA 3FFTA 1HWYA 2PM8A 3FYUC 5CXSA 3UCEA 4RNDB 3T0FA 4AZ0A 2A35A 2YXDA 3K9FC 1D0IA 3L7YA 3ZY3A 4P3YA 3CLTD 4JJEA 3R9IA 2P91A 3CVWA 1JDNA 3HPRA 3UJHA 4AY5A 4FDUA 1M8JA 2DLDA 2J9GA 2DU8A 2YWJA 3NEJA 3PC3A 3CNEA 4J0QA 3BH6A 5TB5A 4C7MA 2BEJA 4FT2A 4CR7A 5JANA 2H8GA 1JLLA 1UJ5A 2WU8A 2H07A 1X0VA 2HLPA 3PJGA 4OJTA 4N4AA 3GWGA 1PGPA 5EMKA 5B6PA 1MP0A 3CLRD 2CLLB 3H42B 2Q1SA 1CIVA 1I7PA 2ZJ3A 3PW7A 3GIJA 5FBRB 1TKRA 1S0MA 2IYPA 4NG5A 3U7IA 2CYAA 1U1EA 1UK8A 3A1UA 1MN6A 3HN6A 4ZQHA 5EQJB 1WHTB 3DMPA 4CMAA 1XPOA 1HOTA 1ZMBA 2DKOA 3HV0A 3LHDA 3R3HA 1NI5A 2JARA 5FP0A 4MV9A 1FTWA 2OZKA 1AQLA 1I50A 2QT1A 4GVLA 4GNRA 4QNRA 3WADA 1QX4A 3AILA 1QM5A 1YS2X 1YFZA 3FMPB 1MRNA 2XYVA 1J49A 5I5YA 1SQ5A 2QMUA 2UZ1A 4P4UA 3KOMA 5B1YA 3MUOA 7GPBA 1ETHA 2PT6A 4Q3NA 1H5QA 2CVOA 3PDHA 3VV2A 3EXG1 3VC3A 1OKKA 1ZH4A 4JBYA 1AKNA 4QATA 2EKQA 2Z09A 1V43A 2P9ZA 1D03A 4NCJA 3FJ1A 2FEOA 2YHSA 3SG0A 3WL8A 3VYSB 2C57A 4A3DG 4ZJPA 2TMGA 3AI7A 1ZK3A 2HTEA 3BCHA 1C4OA 1NULA 1Z73A 4JL5A 4NOMA 2WZCA 4JQOA 1V5EA 4RD3A 3IAHA 3GFPA 3IAAA 4LIPD 4ER6A 4K28A 3T52A 2YXNA 1XTKA 1GR0A 4UMEA 4Y2SA 5B30A 1POWA 1R9GA 5JATA 1M1NB 2B5OA 2I87A 1XR3A 3C7TA 4TSRA 3M6AA 1TWFA 1UZLA 3NWEA 2XF2A 4R1MA 5AVTA 1BFDA 3UMMA 1OH6A 4C0KA 2PUAA 3HYSA 2P1DA 1KMNA 5D1OB 1I7QB 3GBVA 2FWMX 2GEUA 1V41E 2YWFA 4FNAA 4CM1A 5H4HA 3CQZA 1ODKA 2IIPA 2KLBA 1V8BA 2C9MA 3BXPA 3CX4A 2X6TA 4KMRA 3RSCA 1JIKA 3RKSA 2H2HA 1ODIA 1FA9A 1HDCA 2AW3A 4AW9A 5JDCA 3T3HA 4QNMA 2JAHA 1KEEA 1PIWA 3DTVD 4M7RA 3UEOA 4QWWA 4EH1A 4D9CA 4XGQA 2WG1A 4U6QA 4Q05A 5AK4A 1VSBA 5CVTA 6PFKA 4QLAA 1W44A 3IALA 3RSQA 4QIHA 4QJ5A 4LYEA 4UCOA 3AERA 2HN9A 2O1XA 3HCEA 1M1NA 3CEMA 3MTAA 2PX5A 1Z0AA 3OPMA 4ZVLA 3ESQA 2FA9A 3VR6A 4DV5H 1W30A 4JI3H 1SFRA 3O21A 3OQVA 5JD6A 1X7ZB 1EUCB 1ONNA 1O58A 1IBKB 3O4IA 3W2FA 2BFFA 3VFDA 2XB6A 4O2BA 5B3JA 4PZ6A 4WNAB 1DKMA 2VDWB 1EX6A 4QGFA 5DQHA 1KU0A 1BQ4A 4WGGA 3T3NA 4FCCA 3E9RA 1KYTA 5CAEB 3K6SA 5BOVA 2FEWB 1Q1GA 3M6WA 4LS3A 1T29A 3P0RA 4B9EA 2XPCA 3AI2A 4BDSA 4ZI2A 3HVJA 4JYZA 2OCLA 1M10A 3DDNA 2I7DA 1CJCA 4QODA 5CIQA 3UWSA 3V2UA 4CG1A 3QEKA 2PMDA 1Z5NA 1FQWA 5SZIA 1DKNA 4JC5A 4WSOA 5AJTA 5EINA 2XUAA 4OLBA 2FLWA 2MCFA 1BC5A 4RCNA 3DCNA 4W9NA 3GARA 2ZPUA 1OW3B 3A3PA 5A3VA 5IH3A 3HI4A 2CNNA 4V3CA 4TMKA 4V1CI 4HGOA 3JR3A 1DJOA 1W0KD 2ZSJA 1DOHA 4JS0A 3JD0A 4EW3A 4JI8B 2QYSA 1KXZA 3PIDA 3QJYA 2ZANA 4TVBA 1EDEA 3U17A 4XGRA 1LBQA 2FW1A 5DVZA 2N46A 2XA9A 4XUCA 3K35A 3NBKA 4HH4A 1YFKA 4K81B 4UEKA 1V51A 1N33H 1U9JA 3L5KA 3IMKA 2O8NA 5EP4A 1W4CA 1K98A 4ZDKA 2OWOA 2ZSIA 3GIDA 1AS3A 1W7AA 2JZOA 4L0QA 1PQPA 4U2CA 4DC0A 3QQMA 3A7EA 4HRXA 3D7KA 1U2DC 5I48A 3B8HA 2O07A 3QXSA 3T3GA 3LY5A 3GQVA 4FGKA 4KPYA 2Z2IA 1DC4A 1AC5A 1GPBA 1S8NA 2WSIA 4YNBA 4RF4A 1BHSA 4PN7A 2PUBA 3B3QA 3QM1A 1FFXA 5F7JA 1M74A 3VAYA 1SCBA 2B1GA 3D6MA 3DWFA 3DL7A 3KZCA 3SIXA 1NBMA 4DUYB 1CF2O 4FOLA 5HF9A 1VJRA 4DV3B 1Z74A 2EBHX 1SIUA 1B8OA 3M9OB 2Q5CA 3FCEA 4X1KB 1NWCA 5U4XA 4KWEA 4JLAA 4PYQA 1T4DA 1Y8CA 4QT0A 1YE8A 4X3OA 1WDMA 5DTIA 4HNTA 5IZ4A 4OLAA 2I4LA 1A50B 3AI1A 4JJFA 1SXIA 4RORA 3TK1A 4EB6A 4R05A 3M9LA 5CFRA 3ZI7A 5KWIA 4C2UA 4L5AA 3RROA 2DUUA 1QMGA 1SUIA 1F20A 3GPDG 4M60A 1M2NA 3D1LA 4EARA 1ZMTA 1RNLA 2FSHA 1QGYA 5I8ZA 1F1BA 2M6SA 4C4AA 4TXNA 3WWYA 1R10A 1G60A 2WZDA 2I1QA 2ZB3A 3BOSA 3I9FA 3PXCX 4RE6A 2AQ4A 3BDVA 4Z4IA 4K0KB 1KZ7B 1WZCA 5K0NA 4AJ4A 2F55A 5LZ9A 3THYA 4F6LA 2CLDX 1EP3B 3W6ZA 5AI4A 5JXGA 1ULBA 2BHTA 5JRJA 3D3WA 4G5QA 5ALZA 1XDUA 2XOKD 5KJ6A 4OQQA 1XQWA 4PQRA 3WIBA 4N7BA 4C0AC 1A9OA 2X0RA 3QBTA 2UYYA 2E5LH 3MTBA 1E6KA 4WADA 4F45A 2GN4A 3H4DA 4P32A 4E6EA 2WT4A 1PK7A 3E7WA 3NFRA 4GC5A 3QF4A 4CMFA 3IPRA 3H86A 1A4RA 5K03A 3DFMA 1YOBA 3NYRA 1MRZA 5DNWA 5L4NA 1VE1A 5I7AA 2VDMB 1JFSA 5CEEA 2DQYA 1E63A 3A58B 4FU0A 5K8VA 5FI5A 2JLSA 1LBSA 3OCUA 1O97C 2D0DA 2RD2A 2YBEA 1J0AA 4AUEA 5J58A 1L8XA 3NBXX 4Y2UA 4GBJA 4MRRA 4RQAA 3UT5B 2YVQA 2HB6A 2GPAA 2A14A 3MERA 4KLNA 2YYYA 2GKGA 4ND8B 4AUNA 1HQKA 1UBFA 2R8XA 3CNOA 1E9AA 4O4LF 4FEEA 1U3DA 1VJ0A 2I76A 4JI0H 3CZ9A 4LDNA 4Q45A 1X1DA 4NR0A 4TXJA 5IMBA 1RM3A 3URMA 1XDGA 2GVNA 4OHXA 4CMGA 5CIYA 3GLFE 1HNWB 3SN6A 2BKLA 1IHYA 1J1IA 2DBQA 2P2YA 1LSSA 2QRHA 4DR6B 2ZR7A 1XCMA 1NAHA 4J94A 3ROKA 1E1RD 2OKGA 2OXFA 3KALA 4ALIA 1BYUA 1JJFA 1A8SA 2NTVA 5EZ5A 3RGXA 1CCWA 3N0WA 4KXVA 4N03A 3VZSA 2VRCD 4IIUA 2XWSA 1U80A 5BNIA 1IRIA 1SZPA 1LC0A 1XAIA 2BKEA 3C5EA 3PW4A 1E8MA 3IIMA 4F2HA 1NMYA 3KHRA 1F0NA 3ZHYA 3AM5A 4C0QC 5CFQA 2AJ8A 4LFCH 1G55A 4OU5A 4OHOA 2XUOA 4LWOA 3CZPA 3OLXA 4IIGA 4ND8A 3TOCA 4NBLA 3HCAA 4O1HA 5MDHA 1R4ZA 2TMYA 2XIGA 3ZCTA 2CNWA 1B04A 3HDGA 1ZKMA 3MHPA 3FUUA 4OXKA 4US0R 1PS8A 3F4LA 3ZQ6A 3N2GB 3I53A 4RDHA 2ZYVX 2XGMA 4MYRA 2XT0A 1C7EA 1N5IA 2P6UA 3SBXA 5LIPA 2QAGA 1YZUA 4XDHA 4LZPA 4UFOA 2J09A 2PDAA 1CRPA 1XD2A 4KO2S 2WG2A 2GNOA 2C00A 1X9GA 3GG2A 5F5LA 4F9EA 4X62B 1U0LA 2OL4A 4LY3A 1U3VA 2Y93A 3ZD9A 2BSXA 2Q8QA 3PNKA 2R6HA 3WGTA 1KMCA 2ZS8A 1RKXA 3V2GA 1I6LA 5AVKA 5I8PA 1KXJA 2Q2UA 1GHTA 1YOVB 2PH3A 4RCVA 3ZI0A 4EEKA 1N6IA 3MJTA 1H0SA 3RSHA 1CY2A 1BS2A 1ZD3A 3V1YA 3VSAA 5FAKA 4J03A 1AB5A 4BP1A 3P20A 1XQYA 4UDXX 4F4DA 5LMNB 3H8JA 2HJHA 1VA4A 5EUBA 1FU8A 5L95A 1W29A 2XXJA 1ZL2A 3KCQA 2ZUFA 3GAZA 4TQRA 5KFMA 2JHAA 4ZO9A 2BCJQ 5LWQA 2J7KA 3MTGA 4QIWA 1LQUA 3AHGA 2C0QA 4II3A 4G23A 4CF4A 4AWAA 3U5ZB 5CD1A 1AKUA 2EWWA 1CYDA 2P2DA 3AKCA 3GIPA 4E09A 2ZT8A 3RBVA 3LIIA 1QQ5A 3FLEA 3H9CA 3NTRA 4OXYA 5C2JB 4ARIA 1V47A 4M37A 1RYHA 2C5AA 1NBMD 3AHIA 3JVEA 3RYTC 3S1LA 3AY7A 3GUUA 3BSFA 3HJFA 4G0OA 1F8GA 4UZEA 2ZIZA 3BVPA 3PE4A 1MDBA 2JD2A 4NYMR 1T5BA 4W63A 2VP6A 4PXYA 5BWRA 1MFPA 5EWJA 5KPJA 4BGVA 4RVUA 4F3TA 3EF3A 3OA2A 2J9FB 3L4EA 2B2CA 3GIWA 2ZBVA 3I1YA 1WA5A 3WKCA 2I3BA 2GBPA 1K68A 4QBFA 1ZVQA 2ZXUA 4RU9A 3N86A 1FRFS 5LXTF 1GPYA 4FSHA 2VK8A 4IX9A 1RT9A 2UVPB 4N65A 2ZT7A 4QQRA 5FJ8G 1SOVA 4FMDB 5AKXA 2XT6A 3T9BA 5FPPA 2C2YA 2R96A 4Q3KA 3TR5A 3JQ7B 4W5OA 2R66A 3DEYX 3GH1A 4YJHB 5DK4A 1YQ9A 2WUFA 3GLHB 1USKA 3L4BC 3LXMA 5FEMA 3VOAA 2J0QA 4MGKR 3ETHA 3O8BA 4FBGA 3DE1X 3COWA 5BN5A 4YT4A 4LNUA 2Y6VA 1SHJA 5DPMA 3SFZA 4KFRA 2C35B 2R1ZA 4NNOA 1G6HA 2O5EA 3ER9A 4PPGA 3EZ6A 4NAUA 3NRCA 3KTDA 5AKZA 2WABA 1JIXA 3ZIAA 3WOVA 1TEXA 5FDFA 2EX1A 1SC3A 1DCMA 3LP6A 3WV5A 3R8FA 4J1NA 5IMSA 4ZREA 2NO5A 3QFFA 2PD6A 1P18A 3NLLA 2PGOA 3KZNA 3SZUA 3J81W 2V7WA 4N48A 4P7JA 1G7RA 1WS6A 1IM2A 3IHTA 3LX5A 1W94A 1NLUA 4S1OA 5I4IA 1FMLA 2ZE5A 3AX6A 4D4JA 2BTQB 4ZI5A 3JW8A 2X5RA 1MH9A 1SCNE 1VIAA 4RNNA 3HBMA 3R7BA 3UB2A 4BFVA 4BLQA 3VU8A 1XWFA 5FLMG 1DRWA 4LHEA 2XEDA 4C6TB 3ONDA 3GY0A 3NANA 3M6IA 3AB8A 1H65A 1U0HC 1M8KA 2QVGA 3LT2A 5KYUA 3VTAA 3IILA 4ZIRA 4QUKA 3M5DA 5IABA 4I5FA 2GAAA 4M0JA 1H9BA 3DB2A 2JBHA 4M0FA 5JSYA 1DV2A 2XGJA 4UCXA 4FIZA 3DD1A 1QH9A 4CYMA 1NMXA 5DTJA 4NH4A 2CQYA 3F7OA 3ZDEA 4KEAA 3ZS9A 1IBLB 3G17A 1HV8A 2E4ZA 3FDXA 1EWVA 1RWMA 1T2UA 1NM5C 2ABWA 2P35A 2X8JA 5D3MA 4UCWA 5BSHA 1QORA 1R7RA 4G3XA 4CC5A 4FOSA 4NC9A 5LYYA 3WGOA 3JZFA 4ETMA 3BQNB 4AF8A 3GQBB 1M83A 1DO0A 1UMDB 5DT9A 2QMQA 4KKVA 3CLUC 2VH5R 3WYAA 1VI2A 1ZX1A 2ZJ7A 1KDRA 4NENB 2VXYA 3D8BA 1JAHA 3LKBA 3R5JA 4ALMA 4DRXB 5FO1A 2E2IA 2QZPA 3D5TA 4J0EA 2PEYA 3LDHA 3CWCA 1OBFO 3KOXA 3NHBA 3RVNA 4UHKA 4F3NA 2FFAA 5KYUB 1SUAA 2BR4A 2Q2NA 3LVRE 1CQPA 2XSZA 3W8NA 4K9RA 5AW4A 4HWRA 2IEZA 1HX7A 4UREA 2AI3A 2FR0A 4MJ7A 2JFUA 5A4IS 1YRQA 5TVGA 3V80A 2H2FA 1Y1WA 3VNBA 5HZGA 3H1BA 4F4IA 1WHSB 2E6KA 4TPKA 2J5RA 2QRGA 2VWPA 3G5LA 4YGYA 1CUEA 1Z5VA 2H0RA 1TU4A 3HXKA 4KN6A 1TEZA 3TTXA 9LDBA 1LI5A 1ZK0A 1E1MA 3COZA 3JVUA 5ICMA 2C99A 3EQ6A 2PQ0A 1PR1A 1EFKA 4I5EA 4N6NA 3DKRA 1ILEA 2WF7A 1GUFA 1PX0A 3QX9A 4R7TA 3EH1A 4EZBA 1E62A 1EX7A 1NW5A 4Q7MB 2R4TA 3U7QA 2X3UA 1YGPA 3MVEA 4JELA 5LYJA 2FKAA 2HRZA 3FUXA 4G41A 4OI2A 3SXJA 5JJCA 5LLTA 2A1HA 3KXYT 4Q3AA 3NUAA 4R68A 2ZTLA 4BBAA 1GARA 1TT5B 3EVZA 5BVGB 1T6YA 5GWXA 4X66B 3PVZA 1RP1A 3TZKA 5B64A 1TAUA 1PX2A 3PD7A 5ALPA 1T3ZA 2X0DA 2PWZA 4UEOA 4G07A 3GLGA 1E7SA 5BW8A 5TF0A 2W11A 4AL4A 5JYCA 2EFDB 4B4VA 4CQMB 4A2AA 1V5GA 4R1UA 6REQB 4N8DA 1BN7A 5LD2B 1RXCA 4Q3CA 3EQZA 5ALNA 2AOUA 3CQ9A 4D02A 5FWYA 4JGIA 2G9VA 2EOAA 4G0XA 4GEGA 3NDBB 1V45E 2VAMA 3CLSD 2FLLA 3HSYA 4LBWA 4DIEA 3F5FA 5BN4A 3NNDA 5DHSA 4B3CA 3OM0A 3W5AA 1J06A 2FPRA 1USVA 4JBLA 4MP8A 3HOZG 4QG7A 2RGCA 1Z35A 5FTJA 4WBSA 5GZ6A 5G0UA 3EJWA 3IL2A 1V6CA 4U7TB 4B6FA 3FM9A 2XB2A 4BATA 2XUJA 3CUKA 1P9WA 4OQZA 4FFBA 2BDEA 3NBYC 3SM9A 3LOUA 3PPVA 5GV7A 4JLBA 5AW3A 1SKAA 4I9NA 1ICIA 3D2AA 3J7AK 4CQMA 1FTGA 4E07A 2CKDA 1KK1A 1Q19A 2P41A 1FMCA 5AW8A 3KZMA 2AOUB 2VTEA 4I5DA 3F3MA 4BQEA 2VBGA 2NLOA 4IIHA 4RB2C 2HZ7A 1WVMA 5BN4B 4RVSA 2G06A 4ZANA 1IXZA 5G4KA 1H8HA 4CQNA 2UYOA 1FTQA 4PS1A 5LLDA 2XI4A 1T8TA 4DR4H 1L5QA 4H7PA 3TLXA 2FZGA 2P9FA 3ZLVA 5FH9A 1K7CA 4LCJA 5FKJA 4ZP1A 3WQHA 4BMZA 1IJEA 4OD0A 5CW1A 4UARA 2XE7A 4EPTA 3GTOA 4ZVOA 3OU2A 2JG3A 3BA6A 1MAAA 3SEFA 2RK3A 4NBUA 5JR3A 2VK2A 1JDUA 1P44A 3H1EA 4G84A 1JDSA 1Z39A 5FR9A 4JI6H 5BQ3A 5JRDS 1BDHA 1NN5A 2VXOA 2IYUA 1NIPA 3P97A 4D9HA 1D2EA 2BEVA 2D3WA 1KJNA 5D3QA 2HH9A 4BNNA 3H3VH 3A06A 5A2GA 4YCMA 3AESB 1L8OA 2ECFA 3HO6A 1PV2A 2WAXA 5IF9A 3RAGA 3STXA 2OB2A 3PT5A 2W9CB 1O6FA 1TMOA 2E4XA 2I1VB 2VP2A 1SQFA 3A36A 1MX9A 3KKQA 4XR4A 1X1SA 3GZNB 4DDHA 5EKDA 2YJ5A 3EW9A 1OAOC 2KJQA 5L3SB 4W5RA 4W1SA 4Y2YA 4DR2B 3I37X 3TIXB 1XTVA 1GQRA 2W6MA 5BYJA 3L02A 3LYLA 2YNMD 3DMHA 1Y9JA 1NU8A 4IJ6A 3L8HA 4A3KG 5BWVA 2X3YA 2CZGA 3C8DA 4Q4HB 5B55A 3IQGX 1U99A 3O5AA 5JHHB 3GDHA 4YS6A 1AMUA 1A9XB 3A9WA 3FB4A 3GCDA 5A71A 2QE7A 4R51A 2J7PA 2ASLA 3IXLA 3U37A 1N1DA 3L0SA 3TSWA 3PF9A 4DLYA 4XYMB 1EQAA 3RHFA 2KHZA 3KSMA 3T95A 4JC8A 4CL8A 1J42A 5FUMA 3FYSA 2P9CA 1E9FA 3O6VA 2IOHA 4IOLA 1B8PA 2WRZA 5GONB 1BWQA 4KR7A 4HFJA 4DL6A 4UM7A 1VECA 4H17A 3UG7A 1DFIA 2OAGA 2YC4C 3F6EX 1OPRA 3HFGA 2DBYA 4HAVA 3UATA 4CKXA 2F4VB 1ADYA 2ZJZA 5CA0A 4DM7A 3V6KA 5EIHA 1XPJA 2O3TA 4HTAA 4XCQA 4D8UA 1EVJA 1GA6A 1ULAA 3UXHA 4U5QA 1SG9A 1V16B 3PC6A 4J16A 1FDSA 4MKGA 5G41A 2F9FA 3AF2A 3O92A 3SSNA 4LF5B 1PZXA 2YTZA 3Q15C 2YW9A 3VDRA 5BSUA 3WFZA 2NSLA 2PL9A 2RI1A 2CB9A 1N2IA 3B52X 4U39A 3JQBA 4YWHA 5AW9A 1PJRA 3TVDA 4AZSA 3MCWA 5FQNA 4EJSA 3HVRA 2PA0A 4EKYA 3ZJ4A 2E85A 1XK7A 5KFLA 2J4DA 1QU3A 1E1DA 1TD9A 5D3ZA 4MWBA 2PIDA 1LJUA 3M6XA 4P9NA 2IVZA 4V0LA 1VBMA 3NAQA 2I6GA 4R01A 4AMZA 1KJIA 4BLVA 5KOYA 1AY0A 1S1CA 3CURA 1XZNA 3LMLA 3A7DA 3UAXA 4V02A 5TC4A 3A32A 3SI7A 5DN6A 3C2QA 2REQA 4EGAA 1SBZA 5K45A 3BJIC 1Z4MA 1WL8A 4IHJF 1NYQA 2BFOA 4AIRA 4DCJA 3H65A 4G1MB 5FA6A 3CM0A 2BHRA 4TYYA 2VATA 1A8HA 2HZBA 4E2YA 3THXB 4E21A 4YRKA 1PFGA 1TJ5A 4GSKA 4FYJA 2DTDA 4RPLA 1XN1A 3MQFA 3K20A 4B8YA 2XYRA 1TWHA 2Y67A 1SOMA 3FH0A 5EEGA 4W1PA 1G3QA 4R0NA 1FNSA 4EYSA 4L28A 3WDSA 1C9JA 3RC8A 4BMXA 3WY9A 4D0SA 2NG1A 3ITDA 3TEKA 1JH9A 4RZRA 1A72A 1EEXB 2IEYA 1LQ2A 1CEEA 3WLHA 2M05A 1RJGA 4HDMB 5KSZA 2RJOA 2XA2A 1U11A 1DKRA 1FTNA 2CBXA 3EUWA 3PFGA 5AUNB 4BWGA 3WWJA 5JAOA 2AFHB 2JGDA 2PBFA 3EXHC 1TF7A 3A1CA 3CUYA 3ZZ0A 2K5UA 3DYIA 3KJEA 2J3KA 4GXNA 4X8LA 3ZX5A 3KWJA 1PNVA 2HIGA 3RV4A 2OY0A 4MVJA 3UMYA 1SQ6A 2AZMA 2ISCA 3FFWA 3JVIA 2FPGB 3R9RA 4QPJC 3PQFA 4NHEA 1OLXB 4A91A 3KYCB 5F9FA 5HUQA 2PRJA 4KX3A 5EY5B 2K7ZA 1YCHA 3FYDA 5BSGA 1BOFA 1U5AA 3GAAA 4O84A 4WOBA 1FUYB 2PLRA 1BDJA 1HDIA 1T9GS 4GM1A 5I9MA 4C3UA 4EW6A 5JCZA 1ULUA 3GJ4A 5HHTA 5JMTA 3AJRA 2G82A 4X8HA 5LP1A 1RTKA 4WNAA 4WASA 3C3BA 2X86A 4KV9A 4OM8A 1WZIA 4I3FA 4ED3A 4I14A 4QDZA 2AV6A 2JGDB 2FZLA 5EAIA 1GQYA 4UUBA 3HDHA 4P7KA 4EHAA 3LMKA 2VOBA 1YBVA 4F3CA 1I3CA 2F8LA 3ANMA 4MRSA 5CT9A 3RIGA 3JD2A 3UHFA 1D4FA 3TL6A 5JJBA 5C1PA 5FWXB 4YJ2B 1BMQA 2FPGA 4G4JA 3SHFA 2DZDA 3RSLA 1Q77A 3UENA 4HWPA 4P83A 2QRKA 5THQA 4EO4A 4ON9A 3QOFA 5ALSA 1B93A 1AO0A 3N43B 4RXUA 4UM8B 2NXEA 2QPOA 4BS9A 1N48A 2IBTA 1CUZA 3NBMA 4D99A 2HHHB 2I34A 4MVJM 1XZFA 3SIPA 3SQWA 2MSCB 1YTUA 1KBOA 1U0TA 2VNSA 3LQQA 1WXXA 3GLRA 1H8HD 2QYOA 3PPWA 3QVXA 2QLTA 4NY1A 4F4CA 4OHWA 2NSJA 1T5OA 1EBBA 3PYMA 5CITA 1BOOA 3TN7A 1L3IA 1ISHA 3RHSA 3FKIA 2R8HA 2O1EA 1MC1A 1VSQA 4IHJA 2CEKA 3GEBA 4XLTA 2UZIR 4Q9DA 4YIKA 3TTWA 4DNQA 5BWUA 1XRLA 4Q47A 1BMFD 5ELMA 4QYIB 1TW2A 2TECE 5FWXA 2JEZA 3GN1A 1FS4A 2X19A 3HA7A 4JOSA 3P9ZA 4IVQA 3LRPA 2XMBA 1KH1A 2ZYAA 3ZXXA 5DHAA 1B8NA 3QPVA 3ZYCA 4MV8A 1FUKA 1DDGA 1P7CA 4DY6A 4F5WA 3L1IA 2COKA 3KV1A 5SZHB 4QYWA 2G08A 1H9AA 2C2MA 3VMFA 2CDCA 5IAOA 5ICSA 5JYEA 4G5XA 1WCIA 3R1IA 4BKOA 4REOA 5D6NA 1P2BA 4U7CA 3KOWA 4BZQA 3EB9A 1P19A 2F9MA 2IGBA 2QA5A 1Z18A 2VEOA 3VNQA 1XFDA 5A2QA 4RM2A 4JLPA 1Q15A 3GNQA 1OXVA 3HKEB 2P5YA 2V5UA 1FX1A 2IPNA 2W6IA 4AZ0B 2FMAA 5KFCA 4MEBA 1T0UA 2X0IA 5BV0A 4YCNA 4BO1A 3ESBA 1W8IA 5FQOA 3HP1A 1NNLA 1ORIA 1X7YB 2NGRA 4GEKA 4K2AA 2D1YA 2YS7A 1CKEA 3ZTTA 2WIKA 1CKMA 2ZRJA 3WL3A 1NATA 4DQNA 2DBZA 2X5KO 5ERYA 3AINA 3HABA 4YR9A 1J24A 1WCIB 2WPNA 2R7ZA 5TIIA 2D4AA 4LKRA 1NVVR 3PIRA 4P22A 2GDJA 5CNKA 3TRIA 1BKSB 3FOAA 2PD4A 1OFUX 1A71A 1DWQA 4LHVA 2H4XA 1IH8A 1SPXA 4PTLA 3WQSB 3VO9A 4MQ5A 1QB8A 4RZ2A 4E1VA 1Y81A 1G3UA 3G89A 5HOEA 5KFWA 2H4FA 3RFXA 4D9IA 4A0QA 3JWEA 2P69A 5DFAA 4I1UA 4BQPA 3T7SA 5ABPA 5J3JA 5SYMA 2H65A 3Q3EA 1GSIA 2ADOA 3V4RA 1MH1A 2JL1A 2IV3A 2O4UX 2GZHA 3LTEA 4L9WA 1OT3A 4PIPA 2YASA 1FSZA 1AK2A 2BMEA 2WIAA 3FPGA 2WF9A 1OIXA 3OSZA 2NO1A 4X64B 3FETA 4OM7A 1HNXB 3VKWA 2B61A 3DXFA 3QK7A 1ZU4A 1Q83A 3IR6A 3NDRA 3Q7PA 4HSGA 1RMYA 1O9HA 1D2HA 1GWNA 1YBMA 2QZJA 3GAMA 2F62A 4RK5A 3ZHRA 1AQUA 3L77A 3COJA 1JAZA 2COGA 1JAIA 3D0OA 3UT5A 4DNPA 2RHOA 2WPDD 5JJLA 2NZJA 5JI2E 1E18A 5IM5A 5EHGA 1J7JA 2WF5A 1OWNA 2VP9A 4INAA 1DAGA 4PO9A 3NC0B 1CUAA 3ETDA 1FFGA 2PL1A 3F1LA 1HBJA 1ZVVA 1NU6A 1ZMOA 4QOIA 1JG7A 1JP7A 1K83A 1NUAA 2BM0A 1XMXA 3F7NA 4GRAA 5L40A 3A4LA 2YV5A 3FKSA 4Q1FA 2G04A 4AJLA 2AXNA 1M1XB 1E77A 2G09A 2H2AA 5BYBA 3DHNA 3LLMA 4JEMA 4KN8A 4NVRA 3ZDAA 1ES9A 3C24A 3SHOA 2FEXA 1ZH0A 3Q0TA 4W5TA 3AEUA 4ZK2A 3UJPA 3BWCA 1T2DA 3WL7A 4MKFA 3BB3A 1VSTA 3QY0A 5IC5A 4ZJZA 5FLXA 2VT6A 4N8EA 5D2CA 4IL5A 1U7OA 4EUKA 2QSZA 3EX7C 4B2IA 3SPXA 3WKBA 1OILA 2REOA 3PKJA 1T4CB 4F6CA 2H5LA 2AZ4A 1GG2A 1L7EA 2GRJA 1ZGZA 3FZGA 1BQEA 2WFZA 2AJBA 4LSZA 2ESRA 5JU6A 4RKYA 3WKAA 4C4ZA 2GQ0A 1PF7E 1Q6YA 2JD0A 3FVQA 2BN4A 4UCSA 3R6WA 4RCYA 4EP1A 4S1PA 3FNRA 5AI6A 4CR6A 3HKZA 3AYZB 4D42A 3V8BA 3C0FB 4DCOA 1AN9A 3JYOA 2QTBA 2BFDB 4JYPA 1GKLA 1OI4A 2CDAA 2C4MA 2C96A 4JLSA 4WVLA 5I9BA 1MZVA 3ZEAA 5KT7A 3MFYA 5TQ2A 5FOSA 4A73A 3VZRA 4NS1A 1WXGA 4NLGA 1RKBA 3IOCA 1ATIA 2HX1A 4GLWA 3MSCA 1I2KA 2F3PA 821PA 1MJFA 3CU5A 2ZIWB 3AP1A 4DGSA 1HLFA 4BLPA 1YR3A 2HGXA 3IN5A 4E5SA 1P62B 1Q57A 4NYIQ 1RFGE 1N9GA 2FLVA 4QOHA 2IV2X 1NE2A 1N3BA 1NVGA 2MYNA 4DC9A 1JA9A 4Y2TA 1V4NA 5TDHA 3UC9A 3VHQA 3A2MA 3FSRA 1WD5A 1KK2A 3C41J 1LD3A 1Q21A 1U3TA 3CXUA 3HDYA 4KX5A 3E48A 3KHLA 2BM9A 5EE0A 4BE9A 2DWUA 4I3HA 1ZQ7A 2XUHA 3QWBA 3V9PA 2BFDA 2X5OA 5DLYA 1IY1A 2HMWA 4TYNA 3K9LA 1DQYA 1FS5A 5DH9A 1RI3A 3GGDA 1QS0B 2EQAA 4WFIA 3SFVA 4XFJA 4WL0A 2P4HX 3W1EA 3PXDA 4BCDA 4PEVA 4GKJH 4OMFG 2WAOA 4DQLA 4FWTA 2EYUA 1KC1A 4UZFA 3IH5A 4IS2A 3BMOB 1JTFA 3UAYA 4NZNA 3N0TA 4GECA 1O4WA 1KP9A 2GI4A 3NBYB 1Z7EA 2ID8A 1HE4A 3PHGA 2PU5A 4R1PA 3GLQA 4KG7A 4G25A 3L6DA 4B7CA 4AP9A 2QVBA 3M3DA 1JYEA 4OP3A 3MCTA 1UBJS 5KX5F 1TA0A 2IP2A 3KFXA 3NVMB 4MKHA 1S9DA 2QD1A 4HGPA 1HKHA 1SHZA 3DFKA 3NKFA 4P33A 4UHJA 5HE9A 4CT0A 3TDKA 4A1FA 4ZN6A 1W93A 5DASA 3KEQA 4JYAH 1IPHA 4OO3A 3SLGA 3EG9A 4CKWB 2ODNA 5EJ6A 1DUVG 2V45A 3BTUA 1J70A 3ELYA 2Z95A 4LMRA 4EELA 2XRZA 1X7WB 5DX8A 1F6BA 4HP8A 4QGBA 1C7JA 4F04A 2JIPA 4C21A 1WF6A 4M1TA 1RD4A 2L18A 5BO5A 2XODA 3ZWPA 4B74A 2AN3A 3GJ5A 3QU5A 2QTZA 3ZGOA 2GPYA 1UL1X 1F8FA 2G0TA 4I7EA 1A96A 2IHJA 3A6EA 3FSEA 4MV0A 5KNLA 3JQGB 4P36A 3LQYA 5FPYA 5M2QA 4LC9A 4LNUB 2OTCA 3BPSA 5IVHA 1FRVA 4L57A 4HH0A 5K01A 2JFGA 3JYPA 3I1JA 1S3GA 4G2NA 1NMZA 4UU8A 5C80A 4P4GA 3MWEA 4UUOA 1GSHA 1L5OA 4O63O 3IFSA 1TT7A 5CCDA 4U00A 3KAKA 4U7HA 1D8AA 1RYDA 5I3CA 4GLJA 3U5TA 3OF5A 3C43A 4G1CA 1XU4A 2QE7D 2UKDA 4CIWA 3DL4A 5FWNA 1H85A 2PD3A 5LA6F 1KO1A 4LDZA 4EM6A 1K5GA 3B6EA 3RE1A 4REQB 3SYTA 3HOUG 2C7GA 1M3SA 4V2UA 3C45A 1V8ZA 4F72A 5KOHB 3F3KA 2BTQA 3EVDA 1ISFA 3DE0X 3JWGA 1Y42X 3PUKA 3LKZA 3D6HA 3BFPA 1FFBA 2IXEA 1F2VA 1UZUA 2GCPA 1OBVA 2VN8A 1YRWA 2AL7A 3L1JA 4XWAA 1O6CA 3CLVA 1QV6A 1DCKA 1JJBA 1Y1LA 4K8OA 3KUDA 4PLHA 1MFZA 3ZY6A 2QQFA 3DE2X 1RLOA 1X74A 1BWPA 2BEWB 2IWHA 3P4XA 4CL2A 3TJRA 3I34X 4C03A 2FVXA 3PQ2A 2C2DA 2CHEA 1M1ZA 3V1TC 2CNWD 1CRWG 4B34A 2G5TA 4ZYYA 1KL7A 3ADPA 1UJMA 4PBRA 5FV4A 3HM9A 1UBHS 5TEWA 1CUBA 3DQPA 4C6SA 1RJQA 2R8BA 4MH0R 2X8JB 4N0QA 4XAQA 4QECA 3KB1A 4Q1DA 2QX8A 3VPXA 4DILA 3FRJA 5JARA 5KOHA 1OB5A 4BX2A 4KE7A 4I4TF 2QZ9A 3GQBA 1KYQA 2PZLA 1RPTA 2F1RA 2PPLA 4RZQA 2EX4A 4FE3A 1EX1A 2F8TA 3SC2B 4WY8A 4CC6A 4TYPA 5HZKA 5FUBA 1ZVMA 1YZHA 4PQYA 3DDCA 3A1FA 4A5SA 3EDOA 5KMGA 5BWTA 4D9BA 3WJAA 1BTOA 4ED2A 1L8QA 2XDAA 4OGFA 3ZWXA 4ERXA 3WWIA 4HAXA 4YO7A 5ALTA 3VH1A 1JIVA 1XD8A 2FSSA 2XKBA 2FG5A 1O77A 3BFKA 3DMTC 3MB8A 2XQKA 4BWYA 1DEAA 1BVUA 4QTTB 5AWFC 1LLCA 1Q22A 3BJEA 3ZKWB 1Q0SA 1DTSA 4C0SA 5KYNA 1G19A 5CFMA 5BMVF 4P4LA 3Q85A 3TMAA 1GU1A 1N2GA 4PANA 2EP5A 3UAOA 3WG9A 1X3SA 5K6RA 4BPBA 1X80B 2V5VA 4S12A 4C4OA 4YBRA 1WCMA 4IIYA 1DIOB 4O5AA 2LPMA 1HT1E 3SFTA 1XLTC 4ZYWA 1CHNA 4UCUA 1QX3A 1OTYA 1QG0A 1SCIA 1LZLA 4L5YA 4PYMA 2TS1A 3CFYA 4FHDA 4RK7A 1AHPA 3U7QB 5CM9C 4TWRA 4PGAA 1FFHA 3K2QA 5G0TA 5KFZA 4ZDWA 4LXHA 5DGHA 2GCOA 1DMSA 1IDOA 1YR2A 3AEKB 1W6RA 3Q4GA 521PA 3WFJA 5BVGA 1O5IA 1K7YA 2XQIA 1Q50A 1XTBA 3LO5A 1GZSA 1Z83A 2J6TA 3L2OB 4JVSB 2EW8A 3SC3A 3CF6R 4PZPA 5HV6A 4O86A 3NOXA 1YZQA 3MJEA 3OHSX 4GM4A 4DRFA 1D6SA 4KQKA 5DG8A 1CY8A 3N53A 1KETA 3EXFA 4OHKA 4ZZ3A 3CT6A 4U9HS 1J1UA 2LVBA 3T94A 3ZX4A 1NJ5A 1IVNA 5KFPA 4FHCA 5D84A 5DG9A 2KBFA 4DBLC 3ETEA 3P0EA 2AZTA 2B4RO 4UTZA 1JIJA 3FPBA 3NRBA 4JGGA 1KQNA 4A9AA 4BNJA 3D1VA 2ROQA 3CTPA 1BGVA 5K6AA 2QD4A 2IL1A 4H16A 1ML4A 4MCAA 4YRMA 5EXPA 2IYEA 5LMZA 3AFGA 5M7EA 4S04A 2GD2A 4ED8A 2W57A 3O1IC 3EPHA 2FMKA 5BV8A 3TNLA 1I94H 3TIGA 1EQUA 2WY2D 4IBOA 5JJ5A 1N0VC 1MX5A 2GCOB 2VI5A 2WE7A 4R9SA 3RYFA 5IFLA 5TLSA 1T1SA 3PC7A 5D01A 3TUZC 5ED0A 5YASA 1XDDA 1P7WA 2YNMC 3EEBA 3OMWA 2BSAA 5DOVA 2V7VA 3FCUB 3B3GA 4IILA 1RQ2A 3H9BA 1P1FA 1LY1A 5KT4A 3LA8A 4K26A 5EJIA 3UJ8A 5LQNA 4FYHA 1GRQA 1VL6A 1MXHA 1I6MA 3FHCB 3FWPA 3OQHA 4FJ0A 3R5SA 3OLVA 1LK0A 3IP9A 4HRAA 1CJTC 3A28A 5AICA 4DCCA 4FE7A 3U3XA 2I4MA 4A2WA 4EO9A 4YV7A 4Y6GB 5DI3A 4AS3A 3BWBA 4NL4H 3OM9A 4YR2A 1AKYA 1IE3A 1NVDA 3B1XA 3E53A 3OOEA 3KB2A 2HKIA 3ZZMA 5I5SA 1I24A 5CLHA 4ZAFA 3GDWA 1U7WA 1V3TA 1Y3IA 2EAUA 3C3WA 3C7CB 2MSEB 1SK8A 3OZEA 1NSFA 4JVLA 1IBCA 3OZXA 3BYZA 1FXUA 5EKXA 1J5EH 1SHKA 4RLQA 2ZYTX 4H18A 3QKTA 2WWHA 1XYGA 4CHGA 3PRHA 3DE7X 1BXZA 3HKDB 4FYWA 4MAMA 4UUNA 1KWGA 3UANA 2CFCA 1T36B 4QPNA 1W6UA 4ARZA 4BMYA 4KSYA 4ED9A 2JGJA 5ADUS 4U6SA 2JBWA 2ZYRA 3CRW1 3OLCX 3VR5H 2LGJA 3IURA 2VTBA 3NGDA 3D8UA 3EC1A 2YN2A 5JS8A 1Y4DE 4C01A 2ASDA 2CLFB 2HADA 4AYWA 2GPSA 2VSQA 5E38A 1QO0D 4UVEA 3HYLA 1V8FA 3COSA 4JDUA 5KKCA 1I7DA 4EEXA 2CC2A 3CNQS 3R3XA 2ZU6A 4KFUA 4BGIA 1NI4A 1PBNA 1NI3A 1SZJG 4R9UC 4MI9A 2ZWIA 1QZUA 3DUFB 4G5HA 2YWDA 4GMHA 1JQ3A 2WILA 3NM5A 3C4QA 2ONYA 1TDJA 2H5EA 2B78A 4X62H 1W25A 1KYYA 3IQHX 4J0JA 1VBFA 2GF2A 3VDXA 3NVDA 5KX5A 4CM5A 5I7VA 4NFHA 4EF5A 3OCJA 4I5IA 4PFSA 4DR1H 1MOSA 2R86A 2HF8A 3OQ1A 3TM4A 1E1QA 1Z68A 5BR1A 1T5TA 4ZEWA 621PA 1ZY2A 1QTQA 2LKDA 2O0LA 3H5RA 3DE4X 2CNDA 1MX1A 4QDKA 3HHEA 4ECWA 4U9UA 5FTNA 2G77B 4D3SA 4BNUA 2PUWA 5KJFA 1S0UA 3PR2B 4JV1A 1TTPB 4B3TB 5LB2A 1UJ2A 4PNEA 2SKCA 1JU4A 1KVSA 5TRTA 1SCKA 1O6BA 3KB6A 3KXIA 2ODAA 3W2TA 3ETLA 1P6QA 4R6WA 2ZYUX 3WLKX 1QUFA 5EHNA 2ZAOA 3FMFA 1U28C 2GAFA 4PG5A 1P9LA 4JI7B 4EMBA 4OQ4A 2D2FA 3VO8A 2WYIA 2I6XA 2FZWA 2JLAA 4I9FA 2ZZMA 1QRSA 2ZE6A 4Z54A 4U7GA 2PVSA 3M89A 1P91A 4QPDA 2ZKLA 2B0CA 1QYIA 1IAQA 1YUBA 1YSCA 2HNBA 4D2IA 4V39A 3WWCA 1X8LA 1Q16A 3NIBA 3I2FA 3L6CA 3RBZA 4NQRA 5KQSA 3FTCA 4FN5A 1NG1A 1P2UA 4K03A 2QRMA 3LQ2A 4QHYA 2B1RA 2ZIAA 1E5QA 3V2HA 2A33A 5CYGA 2OYRA 3RRJA 4EPWA 1CX9B 1FVOA 2MT9A 3H40A 3IP6A 1UODA 3KBOA 4WMLA 1NPYA 3WGLA 5C81A 2HPAA 4MPTA 4L0MA 4MW7A 4QYMA 4NFYA 1R64A 1SCAA 4UUGA 4TM8A 4ZTZB 5L7YA 4W9RA 1QJCA 5ECYA 1OZHA 1ZETA 5CIWA 3C1UA 2LCIA 1ZVKA 2NTJA 3D02A 2NVBA 3W8RA 1FRQA 4ZGWA 1HYEA 4QE3A 1S0NA 3RS9A 1VDZA 3QUCA 2UUBB 1JXAA 2GGSA 3GJTA 3KHSA 3R4VA 5BSEA 2NZ2A 2NAPA 3BICA 16PKA 3DOOA 1CQXA 1WW8A 3GLTA 3J80W 3GTKA 1GG5A 3BFVA 4M49A 4I8IA 1FX0B 2I2CA 1FB5A 1XQVA 2E4VA 1OH7A 2HUPA 2P11A 1BW9B 2F1HA 3GVCA 2FQXA 1E9VA 3DEFA 2I4IA 4ILKA 2Z5VA 3G2MA 4MQLA 4AJ2A 3KTAA 2XR1A 4M7EA 4PQGA 4QDJA 4HS9A 1RWNA 5KYVA 3TLJA 3W2EA 4K88A 1H22A 1KEUA 3CLTC 1WV0A 1MPTA 4IDPA 2Y0CA 4NK4A 1OLOA 4D92A 1YH3A 4YASA 3PLAE 2WUVA 1NUQA 3QKIA 2IU6A 4KOAA 1I0LA 4ES6A 3IPCA 1EDZA 1Y1SA 1ZMRA 1ZS9A 2R9VA 1PYGA 1VLQA 1G3IA 3P19A 4RSMA 1REQA 4BQOA 4ZYTA 1G291 3Q7RA 3B6IA 4P93A 1U3FA 2GHQA 1N36B 1XP5A 3AUKA 1A88A 1TCVA 3GEPA 4LSGA 4UCFA 3WRWA 4YV2A 2JH3A 3L46A 4JFAA 1IRXA 2A5GA 3IMCA 2EBWA 4KDFA 3NC1C 4FHZA 4B4DA 2JA8G 1KTVA 1Z75A 1E60A 2DFVA 3DVAB 1Z36A 1QUEA 3HJNA 3Q6MA 2J3DA 2PKXA 1DEOA 2DSTA 5D1PA 3FRHA 5K0EA 3B2NA 3JWJA 3E70C 5IBRA 4PG6A 4HXYA 1QR6A 1ZRMA 4EY4A 1XT6A 5IK2A 5C4GB 3SZMA 1KAEA 2NUBA 2HD4A 1N8TA 4EGQA 3PHHA 1NKTA 3NTLA 1I9CA 2VHVA 3CW9A 3BF7A 5IC4A 4M21A 3GCZA 1K6EA 3C6ZA 1UKCA 1PZFA 1R0LA 2E18A 5EIWA 5CUQA 2CD9A 4AS1A 2PZEA 1AGRA 4Q9KA 3S68A 4LF9H 4AY6A 1AJEA 1BKDR 2GAJA 3BFJA 2YQZA 1RAAA 2AEJA 3GJ8A 1N5DA 2EYQA 4JKOA 1YKGA 2M6RA 2ZYIA 1WTCA 1GZ7A 4MV7A 3MJDA 3AB7A 1WZNA 1ZJ4A 3O7MA 4I6GA 5I45A 3ZVNA 2FI1A 4IFBA 4UHDA 3DR3A 5G2OA 4MUAA 3WAKA 1DAIA 1VYTA 5AJUA 2NU8A 2D2EA 4JR0A 5KCZA 2YYAA 1L9KA 4PSKA 1K63A 2GF0A 2I65A 1XKTA 4V0NA 4XE5A 421PA 2PZ8A 5LZ7A 4LXIA 2NTEA 2H0AA 3KPJA 3PNPA 3NB0A 4XWTA 2R1TA 4KXMA 1KY5A 4XW2A 2WWYA 2H52A 3LWZA 4IHJB 3C7AA 1RRGA 2XMDA 2XVAA 2YHBA 5BYAA 1PDOA 3HFRA 3EWSA 3K9HA 4WTOA 3VI4B 3W04A 3H2ZA 5BSVA 4HVTA 1YR6A 5P8WA 2CHGA 4QYIA 4F4WA 3K1YA 4YJFB 4DMFA 4LF4B 5EE9A 1IK6A 1FUIA 1RJEA 2XRYA 4OQFA 4PINA 1F38A 4CBVA 4EQ5A 3H0CA 4FFDA 1BXRA 3IQFA 2R5WA 1EZ4A 1R0ZA 2OFWA 3DPIA 4BVEA 3ZW8A 4EQZA 5KYXA 2EDAA 5JTTA 4HI0E 2VF7A 4W99A 3F7MA 3HOWG 3MRTA 2O23A 4DZZA 2P75A 3CXRA 3KVOA 3EFEA 4Z1MA 3K1AB 4Q3BA 1YF3A 3AFMA 2H48A 2JNWA 2XOKA 2B37A 4FINA 1ZAYA 4AJIA 3EAGA 4ALJA 4DOMA 1PT8A 1UBLS 2R1TB 4TKLA 4QDUA 4ZOBA 3ROQA 1SVUA 4HVAA 1E0DA 2VQ3A 1T8SA 5EWEA 2LE0A 2Z56A 5CDUA 3ZXSA 1QQTA 3SHWA 2OC9A 3PUIA 4UQPA 2OORA 4A3LG 3MW8A 1PVVA 1Q1NA 1SAYA 3ET4A 3VQTA 2XRFA 3W78A 1S8OA 4YDQA 2JEOA 3L92A 4QQNA 4UOQA 3PC4A 4CI0B 4QO8A 2O8EA 1ONSA 1X7YA 4MRMB 1T2FA 2JIZD 4WKPA 5BPHA 5F12A 4RHFA 2HA3A 2NVWA 3PUVA 3CRQA 3INTA 4RS3A 1DC5A 2AOVA 2PVCA 2CE2X 1LNSA 1QCZA 4JP1A 3S0JA 2GD6A 2A9OA 4KQCA 4WLFA 5DIFA 3D4PA 3K70C 3WISA 2XYPA 4PO3X 1T8PA 4NK5A 4BNYA 4OK6A 2YY5A 1QV9A 4N9QA 4OQMA 1VHDA 2M6KA 3PUZA 3QX8A 3T4PA 2MOKA 3GA0A 1PDWA 3UUFA 3L4SO 1XNQB 1PTKA 1AHHA 2V8BA 3Q40A 4KQ9A 4RLFA 5BSWA 1N8NA 3B7GA 5NLLA 1ZH2A 3C3XA 1F8YA 3I30X 3OMXA 5LMCA 4XTCS 1T0JB 4EHLA 2I8AA 5DRYA 1F0KA 4CMEC 3KM0A 5B4TA 4BUJA 4JC4A 5FUQA 5AUPB 2QTMA 1XFAA 4APMA 2WSLA 4DEYA 4ISBA 4Q7EA 2I91A 5F5XA 4AT1A 4FR5A 4ZFNA 5EJEA 2HBYA 4G67A 1EFHA 3CB2A 1JHYA 1Z0DA 1M1YA 2IHUA 3BM5A 4NCKA 1L5NA 5B7NA 5JMPA 1V11A 2QUHA 3OP4A 4LE2A 3GXOA 1N6HA 1JKFA 3BORA 1BDMA 1U0FA 3SR0A 2VPZA 3Q6IA 1VBGA 5A4FS 1XEWY 2Q5EA 4Q4AA 5G1NA 3EZ7A 1MMFB 4A3SA 3KT6A 4QWEA 4P7GA 1D6NA 1TL7C 4DL3A 1S03G 1DTWB 2AC4A 2WHQA 3AHJA 3L6RA 2GD0A 3OURA 2WJ6A 4ER0A 3EYAA 4EYEA 3ICQB 4PONA 3RAPR 5CYPA 4EX7A 3CVJA 2JGKA 5DNUA 1CZUA 1G1MA 5EYPA 3DO5A 3HB7A 2J5BA 1TGVA 3IESA 1UJCA 4OKNA 2Z6QA 4ITUA 4EKGA 4U6PA 3G2NA 5DX1A 5BWNA 3K32A 3MEQA 4PPQA 4IJ5A 2DHEA 2FK8A 1UKVY 3AFNA 3B38A 3FTDA 3V4ZA 1TZBA 1C0EA 4RVFA 4UNPA 1WQ1R 4XX0A 3V32A 2QUBA 1CIPA 1GAJA 2Q1TA 4J3FA 4JSTA 5DHTA 2ZDQA 3AEXA 1QE5A 3I5AA 1ZGBA 3NBUA 4BBSG 3WYBA 3UKJA 3CLKA 2HIXA 2FZCA 1HKUA 4HLDA 5PNTA 2VUSA 4DLAA 1WVIA 2JBAA 4LXTA 3WLJA 3W5BA 3Q8LA 2VZ9A 4MQFA 4HC4A 4B33A 3PL1A 1Y6ZA 1XRNA 2F9LA 2H2DA 2WJ4A 3EZ9A 4TZTA 1CZOA 5FPTA 3DLIA 1KOGA 2WIGA 3BIWA 3CNBA 4BQNA 2W6JD 3M4YA 2QLNA 3O84A 2FN7A 3KETA 3OSUA 1GV0A 3ZHXA 3DAYA 4DWOA 5L7WA 2CJFA 2XNCA 1JFVA 1NP6A 4RACA 4U7DA 2JLYA 3PFIA 2C4WA 1GNTA 3X1MA 5D1NA 3DONA 5I7HA 3CGGA 5DGCA 2PVPA 1EJBA 4BVFA 1E5LA 3CF4A 1SKYB 1U7UA 4QUHA 1KSGA 2J33A 4KUEA 1KRXA 3LY7A 2RARA 3V7NA 5TQVA 4ATNA 1UMKA 4FKZA 4P7FA 5JY1A 1RK5A 2ZSAA 3NVAA 2OWEA 1TYZA 4F4UA 1XHFA 2XDQB 5KQRA 1M5UA 2ZAIA 2BGNA 3OQPA 4AFNA 4EVSA 1MOZA 1E5VA 2EIXA 2R4QA 2HR1A 4FFPA 2W93A 3P4YA 2WIJA 4L6AA 3BDAA 5HIJA 1FIUA 3D6FA 2JCBA 1QAQA 3WGNA 1Q0QA 4O1IA 3PQ8A 3LC2O 4F8EA 3PRYA 3O4RA 2MR6A 3MT8A 1KJYA 3G8DA 2BFEB 3DTYA 1RMQA 3PQ5A 5A4AA 2WHEA 4IQ0A 3TQRA 1EFPA 1RYBA 3NHPA 1KF0A 3CLRC 5IKXA 1NPTO 3MCZA 2BT4A 2W98A 1Z5WA 3E15A 1Z16A 3UA4A 2ONKA 2SHKA 4MS4B 2AMVA 4RMNA 2IF0A 5E1BA 2TMKA 1J21A 2P67A 2SICE 3PHLA 1NXVA 4HSEA 1OZ0A 1DAFA 4JCCA 4KXUA 4X1IA 1DFHA 4KJXA 4V2IA 4YAJB 4AX8A 5IFKA 5E2IA 3QYFA 1YA8A 4NULA 3L7NA 4LC1A 2QUKA 4Y98A 3BH7A 2I71A 4CHTA 5F98A 3DGEC 4O0LA 1MG0A 3G7SA 2BISA 3ILSA 1O95A 1C8VB 3JYQA 1Z2DA 4JYMA 2R62A 3QPCA 5IXJA 5LL6b 3MMPA 3LSTA 4IQGA 4DBVO 1G98A 1YB6A 2NP6A 4JNCA 1XAGA 1IOVA 2UU9B 3BEOA 1SXHA 1O2DA 2CXSA 4R71A 4B3MB 1GT91 5E1DA 4NYJQ 1B8UA 3GROA 5EP2A 3TMKA 4EMTA 1XMJA 1OU4A 2GXUA 2Z08A 3E23A 4G65A 4WACA 3UHAA 3W05A 4MCIA 1VTKA 1XV5A 1NT4A 3QENA 4KWHA 3RU2A 4BLTA 4ZZ0A 1NQUA 4QYXA 1N9ZA 1QVRA 1WULS 1X7WA 1ZIOA 3K0EA 3W4KA 1RFLA 1SM4A 4G26A 4RGYA 3KIPA 4JKIA 4NXMH 3MXOA 4OBXA 5HCIA 4AMBA 3NETA 2P78A 4PTYA 4R1OA 4X1IB 1JIIA 4QULA 1VJDA 2CUZA 2XIJA 2VJYA 3EGOA 3UZBA 4XASA 2FP3A 3P2JA 4TLLB 3UOGA 3ECAA 2X41A 4FLMA 4HDSA 1GZ5A 5M34A 3CRZA 1XQXA 1CT9A 1JLKA 2PJZA 4AULA 2FWBA 3V6JA 5A3RA 1N92A 1F4PA 2IUTA 1RQ7A 4R8SA 4WFJA 1B76A 4BNDB 721PA 3W9BA 1QHGA 1C29B 2OBBA 1NRWA 3HV2A 4CN9A 4MS3B 4QWAA 6LDHA 4CEIB 1DXYA 2ORED 1P16A 2HNAA 2QR5A 4GZ3A 5JFOA 2OD9A 5JCOC 3Q1KA 3SBOA 2O2EA 2G1JA 4F5DA 1TF2A 4G63A 4DA8A 5ADWA 3RFCA 2DP4E 2HA6A 2RK4A 5IWAH 1CNEA 1UFVA 3FSGD 3R41A 4FYKA 1EJ6A 1KAHA 4REQA 5AYVA 3STTA 1SBYA 3DM9B 2Q6IA 2HHAA 2QVXX 4ZALA 1MJ5A 2CKZB 5I5WA 1UZNA 3O1HB 1CR2A 2DFDA 2QM0A 2C8JA 4Y2VA 3PFFA 1K06A 3IVXA 5IJWA 1K8YB 2PGXA 4IOMA 4AYBA 3DBOB 4DR3B 2GWRA 2HW8A 2JCSA 1KI9A 3VZPA 4ABYA 4DLNA 2JCXA 1YB2A 3GRUA 4RK1A 3N07A 4DR7H 4V03A 4YCLA 2JAPA 4XSVA 2IU0A 5IKOA 3SKVA 5K8LA 1Z0UA 3K3VA 4CEIA 3HRKA 2P2ZA 2YHUA 1QRTA 3ET5A 4GD3Q 3C6KA 3GDOA 4PR3A 3U4IA 3CRNA 2C31A 4KRGA 2H0QA 2GLTA 3GT3A 2HJSA 1IZ0A 3MR3A 1CB0A 1I01A 4JOBA 4OFXA 4DIDA 2OHXA 2VZ8A 3ACCA 2ZUEA 1PKXA 4IIJA 2R8IA 4BFUA 2JCVA 3DVSX 5DG7A 2R1VA 3WK5A 2WU3A 4CLDA 4LDJA 4RQUA 2RGRA 2H17A 1CRZA 1P73A 2BI7A 1BD3A 2Z30A 4FHFA 1I13A 4TTRA 3SVTA 3IQXA 4MW6A 2F1OA 4K05A 1EWRA 1JSZA 1IM8A 1UKEA 4D3YA 5IM4F 3H16A 2NO6A 2ZBDA 3OTOH 2G9ZA 3AF4A 5GTDA 4KNYA 4ZAWA 3NKLA 1HNXH 2YV3A 5EESA 5A4MS 2PJDA 4E30A 2PLFA 2NP7A 4AY3A 1LXCA 1P1IA 4YWJA 1RU3A 2Z98A 3QE2A 4UVHA 1E61A 1WMDA 1SIOA 1OH8A 4AJHA 1TO2E 1AQNA 1MD9A 4J1QA 4I81A 1A9YA 1PBTA 3E7PA 3CNNA 4RD4A 1A0GA 3NPMA 2BGWA 1KEVA 2TRSB 4NFLA 1XZCA 2IZ7A 4OXQA 4FW9A 1FFEA 5DEIA 5EI5A 4MUKA 4MTDA 4PQFA 4BGDA 3BE8A 1J0EA 4HNAB 4RXMA 4MLPA 2EJ0A 4BC1A 4UE6A 3ZJYA 1NDHA 3LHKA 1GCUA 5DF1A 4IXDA 4Y2QA 1N2EA 5EJ9A 4DR6H 1F2DA 4FYPA 1YWGO 2WIFA 5BYKA 2AVNA 3HCWA 3IBSA 4I99A 4LK3A 5EE5B 4P3NA 4DM4A 1V48A 1MNQA 2GEKA 3I9JA 4WNYA 1KPHA 1XA3A 5AHRA 5FI0B 1QKIA 1RZUA 1VCNA 2VHWA 5BUQA 1SQSA 1IUKA 3GJSA 2P4SA 2A0UA 4PRKA 3ZPXA 5JAUA 3WLMA 1TEHA 1ZJZA 2F4NA 2FUEA 2GM9A 1A2KC 2GFIA 2J6UA 2ZRQA 2DTXA 3A27A 3EGDA 2I29A 2GCNA 3GJ7A 1ISGA 1PV1A 1V7PC 5DXFA 2ZJBA 1QQBA 4K0KH 2WM9B 4FYXA 4NEQA 4B4KA 1XTIA 2MYPA 4RSGA 2QX9A 1YCGA 5HKAA 5AJHA 4TT3A 3FOEC 3MD9A 4GX1A 1GGFA 3R23A 1DXQA 2GR9A 1BRTA 1EBUA 2PANA 2AIRA 2WE6A 3H5OA 4P35A 2R82A 3I9KA 2JS7A 2Q5IA 4G0QA 2XADA 3I12A 4U0JA 2HLDA 2Q3DA 1QPBA 1SBTA 1YMQA 2V9CA 1BHO1 3CPSA 3QJ5A 5FBKA 2EW2A 5IC6A 2QRQA 1NQXA 2VRBA 3H2BA 3S28A 4OUKX 2JAWA 1P77A 3FNEA 4J3JA 4MGHA 2IDKA 1ESDA 1JI0A 3B78A 3GC6A 1KBZA 3U7EB 2HCBA 3TLKA 4MHOA 3ZWDA 2HF9A 2EBFX 4XIGS 3PEVA 4G2TA 3L7AA 3CVVA 3SSOA 3L7IA 2QTTA 4FD2A 3BK1A 1HRKA 4LJ7A 1MCZA 4K9OA 1I2DA 3K1TA 2YNMA 3SF8B 3A4VA 4CNBA 4R84A 3GRFA 4BFXA 2WU4A 4EG3A 2C9YA 1NQTA 2V59A 1NNUA 4YFYA 2QBYA 5IAJA 3LS2A 1HZJA 4PLPA 4IXNA 2VCYA 3OZWA 3DMRA 2BTEA 3OE5A 5THXA 4HAUA 5CEJA 1A3GA 2JIOA 4E7OA 3FYHA 1JZSA 1U2ZA 3VSDA 5BW4A 3VJRA 5AUOB 3AYXB 3IOEA 3IV7A 2CYBA 3DT8A 1D04A 4HEA6 4XYEA 5MN5A 3P9CA 1LTKA 1ZM7A 1ZM4A 1T36A 4JEHA 1U5BA 4ARZB 5BMVB 3H1PA 3WMEA 4AYXA 3WMWA 2HA5A 3EDCA 3RB6A 1D6MA 3VC1A 4HB4A 2UZ4A 3CEHA 4FFNA 2Y1XA 3QPWA 1P4SA 3TW8B 1JECA 2D74A 1SD2A 5HFJA 2HHJA 4UW9A 1AA6A 1GEEA 2A6PA 3VO2A 1EDOA 3NWBA 1WV1A 3IUBA 3UJCA 4CQLB 5HKKA 5KC9A 3GLIB 2QBYB 1EK2A 4QSMA 1E89A 1YIAA 2L2QA 3PFKA 1G4HA 3QEJA 2GRAA 3DOJA 1A27A 3DUFA 4MCHA 1Y8RA 5J2UF 5JPDA 4OI0A 4UU1A 3G2JA 2CD7A 4J91A 5FXMA 3KEMA 4Y0AA 2VFAA 3GRRA 1WDTA 4KU4A 4A16A 1N8KA 1U5BB 4C0JA 2V7XA 3HKCB 1EDBA 2P9JA 2DOKA 2HREA 2CJPA 2Q9UA 2X9GA 1O75A 2E1PA 3IAM1 5A7HA 3F74A 3V33A 1RRMA 4ETWA 5EZYA 1WF3A 2Q4TA 4GP7A 4X7PA 1XCOA 3KQWA 3OO1A 3S55A 1HSZA 3QPBA 1TWCA 4GZLA 3EOBI 5DLPA 2O59A 3SZOA 2GT1A 2QMYA 4KL8S 2PH1A 3OQJA 1FVXA 1D2GA 1IBKH 2OQRA 5LKAA 4IICA 5AVZA 1BVYF 4IW3B 5EEHA 4CLXA 4KTTE 3IRUA 1IFXA 4IV5A 4B09A 4E03A 3ISTA 3T9FA 4FGRA 1FCJA 2PZMA 1K4YA 3QXCA 1T2EA 5IW8A 3H1TA 3TTVA 2IYVA 2ZAGA 3ABRB 2IY7A 4JB2A 1Y1PA 1TJYA 2AJDA 1FDVA 4V0ME 4WERA 2PMEA 3OP1A 1E0AA 2C5SA 3HKCA 4PC3A 4ECTA 2J6CA 4DKXA 3MR5A 5E1MA 5FBWB 2JIMA 5DLGA 1U0JA 1RAEA 1N3YA 1FNDA 3L8ZA 1FY2A 2YX1A 3H05A 4L9AA 4BKMA 3FDZB 1O94A 4XEUA 2VNAA 2I9KA 4CQMD 1CJMA 1X9HA 4UMVA 2OK7A 1ZGGA 5CDGA 2Z4TA 3VTFA 3KQOA 1Z22A 4UEWA 1Q7RA 4HQ0A 2VHYA 1T25A 2B25A 3EWIA 4GSLA 3SM3A 1GRCA 4GX2A 4GWGA 4MR8B 4JK3A 2KW5A 4BMCA 2I6TA 1TMGE 3I0NA 1L2ZA 1EFDN 3S7TA 4O81A 3EEIA 1DRUA 3NHMA 4GBED 5FR1A 3CA8A 3OKPA 3JD1A 4HS4A 4N3BA 4RJJA 3HR7A 3RF6A 1DXOA 4CPDA 3G1WA 3UB4A 4EHFA 2VF2A 5E7QA 3EYYA 4HKTA 5EG5A 2E1RA 3FKIG 1FP2A 4JP5A 5LPNA 1J2RA 3NGMA 2A1UA 3BC1A 2HWXA 4YRBA 4JB0A 1V9SA 4YRFA 3BG5A 3ZDCA 1PZHA 1SULA 2RBEA 4OYYA 4PLCA 3A6ZA 3L1HA 4I4LA 4UZSA 1JQEA 4IFEA 5B7PA 7AT1A 2KSWA 4P4SB 1TM5E 2RBGA 4OLHA 2AFVA 1N36H 3KYDB 4RHXA 3UYKA 5LXTB 1JALA 5IZCA 3K6KA 1LWOA 1GZHB 4MR8A 5K8IA 3JYHA 1U65A 3PNSA 3QVWA 1U2GA 4FSDA 4DM3A 5AIBA 2AZXA 1CJSA 2XUPA 2J9XB 4JBHA 5ITZB 4AKGA 4MPDA 2QN6A 5F9NA 2E4WA 3FCYA 1D2AA 1WSCA 1TC2A 1W85B 3LX4A 4C9BA 1JILA 2VT3A 1H69A 1U7TA 1JEDA 2QJRA 3BGSA 3WZLA 3CZCA 2FLKA 5A62A 5BR4A 3FW1A 4EMSA 4LV6A 4DYHA 4BDTA 1D8TA 4Q4DA 2BONA 1G2IA 2CMHA 5JS2A 4BTVA 4D8WA 2JIQA 3QEBZ 1Y1VG 2NPOA 4AICA 2X9LA 4EY6A 2Q6VA 3JRNA 2WKSA 3DXXA 1TRHA 2C07A 2VT7A 3VXKA 1ZLXA 1R8JA 2DFKB 4MPRA 3A6DA 3AERB 2QV7A 3K4PA 4N49A 4YJ2F 2FUNB 2V03A 3WXBA 2WB1E 2C98A 3R77A 2FDRA 4MP3A 1RE1A 1Y9DA 4QUAA 2XHEA 4Z2YA 5L9AA 4K87A 5AT1A 3WLEA 4ETSA 3TZCA 2O2ZA 4IXMA 4PLWA 1KH2A 1UXOA 2A58A 3PC2A 5IEBA 2H11A 1L5MA 3TIIA 4I9HA 1PJCA 4PRLA 2EFGA 3NHLA 3ROTA 4Y9RA 3WLFA 4H1WA 4GQAA 2QVYX 4BNKA 2VDWA 3I73A 2EQBA 4D82A 4CUKA 1P8JA 3NW9A 3OTGA 3EMBA 4RCZA 2BIFA 4GOKA 1K7SN 4BASA 4R2JA 4M0LA 4FE4A 3C4VA 3G7NA 1ECPA 2CV1A 2JFOA 1EGAA 3VYUB 2BZ0A 2IYSA 4OYLA 4N41A 4H6WA 2VYVD 3A0UA 3HFSA 4R5MA 3CEAA 5L8VA 5FV7A 4BU1A 1YCDA 2RF4A 2CUKA 2F3QA 2ZATA 3KZVA 3K31A 4JVNA 1O9BA 4U2EA 3WGZA 1YJAA 1II8A 4LEIA 2I7VA 2HF2A 4FFMA 1OAOA 1YC2A 5I7FA 4KR0A 2ZSEA 2BFAA 3HBLA 1OFVA 3FBWA 4C7OB 3UXYA 3AM4A 2Z8XA 3O9VA 1KDTA 2E5WA 1KFBB 4YJFA 3KFVA 5ISMA 5CH8A 3DO6A 4J0KA 4Z0NA 3IUYA 5K4HA 4V0KA 5JTUA 2ZR9A 2JGAA 4BIMA 2VT2A 4M53A 1ZH6A 3EZNA 4JJAA 1GU7A 4XD7A 1R4NB 4B4OA 5KYXB 4TGLA 1O89A 4C14A 3B5IA 1Z6AA 3FCOA 2ICAA 2H8KA 3OLYA 1FFAA 2I8CA 1RHKA 1K86A 3LC1O 3ZY5A 2G4CA 2GARA 1UWLA 3ECCA 3IIIA 3STVA 3V2IA 1MF7A 1NTOA 1S4MA 1TYDE 2PS0A 3IDQA 3ZDXB 1C9KA 1U4NA 3T5MA 9LDTA 2IUSA 2F1IA 4MW5A 2ZVDA 3C1AA 3OZDA 3H11B 5B12A 3PXXA 2ARKA 4H1HA 3KX2A 1TCAA 4J9NA 2H18A 3R76A 2P9QA 1M8FA 4FCWA 3I83A 4HY3A 4AXBA 1G8GA 2VP5A 5JPIA 4DJJA 5B3KA 4NCNA 4A0HA 4M0CA 4UD2A 1R37A 1PKEA 3IHLA 5IUKC 1E2BA 4TMFA 2QAJA 2QTAA 4B7UA 5B3AA 2X4GA 4XYLA 5KDDA 1RRPA 2O8EB 4Y1FA 3WQRA 1QBKC 1VCHA 2HIMA 5AI0A 4A6EA 4ZICA 1S02A 4YAOA 1I1HA 5LP6B 5K99A 1EM8B 2Y9MB 3RTCA 4AQDA 1KI4A 4QFMA 4J6FA 2PRZA 2ZIUB 4GR4A 4KQFA 4MVJE 4FM9A 2NYVA 1VHTA 4X1KA 4BFCA 5H9VA 1MGPA 2OP1A 3C39A 1JYFA 4Q21A 4TTPA 3P9KA 4FDMA 2JFYA 1G5HA 4CMHA 1GQSA 4L0DA 2O9JA 5JAHA 1IZYA 3NUZA 1N3IA 1C0PA 3EULA 3QHAA 4CKCA 2IW1A 5C5JA 3AHFA 4ND2A 5JBIA 2QY6A 2YWRA 1TZJA 1PV4A 1C80A 5F5NA 3RK4A 4EIWA 1P1RA 2NZVG 4O7VA 3HYCA 4HATA 5A9SB 1MJHA 2EZUA 2I2DA 4LQ4A 2YIVX 4BMSA 4QEKA 4QUBA 3E7DA 2OLSA 1NW8A 1UMBB 4EL0A 2YKGA 3THYB 1WMSA 2NO7A 2PFGA 1Q0RA 2ZI7A 1YZKA 4EVIA 1FUUA 3N0VA 2HMSA 2ZUCA 4Y7CA 3AUJB 4Z7QB 4KMSA 1JVSA 4X85A 4K9LA 4B7AA 1SC1A 2VJMB 4ZV7A 4BAUA 1FMJA 4L5IA 4OHRA 4Q1EA 2O06A 3O8LA 3H9EO 1BCSA 5JNVA 4G09A 4KXYA 1GAEO 1EE1A 1IPEA 3O4GA 3G6WA 3EF0A 4CKCB 3RS4A 4WXPA 4YMWA 4MGYR 2IZZA 4DMRA 3MAJA 3O31A 3EPIA 1J5XA 1FQKA 4E1BA 3IKTA 5ELLA 3EGEA 2HI0A 3H87A 3Q11A 4HLQB 2XC9A 3DTGA 3KR0A 3SEZA 4CGYA 1QJ4A 3SC6A 2WTNA 4IH9A 3PQ4A 4AECA 3OE1A 1JKMA 3K0AA 4NJMB 3WKDA 4KLRA 1IN8A 3M5WA 2G9QA 1VLVA 1ZBQA 2A5YB 3D6TB 4FYMA 4HDKB 4M54A 3VNSA 2ASJA 3GRCA 2YHIB 4J0CA 2YQ5A 4Q3OA 4GI2A 4Q1BA 4WK6A 4CM7A 1W75A 3MCUA 4M38A 2JFPA 4BNZA 1E2EA 1OUMA 3BWXA 5L1JA 2JBAB 3CRVA 3R3JA 2VC2B 4MQFB 4HN2A 4G0WA