2VPQA

Crystal structure of biotin carboxylase from s. aureus complexed with amppnp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
447
structure length
447
Chain Sequence
KKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLNIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKAEMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGFRMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEEAPSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVTEMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLAPGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIPFHIKLLNNDIFRSGKFNTNFLEQNSIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYL-COA CARBOXYLASE
publication title Structural Evidence for Substrate-Induced Synergism and Half-Sites Reactivity in Biotin Carboxylase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 146
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature ec 6.3.4.14: Biotin carboxylase.
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain
A PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain
A PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2vpqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2vpqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vpqA01
3U9SA 4WD3A 2NU7B 3K5HA 3LP8A 4MV1A 2ZDGA 3R5XA 5LA6F 3HO8A 4YBZB 1VKZA 2W6NA 5JVDF 2PVPA 2VR1A 5CAEB 4O4LF 3RV3A 3TINA 1KJQA 2Z04A 4O7SA 2R85A 1KJ8A 2YZNA 4FFNA 3WO0A 4O7TA 2W6PA 3G8DA 1JDEA 4HR7A 1T36A 3RUPA 2V58A 4O2AF 2CNQA 2C00A 1AUVA 4MV6A 1Z2NX 3ORRA 4M9UA 4J6EA 2IP4A 1EUDB 2W6ZA 4FFOA 4EA9A 1GSAA 2Z02A 2YS7A 2P0AA 3ETJA 3NUAA 4ZQIA 2ZDHA 4XYLB 2GQRA 2XD4A 3G8CA 3GLKA 3RV4A 3ORQA 3TQTA 1OBGA 1DV2A 4EG0A 1UC9A 1PX2A 3UFXB 1ULZA 1VBGA 3V4ZA 2CNUA 3R5HA 2SCUB 4ME6A 4EA8A 4XZ3B 5HBRB 4EGQA 3DF7A 4HNVA 2V5AA 3OUZA 1JDBB 4EABA 1Z2PX 4O86A 3U54A 5FNVF 4YAJB 4ZOLF 3HB9A 2YWVA 3VPCA 3LWBA 4O7WA 4HNUA 1A9XA 2VQDA 1IOWA 4ZHQF 4M99A 3KAKA 5C1PA 1SCUB 4M9CA 4O2BF 1JLLB 3K5IA 1EYZA 2YRWA 3VOTA 3HBLA 3R9RA 2W6QA 1E4EA 3OUUA 3TIIA 2CNVA 3BFPA 1E4EB 5I47A 3BSYA 5K2MA 4O81A 1BNCA 1I7NA 2YRXA 2V59A 2R86A 2R7LA 1GGOA 4O84A 4L1KA 2CQYA 4I50F 5H80A 2ZDQA 4WBNF 2VHEA 3KAJA 4E4TA 5JQWA 2NPOA 4FFPA 3SE7A 2I8CA 3ETHA 2GPSA 4MV4A 4O7NA 4C5BA 4O82A 2R82A 1KEEA 2FPPB 2W6MA 2GLTA 2GPWA 3RFCA 5IYZF 2YYAA 2NU6B 3R5FA 5LOVF 1GSHA 2FP4B 2W71A 4IZOA 4YJ3F 5LP6F 4DIMA 2R7MA 3AW8A 4XYMB 2DZDA 1IOVA 3K3PA 2YS6A 5EZYF 3V4SA 4O83A 2R7NA 4MA0A 2WYOA 5D8DA 4EGJA 4RZQA 1KJIA 4TV9F 4IWXA 2VPQA 3VPBA 5J2UF 2NUAB 4I4TF 3JZIA 3N6RA 4IWYA 3WO1A 5DMXA 4O4HF 4MV8A 1EUCB 5J2TF 2FPIB 2DIKA 1C3OA 2I80A 1B6SA 2YW2A 2YZLA 5GONF 1GLVA 4O7ZA 5LYJF 1UC8A 1CS0A 1DIKA 4YAKB 1CE8A 4C5AA 4MV3A 5JH7F 2NU8B 4MAMA 3BSSA 4TV8F 3TW6A 5JQGF 2FB9A 1W93A 4XX0B 2CZGA 4TUYF 3TIGA 4FFLA 3BSWA 4ZI7F 3VA7A 4O7RA 3JZFA 4O4JF 5JVLA 2YZGA 2I87A 5HV6A 2W6OA 3Q2OA 1CQIB 1KJJA 1M0WA 1KJ9A 1PK8A 3JRWA 2R87A 3MWEA 1EZ1A 4DLKA 4I55F 3GIDA 4FU0A 3KREA 5C1OA 3JRXA 4NYEA 4FE2A 3R23A 3QFFA 5BMVF 4GGMX 2X0SA 4O7YA 2W70A 3KALA 2R7KA 4IHJF 3MWDA 2J9GA 2HJWA 2XCLA 5CB4F 5C8YF 1EHIA 3VMMA 5KKNB 1WR2A 3WNZA 4HNTA 5BPHA 2GQSA 1KBLA 2PBZA 3AX6A 3U9TA 2NU9B 1OBDA 4YJ2F 4MA5A 4YB8B 1BXRA 4IIJF 3U55A 4EAAA 2PN1A 5BPFA 4EA7A 1M6VA 4Y8VB 1B6RA 1DV1A 5CA0F 3I12A 2QF7A 2HGSA 4QSHA 3E5NA 1Z2OX 4C5CA 1AUXA 2DLNA 4O7LA 3VPDA 2FPGB 5LXTF 1I7LA 1KUTA 1M0TA 4O4IF 2QK4A 5KX5F 2OLSA 5CA1F 4FFMA 2R6FA 1JKJB 4FFRA 1KC7A 2R84A 4MV7A 3Q1KA 4HQ6A 1W96A 1CQJB 4MV9A 4FGRA 3MJFA 3N8DA 1C30A 4O7VA 2YZMA 1A48A 4M98A 1GSOA 2YL2A 2DWCA 3BG5A 1VBHA
chains in the Genus database with same CATH superfamily
3ILYA 1KR5A 2O4CA 1R0SA 5THXA 3M2PA 1IN8A 2FPMA 5IC6A 1YVDA 5LA6F 1I9GA 4LSAA 2O2EA 4Z5XA 1FNSA 5CAEA 5JISA 5A6SA 1R10A 2OOKA 5BT9A 2YZNA 1VDMA 4MPRA 4O7TA 4L4XA 1W5TA 1C9JA 2AZXA 1EP1B 2G1JA 3RUPA 2JJ1D 4L22A 3PF8A 3VTFA 1TIKA 1P3Y1 4MWGA 1GOTA 3VSBA 2MMCA 5IMSA 1I9CA 4IUDS 2FMXA 2WG1A 1KR2A 2IYNA 4JEIA 4K81B 3R6WA 3TXYA 5D7NA 2FSGA 2O0KA 3REOA 4LV5B 4GLWA 1K86A 2XB4A 3SY8A 3HDYA 1J2JA 2LV8A 2P69A 1OF1A 3M4ZA 3WBJA 5K0FA 1CS4C 3TCNA 2P9ZA 4LHYA 3DAHA 2A33A 1VIVA 3VR3A 3OCCA 4TQRA 3FCYA 2A9OA 1XV5A 2IZ5A 2QPTA 3OHPA 3PT5A 2ZGIA 1XJCA 4R8KA 3C8HA 1CYEA 2H48A 1MO2A 5IC4A 4RH3A 4MROA 4MVJH 3RK0A 4LXUA 2QRLA 4DR2B 3KLOA 1RC8A 4A3IG 1BD3A 2O8VA 3ET4A 5KYWA 4WTOA 4UCSA 3AFMA 4CE5A 3OKPA 1OX4A 4J0JA 4FMCF 3SC2A 5JS6A 1L5SA 2WINI 3DB1A 2YKGA 4IV0A 3I39X 2WJ4A 1TVMA 3UC5A 1F3LA 2ONKA 2VHUA 621PA 4JL6A 3TMYA 1FNNA 3R44A 1SU8A 2VDWA 4YGYA 4UREA 1KZ6A 1REQA 3R4VA 2G80A 4RAZA 5JDCA 4S04A 4H3HB 3HDVA 2WD7B 3NHUA 2IU0A 3LYAA 1EVJA 3G5UA 3T4XA 2AX3A 4N39A 3DAPA 1FJXA 4ZOLB 2J7PD 3C15C 1WZ2A 1YRAA 1OT5A 3L8HA 3KBBA 1TWFA 1QF9A 4NABA 4Q3NA 1KK0A 4PXSA 1NN1A 4A0HA 3R0JA 3CZ9A 4Q4AA 4BXOB 3M1IA 2BCGY 4BO6A 3RFXA 5DGAA 2PX8A 2ZROA 1YDHA 4HSEA 3LUDA 1A9ZA 1C9DB 3OD1A 1NUQA 2XQJA 1STOA 4TTPA 3VTZA 1U99A 4HXEB 3LO5A 3QPVA 4CMKA 2WSYB 3CWQA 1JECA 3WMXA 4KQIA 1TYCA 5JWHA 2FV8A 1NBOA 3W3AD 2XWSA 3WJAA 3LA8A 3LUGA 4QXMA 3OT1A 3WISA 2BF7A 2QTRA 2BGUA 4RPJA 2PS0A 1UR5A 1D2MA 4AJ2A 3MVEA 2BTEA 2WNIA 3IQGX 1VG9B 3T38A 4A3BG 5B7NA 2E4ZA 2FE1A 2ZIAA 4IOMA 4KFRA 1QV6A 2QTMA 1W2GA 3ZHTA 3ILXA 5FTNA 4RQAA 1E3IA 4RB0A 2N75A 4BVEA 2D5AA 4U8GA 3KXDA 4TXNA 1DIBA 2VF8A 4H7PA 5F1PA 2FJUA 2PBFA 3IO5A 2WQ6A 3SKXA 3MG9A 4LSMA 4YUVA 4EAAA 4D9KA 4HL6A 1HDEA 5GMOA 4G9GA 1CXZA 3TE6A 3MJVA 1NNEA 5TR9A 1XU9A 1FFYA 5FBKA 2EG5A 4DCPA 5E9AA 1IU9A 3F90A 2YHIB 3NYIA 3JZMA 1WR8A 2VEOA 3K9GA 3MFHA 2WICA 3LO8A 1SEPA 2X2OA 2DGDA 1PFWA 4I4CA 4R4JA 1GVHA 3R5XA 5H81A 3P4XA 2AC2A 5E3HA 1OC2A 2XJ4A 5JMWA 1WQ1R 3SFVA 2XMPA 4P34A 2XHEA 3R7AA 4NJMB 4TTSA 1RPJA 5SZIA 2BAGA 1Q20A 3GCDA 4O2AF 1NQXA 4HOYA 2FVXA 3ABZA 5F77A 5KTMA 1GN8A 1DOHA 2WB1E 1RNLA 3RLFA 5BWTA 1NQAO 3L05A 2OECA 3TL2A 221PA 1K7CA 4PPNA 2NO0A 1I2BA 3HXMA 1TQDA 3M6AA 1KZ1A 4IICA 4GZ5A 1QB7A 4E6EA 1YOVB 2R47A 5FI1B 4IRCA 4BZXA 3PUVA 1N6HA 2CNUA 4FYKA 5IW8A 5U9CA 4IDNA 2HJHA 3K94A 4OMFG 2EP5A 2BHRA 5HIAA 3OKFA 5CH3A 1RM0A 4J4BA 1FYXA 3FD8A 4ED6A 3EPHA 3ACDA 2FPSA 4L0CA 4RE6A 3GRKA 2B83A 1EUZA 3U7QB 4LYGA 3DV0A 3BJMA 2Y1CA 1SKAA 2BZ1A 4PWYA 1PQYA 5AHXA 3FDJA 1AZLA 3ZU5A 4DR4B 3V46A 3WC4A 2IZ6A 4RWZA 3BQ0A 1JEAA 1UWKA 1N7HA 4D0LB 3OM9A 5DJ5A 4A3CG 2R8BA 5C8VA 4NONA 2E5FA 3FPSA 1XDNA 2R00C 2F7SA 3LPMA 4DDUA 3ZGXA 4FGLA 1OFHA 3F5DA 4CUZA 4E5DA 4YAOA 1CIPA 4R7RA 4RTJA 2Q9CA 3UAOA 4QNNA 3T1OA 5K03A 4RFVA 5CM2Z 4B3GA 5SYMA 1PWYE 2IKQA 4UXJA 1XWWA 1BDMA 4RIFA 2X13A 1YE5A 5BN3A 1BN7A 2PKYX 3U17A 5BV1A 1VJGA 2OQIA 4Q45A 1AUQA 3AR7A 3CX7A 1UJ6A 3C1AA 4OYHA 3QPBA 4S24A 4EEYA 3WGVA 1Z7GA 4G2NA 4MUYA 1JG6A 1G5QA 1G5IA 1GPDG 3AETA 1T2DA 1FNBA 2HC9A 4KIUA 3I2JA 1GGHA 1IQ0A 3NVAA 2BV3A 4IJ5A 1YHZA 4NFSA 3HVHA 5FI3A 3W79A 1PR1A 3ZCVA 2I3DA 2HJ9A 5MF6A 3B38A 1BA2A 3K73O 3R9XB 2PH7A 2QP3A 3U7RA 5JR3A 3ORSA 1ZCZA 5KVSA 2NQTA 4OJTA 4R1TA 1FTNA 5C4XG 4POAA 2BFFB 2EP7A 4LQCA 2R8EA 4KDEA 1H1TA 4HRVA 3A1TA 4Q12A 1S7GA 2FFAA 3IPAA 3ZGVA 3ZGLA 3PRHA 4F84A 2CE2X 2DFTA 2PBLA 1I3KA 5AW6A 4WRRA 1H93A 4AQDA 3M6VA 4QWDA 4OYRA 3LRPA 3NBYC 1HE4A 1LEHA 1EJ2A 4CBVA 5IU6A 2UUBB 3UCFA 2W8BB 2OVBA 4H1HA 4E3WA 2RK6A 1FFCA 2IJGX 4PW0A 3E03A 2TMDA 1GQSA 3P1JA 4LH6A 2X6QA 5MGNA 4EI9A 4ABYA 1ZOPA 3G68A 2IYRA 4QLOA 3SZLA 3OC0A 4BCDA 4MUIA 4OX9H 2EATA 3PQ2A 1N8SA 3NW9A 2JA6G 1VBKA 2ZBDA 2IW1A 4IJUA 4ZC1A 3GJXC 4GPBA 2FPLA 4F5EA 4B6OA 1GTJ1 3D5QA 2V1XA 4ESOA 3E23A 3INYA 1E6MA 2XQKA 4MTCA 1ZKMA 5KTSA 3JQEA 2HG8A 4RPHA 3NYQA 3O1IC 2NU7A 1RK6A 4U6NA 3CT6A 4O1HA 2C2YA 4UUOA 5CFLA 5IZ4A 3COSA 2B7BA 2GXAA 1XT6A 2HUNA 5J4HA 1GDTA 3UJCA 2VL7A 2ZQZA 2NUTA 3N39C 1ENZA 3L3BA 3RASA 2BM9A 3AONB 1CBUA 2II6A 1UJNA 1ZN7A 1ZCBA 2YWBA 5FO0A 1TJNA 1L1QA 4XE5A 4KFSA 4PZZA 2Z57A 1JJAA 3AM3A 2Y2VA 2MSDB 3OTOH 3O7MA 1FXSA 2AV6A 5L9XA 3EZ6A 4EY7A 3BB1A 3A1WA 4DRZA 3UBTA 4ECEA 3UMCA 3O4FA 1JFSA 3IIEA 2AR7A 1KE1A 1Z39A 3NBYB 2ZAMA 4D57A 4GZLA 5TRTA 4BQOA 4MQLA 1JQLB 2B1RA 4YLEA 1W8DA 4DLVA 2Q7OE 5KVVA 1IE3A 3CLTD 1Z68A 4EYGA 2HU2A 5ESXA 3IDSA 1AXEA 4YAJB 5JDIA 3WL5A 5FWAA 4LE2A 2I6QA 4J1TC 4LOIA 2R8HA 4UNQA 4LQ4A 1B00A 1SUBA 1TAQA 4Z0TA 1OWLA 2H85A 3V7FA 3GJXB 2ZJTA 4BFWA 1X9NA 1E4EB 1QZZA 3TDNA 3KKOA 2PEYA 2V4UA 2VPYA 2ZYSA 4I1IA 1BNCA 5B6PA 1U3UA 5DN6D 2QL6A 5BT8A 2AZDA 5EUQB 5BSMA 1KIAA 2IZ1A 1FVFA 2HVSA 3T6KA 3KYIB 3AL2A 4UZSA 4BV2A 4JI2H 1Q84A 2ABWA 2GAFA 3LDHA 3ZK8A 2BHTA 1N2CB 2ATVA 1EK2A 5ADUS 1VM6A 3BVPA 4YJ3F 2FR8A 4EYKA 4MKXA 3CVJA 2GUGA 1Q0UA 2OENG 4OFZA 1YAJA 1OXBB 3EVGA 3RTAA 5JT1A 4O83A 4IHQA 2VJYA 5JIBA 3P96A 1L5WA 3MRVA 2VF7A 4C08A 2EJ3A 3TXXA 3EXHA 4QGBA 2ZAOA 4MCHA 4M8KA 2O8DB 4UZFA 1RDFA 3M5PA 2VHZA 1BRTA 3TUZC 4BQRA 3FA2A 2Z6QA 4Q02A 4CMCA 2K7FA 4K0RA 3P5SA 5JQGF 1XMXA 2JBAB 3FMAA 4QQRA 2ZUDA 1F8YA 4UE2A 3UUGA 3LQ4A 1E7SA 2AJLI 3QFHA 2GT1A 1Z0ZA 4OK6A 4F5DA 1QKIA 3UAGA 4JZYA 5CT5A 1SKYB 2D1FA 4AZ3A 2ID9A 1C3JA 4NJEB 1TCUA 3UMFA 1ONOA 3IX7A 3KDSE 1PK8A 2WVJA 1S8AA 3V4OA 1EX9A 5CDUA 4HZGA 1EQUA 1HFJA 4JYAH 3TRIA 3B1WA 3IULA 4EPYA 3KALA 4UM7A 3HLTA 2QS9A 2GKOA 1PW7A 4KJXA 4KR6A 4WQMA 5EMLA 3P19A 2PR2A 2OGWA 1OPRA 4KSYA 3EGCA 1FSFA 2NU9A 3G0GA 1VL1A 2WJAA 2Y27A 3AI1A 3LRTA 2XCPA 4POOA 2ZWIA 3A4NA 1LU9A 1E7MA 2ON6A 1ZY2A 4YDSA 2IHTA 4PRKA 4ZVKA 4MPJA 4YYEA 2C8VA 3NRCA 4XR9A 3WNCA 1JAYA 1KBQA 4P22A 5I7FA 4ZI7A 5KTKA 3NIBA 2GRJA 3HUUA 3ECCA 3GOQA 1NU6A 4YRPA 1IY8A 3TL3A 4IXNA 2W37A 4URZR 1K4MA 3GRYA 2Q4OA 5CT8A 4M98A 4X1KA 1ESMA 1JJVA 3UIEA 3R3VA 4ZQGA 4PHCA 1EM8B 1QWSA 3BPSA 2R5FA 3FMVA 3Q9NA 2PGIA 4Q4HA 1Z38A 3HO8A 2QIPA 1YMQA 1GCGA 3UFBA 2ZWAA 4K9PA 5ENDA 4LKRA 1LDEA 2GESA 2FEKA 2BI7A 3EN0A 1I30A 2HO4A 7REQB 5NLLA 4AUEA 4YR9A 3EPRA 4WACA 3AV0B 2B5VA 5LUBA 2BFCA 4JYMA 3AF5A 5FORA 4KCGA 3AR5A 3GLHB 4E88A 2OHXA 4YS6A 1T3TA 2JHPA 4DLNA 3V8RA 1OHHD 1N33B 2RG1A 4KQMA 3ORQA 5AXCA 1SU6A 3IR7A 5K3FB 1JHAA 2C4TA 3RAPR 3GLIE 1JG1A 3M1LA 2Q3EA 4GSLA 2R8OA 2O1WA 3D3EA 2REQB 1HZZA 4YXWA 4Q9IA 4B3HA 4QUBA 1NVBA 1RJEA 1SBNE 3R41A 2HA2A 1PYDA 4CF5A 1PF7E 5C3MA 3OFJA 2I6TA 4RVUA 1J8FA 3UAYA 2CLOB 3E9NA 5GWXA 1T3ZA 4KQ2A 2HSEA 2Q46A 2RG7A 3FSGD 3MJHA 3K8OE 4PDBA 4B17A 1V11B 1WXFA 1CZRA 2DPXA 4LK3A 5CM8B 5FV4A 4Q16A 2F9LA 4UU1A 2MR5A 2H1CA 3W5CA 3NHWA 3WDLA 3NDPA 3V8EA 2ENWA 3RUAA 1NLUA 3EAQA 2XVMA 3LL7A 4DBLE 4PAQA 4UDXX 3BB4A 1WS6A 2NPOA 2HSGA 3D6VA 3UV7A 4MKGA 4TYYA 2WB4A 2I7TA 4LV6A 4CN9A 5DTMA 4A3JG 4A3LG 1GNVA 3F2IA 1SOWA 3CINA 1GFZA 1U7ZA 3I42A 3F4LA 4E1VA 5LOVF 3UUEA 2ID7A 3G79A 1ZCJA 3QMWA 1I3QA 3BT7A 2DLDA 4YAEA 3GJSA 3HYSA 1RRKA 3HFRA 1CUYA 3PC2A 3D3WB 2BKUA 3TNYA 4G8BA 2PD4A 1L3BA 3UT5A 4LZWA 2OY0A 5EXTA 1H3NA 4L0DA 1Z3CA 3MIZA 4CT5A 3GAAA 4CDMA 4DLPA 3U09A 1CUCA 3BJEA 2GZ2A 4NYIQ 1UADA 4FHDA 3FI0A 4RESA 4F2WA 1TWAA 3FAZA 4TT3A 5GJWC 4ZU1X 3HR4A 2I9KA 1W30A 1IHUA 3H1FA 2ZE7A 2HDWA 4N0QA 4HWRA 3FSEA 3K6KA 2MTBA 3CG0A 4PGAA 4MMXB 2CB9A 2UUAH 1Y1WA 3F6RA 1L7BA 4O4JF 1D6JA 4I6JA 3C0KA 1DMRA 5AVJA 1DC7A 2B8JA 2EIHA 3BBLA 3NDRA 2BRUA 3GAZA 3M3DA 3VPFA 1IWOA 2ZJ5A 5JASA 5FPSA 2O19A 3L7YA 2XKAA 5ICMA 4ZAGA 5FL7D 3KHSA 4N7RA 4NE9A 2D4HA 4RKYA 3KOMA 1EHIA 1GXSB 1MJHA 5KFOA 2QSZA 3PFBA 1CU1A 3FTPA 4UAUA 5J2UB 4PCAA 4YUZA 4RGBA 4FOLA 4B83A 4CF6A 3QNWA 4FOPA 4YB8A 1NM5A 1C0LA 5BWCA 1NIPA 4WI1A 4ARBA 5J43A 4EBBA 1V35A 1HE1C 4M1OA 4HRXA 5KNCH 1N2ZA 4DARA 1Q11A 1VP9A 4I8XA 4QAQA 2ZYGA 2PO7A 1ODTC 1NLZA 3IKMB 5C3UA 4M54A 7GPBA 3RG8A 2YNMA 4KMMA 2PSHA 5A5GA 5LNK1 1CQJB 4FGRA 4DKJA 5KFNA 3WWEA 5ALHA 4DR7B 2YL2A 1ZL2A 1PNVA 2YHAA 1GGMA 1DL5A 4L6AA 4PINA 4G0MA 2GJ9A 3ZZ0A 2ZRDA 2BBOA 3AEQA 2HIHA 3PQCA 2PV0A 3H20A 1KI6A 1VHDA 3PHIA 2NTJA 4PM4A 3WZ2A 3A4TA 3C1OA 3V1MA 3AY6A 1JDEA 3ENQA 5FKJA 1TA8A 1WCV1 2OPHA 4PQYA 1NN5A 3QK7A 1SQ0A 2RGNC 4FFOA 3MJSA 4WT7A 4BBSG 5LZ7A 2RKBA 3TB6A 3IDQA 4ANFA 2H4ZA 5EKTA 1XEXA 4OK5A 2F9FA 1HFKA 1Y81A 2HJVA 5DGBA 1DIOB 3WGNA 1TO2E 1O6GA 1UUFA 2YXBA 4KG7A 4X92A 4NS4A 2I4TA 4BKPA 3PGXA 3EC1A 2G25A 3K1JA 3P71T 4D26A 4OB6A 4XCXA 4ED3A 1ZEMA 2JB9A 2J9ZB 3JARA 3NVDA 2W57A 2V9CA 4HNAA 5COAA 4TX1A 2AJTA 2LWIA 4RADA 4B3MH 2R8GA 1FP2A 2Z2JA 2HMUA 3JSAA 1I10A 2RJ3A 2QRVB 1OXSC 2Y1GA 3NAZA 1RYRA 4M99A 1IZ7A 3CE9A 5BRAA 1THZA 2C22A 4N9QA 3O8DA 3Q7TA 1YZYA 4ROSA 2YYZA 9LDTA 4KAXA 3WKAA 1X92A 5KFEA 3STVA 4LF6B 1C0EA 4BE4A 4RZRA 3ZYZA 4I1SA 4WW0A 4LW8A 2XGPA 3O2QB 4JLDA 3RS7A 1UXHA 3EW9A 4QOGA 3TDKA 2DYKA 3L77A 2H65A 4FFPA 2I8CA 3SI7A 1L2ZA 4NJOA 3NI2A 3U4HA 1I0LA 2JAXA 5HCNA 3ZY2A 3SYLA 3GARA 1BXZA 1SQ6A 4QLAA 3AHIA 1T2AA 4BU0A 1SXJC 2JAUA 1UM9B 3G7NA 2IOFA 1XCLA 5JO0A 3LCUA 5T3UA 2YIMA 2PJDA 4NHOA 5KNLA 2IYOA 2JK1A 3N0RA 2OSBA 2O8BA 4LCJA 3N0TA 2JA7A 4EKGA 4FMBB 1XDDA 3IJRA 4C4PA 2UUOA 2D6FA 4K5QA 3VH3A 3AILA 2CBGA 5JEEA 3BJYA 4EG3A 3RAGA 1G64A 4UCUA 1WUKS 4WK6A 4N0EA 4U2DA 4G1FA 3MPOA 3SEZA 3OZUA 2Y1KA 2OHFA 2GVNA 1Z37A 3F2VA 3TVTA 4MYUA 5AP9A 1CUHA 5I4CA 3ZLUA 2NVUA 2LCIA 2VJKA 2C4WA 1EVYA 2FG5A 4RZ3A 2OBFA 3W5BA 2DWQA 3QEKA 3ELUA 3SFTA 4Z86A 1Q7RA 2OZLB 1PK7A 3L84A 5DX8A 2X19A 8LDHA 3DVRX 3NOXA 2VNJA 1YCFA 2W70A 3NETA 2R7KA 3JQRA 5HGJA 4HY3A 4OKSA 2F8TA 2R93A 1YKGA 3PNOA 4TV9A 3WZLA 5MFPA 2AI2A 1NYRA 1T9ZA 4DAOA 4EYQA 2G1KA 3KKNA 5B5SA 3DQPA 3UH0A 1JAIA 4RA9A 5EAIA 3BWVA 1VI5A 2WIDA 2HHHB 1FZTA 3GT4A 2UU9B 3O75A 3RG2A 2BR5A 4DV7H 1C81A 3DGFC 3X43A 5CA0F 4X95A 2PUTA 2C54A 3B6IA 4I6EA 3RUHA 2QTBA 3HWRA 1H8HD 2JEGA 1JAZA 4DGQA 5EUMA 3EYAA 4D4GA 3Q1KA 1XTBA 1Q44A 1XQ6A 3SHOA 4IJKA 3O8OA 2HPAA 4LC9A 1XMJA 2QVLA 3A1UA 4A1OA 1E92A 1JKFA 3D4BA 3VR6A 5B7PA 3QU5A 4I3HA 4KITB 1W4AA 4IHJA 2W2TA 4EG5A 5KT3A 2TECE 2FK1A 1KXJA 1PDVA 3B1JA 4BIIA 4DWVA 4E03A 1JA0A 2V54A 2BVNA 3SZUA 1CUGA 4G9EA 2LP4Y 4LA4A 5JXIA 3TX2A 2HFKA 1VJCA 5JCZA 1F4LA 4XYGA 4F5WA 5D6NA 5KJFA 4EHAA 2PV7A 1YB6A 3AP1A 1MPXA 3CUEF 1EUDA 4M9ZA 1XZPA 4JBWA 2Q99A 2ZSFA 1L5RA 2O03A 4FYYA 4YDHB 2Y0DA 5KOJA 1UKCA 4B9EA 3UC9A 3I01M 3GA0A 3ZLVA 1H3FA 1ISGA 3JASB 5IJXA 5CFQA 5H83A 3V1UA 2MOKA 1OYVA 2GFQA 3F6EX 3E70C 2ONJA 4AQ7A 3OQMA 5LQAA 3Q7IA 4OM7A 3UV3A 5DBOA 2QENA 1N6NA 1N0VC 1LI5A 1SQSA 3BERA 4UNPA 4JY7A 4LWZA 3W8RA 1TUBA 3I58A 5NULA 3RS9A 1V2HE 5F5NA 2QN3A 4GHWA 2PWPA 2HT6A 4CM1A 5FOTA 3RJ0A 1MQSA 4REQB 1OCEA 3S7ZA 5M7EA 4CNBA 1IJKA 1EJ6A 5J47A 1I3NA 1USVA 2GTHA 1R88A 3IQDB 1BVRA 3AYXB 2F8MA 1ESCA 2V59A 3L6OO 4NAHA 4BLRA 4F2DA 4YNBA 3OFKA 2ZI7A 2GK7A 5BXYA 1MP0A 4EY8A 1KDOA 2AJDA 3EPPA 3H9JA 4B1FA 2V5VA 3FOEC 4J0IA 1NASA 2NU6B 4GYJA 2G4VA 3FDZA 3ZNQA 4ZZ0A 2I7CA 1P1KA 4PYNA 1SOMA 5ER6A 3ZHOA 3ROZA 3FSGA 3CBGA 3JQFC 4U2BA 3D8TA 4Q21A 2SKEA 4XM1A 3UT0A 3HJNA 1E4YA 1AGNA 3O9MA 1ZA1A 1K83A 2ESRA 4XUEA 1EJ0A 4II7A 4Z7JA 3LBIA 3LVBA 3L8ZA 2D5IA 4JUIA 3WO1A 3KE8A 4ZVQA 4CIYA 2VA9A 2WIKA 3VDMA 2HVRA 1DLIA 4M9SA 3GLIA 4QXRA 1AJEA 2GF0A 1PD0A 4RJTA 4C87A 2OQ2A 3WMEA 4E46A 1J5EB 1FRNA 1JJFA 1QF6A 4HADA 4HH3C 1C0KA 3H4MA 3DW1X 2MSEB 1BXKA 1SBTA 1KEWA 2FUNB 4Q15A 5HFJA 3MWMA 1JU9A 4KL8S 4JJ8A 1QO7A 4DIBA 4Q9DA 1JR4A 5CPFA 3L7OA 4A1FA 2VK8A 4RNDB 4TWIA 4GXQA 1GPAA 3PPIA 1UAAA 3UA3A 2BEVB 4XXHA 4P58A 2BZ0A 2YV3A 3WL3A 4H7HA 4WZAB 3LDGA 4GBJA 1U63A 1W48A 3H11B 2KYRA 3QFFA 2B1GA 2X0SA 1TGVA 3WGJA 4X90A 3T54A 4A0FA 1QHHB 5F7ZA 3TI9A 4HPXB 2VSQA 1PTJA 3G5AA 1YU9A 2KWIA 3O1LA 1GUZA 1RADA 1AMOA 4QHSA 2E4VA 4GLFA 4G41A 1OWPA 3A4VA 3LIIA 4NECA 3IAAA 4PWQA 3LXUX 2AMVA 2CSXA 1IHOA 1XX6A 2FF7A 1V4VA 2V3WA 3N2YA 1BW9A 1XSEA 5KX5F 1WZCA 3HK2A 5BQFA 4BBRG 2AGQA 3FG9A 4M60A 4DNXA 3G0HA 2Z8YM 5A5EA 4ZYZA 5JZOA 2I2DA 4QGGA 5F3RA 4Q3AA 721PA 1UP7A 1JR3D 2VBCA 4B31A 3ICVA 5F51A 5F5XA 3K0AB 3OQIA 5DP1A 3G7UA 2PMWB 4HK4A 4FGJA 4E5YA 3ICQB 5EIXA 1ZD4A 4EPWA 3KVVA 2DBZA 3ZWWA 4B8YA 4BPRA 4ZC8A 3I2HA 2PVPA 1NPYA 3TINA 4ED9A 3RK1A 4S1WA 3VR4A 4QPCA 1FL9A 1Q7TA 3S2FA 3O9VA 5HKAA 3OEEA 4Q18A 3E9DA 5BYJA 4B2PA 1SZDA 1SG6A 1P2DA 2IH4A 1H4TA 1WCIB 3RWBA 5I5WA 2XB9A 4BUCA 3HA5A 3H97A 4TWBA 1G2WA 3KQHA 4ZIRB 1OLXA 4IS2A 4MW1A 4R1NA 2V65A 4QWMA 3MJ4A 2H2HA 3P7MA 3FWZA 1EFTA 1TCAA 4O4IB 2QD4A 3LX6A 4UHBA 2I33A 1EXWA 4OV6B 4BWSC 3UJNA 1Z4OA 4RE5A 2D7CA 2P3LA 1UBSB 1LJUA 2O3SA 2QOEA 4DV5B 4P0TA 1OWTA 2FKNA 3ESRA 5JRDS 1CVLA 4JLNA 5TJ9A 2QRPA 1R16A 3ILSA 3GUUA 4AXXA 4Q4LA 3QWFA 4GMGA 3VPCA 3W9SA 3RRZA 3LP5A 4A6EA 4IEEA 3VH4A 5LR6A 4Q7MB 3WLMA 1B8VA 4NNOA 4BDSA 4BV3A 2QL7A 1SHLA 4QU8A 4Q82A 3OLWA 2PX0A 3PVZA 3FPBA 1SBQA 2RD2A 1NMQA 2O48X 2AFIA 2I29A 3EF0A 1LLQA 1K2WA 4LZNA 4LHZA 3GFFA 1MB0A 1X9IA 4KQ6A 2VHQA 2FW7A 3LTNC 3F78A 1ZGCA 4B8ZA 2JAPA 2OCKA 1P0PA 4HUQA 3T1NA 4E2FA 5FI5A 3TLCA 4W9MC 3ER9A 2PKQP 3UJ3X 1N5MA 1QQ7A 4RB1A 1E9EA 2W43A 4DG8A 3CM0A 4E5PA 3N0XA 4TMTA 2ATLA 1JF8A 3CLSC 5EZYF 5EQDA 8OHMA 2X0JA 2ZJ3A 4QW9A 1G60A 3DQZA 1Y3FE 4EG4A 1RI2A 4YQWA 3ANTA 4MMYB 5AXBA 2QZPA 4HAIA 2NVOA 4LJYA 4FDVA 4KN9S 3TLYA 3JZIA 1IEVA 4MW2A 1T1EA 2GILA 3ZCRA 1XCPA 1C2YA 3K0SA 4LJRA 1C1DA 4HLUC 1Y4ZA 3WFJA 3KJGA 3W5VA 4AECA 3ER6A 1C3OB 3V4RA 3TM4A 4F4XA 4DYDA 4NSNA 1E5VA 1RI3A 3ME5A 5TSDA 1YV9A 2J0UA 1QGYA 3PEWA 5K0CA 1T9DA 5H9WA 1EHCA 1T5DX 4RY9A 3DLBA 4WFIA 5K6RA 1Z22A 2C03A 4Q03A 2A1HA 4KQWA 4AYXA 1QP8A 4MZXA 2PSEA 1E62A 3KREA 4KSBA 5FB3A 5FWDA 2IFTA 5JNTA 2F1HA 2J6HA 4B81A 3E8SA 2YWFA 1VGVA 4JI8H 2CXOA 1GPWB 3T5KA 1ADBA 5CNIA 4B6RA 3A3YA 4CCYA 2BM1A 1GUFA 3HEBA 4XA8A 3PGVA 1PGJA 2D5BA 3R4CA 3SSOA 5EGSA 2CXQA 5HVNA 2DKFA 1FMTA 2BTQA 3L07A 1PG0A 3OPYI 4V0MA 3K0CC 4WSOA 1ECBA 3S29A 3C7TA 2IUUA 4LJKA 2OLKA 1YMUA 5DWDA 3Q15C 1BA3A 1KRWA 1PFYA 1CV2A 4U39A 3V1NA 1PRYA 3M9MB 4NOJA 3HCFA 4CQMD 1LK0A 2NSYA 3DNMA 5DI3B 1VMDA 4GNKA 3G0IA 1Y1VA 4ECAA 1A5BB 1YZFA 4F6RB 4DM4A 1B6TA 3PUWA 1O5TA 4YHHB 1HE5A 1H5NA 1M8PA 5DX0A 2NMVA 2HXYA 4TLLB 4K8RB 4LSGA 4Q9HA 1L8XA 3SQLA 1EI9A 3QNMA 3IXMA 1BJKA 1HF3A 2GF2A 4L8YA 1BMDA 3PDIA 4Q43A 1QGAA 1Q15A 2BQ3A 2OCYC 3G9XA 4L5JA 3NDBB 1N92A 4H08A 1D4ZA 3WIVA 4N49A 4XEUA 3HWWA 3U39A 3G8YA 3ONWA 2OUIA 1LB1B 1VHTA 1YKFA 1DCKA 2P9QA 3HKBA 4FFBA 4GQAA 1KMIY 3W7AA 1PTKA 2EHDA 3RVNA 3QOYA 3LQKA 3PHHA 2GEBA 4F3CA 3CF4A 1BCSB 1DV2A 1RJGA 4DC9A 1J0BA 3M3PA 4JR0A 5A2QW 5I5EA 5AHKA 5FADA 1P4GA 4O08A 4KP7A 2VJMB 2NXJA 1NC3A 1MA0A 3QVGB 3H2BA 2QLMA 4BFXA 2C4MA 2DWPA 4GKAA 2ATIA 3TE7A 3OFND 5I5SA 3T3HA 4E3ZA 1Q22A 3AKZA 1Z45A 3O4HA 3VO9A 2NP7A 2BR0A 4UAGA 4YK7A 1SBCA 2B2CA 3P2EA 4B74A 4HDAA 3TOVA 3R6GA 2CYBA 5FLKA 1MO4A 2OV8A 1B14A 4TLMB 4C0JA 1VKJA 4FS1A 3K20A 3E15A 4FIDA 3D4OA 3V6HA 3KYCA 1CY6A 2YZ2A 2IE8A 4U6SA 3DMGA 1M74A 3WXMA 1XZ8A 2J30A 3C3DA 2Y0CA 2RKWA 1TZKA 3J7TA 4I8DA 4CGZA 4EY5A 1RU3A 1L3CA 2R8JA 1CJSA 3L46A 3WK5A 3ENWA 4ARCA 2P2LA 5IXSA 3UN1A 2JH3A 3UCXA 4YJHB 1ORRA 2C78A 3QYPA 4UD2A 3NTRA 2MT9A 4IRXA 2O3QA 1ANKA 2VCHA 5HIJA 4GP9A 3NPMA 2DZDA 1BE8A 4OSEA 4DZTA 2IYAA 3O8RA 3GTKA 2NW6A 3DMTC 1RBMA 1D2GA 1G63A 4PZ6A 2PYZA 4BEBA 4W5RA 3A6DA 1J24A 1XTQA 3LBAA 4MP6A 2YVQA 4MUAA 2XUJA 4Z2YA 3U0VA 3OKCA 3RTXA 1RXUA 3A9RA 4AMGA 3WB0A 2WYUA 3R7BA 3FAKA 4BMCA 3L43A 1DLJA 4JFRA 2SHKA 1Y1WG 2DR2A 3CPSA 5D87A 3P27A 3U48A 2EP8A 4L5BA 2Z5GA 1F12A 1G21B 3GCWA 5E1BA 4WCVA 1ZOSA 3M9OB 1P9RA 4JJEA 3T95A 5IM4F 1WIWA 1VE6A 4JQYA 1RYYA 4H18A 3VSAA 5KSPA 4ALJA 1V3VA 4C43A 1ET0A 4CKWB 4MR7B 4O59O 5BUCA 2QM0A 2VPXA 5C34B 4R5HA 3JV7A 3QY9A 4FCTA 4RHUA 1ZUHA 3DE4X 3VZBA 2H92A 4MQ4A 1U0OC 1ZEJA 2LDXA 3CF6R 1QH0A 1XK5A 2DFPA 4H7DA 2XTZA 1DO2A 3Q0EA 2C7OA 1O5IA 1JDZA 3SIRA 3MFIA 1OGJA 2G9QA 3B60A 4XWWA 1GA6A 2MWMA 3ZBUA 3ZI7A 2WF5A 2ZSAA 2F1JA 1N5KA 3ENNA 2UXCH 1EXMA 1RM4A 3TYXA 1F51E 1K4KA 1V39A 4ITUA 5H59A 1WXXA 4W1PA 5B53A 2ACVA 1FLVA 1NPTO 3DOEA 3SVLA 4Y2VA 1QOPB 2DFKB 1KERA 2OB1A 3ESYA 1YQDA 2NZXA 2YCHA 3DBRA 4K05A 3LCJA 1N2EA 5BR8H 3VV2A 3NGMA 5C5IA 3ASVA 1K1QA 5GADl 3D1LA 1A48A 5DXFA 3MWYW 1U3VA 3SNOA 3AR9A 3ZK7A 1RLIA 4GI1A 4IRDA 4DQ0A 3EE6A 1JX4A 4JBIA 4FT4A 5BMVB 1QZTA 4U63A 4KUHA 1KEPA 3FNBA 1P62B 4JX8A 4HAUA 2W6NA 2I4IA 1XVAA 3RSHA 2HIAA 2I4LA 3D31A 1S0OA 4UUGA 4OI4A 5E4JA 1OFVA 1JE0A 1ZCAA 5CX1A 2BBTA 4HWSA 3OOYA 1DJNA 4S1OA 4V03A 4MW5A 3TQQA 1Q1BA 3O8QB 2W4MA 1Z29A 4R9UC 4ARZA 3RRYA 2GK6A 1Z28A 4M0UA 3HOYG 1GUBA 2HMSA 3LY5A 4QBTA 1PHPA 4EVRA 4OLFA 5AVUA 2D13A 2VTEA 4XWGA 4IMIB 2PMZA 3NATA 2NO4A 2BEUA 3GT7A 3UV6A 1QTRA 4JU9A 4G8CA 1RZRA 1YBFA 3CW8X 3RAJA 2NUPB 1VIMA 2XUKA 1Z0UA 3H2SA 3CB4A 5AW2A 3Q7RA 1GT91 2JEIA 1WD5A 4OHZA 4G56A 3BAAA 4RDHA 4UFNA 4RDXA 1S2LA 5LU9A 1LS1A 1TMYA 4FINA 2FFRA 3KTFA 5B1YA 2CNVA 5LKAA 4WH0A 3U3OA 3UO8B 2FK7A 2EAUA 5LPNA 5KINB 2BM8A 2R86A 4EUEA 5KNDA 3LGAA 1YQUA 4XWAA 4UBMA 3SE7A 4X6XA 4MP8A 1GGJA 3QNUA 2GK4A 1N2OA 3H1AA 1CY2A 1TFRA 4QIHA 3TZHA 3WMRA 1WLSA 1IBMH 2GLTA 1E5XA 1QH1B 3LDFA 2YC2C 3NCHA 3ONEA 2ZYWX 4DIMA 4BX8A 3ZDDA 4IF4A 2CNOA 4NQZA 3ZTWA 4OMDA 1RYSA 1ZAUA 4LF8H 2JA7G 3ESBA 1DAEA 3FDSA 3WJ7A 1HT1E 3LLUA 1QP7A 2R68A 2WWFA 3ST7A 3K6SB 1MX5A 4Y7CA 3KEOA 4OQQA 4NXNB 2IVZA 3G9ZA 2R8YA 3H2IA 1SUWA 3F5MA 2WHQA 5FLXA 3CCCA 4OPMA 4CMJA 5IP5A 2CMKA 2YW2A 2W7OA 4F5YA 3PQDA 3FOFC 5AW1A 1DJLA 3HWSA 4L2IA 4BMNA 1UQRA 2HJSA 5KYUB 2RSLA 3S7TA 3V42A 2UXBB 3JVVA 3PLAE 4LFCB 3TMAA 1S2OA 2KQUA 1V4BA 1QG2A 5AUNB 2H9YA 4MJ3A 1I3LA 2NTEA 2V4MA 3JRWA 3HRKA 4BGUA 1FFAA 1KC1A 2X0KA 4Q34A 2XYPA 1N2IA 4ECZA 2L42A 1CR4A 2JF0A 3WWPA 3LPLA 4FQ7A 1FY2A 2ALJA 5JE8A 3RT9A 1E2MA 4GG1A 2V6BA 4WY2A 4RTSA 4CC6A 4D80A 3JAWA 4EGAA 2E9SA 4PCLA 5EE0A 2IOYA 4TS1A 1EEHA 4OQZA 4R71A 1N48A 2DWUA 1ZNZA 1AQ6A 1I6MA 5M3BA 2DB3A 1JQBA 3S1AB 2PN1A 1TW2A 2QN1A 3WWYA 2R97A 4M0MA 3LKBA 3BQNB 1VIDA 4W5JA 4ZEWA 1V6SA 3FYDA 3FUVA 3N2EA 3FGPA 1N2JA 5LLSA 1RKBA 1P7VA 1EEXB 2PAFA 4XPZA 4QLBA 2JJ1A 2RBEA 4E33A 1GUYA 2O3JA 4ZOBA 3HR7A 1PGNA 1JEYB 4RVNA 3A1SA 2DJ5A 2VJQA 3O2NA 2ICAA 2GEVA 4H17A 2YOFA 3KU4A 4G5GA 4IILA 5AQEA 4YH1A 4L8GA 4NE2A 4MV1A 3UH1A 1NN0A 3W05A 1XNRH 2J3IA 4MRAA 5A9RA 2VO1A 2FQ1A 2EFDB 3FNFA 4F91B 1N34B 2Q5FA 5IUJC 1UFVA 4MI6A 1OFUX 4FNMA 2J5QA 3OLVA 1NVVQ 3HOVG 5EC8A 5DM2A 4CEIB 3RYFA 1JEQA 5BR1A 5IABA 1S02A 4EG1A 3EA4A 2PSFA 3A1FA 1EKFA 4JV2A 5KFKA 1WVMA 5CDSA 1IMOA 2HIMA 4XWTA 1KFBB 4EJSA 3EQZA 2JRLA 4XTRA 5KG7A 3EG9B 1AKRA 4UHFA 3EAFA 3IE2A 1U9CA 1H6DA 4J0EA 5BWWA 1K3UB 3TY5A 1K6IA 2H06A 1YRLA 2FJPA 3TJZA 3G88A 4WOKA 3IEIA 5FNVF 4JQOA 4RTPA 4YI3A 3ZZNA 4N5NA 1RAHA 2RHOA 2W2KB 5E3JA 3RIEA 2ZT5A 4NRDA 3KYDB 3KX2A 5K6AC 5K45A 3CC8A 1L6RA 2CXRA 3I6ZA 5KJEA 2XW6A 2RB5A 3IVXA 5IKPA 4ESVA 1SHTX 2ZTVA 3MQ2A 2D00A 5AUQA 3M82A 2FN3A 3QMMA 4IO1A 1T6YA 1NDQA 1XEWX 2R44A 1S2GA 2J7PA 2X1LA 3NEJA 1ULUA 4UXHA 1Q19A 2YZKA 3CEBA 1DQZA 5DF1A 2E4XA 2Z6UA 1UKZA 3N2NA 3RF2A 3TEJA 2L69A 2VT3A 1VSTA 3HB4X 1TM2A 3HEMA 3N9IA 2PMEA 4P0PB 4OBBA 4RHFA 3GRUA 1ZKDA 3EW7A 4WKOA 1L8QA 4WKPA 3FYHA 5CA1A 2V97A 1RHMA 5AIAA 1NT2A 2NAFA 4RK5A 1OBVA 5AW3A 2JGAA 2R11A 5I9LA 2VUHB 4BZPA 3KKQA 1GL9B 3W3AA 3UHAA 3WNDA 3EVZA 4NNJA 1VSUA 4MVJD 4CR8A 5A3RA 1WNTA 3L7LA 3IILA 3O83A 2JKVA 3VPHA 4ESEA 5B1DA 1RLUA 2OG1A 1N5LA 1XZJA 4YIHA 1YVPA 3ZBTA 1GDDA 4QICA 1GCIA 3OLYA 1FTQA 3HUEA 3AHJA 1UC8A 3D3KA 2IL1A 4QWAA 1NA5A 3M6FA 3AUTA 1EXNA 2ZSUA 1IZZA 2R1TB 3LT5A 2AQIA 1ZMBA 4BLUA 2XUHA 4DG9A 3BMXA 1XYYA 4PPQA 3U7GA 3AEKA 5ELLA 4MV0A 4BZWA 3C6YA 3K9CA 1KJ9A 3DR5A 5M04A 3KSMA 5EHIA 1T8SA 1PQ4A 2OAP1 5TC4A 3AM1A 3HYRA 1KTVA 2ZR8A 2JLAA 4H4CA 4B34A 5I9TA 1DINA 3BD7A 4CWAA 4YMHA 4L0QA 4J2TA 2FG6C 4KXYA 5C8YF 4WMLA 4GUDA 2ERYA 2IXGA 5ALVA 3PGMA 3R76A 2E21A 1OXMA 3IDAA 4RZIA 3BE8A 4OJKA 2N0SA 3KKPA 5ALWA 4CCAA 2RCNA 4IKOA 3AHCA 4JA0A 4ZO8A 3SLKA 3R74A 3UGJA 2X9VA 3HGQA 3NM6B 4C5CA 2FFJA 2WPDD 1JJBA 3QZ7A 5G0VA 4TLCA 4QVIA 1PWEA 1X42A 3SF8A 3E9MA 1EFLA 1SPBS 2D4AA 2CDCA 3H1EA 2IT1A 4EPRA 2W9XA 4E51A 3I1YA 4QWEA 3JQAD 4BKMA 4CLRA 3RF7A 4BTEA 5G0TA 3ZCPA 1UWVA 4HAYA 3ZV5A 2P4UA 1AK2A 1DHTA 2D1SA 1BHSA 2AIRA 4KQHA 3GDWA 5JXHA 2RI6A 1HNXH 4ARAA 1GRVA 5E7MA 4OQFA 4PWZA 3SHWA 1EGAA 4JITA 4OYYA 3TXAA 4HDNB 4O6VA 5ICGA 2YRFA 1GTVA 3NC1C 5BSGA 3TD9A 2Y0SE 1A97A 3CSWA 2JNWA 5FOXA 3WV4A 1U5BA 1H2FA 3BIWA 4OGGA 1T35A 5KYXB 3DP7A 2YDXA 3QEAZ 4ZQIA 4XYLB 1FKAH 4EUFA 4GI3A 3U1TA 2J41A 5AW4A 1GQ2A 5C7OO 4BO2A 1GZ4A 4X84A 2NPIA 4JBXA 1T2VA 3THYA 4P8RA 2XMQA 2G0AA 1VXRA 5FJJA 3QVMA 1HQDA 1WZIA 4AJOA 3VZDA 1T4MA 5HE8A 1MNQA 5IUNC 5JJ5A 1G3RA 2GJ8A 5HBRB 2ZRGA 4LRWA 1GUDA 2J46A 3LJKA 4TN1A 3ACBA 5FOSA 1SK8A 2BFWA 2UKDA 2ZYHA 2C0QA 4JWTA 2RARA 2PXCA 4RTRA 1HMPA 3TCKA 1TKRA 2Q21A 4DDHA 3LS2A 3AF4A 1BWSA 3DPSA 1SB9A 4XDGA 1S4QA 1S89A 1ACMA 3H83A 3AB8A 4JP3A 1FNDA 1RXIA 1AS3A 1TQ2A 2QTHA 2QD2A 3FLAA 3IVMA 3LM8A 4R2MA 3IKLA 1V96A 3O3OB 1YTUA 1YRYE 4C5BA 2WT8A 4LXGA 2IQIA 1JPUA 5CDFA 2JLWA 1JEDA 3NBMA 3K3PA 2VTVA 3P94A 4NBWA 1DWQA 4DJTA 2FE3A 1ESDA 4J6FA 2IU4A 5AOBA 5ADHA 3NVMB 5G53C 4W99A 2XT6A 4OH7A 3Q9SA 4AUNA 4DPMA 1M6HA 2GPBA 2M6SA 4LBVA 1TYAE 2P4HX 1Z3IX 2X1VA 4D0SA 1GKLA 1FFGA 2V7PA 4LS3A 1XRPA 3EJ6A 1A7AA 3EARA 4KK3A 5TQ0B 4JLKA 3KQLA 3P9NA 1N8TA 1WAMA 2F6RA 4YAKA 5A02A 1DJOA 2W00A 4C01A 2AFIE 4I50B 2HRCA 4D6PA 3GG2A 5L1KA 3EXIB 2ZXUA 1NX6A 3GJ5A 3T7TA 3EJWA 3QHPA 3R6TA 1W9MA 5HUJA 5B58C 1ZIYA 2H8KA 4R0VA 2WBLC 1Q92A 5A4FS 2W2MA 1FXWF 4OUKX 4BQQA 3DF9A 5C1OA 5JNSA 3SDZA 3KL2A 3OO0A 2G82A 3L7IA 2Z2KA 5SZJA 5FUQA 4XARA 4HAZA 1K9VF 3B5EA 2ZT7A 4RJJA 2CVPA 5AVZA 2PKXA 3SR0A 4BX3A 3B52X 3AF3A 1YFZA 2FW1A 1UP6A 2GEFA 2LR0A 3SZRA 4JDUA 1Y7IA 2VAXA 5BPHA 5DTJA 5EA2A 4J0KA 1M34B 1Q91A 2YMMA 1TA9A 2E82A 2JGRA 3FHJA 2CDAA 3LY8A 3U3XA 4E08A 3R2JA 1ZXLA 2AEMA 4Y8VA 4DL2A 3RT7A 2FLKA 4OHWA 3R9KA 5JXWA 2WMDA 3WR5A 2XTJA 5L51A 2QGNA 2AQKA 1TT5A 1Y1VG 1ZOIA 3QFRA 4CQLA 4NK5A 2G04A 3C43A 3AM5A 4DIFA 3OURA 4TQ9A 1SUFA 2QDXA 2VJPA 4OB8A 5I3ZA 1QTNA 4O7VA 3MSCA 1GSOA 1P6QA 2JLYA 9GPBA 3BG5A 1L4NA 1JIXA 1K63A 4AF6A 3ZNOA 1QM5A 2BHLA 4G0XA 2W0MA 4F21A 1OH5A 4H60A 1AKTA 2PM8A 1G8PA 3QU4A 4D9JA 2AOUA 3PPWA 3H0CA 2EG9A 1R8XA 3GGSA 2FYTA 5FIUA 3KTAB 1QQ5A 2WAMA 1IN1A 2V7UA 5AXAA 1NXVA 3G2LA 2A78A 4UM8B 1MAAA 3TTSA 1PVOA 5FULA 1E2JA 4JI1B 3NTVA 4DL9A 5SICE 1LWNA 5TIIA 3F73A 2VUIB 5ENZA 4WOJA 5FAXA 2IHZA 1EBBA 3K0FA 3CF4G 1S2DA 1EVQA 1FF9A 4V0ME 5DKFA 2D1TA 2VJBA 3FM9A 5ALNA 1Y4AE 1J22A 1PN3A 4YJFA 3MA0A 1AQUA 3CG4A 2FMKA 4IV8A 3FZQA 4JFAA 2APJA 4K26A 1UEIA 5DN6A 3PUXA 1U28A 5CITA 3IERA 3A27A 3HI6A 5B36A 1X80B 1LBSA 3DGEC 5FUVA 1UOPA 3ZBQA 4YV7A 3NC0B 2HTFA 1X7XB 4JT9A 5JVDB 1CYDA 5LVAA 5KFBA 1CDOA 1OTYA 1SZPA 1CUUA 2OEPA 1JI0A 1COWD 3CNNA 4R8RA 3I4NG 4U7CA 4XB1A 4FXOA 2HUPA 3DD1A 1DAHA 3TNDA 1I7NA 1YS6A 3QFCA 1A8HA 2V6IA 3AEUA 1ZIDA 1A04A 2KS6A 3GRZA 5JROA 5EJ9A 3NHFA 1IMJA 1G42A 3E84A 1GARA 3DP9A 1F38A 2W48A 2H2IA 2FPPB 1A2KC 3GMTA 1OLOA 2FSVC 1E6WA 1ZNYA 4PC1A 3CRNA 2C7PA 2GEDA 4RF3A 4TS3A 4WJLA 4RY2A 5GM2A 3SMVA 3DD5A 4PVCA 4EI2A 2XOKD 3FPCA 4QTTB 1QAOA 4N5IX 2X15A 3IAS1 1KAMA 4UEKA 4LMRA 4Q0MA 4INAA 2ZWMA 1QIGA 2FMFA 2EBUA 4NL4H 3ISTA 4ZJYA 3DE5X 2IEZA 3LI2A 1E3DA 1IXZA 4LGMA 4QTUB 5DULA 4PGHA 2ZUEA 4JGIA 4QRIA 5F12A 4IFBA 4OGFA 5HR5A 1B76A 1E7WA 1W1IA 1M2WA 2HSWA 2F4NA 4CI9A 2O5RA 1H2ZA 1O97D 2JA8G 2J3KA 5KSWB 1O95D 1DJPA 5E38A 2QLTA 1T9CA 1WEHA 3MR3A 2GD1O 1TO6A 4LX0A 3NXSA 1VFNA 5LJIA 1DC6A 4AJPA 2DHDA 4MYHA 1FFBA 2C5AA 4R7GA 3I5AA 1PVDA 1YK0A 4MQEB 1FTSA 4MWEA 3C70A 4LRUA 5BORA 4JLVA 4QM6A 1ST3A 1D2CA 1QYXA 3AG5A 1GNPA 4ZAYA 1B1CA 2OV3A 3B3AA 3RKSA 4TQSA 3T3GA 3JD2A 4RVSA 4BFYA 2B8NA 2AG5A 1K89A 2AG0A 3PCRB 4L5YA 4UBLA 1EFHA 1DKPA 3N8NA 4NU0A 4K9QA 3KVYA 1Z82A 4IZHA 3WGHA 1JIVA 4R2JA 1KS9A 2PMBA 2IY7A 4QTYA 3I4LA 3PQEA 4GYWA 1XAGA 1NL3A 4FYPA 3KQYA 1AUPA 5D5HA 1BJRE 5KQRA 1HNWB 4KK4A 4F2HA 1TEXA 2GYYA 2FPGA 3TPFA 2QKYA 3EWAA 2XE6A 3EBOA 3QX3A 2C61A 4V3CA 2WKWA 4HYTA 4AMVA 4NYMR 3T52A 1TLFA 1V7QA 1XMOH 1QYIA 4YJGB 1YCDA 1BHO1 1G8GA 1QVRA 1OHHA 3T3PB 1VJTA 2AWNA 4UU8A 3RTDA 2XYQA 1FTYA 3HGMA 5EWLB 2MCFA 4Z49A 4MLZA 1BTOA 2OCIA 2X9NA 1E9VA 1ST2A 4O3SA 3H8VA 2E5WA 3A25A 4JN6B 4I19A 1J8MF 4HNGA 5LQDA 3D7KA 5C80A 4U00A 2D5LA 4M88A 1UCFA 4X1YA 3PUKA 4J2HA 4YACA 4RDCA 3V7WA 2QTZA 2ZSBA 2DPYA 4BNGA 3GZNB 2V4ZA 5LXTA 1Z07A 2OM6A 3I1FA 3GLKA 2F4VB 3L41A 1VRCA 2ZATA 3TZ6A 1NYTA 3Q8PB 2A9PA 2JI9A 3TIXB 2IKSA 2JEZA 3PG5A 2NYVA 2VQFH 1SVIA 3RVDA 2XB8A 3TGPA 4NZNA 4XZ3B 3I9FA 3ZXIA 2A1UA 2IPAB 1E2GA 3VYWA 2XGSA 4RPLA 2GN6A 2YC4C 1XN1A 3IAEA 4B3DA 4B3IA 1Y6JA 2GLXA 5ANRB 3WE7A 4ZDJA 3GAFA 3NGLA 3EY9A 5ALRA 3JQGA 3EDMA 1KQGA 3BFPA 3KKKA 3KZMA 2N3ZA 1RC0A 3QSYA 4AYTA 3UATA 1M2EA 1I13A 5CNMA 1OMOA 1P1BA 2BI4A 3L6EA 1CFJA 2PSDA 2DUWA 4KO1S 2B4YA 2Y92A 2GZ3A 4FGSA 2WJWA 2LUOA 1SD2A 4KXUA 5AJUA 3EXEA 1DQPA 1OYOA 1RP1A 2C5GA 2IIBA 3ZCSA 2PMZE 3OJ0A 2O8FA 2Y0SA 1IOVA 3QUCA 3OPYB 1ZC3A 5ERXA 1ECCA 2Y77A 1W49A 2AU0A 1JFTA 2R7NA 1I2MA 2XF8A 5LMUH 2WUWE 4EGJA 3GMDA 3CX4A 3UEOA 2AQ4A 2PZLA 3FDFA 4O2BA 5ICSA 4TWRA 3GJRA 2G09A 2OPBA 2WE7A 2H08A 1I1OA 3AI2A 1NHGA 5IKXA 5DX1A 4MYSA 2DMRA 4DCNA 3OZAA 4NQRA 1DQRA 4KQCA 4UFOA 1QMGA 1CS0A 2VQEB 5FL7A 2OT3B 3MCUA 3HB5X 3L0DA 4W63A 1U2ZA 1S97A 3T7IA 3UAXA 5KPDA 4PRZA 4WBNA 4GKBA 4BP9A 3PVCA 3AFOA 5ITVA 4O3PA 3GJ6A 2GBLC 3TIVA 3MCVA 3NAQA 1P80A 4I55F 1X1CA 3CGGA 5LP6B 4LXXA 4FNOA 3MTBA 1V2GA 4M4SA 2FUEA 5A4JA 1T6NA 5KKCA 5J4YA 1RYZA 1PFKA 4IJQA 4PN3A 3FWNA 4II3A 1E4VA 2ZW9A 2PVSA 3W5AA 4K9MA 3AINA 3EWIA 3IAHA 2OOSA 2G9ZA 4HYYA 1N1GA 5DNEA 5DGIA 2YFQA 5KFGA 1GZ7A 3N2KA 4F60A 4YP3A 3FPHA 2BMDA 3ZHQA 4Q3BA 2DU8A 2FUCA 3KHTA 4BNJA 1NBMD 3EB9A 4WERA 3VU9A 1CFZA 3PFKA 5T8KA 2CV2A 3FB1A 1HXHA 1CF9A 1QUEA 2YJ5A 3N75A 4KVFA 2PMDA 4BDTA 3LKZA 3NTUA 4GKKH 1NBIA 2GBIA 1DV1A 4TV8A 2EW1A 1PT5A 1L4HA 4DR5H 3DXZA 1SRRA 3GDHA 3CE6A 2GRUA 4LC1A 5LZ5A 4L6IA 2PYDA 1M2JA 3NTXA 1ZHHA 1P1FA 1GZ3A 1Z5NA 3Q8SB 1O7JA 1TUIA 4TKUB 2IEAA 4GGPA 4S2UA 5HUHA 5AVTA 1Y5MA 1LC0A 2DFLA 1BQ4A 5IDQA 3F7TA 4Q48A 1RW4A 2ZTHA 4IEIA 2VBGA 1ZZEA 1NW3A 3MD9A 1LPOA 1J23A 1N77A 1UIMA 1K2VN 3MF4A 3FOWA 4HPWA 1YBMA 1QKJA 4MS1A 3K1YA 3H40A 3UKOA 3GPCA 4MLPA 4O25A 5IKOA 3ZKWA 2QRJA 2IF0A 1JPVA 2DBYA 2VP5A 4IGFA 5JMPA 4JKYA 3GEHA 4FT2A 4EVSA 5K3OA 1LD3A 1QR2A 1N5OX 5F2NA 4D6YA 4E13A 1VXOA 3RB4A 2LCQA 3RFTA 5KNCD 2P2GA 2HHLA 3BFXA 3T9BA 4QKQA 3FJ1A 5DRTA 4DJEC 1EE9A 4DXHA 1TWCA 2EZTA 5AVXA 3ABRB 2GQRA 2CKMA 5CB8A 2QAGA 1J9GA 4MAFA 3D6HA 4GBGA 2JGMA 1OBHA 4J3NA 2NNLD 3Q10A 1G8SA 2XBUA 2Q3BA 2F1IA 4K9RA 4E4RA 1U0JA 3CZAA 3E9YA 1V4NA 3AJRA 4EJFA 2PH3A 3HU2A 3U2QA 4LYJA 1LZLA 1K7XB 1DFGA 2VLIA 3LOPA 1PJCA 4TL9A 4NU5A 4KHPH 5BWOA 2A7XA 5CCDA 3AYZB 2WLSA 5FO1A 1OTXA 3Q8LA 3Q0TA 2NACA 1HUQA 3QHQA 5FUWA 3L4BA 1S4MA 4PC2A 3TLKA 3N07A 4O81A 4HEA6 2VZEA 5AWFC 2QQEA 1S2IA 1SXPA 3HXTA 3UWOA 5IF9A 4OLHA 3DNPA 4Q3CA 4DHEA 1YGPA 2QT9A 4N3NA 5DCLA 1HO3A 2FWMX 1XXHE 3VOBA 4LOJA 4UBIA 3DUWA 5REQA 1SEIA 3ADOA 3FOCA 5AO9A 2LW7A 3F6CA 4KR2A 1CUXA 1QIMA 4BQIA 3W90A 1OZFA 3WGOA 3P9YA 4PYKA 1CT9A 1XNJA 2QTGA 3VV3A 1RZ3A 4M0DA 2WWYA 3W5SA 4XW2A 4UAVA 5CTAA 1W4CA 3D2BA 1USGA 2H1IA 1O8BA 5LUAA 3LUJA 2BTOA 2VZ0A 3AP2A 5KG5A 1E5DA 3KUKA 2CD7A 1E1MA 4ZHQB 1NTOA 1EGVB 1GU7A 4IWYA 5EJ8A 3PP8A 3Q3HA 2OORC 1NC1A 1OFGA 4ZT7A 1ZBDA 3QKSA 5B6JA 2WWGA 4YRRA 1WF3A 1PLLA 3AFGA 2NGRA 4ZT3A 3SJZA 4A2BA 2XXJA 1K8RA 3CYFA 1OT3A 1KO7A 3F7NA 4PO3X 4ADSG 3ZV3A 1EVZA 2VLBA 3CSUA 1NLMA 2ZM6H 1UFRA 2HHCA 2JEFA 3ABSB 4U2KA 5K0NA 2BMWA 4EW3A 4M36A 3K05A 4IIVA 3RWMB 3ADBA 2R5WA 1MXFA 3I2YX 3OZ7A 2PUAA 4EHNA 4BY7G 1H8HA 4A3FG 5DGHA 3U40A 5D85A 5KFTA 2QDKA 1U3GA 1K3TA 3E7FA 1BEUB 1OC4A 4GW3A 4Q6BA 4B6PA 1QWOA 1B26A 3LWDA 1OWMA 5BW5A 5DT9A 3PDWA 5J2TB 3SSNA 2HK9A 3GTMA 5LQNA 3GEBA 4DRXB 2AOXA 1TVKB 2VRBA 5CDHA 2F1KA 3HCOA 2MJLA 3CRW1 5BOSB 4OAPA 3ZD6A 2KBEA 1T4BA 4IJWA 2YWDA 5HF6A 4Q8EA 2YZ7A 3AWIA 1C14A 1EIZA 2VJDA 2BFMA 3PRKE 4CL8A 3OIVA 1GEGA 1FVIA 4D9EA 3QV1A 2HQOA 3DXXA 3FKIA 1RMYA 3RW9A 4CMIA 4DANA 3UB4A 3NBKA 2REBA 1N4AA 4QDZA 2PGOA 4DCOA 3ZLJA 2AR0A 3CN9A 5HWSA 2D0DA 4E70A 5ICCA 1OX5A 2DQKA 4P31A 3Q7EA 1E20A 4IJMA 2GM4A 4JCCA 1ZH2A 2QROA 4PHHA 4GE0A 2GPTA 4E30A 2ZJ0A 2DY0A 3K53A 4Q39A 5J3JA 3EGVA 2GKGA 4Y9SA 4RHTA 5FPPA 3SBDA 4Y2SA 2FH5B 3AEZA 1VLJA 2J9FB 4CL0A 1YJAA 3IEKA 4FS3A 4I1OA 3MMXA 4F5ZA 1H8ED 4IAJA 5BOVA 3MB5A 3M4JA 3FH0A 1NTRA 3PEVA 3OJEA 4FEYA 4UPVA 3SEFA 1PUXA 3FCAA 1TLTA 2IMWP 1T5LA 4A10A 4YI5A 2W58A 1XU7A 3RTGA 2W90A 3JU3A 1N3BA 3E3NA 5H02A 2WJ6A 4ZVLA 1G7TA 2J0SA 4OXKA 3QKTA 2Z5FA 3VU8A 1RBQA 1AVTA 2FUG1 2G4CA 4DR1B 4C06A 2BPOA 1BSVA 3VGJA 3R24A 1W85B 2YTZA 3DKRA 4LH7A 1V5FA 1QVVA 1YZUA 3B48A 3ZNNA 2A3RA 3Q3CA 4B3SH 3QW4B 4RFSA 1NUAA 3T7EA 1S68A 1CHNA 3GFBA 2O23A 1T5OA 2K2QB 3SS8A 5EUBA 2DE0X 5IS2A 1E32A 1B0PA 1OFIA 2I6GA 3CZRA 5HZKA 3U0BA 4TL6A 1RRCA 3UT6A 2PZJA 1Q21A 3F8NA 3OETA 1KU0A 2JAHA 1YRWA 4V2UA 3EGWA 2JD2A 1ONNA 4KGVA 1R5NA 2ZYDA 5DTEA 2BFEA 3L6UA 1N1MA 3DUFA 5KYTA 3KJEA 4PVDA 4TLEA 3AUSA 3DZIA 4C6TB 1KHTA 2CVFA 1CY8A 2GWHA 4L73A 3KOYA 2R751 2I2FA 3BIOA 4Y2HA 5H8WA 5A5DA 5C81A 1CUZA 4HFRA 5JCPA 5HDBB 5KEIA 2FRDC 1K8ZB 1ZVQA 2QT1A 3UHJA 2BY4A 4RDIA 4ZXFA 4U7HA 2Q2WA 5HTOA 3WHIA 4R68A 1Y8QA 3I9MA 3WKDA 1W2WB 1XNQB 4ZEXA 1LVGA 1EIWA 3JZFA 3ZBPA 1DTWB 4YQZA 4FGWA 3VHRA 5JFGA 5ERYA 1CR2A 5KKAA 1I1QB 1H85A 3M9WA 3PVXA 5DW3A 4KVAA 1RXCA 2E4UA 3JWPA 4Q4JA 4HMQA 2HLNA 3EVTA 5CDFE 2IX3A 4O3NA 1RYDA 3V7NA 3C3MA 1R3UA 2DH5A 2X5KO 1ULSA 1WHTA 3ZWMA 3B7WA 2XZDA 1LKZA 5HS4A 2HA7A 5KFQA 4YV0A 4S1VA 1DWUA 2KLBA 4YRQA 2C2GA 1JR3A 3FBTA 3WAJA 2B7LA 4WESA 1OBDA 1CR6A 4EEQA 1G38A 2FF5A 2VP2A 4GP7A 1P45A 2HIGA 4UUPA 2OZVA 4K7JA 1OGIA 2IHJA 2H1WA 1UMBB 3EISA 1XPUA 4WGGA 2ZSJA 1A5SB 4PCUA 1KMQA 4TLAA 5EOYA 3FHLA 3CX8A 2FR0A 1SR8A 3PHBE 1LVUA 1TE2A 4PLCA 4OVKA 3QBVA 3FVRA 1L4GA 3TZEA 2PO5A 2DPJA 4L5CA 1KFKB 4IRMA 1IBLB 3L8CA 4PF1A 2B63A 1LPNA 3QQ5A 2J6IA 4GWGA 1MU0A 1UBNA 3KQMA 2BDUA 2P6OA 5KQPA 4IG9A 4CQJA 3MCTA 1HDOA 5FPQA 1ZGBA 4ABTA 6REQB 5LL6P 2QSJA 4ZYYA 1VBFA 1M54A 1KYXA 1R5JA 1QOQB 5EPOA 2YV2A 1JQAA 1KF0A 4DLSA 5JCOA 3IOYA 5K6TA 1MAWA 2Z09A 4M9UA 3W9YA 4LF9H 4KNYA 2CDBA 3PE3A 4J7XA 3PUJA 5BN5A 3VYUB 3G8CA 3GTQA 1FLNA 1JEJA 4LC0A 3TBFA 4PBCA 2A9VA 2WIAA 3FLEA 1NVEA 3DHEA 3L8EA 4CFZA 2IK8A 2BYTA 2Y1LA 4N3GA 3RAXA 2Q5IA 4PTZA 2IXFA 3UFXB 1G66A 2ZIFA 4ZPXA 5CLHA 1G20B 4LTDA 1GLGA 4ZJPA 2I71A 3UZOA 2ZRAA 2OBLA 1M75A 1SCNE 4XOUA 1LUAA 3DF7A 1NI4B 1XD9A 3P9XA 1BU5A 4FB5A 1KEZA 1WOYA 1JHYA 5JXGA 4KN6A 4IQFA 3G1TA 4OXXA 5EZ5A 2O57A 2XIQA 4U6PA 2ILVA 1NGSA 1JQKA 3ZHZA 1CKOA 3WGGA 4G09A 1AKMA 1CKMA 2ZOSA 2J7KA 1VPTA 4EUSA 4GWKA 2L0XA 4J03A 5KOHA 4LRYA 3EGOA 4DEYA 2JG3A 4NENA 3G0CA 2QVCA 1OKKD 3K1AA 3STUA 3DBHB 3W1GA 3KQKA 5IVPA 2CQYA 3WMWA 1QGUA 2IXTA 4KMOA 2P3OA 1LY1A 1JG4A 1Z6AA 2P9HA 1EFCA 1KYYA 2G17A 3NJ8A 2R93G 1FRQA 2CBXA 1SELA 2NZVG 2A3NA 3C39A 5GVSA 3JWJA 3W5DA 5JS2A 1GSHA 1EG2A 4CW7A 3LDUA 4J7AA 1NWHA 2CMHA 2RGBA 4P4UA 3A36A 1KOGA 2C2WA 3DTNA 4EBFA 4RORA 5EOVA 2WOOA 2PRYA 2O3TA 3GTGA 2GQ0A 3EYYA 4R98A 3CH6A 1Q3TA 1CJMA 1I14A 1J07A 1IPHA 1ZDMA 3U0GA 1VLQA 3O03A 3N8IA 5BSEA 3GJQA 3GB9A 2QTLA 2GN1A 4YT2A 1JHZA 3TVYA 3K9LA 5JG7A 4J9NA 4GOLD 3NTLA 2Z3VA 1SXHA 3H5NA 5ECWA 3K0KA 3SU8A 2CYAA 3H1PA 4BB6A 3VHXB 4Y9RA 1V1RB 4EARA 4E4YA 3CMMA 4XX0B 1J0CA 4BNNA 3W2EA 1H66A 1FCJA 1T8UA 3KOZA 5FR1A 1NPDA 4YIKA 3BJIC 1OXKB 1BS1A 3LIPA 4Y1RA 2CFTA 3K0EA 1JLKA 1N32H 2MSNA 2OHIA 3N2ZB 4NZ9A 1R1DA 1E4GT 3DE1X 2D0IA 1Y3HA 4AS1A 4UVIA 4HNRA 3GA5A 3VYRB 4PXAA 4LECA 4J1SA 4Y2RA 2NLOA 3BGOS 4ZAXA 1KH2A 2B30A 2JIMA 4CHIA 3TR5A 3E53A 4LXYA 4CQMA 1JIQA 5CT4A 1HNNA 2HY7A 2XMBA 4PYIA 4IPTA 5DHQA 3ZDBA 4AXBA 3V8QA 1YSCA 2O0LA 4NPHA 4IJVA 1XXHA 4JB2A 1ZM2A 4UCWA 2OXRA 3GIPA 2QMOA 1WNFA 3UK0A 4B3RB 3S28A 4HFNA 2IYSA 5I7UA 3TECE 2EGHA 3AVVA 1PV2A 4B82A 3OQVA 4QO8A 3E7DA 1X8JA 3E6AA 4L08A 4WV3A 4NLGA 3RB6A 1HSOA 2CJWB 2OFPA 5I5GA 4H16A 1SUPA 1QIEA 1VAJA 3KAQA 3S2SA 2HT1A 1NBWB 2W4IA 4MV7A 5DHFA 1DZIA 2DP4E 3VNNA 4WA8A 1A27A 3INTA 1KSGA 5DE3A 3N41B 3OICA 4ZV9A 1TYZA 3FN4A 5EXXA 3B3QA 3ZZTA 2AF4C 4RA6B 4ZGGA 4D5EA 4CETA 1VCNA 1NRIA 1V8FA 4RK6A 3IDZA 3I5XA 5IMBA 4I1YA 4XKJA 3UG7A 1YQ9A 3IIMA 3AV3A 2BF4A 5TS3A 3CUTA 3D4NA 2AEEA 1GPKA 3WDMA 2G07A 1HTTA 4EB3A 4EVIA 4XIYA 1R0RE 3N53A 1ZJYA 3KKLA 3JYHA 5CJ2A 3W4JA 1Q7GA 3OFNA 4XFDA 1E6EA 4LVNA 1DTSA 4KN8A 2WAAA 3P0FA 3DOUA 1TF2A 4O5AA 2C83A 5CCEA 2XWPA 3RV4A 1BQEA 3BGVA 4RS3A 2O2YA 1QRDA 2PX6A 4S2EA 2Q27A 4ZGWA 3JQBA 4ND8B 2QD5A 2HRQA 1Q0TA 2ZTLA 2XCIA 1Q0PA 3KPWA 5KQGA 4EY3A 2FSUA 4FBTA 4OQNA 3GROA 3NC4A 3NBXX 3GJ4A 4ZCMA 4Q7JB 4KFTA 4G23A 2OVFA 4EGQA 3GQBA 1Z6TA 3A2LA 4ZPJA 2R6ZA 2NP6A 3KC2A 5G40A 4KN5A 3L0YA 4JJAA 1UBTS 5DQGA 4R69A 5HQ3B 4TTRA 3H6HA 1CD5A 2PLAA 1ZUNA 3ZDAA 3DEZA 4CC5A 1B04A 5CK5A 3QY0A 1U3DA 4WBSA 4XQGA 3G8AA 3A7DA 2HPZA 1SAYA 4XM2A 4CR6A 5HZHA 1RYFA 4X7MA 1D7OA 2ZBPA 3ICOA 2BWJA 3PI7A 4M1WA 4QJ4A 4DCJA 4HQRA 1ZM3A 1C3LA 4A91A 2CLLB 4FCVA 2I4NA 3UJAA 4EA6A 3PENA 3BIXA 4XDYA 1Z5UA 1P5FA 4BECA 5ALMA 3RC8A 4QU0A 5H9VA 5HYVA 4GMFA 4KEAA 5T14A 3TFQA 4Z6KA 1OI4A 2VXBA 4WIAA 1JVBA 1W5SA 1RRFA 3K09C 4RJ2A 4IOLA 5A7GA 3SQMA 2NUAB 3SHFA 4K1LA 1JAHA 2X0FA 1Z5VA 1G8HA 1G2IA 3AIIA 4K6FA 1RXYA 4WK0B 4QOHA 5IDWA 3QA9A 4KR9A 4RULA 3SXUB 4EYOA 1Z73A 4DQVA 2O8EA 4ZMRA 1U8ZA 4TMXA 1IXRC 2BGMA 1DG3A 3RC1A 5MN4A 4MS3B 2RGAA 3PQ6A 4BRZA 5EWFA 2W9CB 3HY6A 3PL1A 5IYZA 4D8XA 4U7GA 2EEZA 5FOWA 2C9ZA 2QTNA 2GARA 3EIQA 2AF3C 1VPWA 3DTVD 1UEJA 5CYFA 2JLBA 2C28A 1BFKA 1MVNA 1HOXA 1Y1TA 4A9AA 3VKHA 1J20A 1Y5RA 1XYGA 4GOXA 1IG3A 1LV7A 3AY0A 5T3YA 4UQOA 1HYEA 3AJEA 4YMIA 3OEYA 3AKCA 4BWGA 3W1BA 4COKA 4MGEA 1RAIA 2M6LA 4KXNA 2HEIA 2HBZA 5I7AA 5B37A 2ZJ4A 3K5WA 1Y6FA 3K92A 3GRAA 1KE2A 1A9PA 3M5CA 5DAAA 4JUZA 5PNTA 3F46A 4IZ6A 1D0SA 5K5EA 2C4VA 4X44A 1GFWA 1E0KA 3VVBA 5C3EG 2HDHA 1K8YB 4IGEA 2QTWB 4BATA 1GL6A 3P32A 2BONA 1DBSA 3T3OA 2OO5A 4AF7A 2QPLA 3ZZMA 3RB3A 3HDHA 1R4ZA 3EQ2A 4E12A 3O4IA 1JDNA 3LCCA 3T1HB 1L1FA 3GU3A 4M1ZA 5AK4A 3HJUA 4R51A 3TW0A 2WJPA 3QWAA 2X8JA 5C5JA 4AY5A 4QUIA 3BXPA 4Q9NA 2A30A 1KY5A 1QZXA 2PWZA 2PRIA 3LAWA 4ZFNA 2VR1A 1IUOA 2A5FA 4R3WA 2YXLA 2QLJA 4JHLA 3X1ZA 3O74A 4X64H 4BNDA 5FPOA 4LF4H 2Q8PA 4MQFB 3UYYA 1HM5A 1QV9A 1L4KA 4FGKA 1J39A 3AWDA 3EXFA 2B4RO 2ZKLA 1D5WA 3L7JA 1WPGA 5IJ0B 5C5EA 2QVGA 3GRVA 4LXQA 1SURA 2WSBA 5CBKA 1ISSA 5K3BA 3ED1A 4WXHA 2DF8A 2DABA 3K9WA 3HBMA 4CV1A 4URWR 4ND6A 1MO6A 5GV7A 1PFUA 3IAM6 1OWOA 4I4IA 4U2GA 2IDMA 5ESRA 2RAVA 2EKZA 2HV8A 2H7YA 3TLAA 1UDBA 3OF2A 1TADA 1KMCA 3ZDYB 4BGEA 4M1KA 3ZV6A 1GRCA 3YASA 3IJ5A 5GOZA 1CX9B 4PBSA 3JQ8A 3T5TA 1SA0B 4PZ8A 1UKVY 3VKUA 4ZEVA 1T5HX 1QR6A 3BWBA 3EY4A 2A0WA 3ZE0B 4U9UA 4G97A 4W8GA 3FGZA 5JEDA 1TAHA 2ZIVB 4CF3A 1SC3A 4GECA 3BMOB 3M9XA 2YVKA 4PZ9A 2IHBA 3B6MA 2B4TO 2WABA 4UZEA 3SMQA 3VNRA 2XA1A 1ZWKA 1HTBA 2EJ2A 1JDTA 3DDSA 4NNPA 5F33A 5HXAA 1PYOA 1FW6A 2PSJA 3GLSA 1GFIA 2Y67A 4WY8A 2AFHA 2VP4A 4H3SA 2Z2ZA 2AGVA 5M5BA 4IVPA 3FFXA 2QUZA 2I6FA 1HY3A 3R6LA 3B70A 3M9LA 3PD7A 4CIBA 2FZKA 3RRNA 4F50A 2WI8A 1E3QA 3E22B 1T1IA 3NC0C 1N0HA 3RGZA 4GFDA 5BUZA 2OILA 1FVXA 3RNLA 3ORFA 4AS2A 3GIMA 4URUR 1IYDA 3DWGA 4DIDA 4DV1B 1K6EA 1KZHA 3R8XA 1UJMA 4DLXA 4IVQA 4JI3H 4US2R 5GONF 4OTZA 5LYJF 4PZUA 4Y2PA 4DMGA 3CUUA 2WR8A 3GTOA 5CR9A 1SUAA 3VX4A 2H9AA 2ADOA 2BFOA 3TL6A 3B36A 3F8TA 4OAOA 3CRMA 1OU4A 5T5QA 4LYEA 4N18A 2CXTA 4MTEA 3QJYA 5HIIA 5EWJB 3PHGA 4MGHA 1RRGA 2I8LA 4DLKA 3O95A 3GFRA 4QDKA 4C78A 5A7HA 2Y1XA 7ADHA 4LE0A 2PTGA 3EHEA 3O21A 5CB6A 4F4ZA 2ODQA 3BIJA 1E58A 3ZV7A 2P91A 5JRZA 1XB2A 2VQSA 4AY4A 4TMYA 4FBMA 4HEHA 3UA4A 1V16A 1SM4A 2YWEA 3WYBA 4K9NA 4Y0AA 3RC7A 4Q47A 3U55A 3TEKA 1F17A 3O1JC 1RIFA 3V1KA 4HO1X 5JSKA 3O92A 4QJ3A 3WYGA 5LBTA 2QF7A 4I1UA 4JI4B 4JASB 3UMMA 421PA 3RBEA 3B8HA 4G4JA 2RB4A 3VKGA 3LPCA 1JHDA 1YR3A 4B3XA 5IX8A 4FFMA 4PQGA 1GQQA 3TJMA 3NANA 4YMTA 4KC0A 1CUBA 5U4QA 3GLRA 1D0IA 2Q5LA 4R0MA 1QYVA 2XECA 1EFPB 5LZ4A 4BVGA 3UNXA 1F60A 2XX3A 5KB3A 3T34A 4BN0A 2XXAB 1GY8A 1KI1A 1NONA 4O3MA 1MBZA 1H6AA 5EVJA 3SN6A 1KTIA 5EGNA 4HGYA 2P5YA 1XZNA 2AQHA 4ACBA 3MD0A 3Q41A 2XC9A 4HBGA 3PDUA 4UTRA 1PU2A 3EDOA 3JW8A 2A4MA 1IWPB 3AFHA 3HACA 1QS0B 3OX2A 4DAEA 3HCBA 4EDFA 4XSHA 4MDFA 4MCIA 5E1DA 3FWPA 3HN6A 3IP6A 4W82A 2QG6A 5F7XA 3CKMA 1ZZGA 3WQSB 1E3WB 4BGDA 2W6PA 2QLFA 2VT7A 2GYUA 4D8UA 4YJ2A 5L3VA 1G41A 1AUVA 3WRYC 3T1YH 2V74B 1I2DA 4MV6A 4DSTA 3ZUGA 1RM3A 2Q2VA 2VAPA 3QTLA 1R9TA 4WNAA 3AVOA 5AM3A 1Y9EA 4M89A 4Z9BA 2OBMA 4L8LA 1FBNA 2E1RA 3C6MA 3BK2A 4DCMA 3P2KA 2PIAA 4ZV7A 2Z6VA 5L3SA 2GAOA 3ZDRA 1LWOA 2I99A 1ZMTA 3ZE2B 4XB6B 1FE8A 4G5QA 2HU8A 3CRQA 3D54D 4JK3A 1CQZA 5FUBA 3QX9A 4O33A 3M83A 1X2BA 2AW3A 3PR1A 3WVNA 4YUWA 4MPDA 5IANA 3KAKA 1E3JA 1YS1X 1ZJZA 2GCIA 5ADVA 1YR7A 2EHJA 3D7RA 2PGDA 3LBFA 3PF9A 1EYZA 3K8YA 5CLQA 4J0CA 3WKEA 5ARBA 4CLEA 4MW6A 4NF2A 4BC1A 2DR3A 1S6YA 2R1VB 1A72A 1PZEA 4X93A 3CJQA 3V1LA 2IC5A 5K0LA 4RD1A 3UK7A 1F0PA 3MN1A 2WC1A 1QE5A 4N54A 4MVJA 3ZPXA 1DZ3A 1J33A 2ZI3A 5CM0A 1HDIA 1OI7A 1HPLA 4DA9A 1KPIA 3BORA 4QBGB 4GVXA 1C7ZA 1XMSA 1F2TA 3GF4A 1MJ5A 5L3QB 5JYEA 1D4FA 2GEKA 2ZTUA 2YYAA 4E14A 3ZWPA 5E9WA 1UXJA 1DC4A 1F9AA 3HBNA 5KX5A 5CBPA 5BR4A 4HQKA 1I5EA 4F71A 2KI5A 2VDPB 1R6UA 1P2BA 1H1DA 4JBYA 1G4UR 3FE2A 3WP1B 3AVXA 1EGHA 5LN1A 2DETA 5BWMA 4IH9A 3VQTA 1NVWQ 1V95A 5I5UA 1LPMA 5CLJA 1WEKA 4A93G 1Z8DA 1RYHA 4BVKA 3L7AA 3RQSA 5EIHA 2C7GA 4B09A 3LG2A 1AV7A 1D7AA 4B43A 2NN3C 3KE9A 6CHYA 1WX1A 3TIGA 2DCUA 3QVVA 2JJ8A 2JH9A 2J09A 1HG0A 4DMFA 3VA7A 3PC7A 4D8VA 4WCFA 4YRGA 2AOTB 3HBJA 2RKOA 3WQBA 5L4LA 1A0OA 1ZGGA 2AEFA 1EX6A 5FLYA 2Q5JA 3IDOA 3LVRE 5IFLA 2KHZA 1GAJA 5HS6A 4CHGA 2WPDA 3V9AA 4BAGA 5JNWA 1U9JA 1V45E 2IEIA 2XCLA 3DDZX 4ED8A 2O05A 2IRWA 3U37A 1XU4A 1F14A 1EAMA 4CT4B 1KMHB 5LLDA 3NZEA 3JQAA 4I4TB 2F1RA 1ODIA 4HLCA 3CURA 3OZSA 4M53A 1MDFA 3L0OA 3NKLA 3EFEA 4FYXA 3HWX1 2TRSB 4X97A 2IYQA 1K97A 3Q3EA 1RT9A 3JQQA 2JKYA 4GAEA 1EPUA 1QLWA 3SICE 3H9QA 3AY7A 1ECLA 1QDEA 3C7CB 1KOJA 4RYDA 1KO4A 1BKYA 2B63G 4QT4A 4DUYB 3MMPA 2J3DA 1GYQA 3LLSA 5IDYA 4NMMA 5KG3A 4I7EA 1JQDA 1BFDA 4RO0A 2O7VA 4MOWA 1WHSB 3OJCA 3DEJA 4YAWA 1TEZA 1R0XA 3KK0A 5LP6C