2VPQA

Crystal structure of biotin carboxylase from s. aureus complexed with amppnp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
447
structure length
447
Chain Sequence
KKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLNIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKAEMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGFRMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEEAPSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVTEMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLAPGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIPFHIKLLNNDIFRSGKFNTNFLEQNSIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Evidence for Substrate-Induced Synergism and Half-Sites Reactivity in Biotin Carboxylase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords ACETYL-COA CARBOXYLASE
total genus 146
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature ec 6.3.4.14: Biotin carboxylase.
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain
A PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain
A PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2vpqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2vpqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vpqA01
1CE8A 2DZDA 5LP6F 4MA5A 2VHEA 1EUDB 3SE7A 2QK4A 2R84A 3KAKA 3R5XA 5DMXA 4DIMA 2YS6A 4EG0A 4ZHQF 2VR1A 3TW6A 2ZDHA 4RZQA 3ORQA 3GLKA 3LP8A 5CA1F 3WO0A 5GONF 4WD3A 1M6VA 4TV8F 3R9RA 2J9GA 2CNUA 2GQSA 4NYEA 3AX6A 4HQ6A 2VQDA 4MV6A 2R7MA 4C5CA 5C8YF 3KALA 2NUAB 5CAEB 2QF7A 4I4TF 1CQJB 5FNVF 4WBNF 2GPWA 3RFCA 4EA9A 3V4ZA 2PBZA 2W6QA 4FE2A 4O4LF 2FPIB 5LYJF 4EABA 2GPSA 2W71A 4YJ2F 4MV4A 5LXTF 1B6SA 2PVPA 5KX5F 3AW8A 3TINA 1KJ8A 2YZMA 3TIGA 2ZDGA 3BG5A 3K5HA 3ETHA 3VOTA 1OBGA 1M0WA 1BNCA 1W93A 1EUCB 4GGMX 5BMVF 2GLTA 1PX2A 3ETJA 2NPOA 2XD4A 1EYZA 4FGRA 4O4HF 3G8CA 5BPHA 2NU8B 4IWXA 4ME6A 2NU9B 3UFXB 4O4IF 2FB9A 2HJWA 4ZI7F 4YAKB 1M0TA 3GIDA 3I12A 2V58A 4IHJF 2CZGA 2OLSA 4MV3A 3BSYA 1IOVA 4O7WA 1GLVA 3U9SA 1Z2OX 3BFPA 3LWBA 1OBDA 1B6RA 4FFOA 1JKJB 3VMMA 3HO8A 4YJ3F 2W6OA 5I47A 4EGQA 3Q2OA 3OUZA 4O2AF 1KEEA 2R7LA 2YYAA 4O86A 3V4SA 3JZIA 5JQGF 1E4EB 3U9TA 2V59A 5JQWA 2YS7A 5JVDF 3MWDA 3OUUA 4MV8A 1W96A 2YWVA 4O7TA 4YBZB 4EAAA 2R87A 2V5AA 1AUVA 3QFFA 4XYMB 1GGOA 2YRWA 1GSAA 2ZDQA 3K3PA 3R5HA 1VBGA 2IP4A 4C5BA 1ULZA 2FP4B 3TQTA 3RUPA 2Z02A 5C1OA 1KJIA 2X0SA 1DIKA 1I7LA 2VPQA 4XYLB 2GQRA 2R6FA 2CNVA 4XZ3B 2CNQA 2DLNA 4HR7A 4EA7A 5JVLA 2R7NA 4MAMA 4O7VA 5EZYF 3JRXA 1BXRA 2YW2A 5LOVF 1T36A 2R85A 1KJJA 4O7LA 1SCUB 2W6PA 4YAJB 5C1PA 2YRXA 4O7NA 4TV9F 4I55F 2YL2A 4O84A 2XCLA 4FFRA 3E5NA 4MV9A 1I7NA 3U55A 4HNVA 4IZOA 1KC7A 5HBRB 2DIKA 3MJFA 5HV6A 2W6NA 3VA7A 3KAJA 1JDBB 4FFNA 3N8DA 3TIIA 1WR2A 1A48A 5CB4F 4IWYA 1DV2A 1KJQA 3JZFA 1CS0A 4DLKA 4HNTA 1A9XA 4IIJF 4O81A 4O82A 5J2TF 2W70A 1CQIB 3HB9A 4EGJA 4M99A 4YB8B 3JRWA 3WNZA 5KKNB 3VPCA 3BSSA 1VKZA 1AUXA 4O7YA 4MV7A 2C00A 3RV3A 4M9UA 3N6RA 4ZQIA 5IYZF 2R7KA 4E4TA 1KJ9A 4XX0B 4QSHA 3VPDA 4O7ZA 1PK8A 1Z2PX 2FPGB 2YZGA 1UC8A 1VBHA 3R23A 4FFMA 3VPBA 5LA6F 2W6MA 1KBLA 2P0AA 2SCUB 4M98A 4C5AA 2CQYA 2HGSA 4Y8VB 1KUTA 3DF7A 4O83A 4M9CA 2YZNA 4FFLA 2Z04A 1JLLB 4O4JF 2W6ZA 1GSOA 1E4EA 4O2BF 4EA8A 1GSHA 2PN1A 3ORRA 1C30A 3HBLA 3K5IA 4MV1A 5J2UF 3R5FA 3NUAA 1IOWA 5K2MA 1EHIA 3BSWA 5D8DA 5CA0F 4L1KA 1JDEA 4HNUA 1C3OA 3KREA 3WO1A 4J6EA 1EZ1A 3RV4A 2I80A 2I8CA 5JH7F 2YZLA 5BPFA 4O7RA 3Q1KA 4O7SA 2WYOA 4FU0A 2R86A 4I50F 3G8DA 4FFPA 2R82A 2DWCA 2NU7B 2NU6B 4ZOLF 5H80A 3U54A 4MA0A 2FPPB 1UC9A 1Z2NX 3MWEA 1DV1A 2I87A 4TUYF
chains in the Genus database with same CATH superfamily
4EW1A 3QX8A 4XVHA 1BEZA 1MNQA 4YQWA 3LHIA 5C1DA 1Y4SA 5CRIA 4Q3CA 2VHEA 5E2AA 3WNQA 5IWAB 2PO7A 1GRVA 2PSJA 3FNGA 4YT8A 3AT1A 3C14C 3UJCA 3F9CA 1EM8B 3HYRA 5IUJC 2WTXA 4IIFA 1G5TA 1S5PA 2HC9A 5KSYA 2EW1A 3EG5A 1A5BB 2ZTUA 3AUTA 4FMCB 4YRFA 5DM2A 4B34A 1J8YF 3IIJA 3NHZA 4BN0A 2WIGA 3P2EA 4JL8A 5JZSA 1ADYA 3HQ4O 4FX2A 3GLKA 2J5RA 5C7YA 2V0GA 1F1JA 3HN6A 3RU3A 3OHPA 2RH4A 4HSGA 4AN1A 4G2NA 3F8TA 3K70C 2QDKA 4TSRA 5KOYA 2GZAA 1Z8HA 1XLTA 13PKA 2O1WA 1XNRH 4FYXA 2QKYA 3RRZA 1XCOA 4DMHA 2A86A 4WZ6A 4DGSA 2C84A 2UUAB 2WTEA 4GX1A 5LDHA 2XNDD 3E9QA 3MJHA 3OZIA 3AX6A 5HOQA 2YNMD 2XDQB 3BFVA 4DUYH 4OI4A 1TVMA 1KVRA 5IC6A 3ML1A 4P7BA 4GOKA 2EWWA 4A8HA 4FN4A 5JR3A 5HX7A 1UUFA 1KFEB 5EGNA 2GK4A 3S2IA 1E7RA 4MZDA 3KALA 3SZUA 1KS2A 1T9BA 3NTUA 1CQJB 2FLPA 5AJTA 3KSMA 4UVGA 4Y1EA 2ZCJA 4EI8A 1Z28A 2WABA 3ZBQA 5H1YA 1OMOA 4BNFA 1E6LA 2X23A 1L2ZA 1NC3A 2DSNA 2GAIA 4AKSA 4BVEA 2XQIA 4ETMA 2ZJ1A 3BMCA 2H1LA 3HP1A 2A30A 3UAXA 1OROA 4DCVA 2XLBA 4FFBB 3V80A 3WLOA 3KDSE 4DCSA 4BMSA 1U8AA 4RTPA 3SEFA 2V3VA 2ID9A 3U9LA 1PX0A 3D5EA 1XRRA 2FW7A 4M7RA 2NSJA 4IRXA 2V9ZA 1Z4PX 2JAOA 3TEKA 1UBJS 3L01A 4HDKB 4JXKA 1NQ5A 4M37A 4L95C 4TXJA 5BV0A 1A7AA 4QE3A 4DBVO 4UCVA 2I65A 3GRFA 4URUR 2VATA 4PRYA 4R8SA 3WYEA 1KWKA 2VRNA 3T5TA 1V8ZA 1T5LA 1A2OA 4RIFA 3A2KA 1HMPA 3AO0B 2CMHA 5E8JA 1PQYA 2F00A 1SO8A 3OPXA 1DDIA 4KDFA 1ZJ6A 2PS0A 4WNAB 3VZRA 4Z1MA 3G79A 5KTYA 3JSNA 1BMQA 5AXAA 4MW1A 1KVTA 3DV2A 1WB5A 1XDUA 2F64A 3P9SA 1VA5A 4IIVA 4O33A 5CEJA 1QJ4A 1GQFA 5LQRA 4C2UA 3OJCA 4UQLA 5D3MB 1LV7A 2OORA 1QH8A 3QV1A 4S1PA 4E4YA 1EP3B 2SECE 1BNCA 2YWHA 1UBCA 1A88A 1F2TA 3SICE 2UVPA 4Q4AA 2VOBA 4RPLA 5C5CA 5KT2A 4YI3A 4F2GA 2ADMA 1FFCA 1Q12A 3WICA 2PEYA 3M5CA 1SOVA 1HQKA 1QWOA 5C8YA 1QRTA 3WV4A 3WGMA 2JIOA 2O8BA 4W5NA 2BFBA 1UEJA 3OJFA 4TSFD 2AFIA 2DQSA 3VAZA 1JUDA 3NV9A 1ORIA 3T52A 1J9ZA 1GQRA 2O8BB 4RB0A 4LH6A 2H4ZA 4Z9FA 4PHTA 2AKAB 4KN6A 5HKLA 3CNOA 4JOBA 2C8VA 1D4ZA 2VLIA 3GEGA 4G6ZA 5EVCA 3FVVA 4A3MG 4F3NA 1OA0A 5C1IA 3RQIA 4RTJA 2XDAA 4MW2A 1JAZA 1XQYA 5TE9A 1I2KA 1I3KA 1Y3DE 3AI3A 3JATB 1COZA 4OJNA 4RCZA 4CCWA 4PPFA 3OSNA 1E3LA 3B7WA 3GNTA 3BDIA 4TLAA 4ZMRA 3QOXA 4N39A 1OX4B 2XE8A 3N59A 1HURA 1FS5A 4WY5A 1JYSA 3PA8A 2HI0A 1PNTA 1QHYA 1RSZA 4Q93A 4N7MA 4JI5B 2Q8QA 5CMLA 3RREA 5BUSA 2XUZA 1KYWA 4F96A 5GTDA 4HB0A 4WVFA 1LDGA 3WDLA 1C7QA 1TA4A 3X2FA 5IZ4A 1KR2A 1KO7A 4K9QA 5I5XA 3ADPA 5KT4A 1WY7A 3I9FA 3OQ1A 1TWAA 4IUBS 4TS1A 3WHLA 2YHIB 1NVWQ 1IOVA 3BSYA 1AB6A 4GC7A 3F96A 5AKEA 4EOGA 5KTRA 4II2A 3O2SB 3GZNB 4WLVA 2H29A 4XQCA 4Z9BA 3TBFA 5JD6A 4RPJA 3UUGA 2VZ0A 2Q07A 3IR5A 3UUEA 5K0GA 3ICQB 4RENA 4L6IA 2DETA 1O8CA 4QGGA 3F6CA 5ALRA 3GV0A 4YAIA 2V6JA 3WJ7A 2ZSJA 4QSMA 1Y1RA 1G17A 2O3TA 1OBVA 3PC7A 5EIWA 4C0JA 1U9CA 2Y0BA 3UKOA 5KYXA 1RIIA 3Q3CA 4YACA 2A3NA 4BXOB 3BTUA 2R96A 4M0FA 4MPRA 4QRHA 2FDCA 3OKFA 4EHDA 3QPUA 4BCBA 3HOUG 4JLBA 3R4VA 4ZHSA 3FN4A 1EE1A 2AKEA 5DGTA 5COAA 4NMHA 3W1EA 2FX2A 5IK2D 1ISMA 1XFDA 3GTKA 4RY0A 2WIAA 4Y9DA 1CEQA 2QD4A 1LH0A 2EFDB 1RWKA 5FO0A 3KFXA 4QNRA 3QKSB 3HBMA 2LXNA 4FOLA 4MCHA 5E8RA 4HGYA 1UT6A 4JWTA 1D6NA 3MT8A 3LYAA 2WPDD 3OEHD 4MYHA 1G2WA 1GTMA 1UP4A 4QQRA 2GYUA 5BW4A 4BP9A 3THXB 1E2GA 1W85B 1FOEB 4C7KA 5KFDA 4EFEA 4BC0A 2B20A 2VAMA 3TD2A 2V9PA 2VXBA 1N2IA 1XZBA 2SHKA 4IDFA 1VRVA 3FUVA 4V0KA 4W9RA 3RVSA 1E98A 1HEIA 4DILA 1L8OA 1T8YA 2CDNA 3V4OA 4D26A 3PFIA 1WCXA 3B1JA 4HY3A 3H8WA 2D4HA 4NG5A 5IJWA 3KZCA 4QJ3A 5JVDF 2Q1UA 4FGKA 4UHCA 1C2YA 3FB4A 1QHNA 3ME5A 3AVPA 1JDJA 4MV8A 5F3WB 2GJAA 3N0RA 4RDHA 3I2IA 5BXYA 4NBTA 5KT3A 1Z07A 3UAZA 1QONA 1WQ4A 2ODNA 1QR6A 3GNSA 3I6MA 1GVNB 3X1DA 4QIWE 1H1LA 2O3JA 1SIOA 1XDBA 3HP7A 4FEAA 5TXGA 4ONEA 5M7EA 2PYDA 5EHNA 4RTKA 5KVCA 3FHJA 2QZPA 3BHMA 3G2LA 3A9SA 3D8BA 3UTDA 2I7CA 1HUQA 2VUIB 2NQTA 2PIAA 3PWZA 2IWRA 1J5EB 3WLJA 1T6YA 5COQA 4DCPA 3PF8A 3DEHA 3DVLA 4I9FA 1W36B 3GDFA 4HAXA 4MUJA 4ZXFA 1O5TA 1R0KA 3I45A 2RDJA 1B2RA 1DFGA 3VC1A 3CEAA 4EHBA 1VG8A 1ORWA 3WRVA 3M1IA 1ZK2A 4CF4A 3DE7X 1PE0A 5JCOC 4NMLA 4QO7A 4ZT3A 1XSEA 1DKMA 4I5EA 2NXJA 2EP7A 4N5HX 5G40A 4AN4A 1S2LA 1ZG3A 2J07A 3E5MA 1VPEA 4URYR 5DULA 2DBVO 3A6DA 4D4GA 3MOIA 1U7OA 1B2LA 1DQYA 1ZU4A 1UKEA 2DVMA 1KKMA 4KKVA 5HKOA 3L02A 1XZIA 5CP8A 3ZYCA 1K5PA 5J1SB 1FTGA 3IQGX 1DQZA 3G0CA 4RIHA 1WD7A 1NFRA 2GQRA 3BZBA 2JPDA 4Z4FA 3CR7A 4QYTA 2F1RA 1U65A 2OD7A 1TA9A 2LR0A 2W8LA 3SE0A 3VDXA 2I6SA 1GZ5A 1T5TA 3SYRA 2QJFA 4KRYA 4PCUA 1G9SA 4WHMA 4CG3A 3K0BA 1Q57A 1HYGA 4N54A 3W9UA 4CMGA 2IEBA 4DREA 4RF5A 5FOUA 4DLRA 1HFJA 1NNLA 2QL6A 4E5UA 4OI0A 4FOTA 2PH5A 2FX3A 3J81W 2RCNA 3PYMA 4FMCF 4MUGA 4EDHA 2QPAA 1N6RA 4CF5A 1EWRA 1Z2AA 4MHOA 3D3WA 3TQIA 3E9MA 1MX1A 2CHQA 4IDGA 3A2LA 4ZHQB 4E6NA 2JFPA 3BD7A 1QHIA 2A0UA 2P2SA 3INGA 4IXDA 2QW1A 4LH7A 3EPRA 3VJRA 1D2CA 4RVHA 1QYWA 4JP1A 3M4NA 4L7QA 4QTUB 5FPQA 1XU4A 2RGCA 3HUEA 4CNBA 4ND8A 4YCCA 3UJNA 1UPAA 1FRFS 2O06A 4QWDA 2VUGA 3PNKA 4H6WA 1JQKA 3W5IA 2ZWMA 1JR6A 3PSAA 4E5MA 4JI4B 3M4IA 1JFVA 4K03A 4EG5A 5AI4A 1A8IA 4LISA 2FI1A 2PA3A 3GC6A 2YZ2A 1E99A 1L4GA 2BUBA 3WYCA 3ZD9A 1Q0ZA 4MAAA 1B8VA 1GP2A 5EE0A 5JXGA 4YA6A 2PRZA 1GKYA 1YB2A 4JSTA 1ILWA 2I7DA 2LWIA 4FP9A 2YVQA 4RXTA 2HREA 4A2CA 2B9EA 2XWJI 3B3QA 3ZDBA 4ZZIA 2M6SA 1KC7A 4P83A 1KVSA 3P8ZA 4JKIA 4HUQA 4MR9A 1IU9A 3EQZA 4AULA 2CKZB 3ZVMA 1F7VA 3CRMA 2RAPA 4B83A 1T5HX 1Z5OA 2CVQA 1CEXA 2GAAA 2WHRA 2YJ4A 3DEIA 4QXPA 3Q5GA 3TJRA 2BY4A 4V0OA 1P29A 4YCNA 4CL2A 3HVUA 2FNAA 1KZ9A 3DHVA 4DJTA 3J7AC 1XDSA 4CMEA 4LRUA 5H70A 1QUEA 2FR1A 3PUXA 4MCJA 4A9AA 1X19A 1XMQB 3LX5A 5C4IA 3GJRA 4BBJA 3TIVA 2B7BA 1K2WA 2PLFA 4QQFA 1ONBA 3AMVA 1XB2A 3Q5DA 3QIAA 3RUAA 3TLBA 5EZYA 3UMGA 4JVSB 4DLKA 3A6LA 3ZI0A 3V55A 2CMFA 4PBCA 3EDCA 1ECBA 4FCVA 2IHVA 1YBVA 1MV8A 3HR4A 1STOA 2CNKA 5JFTA 2O1EA 1J07A 2QXUA 4WLOA 1L1FA 4CRWB 3LWDA 1FQKA 2UAGA 1DEXA 4DLWA 4JVLA 5I48A 5EWEA 1FTSA 4UASA 5CX1A 2HCFA 2DR2A 1WPQA 4A0HA 3VC7A 2XUIA 2X8JA 2ACEA 3B8EA 5H4HA 4D79A 2Y2VA 1C8LA 1MVOA 2YH2A 3ESBA 2X3UA 5HE8A 5BQXA 2ORED 1Z4QA 1R9TA 1M6EX 1Y6RA 1I1LA 5AWFC 1UDBA 2BFPA 4HB3A 1HKHA 4G41A 3X3HA 4BFCA 2FQWA 4LXGA 1BQ3A 4O7YA 4MDYA 3M5DA 4Z0PA 4TS4A 1N32H 4F93B 3PZPA 2BOVA 1GT6A 3L0YA 4YPVA 5KNDD 3EGIA 1GXSA 1TWCA 3ZUPA 4FGZA 2C22A 3WZMA 1R16A 4RYDA 4ZCPA 2BGJA 1M2GA 2W4IA 1PJCA 3KQLA 1RZVA 1MJFA 1KJZA 1TECE 2QPLA 3GK3A 3BJEA 1PK8A 2A33A 1KYVA 2VSNA 4PGHA 2QQEA 3TXXA 4RMGA 1R4NB 1Q7CA 2VNKA 1CDDA 1ZD5A 2Y0PA 2GGSA 3OQJA 5EHQA 3E53A 1CY6A 5CU7A 1U9IA 2BCJQ 3CY6A 3F67A 3HLKA 3K9GA 4QICA 4XGIA 2F3PA 1E1CA 4OLJA 1NF3A 2ZRBA 1RWQA 1AMUA 1CJKC 3E1SA 3CH5A 4UCQA 3ZCSA 4L8VA 5GV7A 4PPGA 3D6UA 2D7CA 3W3AD 4FR0A 4CDGA 1H42A 4XIIA 1U2PA 1YMQA 3PQ3A 3LP6A 4MR9B 4F4YA 3RBEA 1KAEA 4PZ8A 3FYUC 1GG8A 2A4KA 2QUAA 4OHVA 5JLAA 4C4TA 2GM4A 1GAJA 1MC5A 1N3BA 1YWGO 4Y8VB 2IDMA 3A6EA 3ZDXB 9LDTA 4EYGA 2AZXA 3WK7A 2QX6A 1E9FA 3CUWA 4O83A 2Z2IA 4YCMA 3TGLA 3U7RA 2H7YA 4QUHA 4HWGA 4EHJA 2OV4A 1JPNA 2QNRA 4R1LA 3FI9A 1DINA 4DR3H 1R5OA 4G67A 5B7QA 4HWSA 4AC9A 3LYHA 4FX5A 2ZRMA 4R8KA 1C9NA 1OQAA 5IS2A 4R5HA 3OQMA 1Z4NA 3TCKA 1GPWB 5HG0A 4R1NA 2VPYA 2HWKA 2J5XA 1C1XB 4JN6B 1NLFA 2ZJ6A 3EIUA 3HP4A 4AB1A 3DEFA 1PTJC 2WB1A 1ZN7A 1DAIA 4KIJA 3HBLA 1VKJA 1WKCA 3NV7A 4EJSA 1FTQA 4RTNA 5A5DA 4YUVA 2AN4A 3OUTA 5FTJA 4CG0A 5KHLB 2WD7B 5BRAA 5AKIA 1DBPA 1YTLA 4ZEMA 3WLIA 4LYYA 4OH1A 5HKKD 1U4SA 2DECA 2PR2A 1BKYA 4RVDA 3U39A 4DR2B 2QAGB 3DD1A 2BP7B 1N48A 1HXHA 2JIRA 2A1IA 5EDWA 1FYVA 2HIMA 4R71A 1R6VA 3SBDA 5FTNA 4XASA 4P7GA 2P6NA 2H4HA 2HF8A 4A5SA 4CEHB 1P45A 3PFKA 1J00A 4QQ8A 4TZ0A 5D3QA 2CEKA 2YN2A 5EIHA 4EZIA 1ZCJA 5AVXA 5JH7F 1NVXQ 2GNPA 4IKEA 4MKIA 4YJ2B 1EHCA 5F2EA 3ZS9A 1W52X 3D3JA 3B5EA 3S5UA 4BBZA 4U5XA 2H54A 2RONA 2ZTLA 4LZJA 4A10A 1W48A 1ZO8A 3CRNA 4OQXA 4B85A 1K1QA 1QMPA 5LQDA 4WRRA 3DP9A 2UXBH 4AG3A 2WM9B 3M82A 2FUCA 3ZH2A 2VJNA 4WEOA 1WR8A 1P6UA 1QF6A 5LC1A 3CUTA 3RAXA 3UV7A 1J24A 1KQ3A 8ABPA 1F3LA 1XXHB 4L4SA 4BV8A 1L7PA 1JIHA 4TL6A 4LQDA 2XMPA 3DEJA 2QTMA 1FYWA 2G4VA 4K1XA 1C7ZA 3MGAA 3S81A 4YO8A 1IWBB 5JTUA 1AURA 3JAWB 3Q0TA 3U54A 2XHEA 2A1UA 2J3EA 3L6OO 3QQPA 4FNAA 2ZR0A 4TZ6A 5IP9G 3D43A 5EUMA 3RRBA 2J7PA 4UCFA 1Y34E 3TSYA 3P9NA 2M32A 4HQOA 3OP1A 4XVRA 3ZX4A 3TQ1A 4MA5A 4GKJH 1DRVA 4H3VA 1TYCA 4ZGBA 1HDXA 2JIBA 1SELA 3E9CA 4RUKA 5ISMA 3DBRB 2ZRFA 4W8HA 2H00A 3GP3A 3DG9A 4RU1A 4X1IA 4B84A 3VYWA 2GRAA 5L4SA 1YBAA 1XPUA 3PEVA 3R5XA 4IJWA 2WSBA 1XGKA 2EQAA 2VHTA 3KXIA 4QODA 2CF5A 5CT6A 1YIAA 4L2IA 4YP7A 1C3XA 3AXSA 1YT5A 3FMOB 1JXQA 1PZFA 3KKPA 4QOHA 5KFIA 3KQOA 4INJA 3TTYA 3U44A 3GJXC 3A9UA 4NZYA 4C4SA 1W1WA 3DAYA 2E82A 1T2FA 3LZ6A 1XD9A 1LV8A 3RAEC 5DHSA 2WD7A 3OWXA 5DT2A 1XAGA 3EXEA 4L5CA 5FI3A 3EMBA 7GPBA 2E49A 3B3AA 1MA3A 1ODKA 3FY4A 2H2FA 1ZOIA 5DTEA 1CVLA 1E2EA 4LJLA 2ZB2A 1JIQA 4QD3A 1PYDA 5FXMA 4Z7NB 1Z0KA 2ON6A 2MOKA 2RGUA 1C81A 1VCNA 2P8JA 2WTMA 2ZT6A 3WLPA 4GNRA 1L6IA 1RRKA 5KUTA 4Q47A 5F76A 3CSDA 5IAKA 1FDIA 2EG5A 3DOEA 4KO3S 4M2LA 2X0IA 1RKBA 1ZMBA 4JGIA 1JEEA 1XX6A 3C97A 3RYIB 4I4TF 4A91A 2QRVB 2AXQA 1W0JA 3L7KA 3D3EA 3PUZA 3Q3JB 2JL1A 5H68A 1PHPA 1NVGA 1A9TA 2H18A 1I0IA 1TIPA 2DCMA 3OIGA 1YKGA 3QUQA 4ON9A 5JFOA 5CYGA 2I9KA 2VAPA 1UKZA 2A0KA 3HHPA 3C15C 3V8MA 2ZTHA 2O2XA 5DXJA 3NTLA 5C7LO 1J8FA 2EF0A 2Y67A 3E22B 1SUCA 3E05A 4YV2A 1GG2A 3N9IA 4Y6RA 5LXTF 2HVRA 1DU4A 4HDMA 2EU8A 2AX3A 2I1VB 5EWJB 1I4DD 4XYBA 4BV9A 1I2AA 3O2JA 4M46A 3R6DA 2J6CA 4E70A 4RAOA 1JVSA 2IY8A 3ICPA 4MS4B 5DWDA 3AHHA 3TINA 2XMRA 4IHJA 3SGLA 2BGUA 1XZMA 1Z8DA 3ZGOA 1GV0A 4ZMBA 1C1YA 1VS0A 2BPOA 3K0FB 5F33A 4ITUA 1N7IA 3B5JA 2AFIE 2ONJA 2UUBB 5ER9A 4PFQA 2GI4A 3BEDA 1E3SA 5KT5A 3EVBA 2NZUG 1V5WA 2VYVA 3GLHE 2J0UA 1TO2E 3O1LA 4BYGA 4UUNA 3T3NA 3OQ6A 4CMJA 5F1OA 4RCVA 2B2NA 2IYPA 1NFQA 3U7EB 1Y7HA 1XU7A 2K4MA 1HFEL 1OTXA 3VHXB 5L8VA 3QWAA 4N0EA 4RZUA 1JU9A 5TPZD 1FXWA 1S3IA 2VAWA 1CX9B 2LDBA 3O4IA 2BFAA 1E7YA 3EG9B 4PSCA 4TRNA 3S7ZA 3EZXA 5B3JC 5IANA 2XQJA 4ID3A 4FI3C 2BKAA 1SU6A 4XOIA 5ALKA 3ZIUA 4E5SA 5KTKA 3CINA 2J5BA 5ECGC 2C3YA 4EB6B 2ZE6A 2HHCA 3IAM1 4XEHA 2IPMA 5LQMA 3HJTA 1CYEA 4RPGA 3I2HA 2VDOB 4ZQFA 3V4PB 3RSSA 4F56A 1KMCA 3D59A 1QOPB 3IP1A 1XIVA 2NPOA 3AINA 3CX7A 3FFTA 4G23A 4I8XA 3B7PA 4EHAA 3QYPA 3KQWA 4NOKA 5JC8A 4DLUA 3H0CA 1IWPB 2JVJA 3W4KA 3SYKA 1QPGA 2GUGA 3DZBA 1WXWA 3UFXB 2WBLC 1KEKA 1RCTE 2QR2A 4JLPA 3WOVA 1XAIA 1XRJA 2CLOB 2I4NA 2NUBA 4AQDA 4NTZA 1SVMA 4YQZA 1XMQH 4TKVB 1F5SA 1PNRA 4B33A 3KX2A 1LSJA 4IZHA 3W5OA 5SYAA 3H99A 1KR5A 3UW3A 3MMSA 3GFSA 4QBIA 3NZEA 1UBLS 4LVNA 1HTWA 4MJXA 3HR7A 3FSEA 4P3NA 2QTRA 1NJ5A 4PAQA 2PKRA 3I9V6 3KEQA 5C3MA 1T26A 2VTBA 2AF4C 3FCUB 5EKTA 2AXEA 1ZI6A 2Q41A 3HUUA 4L3WA 2EKDA 2VTBB 2IFTA 2X40A 4MWGA 2O0JA 1NVTA 4B2LA 1ZNXA 3PFBA 1AM4D 5DN9A 3GBSA 3URMA 1T1EA 2JAXA 4MI9A 3DMRA 2EFEB 2X1MA 1OLUB 1IK6A 1AGYA 1BVRA 1Y5RA 2UV8A 4RGYA 4UU7A 5HZGA 4DJ5X 2GHIA 1JKJB 1J5EH 1W5AA 2OAEA 1H4VB 3HCFA 3KWFA 1V9SA 4QDXA 4X91A 4ASUA 1XRMA 2N46A 1PWHA 2WF8A 2GBLC 5LIRA 5IUKC 4C89A 5JATA 1P2TA 1MJHA 1YZVA 2CL7X 5D5HA 3V4RA 1F2DA 5FFNA 5D7BA 1II8A 4UNIA 4OXQA 2QAGA 2FCAA 3EAFA 5CFRA 2PMZE 5GZ3A 3PVZA 1Y4AE 2KWIA 4O2AF 2ZIAA 1XNRB 1Z74A 3GRUA 3DL2A 3O4GA 4I55B 1KE1A 3WL5A 4MPDA 3WY9A 4CN9A 2YYAA 1ZESA 4DWWA 4UCOA 5KFLA 3MRTA 1SXJE 3BD9A 3LNCA 1K4MA 3CG4A 3M4JA 3WR5A 3EF1A 1XDDA 3AHEA 4FCWA 1K08A 1E4EB 3USZA 1G1MA 3W2EA 5JQWA 5EHZA 1CJMA 3H11A 2QD1A 2F43B 4M0JA 3VNRA 3ZLTA 3WFJA 5F4ZA 4LRSB 2E4VA 5C80A 1JR4A 5I4IA 3MWMA 4ND8B 3J80A 5IYBG 5JISA 1JDPA 1PS9A 3F6PA 4G4SO 4DMLA 3OAAA 1XKTA 2BD0A 2JGLA 1MAHA 1VA4A 4UVIA 5BN5A 5KQPA 3BMNA 4AP5A 4KPGA 1R9JA 1WL8A 4TV8B 5DU2A 1UBSB 3ECCA 3I2YX 3OY7A 1JMYA 1EB8A 4GAEA 4OQEA 2AE2A 3N2NA 5DSTA 2IWHA 1J0CA 4D57A 3NTXA 2G0TA 1THTA 1XK5A 1AN9A 1V1JA 2NXEA 2ODAA 3DA8A 3EBPA 2D5BA 1PJ8A 3H5AA 4KWIA 5C3UA 2Z5LA 3PIRA 3PO3G 2JEJA 1SA0B 2RSLA 4GC6A 1L4EA 3BZWA 1FW8A 3RB4A 1F2UA 1OWNA 4LW8A 4OFBA 5FFFA 1X1RA 2QA5A 3UPDA 2B8WA 1JB1A 1TVEA 1SB9A 2DTEA 4AXXA 4JD5A 1ZYUA 1ACLA 4JSRA 2RDMA 4E5YA 3QNMA 1HSOA 3JVDA 4TT8A 4G0WA 4CR8A 5EZQA 3GOQA 2R97A 4ETSA 2EEPA 3BQ1A 3NVAA 4HNAB 4MGEA 2ZCVA 2D7DA 4EFKA 2C78A 2CYCA 2B7LA 5BORA 1BMFD 1SG6A 1I3QA 5C8ZA 5G2OA 2FY8A 1WTCA 4BVLA 4EO4A 4G0MA 2LCIA 1TKBA 3AGQA 3HABA 4HF7A 4DIKA 5TJ9A 1DIKA 3EDYA 3VKWA 1VJRA 5EPUA 3GJ5A 1EM6A 1WDWB 2A5JA 3TMAA 1VYVA 2NZYA 3DCIA 5B3AA 5F51A 5HKKA 2ZYWX 1G20B 2QN2A 4DS3A 4DM4A 4PG8A 1USWA 2GERA 1FVXA 2FMKA 3ER8A 3EGEA 4UCSA 3DMTC 4RVUA 3T0FA 1QLJA 1RRMA 1ZDMA 2PYZA 1HT3A 1P75A 4LWQA 4CQMD 1WMBA 2PH3A 2ZAIA 3KZNA 3QE4A 1PZNA 2FLVA 3S24A 2WNHA 1Z0AA 3HN2A 4CQMB 1XPRA 3IR6A 1XTPA 3TLZA 3UXMA 3P27A 4F97A 3I01M 3SZ3A 2E4ZA 1IUNA 3DBIA 2Q7DA 2PLNA 2VPIA 5CG2A 3KKMA 4Q9JA 4FK8A 4G1MB 4TS3A 2H07A 1LVHA 3RW9A 5MFPA 4D9IA 3H4DA 1NR1A 2MIIA 1HLFA 3DOCA 1S01A 3VX4A 1SC9A 4BMDA 1YE8A 2PM8A 2V4ZA 1A5AB 4JXUA 1SKQA 5K3AA 3QLUC 1ZM9A 1CZNA 1UJNA 2GCGA 4FE4A 5L51A 4DV7B 4O7NA 3BA8A 4TV9F 2I76A 5ULLA 4IFIA 2DPYA 2B4AA 5K1ZA 1IPFA 5L45A 6REQA 3V1NA 5EJ6A 3ZU2A 4TMTA 5JPDA 1U4NA 3LT5A 2GF0A 1D9XA 5C37A 1ITZA 1U9YA 2JLXA 1LZLA 2P9FA 2VRBA 4DAOA 3KPWA 4O3PA 2EX1A 4X64H 5J47A 4AQ7A 3EQ7A 1I3LA 3AUKA 5KQGA 1WHSA 2Z08A 1ISPA 2ZRDA 4HI0E 2GARA 3K0CA 3FTPA 4K9KA 1LWNA 1L7DA 2JZCA 4JJZA 3L43A 4K3UA 2W6NA 3QE9Y 4MUAA 4CLRB 4EBDA 5LQKA 3LO5A 1RJRA 3IEXA 2WSSD 1VCOA 1WXGA 4IQ8A 3S3TA 3CU5A 4Q05A 4K40A 2XUJA 1Y0BA 3VO1A 2PGLA 4YRAA 1D0IA 1UMCA 1T0JB 1DAMA 3L41A 1SURA 3WK6A 1KA9H 1JDBC 2V7XA 1HEYA 1ZGJA 4JLSA 5KWEA 2D1QA 4O02B 2QX7A 2E4XA 1NQXA 1DMRA 3W8RA 4NNPA 1XN4A 4O0MA 4BKQA 4YCLA 5CVJA 3N6XA 4BMCA 3R6TA 3GTGA 1NVMB 1QJCA 1A9XA 5JMTA 3MJCA 1A82A 1IZYA 1QGDA 1I24A 1M10A 2ZJAA 1Z5WA 5A3SA 2ZRLA 2HB6A 2HSWA 2W70A 3FB1A 3HB9A 2ONZA 3EXFB 3KUDA 3JVUA 1HRKA 2X2OA 3CNQS 2P75A 3C3JA 4JJ7A 5JY1A 4G0ZA 3ZWMA 1ESMA 3T4UA 5C3EG 5HNEA 4B31A 1M1NA 2XGMA 3SQWA 2KSQA 2ZUVA 5TPWA 3KIPA 1PR6A 4QNMA 3H5VA 5LD2C 4RM3A 3SF8A 1N2EA 1PWZA 2WWGA 4GLWA 3SD7A 4S1VA 4MIOA 1UL1X 4B47A 3O26A 2KW5A 4H3KB 5CVUA 1ZC3A 2DU8A 3RARA 4RZ3A 1LDYA 3K09C 1VECA 2ENUA 4M0KA 4XEUA 1NNSA 1A8UA 1T6ZA 5AK0A 2OQVA 2FPLA 1OU0A 5I9BA 1NTOA 2YMLA 3EGOA 3GNLA 5FPHA 1G6Q1 1U80A 3EISA 3CKLA 1N92A 1PG2A 1T35A 3DC7A 1QPZA 1CUVA 3LKBA 5ERXA 3DXYA 1KXZA 5KPJA 2FSUA 4A3KG 4JB8A 3RUHA 1SIBE 3OWHA 4EPWA 4HGZA 1T8RA 3LT0A 1M2FA 3K2EA 3ENVA 3BD6A 2O2CA 1MEEA 1CB7A 4JBYA 1HYHA 5A05A 4S12A 1ZJZA 4Q4CA 5GINE 2WP0A 4LV5B 2PMWB 3AYXB 3WTCA 2W6JA 3LUCA 1PL0A 1Q2XA 1RJDA 3QYFA 1UK7A 4ERNA 3LKDA 1V51A 4WAUA 1R18A 1NXXA 4LBYA 4UM7A 3LMLA 1XD8A 3R7SA 4DDKA 4C5AA 1VCHA 5HQTA 1FTWA 2JI8A 2PUWA 1VLHA 3SG0A 3WGOA 4C3VA 1BRTA 3EXHB 2AMLA 2XBUA 5A1TA 2I33A 2RKOA 2ZUDA 3M6LA 4RSMA 2ZXFA 3ZDZB 2OOSA 4FI3F 2F90A 5JXHA 3JR3A 4A23A 1R4MB 4Q02A 1IJEA 3SFZA 3CCCA 4I46A 1NXQA 4D97A 1H94A 4P4SA 3AOGA 3FHCB 3CGWA 4ZC8A 5DK4A 1SCKA 3AJEA 4PG5A 3W1VA 4KB5A 2IU3A 4G5HA 1W8IA 2Y0EA 4DA8A 3ZJUA 3M1LA 2Y1CA 2ZJ7A 2P4SA 3MQ2A 2C2EA 5CB8A 1QIMA 3OLVA 4Q4AB 2N3ZA 3CRRA 3RWMB 3N8HA 5CDHA 5F2KA 4CHIA 3BHIA 2F1OA 5IT9A 5CX1B 1S2OA 4L1KA 4FGJA 1AZSC 1SOAA 2PXXA 4WCDA 3H9BA 4J16C 4ARCA 1Q0HA 4PWZA 4YXFA 3M3DA 4QJFA 2FEXA 2QMOA 3KEGA 3T9DA 5A4JA 5CVTA 1N2OA 2G40A 3DDWA 2YXNA 4U8GA 1Y33E 5CYPA 2JKYA 2Q5CA 2NXCA 2BFEB 4NY1A 3GWGA 4V0ME 3TX6A 3U13A 1QE0A 3NS7A 5DH9A 3WGTA 1REQA 3RFTA 5AO9A 4BJ1A 2B34A 1Y5MA 4BY1G 1ADGA 3CLUC 3KSUA 1L1RA 2SNIE 1Z0UA 1ZD8A 2WIKA 1C1HA 3GFFA 3H2YA 3MIZA 4KI7A 3ZDQA 4UEOA 4PO9A 1BH6A 1SH7A 1YKFA 3DE1X 4FFSA 4IGAA 2COJA 1GCUA 4J75A 1BFDA 4QPDA 2IVZA 4LF8H 4DV4B 3FZQA 3DAHA 3L84A 1XLWA 2QLFA 2YW9A 5DIZA 1F20A 2B4KA 2AGPA 4LXQA 4IOLA 5DEOA 3QX7A 4JI8B 2BSAA 4N4AA 1OB5A 1SQGA 4JP3A 4LY6A 1P8AA 2F2TA 3QLVA 3V5NA 3Q3IA 3ACCA 3DMTA 2ZYIA 5IAAA 3CQ9A 1SUEA 4MDFA 1FUYB 2BEWB 2H16A 3HSKA 1ONNA 1NY6A 3M2TA 4TRMA 2MCTA 4U7CA 1ZNQO 3GT4A 2Z0MA 4MQFA 1XL0A 4OMCA 5F3DA 1X14A 2O5EA 1B26A 3DZIA 4Q6BA 4EL0A 3PC6A 1CWUA 3OQOA 2QY6A 4E94A 1NV8A 1CZLA 5LA6B 1D1TA 3D5TA 2WAQE 2A1UB 3DP7A 3K94A 3PJDA 1UPFA 1FS4A 1BFKA 1OFUA 2PMZA 4HAVA 4R6WA 4XYMA 3UHOA 1ECGA 1L7QA 2R2AA 3F7NA 4QOEA 5KFRA 3CZMA 4ER0A 3FCCA 1EX9A 4AF8A 1K66A 2JHAA 1GGEA 2AYXA 4JIMA 3DLCA 4EG0A 2HA6A 2R65A 4O8ZA 3TI7A 5HQJA 3RS2A 4YUYA 1IN7A 4PSDA 4J9KA 2OFXA 2XWQA 3CEMA 3GLGE 3TPZA 5ELLA 4PX2A 4ILEA 3NJ4A 4EF6A 1Z3IX 1NXVA 1UNNC 3N2IA 2DR0A 3EWIA 2CVOA 5GONF 1ATIA 2ORWA 5DNEA 1NXPA 1Z2DA 3AERA 4FDTA 4J43A 3I2FA 2WJHA 1CHDA 1KFJB 3AI2A 3E7DA 2UYOA 3PD0A 2NSYA 2BMVA 5TX7A 5FWAA 1OVGA 2EJ3A 1U0NA 1C2TA 2AD1A 2GUWA 3MERA 4HFRA 4LHWA 4DQNA 1K3FA 4B6RA 1B16A 4X41A 4DDMA 1IY8A 3I9OA 3L3BA 1TVKA 1XELA 2AJCA 4Z8XA 1EG2A 2EHJA 4WXMA 2BLNA 2JFVA 4HQ6A 1IZ7A 1ZGBA 4Q12A 4D0RA 4EIWA 3KZOA 2FEAA 2VQDA 3DT9A 2VAXA 3E9RA 4FINA 4ECTA 4HYQA 4K9DA 4ZVLA 1M33A 3DULA 3UGTA 3F73A 2PGNA 1RRCA 2P91A 3EEBA 4C5CA 4KR9A 5KPDA 1XVVA 1OFVA 2EVWX 3NM4A 2KLHA 3LAWA 4WCVA 5TDHA 4YIHA 2RARA 3HS3A 5K8IA 4BKPA 1P1JA 2MYUA 4LX0A 3UHJA 4FXOA 2Y1GA 3D4LA 3LVRE 4L73A 1ZA1A 2HMAA 1VMAA 2ZYRA 2I3GA 1XTRA 3DE6X 1FJGH 1D03A 1QHFA 4O4LF 1JA0A 3LYUA 5AOVA 3OOEA 2HMWA 2UYGA 3TW8A 4EBFA 4EJMA 1C9KA 4WY2A 1QG4A 1QX3A 3QMPA 5IM5A 3KKZA 1H6DA 4FMBB 1HZJA 3GZNA 2PSSA 4LMBA 4GRIA 4J91A 1OT3A 3HRIA 3C48A 3PE6A 1P7PA 4FE7A 1DQRA 4NWIA 2F9LA 4BB0A 3AEQB 3GN1A 4U7FA 2BKLA 5EMHA 3DAAA 2QRNA 3H2ZA 1UZLA 5EOVA 5DHQA 1MAAA 4KQFA 4EYKA 3O3OB 1BAPA 3LCCA 2HLNA 2PJRA 3EGXB 3JVEA 3K5HA 3C6MA 1Y89A 4WNYA 3TZBA 2HUPA 2W2PA 5E9QA 4A6PA 2Z8YA 2XD9A 3NVMB 4D3DA 5I7HA 4KOEC 2J08A 4XXHA 2IH4A 1BDIA 4RS4A 2PGAA 2ZROA 2PLRA 4IJKA 4KQ1A 2M2IA 3Q8SB 4Q0YA 3RJ5A 1PYGA 4BIIA 2QRQA 4Q15A 5K51A 4N6NA 4NDNE 5I8WA 3VPGA 1E3MA 5DNWA 4K6CA 2GESA 1BXZA 1KS9A 4Q3LA 1U94A 4FYKA 3X1MA 5FFMA 2WU4A 4Q03A 3U17A 3VBEA 2XRZA 4J9VA 3MCWA 3EW7A 1WOYA 4C14A 5JARA 2G9RA 4YRCA 2RBKA 2OK8A 2H2AA 4J1NA 1DEOA 1EAYA 1Z6YA 1OZAA 1QWSA 1Z83A 4K6KA 3NOVA 4O2BA 5JSUA 3H5WA 4OMDA 2PUVA 1IHXA 1MQ8B 4HK4A 1P7WA 5TS3A 4BZWA 1GPH1 2JW5A 3B78A 3PT9A 4WCFC 1O94A 1PS0A 2P4EA 2DWPA 1U4OA 3NDBB 1QFSA 1Z0DA 1M2WA 1O0SA 1E6MA 3O4RA 2WK1A 4DLLA 4U9UA 5L6LB 2NVOA 3ZCQA 1D2AA 5F78A 1YDMA 2FB9A 5L7TA 4F4DA 4JLKA 4L7VA 3LRXA 1RWPA 4QAJA 3AWDA 1A2QA 3R6LA 3IX7A 4HGQA 3HO6A 3L7BA 1U8ZA 1PJSA 4P5PA 3T1QA 3GLVA 4PEVA 3MUNA 3RYTC 1Y1KE 2PUDA 2Z1DA 4QU8A 1PBNA 5EG5A 3SGIA 3QKIA 4FOOA 3N6VA 4H60A 3VVBA 5JFGA 4LF8B 2X5RA 3CJTA 3EWNA 3I62A 2C58A 4BQPA 2I2AA 3IPYA 4UHJA 2OXFA 1RZ3A 3HVJA 4R7GA 4HXEB 1JLKA 3NHMA 3TECE 4DV6B 4OHPA 3NMUF 4DHEA 3LWBA 5IM4F 1RBZA 5HM6A 4PBTA 3FGNA 2Y4NA 4QXRA 3D64A 2YJTD 1KEEB 3E5RA 3PC4A 4KW7A 4OKIA 5G53C 5I5SA 3IHTA 4R2XA 2OA0A 2R66A 3VDQA 3HO8A 3INYA 3DONA 2B8JA 1UT8A 2CD9A 4WLEA 5EXDA 4ER3A 1YIOA 2E4AA 2VLBA 1WRVA 1Q11A 1VLLA 3C7TA 3Q7EA 2XX3A 5FPKA 1POXA 2FPIA 6LDHA 1T0UA 2A9VA 3O2QB 1HDIA 4LDRA 4N3AA 3P7MA 3EZ2A 4B7ZA 4NZNA 4A93G 1JXOA 2AC2A 2B37A 2QRGA 3NOOA 3MLEA 1V4NA 5FLEX 3RBVA 2CHFA 1XJ0A 4C43A 3PFHA 4NMXB 3ZXXA 2Y1DA 4CTMA 4L28A 4ODIA 3PXXA 1O03A 5T6BA 3TQRA 1H0HA 2Q28A 3BH7A 5JROA 4Q9LA 4LF7B 1D2HA 1LI7A 2NM0A 4N82A 2CNWD 3SQLA 5K3FA 4XARA 2EOAA 3EYYA 2BEKA 2Y1WA 3N8NA 3PDUA 4GPBA 3MWJA 5FPOA 4N1AA 4RPCA 1EBBA 5GADl 4DYVA 2IEDA 1OKKA 2RJOA 3RWOA 2ROQA 1NBEA 3DDZX 3LW7A 5LDDC 3LQSA 3OO0A 3MRXA 1AKWA 3KQNA 4U6NA 2O3QA 2BR4A 2C4HA 1UFKA 3H6HA 1LDEA 2BM1A 1I51A 3AESB 3W6NA 4CMFA 3KZ1E 2NXNA 3E9DA 5HXAA 1ZRHA 4WY8A 5JHHB 2C28A 3HKZE 1GN9A 1W96A 2ZGIA 2OMEA 4BLTA 1EA7A 2VDKB 5CNKA 4IYJA 2V4UA 5U9CA 4LGYA 1NT2A 3OZEA 1MTZA 3UZOA 2YV3A 1JEQB 2H85A 1NZJA 3LWZA 3HJUA 2IZOA 3JYOA 3QTTA 4X8MA 5LOVA 1OPXA 3KUUA 4CM9A 3U7QB 4RD4A 1XZQA 2X19A 4BFYA 5K6AA 4DPKA 1RQNA 3K05A 2O2EA 2N42A 3E2IA 3WXMA 4AJNA 2ZPUA 4MYRA 4PLPA 4LOAA 2V0CA 3EBOA 4LZNA 3UHPA 1Y8QB 1VLZA 3GV7B 1E60A 1RNLA 3IESA 3QHAA 4Y2UA 2XBMA 4DV0B 3H16A 4YXWD 3IQWA 1TJ5A 2OENG 3BB3A 4JJIA 5D6OA 3PQDA 1N8NA 1WQ1R 2FSHA 4YRLA 3RIXA 5E7MA 3ROTA 3NVKI 4JFAA 2NYRA 1C9MA 3CC8A 3KVVA 3PGKA 4W5QA 2J41A 3OQVA 2IYZA 3ND5A 1PR4A 1ZOPA 1KJIA 621PA 5KYUA 4B82A 4DDHA 4BNGA 5I7RA 2M05A 1E4VA 1E9CA 3MINA 1CG6A 1D5WA 1G16A 1A9XB 1KRHA 1L7VC 3F9IA 3HY6A 4UOQA 3U31A 3V1KA 2PUAA 1TAUA 3IOBA 1KIMA 1XCJA 3HCEA 4NS4A 4TYWA 3E9NA 1L9KA 3CUKA 1KI6A 1KZ4A 2HBQA 3G82C 1UBGA 2H51A 3JQ6A 4QM7A 4RKQA 2G8LA 3FJOA 1UWLA 4AJEA 4CUKA 1P4GA 1SBCA 2IYXA 4IO1A 1EFPB 3RSZA 4DF3A 2GSDA 1KI6B 5DKFA 1TAEA 3SFTA 3SIWA 4PYNA 3NEAA 1FLDA 2NTNA 2WWXA 3G02A 3IYLW 3PE3A 4LYFA 4XAQA 4Y9UA 3STWA 3GV5B 3ZDEA 1H4QA 1KYQA 4XDGA 2QV7A 5FI1B 3SDBA 1MIOB 2AYZA 3L6EA 1Z45A 5KFNA 2P3QA 4BTVA 1YS7A 4NCNA 2PLAA 3OM8A 3P4UA 3WGUA 4W8OA 4HGOA 1ENZA 2AW5A 2C7RA 2VPWA 3ABOB 3CLUD 4MMZB 2I6QA 5A7GA 3C3XA 5DB4A 3TZ6A 3FKQA 2LRHA 1NUUA 4ZOLA 2VYFA 4ZYUA 4JXZA 1JN0A 3ELBA 1D1PA 1TKRA 1NVDA 1VDZA 1XZDA 3ACBA 3HWWA 2JD0A 3OF3A 2UYCA 2DPJA 4X1YB 3H3XA 4FYIA 1RPJA 3BWMA 4MIKA 5CNJA 3KS9A 1RLOA 1YDHA 5C1PA 3ZHSA 2GO7A 2O52A 4RL6A 1CBUA 4FUQA 4U39A 4ERXA 4AIIA 1X0VA 2IPOA 1PZXA 2ZSAA 4K1LA 1VYUA 4FFRA 3AHFA 4C1NA 2D3TA 4JVMA 4M4SA 3GEEA 4E32A 3EODA 4Y9TA 4ZXPA 1BG6A 1N34H 3CLRC 3E3OA 3UIEA 1I6UA 2OB2A 5B7GA 3LPDA 3BGDA 3IT0A 4N01A 3ZZMA 3W8FA 1U04A 3DFUA 3AL3A 1CERA 5HV6A 1X7XA 4WXHA 3AVTA 4BWGA 4CQLB 3TOSA 1K6JA 4JQSA 4UUPA 5F1KA 1NUQA 2UVRA 4L16A 3QV2A 5ENZA 4NPCA 1T2NA 2C29D 2VWHA 3IDZA 1MHTA 3PQFA 3N2LA 4EUNA 1FP4B 3SC3A 3LLCA 1JILA 1J8QA 1CTQA 1TCUA 5E25A 5K09A 4I1OA 3K70D 2VXYA 4H2DA 3CNBA 4N7RA 5A7FA 3G89A 1M3SA 2UVVA 3GRZA 3NBMA 4GMGA 4WN3A 4ECVA 4WSOA 1GO3E 3BS4A 4CL3A 4Q3DA 2DT5A 1WU7A 2C2MA 4LZOA 2OO5C 1NDQA 3MQ4A 1BDJA 3PQEA 1OIVA 4OLAA 2DUJA 3PUJA 1BWPA 1L5QA 3R5JA 4CQJA 5EWMA 4JYAB 4GZ3A 2F6RA 3FR8A 4OF4A 1AK9A 4EGJA 5LZ4A 4PZDA 4YTEA 1BOOA 2JA8G 3FKSA 1U0GA 4HTFA 1S6YA 4HLUA 3TKYA 3F6YA 5I5WA 4HYKA 1AKVA 3C7KA 4S1TA 5HDBB 1YA6A 1U9IC 4RH3A 4F85A 1AQNA 5A04A 4KPUA 4PZ6A 4X6YA 1QFYA 2Z2JA 4P98A 1TZ2A 2GYYA 4C06A 1AUXA 4MUEA 4RUAA 4Y9RA 4MV7A 1E63A 1TTQB 4I9UA 3V9PA 1JSLA 2I99A 1X7WA 3RV3A 4M9UA 2J6IA 2FEPA 5BYJA 2R8XA 1JEQA 1U7DA 2NYUA 2YHIA 3T5PA 2QYZA 1YAJA 1ZVJA 4Y1RB 3H19A 4D1YA 1XP5A 4TZTA 4F6CA 5A5EA 1V7ZA 2WVGA 1IQPA 2FEWB 2Y27A 5H3LA 3ZWQA 4PC2A 4B17A 4ENWA 3E18A 1QVZA 4ZGWA 2PLWA 3O4FA 3BHNA 5B2EA 5B2FA 3EXIA 4HWPA 1CY0A 2OFOA 1ECFA 4MIYA 4QU0A 5LKAA 1OBHA 4INOA 2AZMA 4GKJB 3QPBA 4UUAA 2HLPA 2J31A 1ZNYA 2OWEA 4DLZA 4P80A 1JS1X 1YJ8A 2PCLA 2HQBA 2ZR7A 4RTLA 5AK3A 4LJKA 5FA5A 1X80A 1Z3CA 3TSCA 2V7QA 5IXJA 3KCQA 4TVKA 2R8BA 5AM3A 2BEUA 5KYYA 1YI1A 5C32A 1R9GA 5CUQA 4EY3A 4HWOA 3KD2A 1ISRA 4JLAA 1G8YA 5BWBA 1TLTA 5ES4B 4TM5A 1OGIA 3D8TA 1CC1S 4NBRA 4KPFC 3NTRA 4LFBB 1EUZA 2IYUA 3ZHCA 4YT2A 4LWPA 4JELA 5KFMA 4J9NA 2RGNC 3NGDA 1JQDA 2DFDA 3FRIA 1LLUA 5AW6A 1YFJA 1T91A 3G5TA 1G4HA 1Q1AA 3SNOA 1U99A 5HJEA 1ZL0A 2ZSFA 3I6QA 1Z29A 4LSZA 1T4DA 5IARA 2PL5A 3QY0A 3R7WB 4U3JA 4B6OA 1QYIA 1E4GT 1P0IA 3KR2A 1VMIA 3SYTA 4UTPA 5C5EA 2VCEA 4TWJA 1DDOA 5GM2A 1UT5A 3HCAA 3UC9A 4A0RA 2PZAA 4NONA 1CZHA 2PX0A 4JL5A 1GWNA 4RNDB 3ANXA 1E59A 3IP9A 1NJSA 2YFHA 3I09A 1S1CA 4DLAA 2F3TA 2P79A 3T5GA 5IW8A 3VO2A 3WRXC 1S89A 2PR7A 2HY7A 3B6ZA 4L15A 4DQ0A 4HV4A 2GXQA 4FOSA 2A0YA 2QTVB 4IO0A 5ARCA 3AV3A 3FF4A 4O1MA 1Y3HA 5CT5A 3KQKA 4QATA 1HFKA 3RAGA 2H1RA 4OHCA 5KWSA 3GNQA 3M7IA 4P4TA 1A72A 3R0QA 2XXAA 1E2JA 3BAAA 4YBRA 5BPFA 5EJMA 3PFWO 5G3YA 2WYOA 2D1FA 2HBYA 1KYYA 5JS8A 4UUBA 3PHIA 5TB5A 2XKKA 1N6OA 1ZJYA 3IIIA 5MHTA 4XCQA 4WOCA 1P2DA 4AZTA 1I7SB 4IXTA 1FW6A 4HNGA 5BWWA 3ZEAA 4UZFA 2VVTA 2G63A 2WF6A 1EP9A 5DK6A 3JARA 5HF9A 2CF6A 5DFAA 5BRNA 2IPLA 2NV6A 1V1RA 1N3YA 4O59O 1T9HA 4XA8A 3PPXA 2JEYA 3EEQA 4F7WA 5IFKA 1IQUA 5H80A 5IK2A 4DE5A 2Y0SA 3AHGA 1AKTA 1TO1E 2HDHA 4RZSA 4RTSA 5GIPE 3AR8A 1WAMA 1QBGA 2XWPA 1KI1A 4J7UA 4ZDWA 4EKIA 3BGIA 1VGVA 3EGDA 4V0LA 5L3QB 5LM3A 2BIFA 3O21A 3DZFA 3OLZA 1H5QA 1F7UA 2D5CA 1MV5A 3DKVA 2XGPA 3RU9A 5DGIA 2DZDA 4J90A 4N0PA 2IYYA 3CKKA 1A9ZA 3PW4A 2A94A 1EKVA 3R3YA 1LLCA 4RY9A 1ZUNB 2AFIB 3KSZO 3TBHA 1LNSA 1NKSA 1KY3A 4GQIA 3GFGA 4U6SA 1PW7A 1EB9A 2RKWA 4PYOA 3D2BA 3BE5A 1K92A 3EY9A 2J59A 3HA5A 3GH1A 1ABBA 3FKIA 1NXOA 1U7WA 4G1BA 2ZWAA 4ALJA 3BQMB 3QHPA 5EJ5A 5JJBA 2L82A 2PZJA 2VR1A 4US1R 5HK9A 2JAPA 1E1NA 2EEZA 4J9LA 4Q7LA 1M6WA 2WG2A 3K8OE 2ZI7A 3IV7A 3G5UA 4LJ8A 4F3YA 2YOFA 3M6VA 1SWWA 4LE2A 3TPFA 3VR4D 1SBZA 1XU9A 3CN9A 1ENYA 3OF5A 1DLJA 3FPKA 4M54A 4XLTA 1SRQA 1QTRA 4XTRA 1ZC4A 2Q0XA 4NOJA 1Y7IA 2CNUA 4NYEA 1RWWA 2YIJA 4AZSA 3O1JC 2DHRA 4RETA 1G7SA 2AI1A 2C59A 4LS3A 1RQGA 4N8DA 5CM8B 5CLJA 2XB6A 4FS8A 4G0UA 1M2OA 3S2SA 1UANA 3IDSA 3MGBA 1YE5A 4HMPA 4S2EA 1YBMA 5C8YF 5BUQA 1LSOA 3MMNA 1E7MA 3R9IA 1FFXA 3RGZA 1GRRA 1YHYA 5BUZA 1K6XA 4XM0A 1KZ1A 3C8DA 5I9SA 4ED3A 3RTCA 1YUBA 3KZXA 5FBZA 1DXHA 2RI0A 4QL3A 3FH0A 3IOMA 4ZT2A 3ZXIA 5JYBA 3IE1A 1Q2UA 3GTMA 2OMKA 2V65A 4DCTA 3N1UA 3RUDA 2J9FB 2XGOA 4ZVUA 5TR9A 1CF2O 1V7QA 4C0HA 3UMFA 4N9WA 3ZWCA 1SUSA 2GHQA 1B6SA 4OP2A 1FQWA 4KO8A 3R8CA 4G3IA 4MMYB 3FW1A 3SYLA 4UPDA 2VF2A 4HDCA 4Q9HA 1O97C 1QHXA 2IQIA 1L8QA 1OFHA 4EHHA 1TCVA 4JEMA 1IQRA 1NBIA 4X45A 3UJDA 5COBA 3ZIAA 2QTAA 2FOLA 3WQSB 4TTVA 2BT4A 1PL7A 4ZKDA 3H1EA 3AP3A 4E5VA 3RAJA 1P6XA 2RGAA 5EQFA 3TZHA 4D8TA 7YASA 2OHGA 3VPSA 3V6JA 1WU8A 4WKPA 3ZJVA 2WUDA 4XGQA 2M9MA 4AZWA 1JHPA 2YQ4A 3ZE0B 2PZLA 4HGRA 2FETA 4DSUA 5B57C 4PGGA 3DWIA 4DR1H 2XE4A 4RSRA 5K5EA 2J6TA 3STYA 1HG1A 2GEBA 1M7JA 2VRCD 3RYCB 1IXRC 3LFHA 2VH1A 4Z9YA 4YR7A 1ND5A 1KL7A 3RBZA 4Z3KA 1KVQA 4KNVA 3NBKA 5CR9A 3SS7X 2Z9BA 3B3FA 3DTVB 1R2QA 1MO4A 3EZ9A 1KIFA 3WLEA 2H9AA 5GJCA 3WLFA 2Q1WA 3L77A 4TMKA 1TYZA 2GVZC 4G8JA 3W04A 3ZZUA 3U4QA 5BMVF 3B9PA 4CMBA 3L18A 3C7CB 1PX2A 4WOKA 1BXGB 4J9UE 3LCMA 2HRQA 3TJMA 1QKKA 4TRJA 3KEOA 3ERCA 4QUIA 5GP1A 1YVEI 1X7ZB 2PRKA 5CTJA 2LVBA 5KI6A 3UCXA 4D44A 1WSBA 3GJZA 3RADC 4RCNA 1VM6A 1ZVKA 2O1XA 2VHUA 4MS1B 5ARBA 2BHTA 2O0MA 4B4VA 4NLGA 5A02A 3JD2A 1QIIA 2XVXA 3KJXA 3OBBA 5K8CA 4F12A 4O4IF 4EZBA 1U2DC 1LFDB 2FJUA 1H2HA 3PICA 5CNMA 4BEJA 5KX5A 3L0BA 1ZH0A 2CVZA 1E69A 1V1RB 2EHDA 2WJ4A 4CQNA 1X9IA 3ANSA 4M0PA 1EE2A 2HOQA 3B89A 4TQRA 3ROQA 4QXOA 2P9HA 1R5BA 2FW0A 2OLSA 3U37A 4C07A 1FDTA 1WB9A 1VG0B 4GBJA 3VZCA 2C7QA 1FMFA 3RVQA 2X4IA 1VLMA 4Z86A 2F1HA 5BN4B 3G5LA 1DS6A 1QYVA 3O8RA 4TLEA 4LF9H 1Z0FA 1LX6A 1NQAO 2XIQA 3FPBA 2L17A 3RS5A 4FS2A 3IELA 1B6TA 2O7RA 1A2KC 3H7IA 5TMEA 4W4TA 5CB0A 2H63A 1H22A 6GPBA 4B3SB 4HNRA 5KJ1A 5JMWA 3IUYA 4IUCS 1WCMA 2Z6VA 3F6RA 4RLSA 3TZEA 1Y1WA 3T1HB 2KBEA 4ZTBA 5E7QA 1R1DA 3OMLA 3UUFA 3DBHB 2WSYB 4F84A 4KWTA 5DGCA 1QIDA 3MOGA 3TL3A 4MICA 2WWRA 3E03A 4MRSA 3U0GA 2EFYA 1GYRA 5KINB 3BWDD 4JR0A 5A5FA 3PE4A 5K99A 1W4AA 5DISB 1IDN1 2PS9A 4L3OA 4BBPA 5G1OA 3C24A 4BO2A 3TUZC 1ET0A 4TMZA 2OCYC 4J0QA 1XQ9A 4MW5A 4C05A 4IDQA 4P3KA 3SQDA 4LVUA 2PPVA 3V4SA 4QLBA 3RSQA 3FWKA 1P18A 4NBNA 1QRRA 1U0OC 4RD3A 5TARA 4I50B 2IUUA 3ELWA 3X0DA 1YIDA 2V59A 1XDZA 1NBWB 1PVOA 1KARA 4MRMB 2YMQA 1CUJA 3K9CA 1QC5B 4NYMR 1HGXA 2AOWA 2X5OA 4HBGA 1IAQA 4C4PA 3GLFB 2BFCA 1RJ9A 4XYEA 4UBLA 3L8GA 3SSAA 2I3BA 1K8XB 5KYGA 1WUTA 4KIFA 3RK4A 2BN4A 4PN3A 1A97A 2AMVA 4O0LA 4AO7A 1FTNA 2JGDB 5HF5A 3FDIA 4P7KA 3C2QA 3W2GA 2A0XA 3K32A 2AA3A 4DG9A 3RRNA 1MRSA 3KLNA 1MB9A 5IDQA 1B23P 4UAJA 4YBZB 1DB3A 2D2IA 2YMPA 4J3JA 4Q19A 5ED0A 3KTOA 5BSRA 1DKOA 4GECA 1Y81A 4FHZA 4X6XA 1X8KA 2FZGA 4LZLA 1D8TA 2E7ZA 4LYDA 4B79A 4Z54A 1FZTA 1FFBA 3AWIA 2DQKA 5EWJA 4FWBA 3C45A 4EO9A 2OXEA 4DRZA 1YS1X 2COKA 3M9NB 3UAWA 1TWHA 3IBTA 3UO8B 1T6NA 3IO3A 4EJ2A 4DZRA 3ZOKA 1OAAA 1HNZH 1XDGA 2P67A 2ZIXA 1XQ1A 5AKHA 1UDXA 1E2BA 2B2XA 4G5XA 1K1EA 1GSAA 1XYVA 1Y6QA 2OGUA 3BIOA 3D8HA 3G85A 2Q7XA 3GRVA 4L0QA 3NAQA 4MP6A 5FBRB 5DF1A 4PONA 5LOVB 4KE8A 4RJLA 3D3WB 4BAZA 2ZTMA 4NCIA 2YJ5A 1JLSA 5SY9A 1AK2A 2MSCB 4M21A 1IVYA 1HC7A 4M1ZA 2DAPA 4HD8A 4OHRA 5SY6A 2EL9A 2VQFB 2Y1KA 1ORVA 5REQA 3N7TA 3UBTA 3T7RA 3ROEA 4CT5A 1TPYA 4ENTA 1Q91A 1HDOA 1KI4A 4YN3A 4DV3H 3ZK8A 1EVJA 4BEBA 4BE9A 3H3JA 3KPVA 2XCIA 4KE7A 4QT4A 4TYMA 3RVMA 1BOFA 3UYKA 2ODQA 4LAFA 2C7VA 5F9NA 4XYLB 3TNLA 1JJ7A 3AIIA 3WQRA 1KBOA 1MU0A 1BN6A 3NCTA 3OWOA 4W7IA 4JC4A 2HYIC 1Q0LA 1ORTA 4EUEA 1Y7TA 1RKVA 1TDJA 2WJ3A 4XZ3B 4P93A 4B45A 4R40A 1Y3CE 4FGWA 4CQMA 2DLNA 1AC5A 4K86A 4S1NA 3Q9UA 5JVLA 3K35A 3K9HA 2VSFA 3ZJ4A 3GUYA 4YJGB 3EOAI 4ECRA 1WMEA 2P11A 4RK1A 3ZNPA 3U5ZB 1WG8A 2DEUA 4B8ZA 1J42A 4PNZA 2RHHA 1PG0A 2DQYA 1V8OA 3VPFA 2YNMA 4TRRA 5EZYF 1VIYA 1Z8FA 1PD0A 3E82A 3DLTA 4H7PA 2JFHA 4C2BA 2W9BB 2ZAOA 1JEAA 1EVKA 1YUNA 4HWKA 4MQ5A 1XTKA 4GC5A 4BLVA 4DIUA 2F3UA 1A4RA 2QMQA 5ALQA 1VGRA 2JI7A 2FRVA 4X7BA 3MFIA 5JNTA 3PEFA 1FZQA 1KOJA 3ST7A 2QN8A 2WG1A 5JANA 4NYJR 4UNSA 4YK7A 4CFYA 5DO9A 3INNA 1YF3A 5EOYA 1HY3A 1X7YB 4UDOA 4ESVA 1XA4A 4ZD6A 4O2AB 2ZU0C 3ER6A 4BO6A 1XVAA 2PZFA 1ZIDA 4PPQA 4M76B 4E2ZA 1T5OA 1X7YA 5HMLA 4XWOA 3H2KA 4Q1EA 2CV0A 2Q1TA 4QG3A 4QUDA 1JW9B 1QK3A 1Z5PA 2GA9A 2JARA 4ICIA 2Z2XA 4ZVOA 3FGPA 1RZRD 2AN3A 5GZ1A 3KE8A 1QGOA 4UMFA 3PGVA 5DGXA 3M89A 3JRNA 4KL8S 1N1GA 2PKQO 4QFMA 3VU9A 1QV9A 3W7AA 2DABA 2HXSA 1BO6A 2ZUSA 2YJNA 1RACA 3BWYA 3HLYA 2PU5A 3L2OB 2FFRA 3QELA 1OR8A 3B20A 5JCOA 4ZHQA 1G2IA 4U00A 1VSBA 3ICWA 3IP6A 2JLVA 1A5ZA 1HSZA 1SR8A 4L02A 1ZNZA 3ROKA 3B2EA 3HL4A 2Y2UA 4PGFA 4QXAA 1ABEA 3A1DA 1U3DA 4DRYA 2HT6A 3H1FA 4JP2A 2DFLA 1X8LA 1YCGA 2CEAA 2EIHA 3LHSA 4EQZA 3BGOS 4WNCA 5CB4F 1KDRA 3JQPA 2EW8A 1VPWA 5CYOA 3JZFA 1UKAA 2DWQA 4JJ8A 1NVAA 1WULS 3MS2A 1JB9A 1RP7A 2B63A 5BR8H 2GCNA 4OSEA 4MLCA 4YMIA 4DL3A 3MS4A 2I6TA 4RJIA 2QE6A 2HMTA 1S3SA 4O81A 4KPUB 4IAJA 1Q0UA 3GAFA 4M22A 4PG7A 3R7LA 3Q0IA 2FDXA 2XLCA 5BYKA 2ZUCA 4YDHB 1HV8A 4EPVA 3CXUA 2PQ0A 3KB1A 2W98A 4K0KH 1Z47A 1GDDA 5E2BA 2I2FA 1KDYA 1V7PC 5I9TA 5A2QA 4OQFA 4XWAA 3WAGA 3W8NA 4M0DA 1DTSA 1QHHA 3TXAA 1X42A 4AY5A 4Z5XA 5LMUH 2HQRA 2JJ8A 2OM6A 2Q3JA 2XYPA 2OYCA 3L49A 1C5KA 4N3NA 2VHJA 3PP8A 4OGKA 1CF9A 1HZZA 1KK3A 1V7CA 4E11A 1GAEO 1I4TD 1KI7A 1Z36A 2AK2A 2J3KA 2Z8YM 3B3JA 3DZGA 4P6VF 1KYXA 1MZVA 1EDOA 1C8VB 1DJNA 2VOJA 3LBFA 2RGYA 4FMDF 3TLYA 2X9VA 3AK4A 2F9MA 3U4GA 4B6JA 3WLTA 1Z56C 3DMGA 1GA4A 3B2QA 1V45E 3DV0B 2ECQA 4E4TA 2C2DA 5ALEA 4GLLA 5LBIA 3GGOA 3UCEA 2YU9A 1C3EA 2E1RA 2QR3A 2ZRQA 4BX0A 3CIFA 4PLWA 4H3HB 4NE9A 1JI0A 2CNOA 3FIJA 3FYDA 3HBAA 5DT9A 3HO1A 1N3LA 5LL6b 1Z2PX 1JFFB 3L79A 3OHBA 3VUFA 1J1ZA 3TY9A 1HLDA 1NP7A 2YN4A 2AD5A 5FEMA 4ECEA 3T5MA 5EMMA 1E5LA 2ASEA 3V2HA 3V2GA 1LU9A 2G1KA 1N33H 1J6UA 4WADA 5TPZA 1Y1PA 4CTKA 5CYFA 2X6QA 4EFBA 1Y8CA 4KIWA 4ABYA 4AJ1A 4BB9A 4ZALA 2JLWA 3L07A 2VJMA 1AUOA 2FRDA 2YJGA 4RHUA 5BSTA 2VXCA 2G36A 3QVSA 2QLJA 4H4DA 3VZQA 4M9CA 4OUKX 1YOVB 2C35B 2YASA 3AQ4A 4YFYA 4ISBA 2GCOA 3SKVA 1GU1A 2CLMB 3ENNA 4LZZA 2WSLA 4CM8B 4XX1A 2IMWP 3ZCTA 5IJ0A 3L7IA 5ALJA 4JASB 1Z18A 4B3CA 4R2KA 4UHHA 1A8PA 4ATNA 1E4EA 2I4RA 4US0R 4EB6A 2I54A 4BMOB 5C46F 1KI2A 1NAIA 2CLKB 3PI7A 4GRDA 1JF8A 2AQHA 2Y77A 1W36C 3UAYA 1EK5A 3K5IA 1M76A 4YJFB 2JVKA 5JCJA 3ZLJA 4MV1A 1DKRA 4OP1A 4JT2A 4BP1A 1EUQA 1FSSA 1RLMA 3QVUA 4QU5A 1XWIA 4P82A 2W6IA 1UOPA 1R9NA 2VJOA 3AH8A 4IGFA 3U3XA 4C0XA 4J0HA 2PX6A 1IPEA 4ZCQA 4GFDA 3F5DA 2BI8A 4IR1A 1MC8A 3OJLA 3PQ5A 5CCDA 3IEVA 2MTBA 2RB4A 1FQOA 1E6UA 3QGMA 3UMVA 4JC8A 4PNHA 3T1NA 4K6FA 3TLEA 2EAUA 3VBCA 1X9HA 1KTVA 3A31A 3G59A 2AR0A 4RESA 3WSTA 4IHJB 4F2WA 4U7WA 5BSGA 3KC2A 3M6FA 1C4WA 1C7IA 4I4IA 1AG9A 2ZLBA 4FU0A 1F8YA 4RIGA 2OFFA 2FLNA 3N87A 4REMA 5F1YA 5HGXA 3IVGA 3U7FB 2PMKA 3GEDA 1LQUA 3PU6A 5EFZA 3IUMA 3NHFA 5F9LA 1ATZA 2EBUA 3HFRA 1SVOA 4YY3H 1NATA 5ALOA 4FFPA 1KBZA 4FT2A 4JQZA 5T4BA 5IT5A 4NESA 3KZKA 4JJEA 1MRNA 4I1UA 3NX4A 5E6UA 5L1JA 3I73A 1RAHA 3DUFB 2PV0A 2YHAA 4ZJYA 2VF4X 4HUJA 1LBHA 3N76A 4Z3DA 1Z4JA 4MA0A 2MYTA 1U7HA 3OTGA 4P53A 2FPPB 4Y6SA 5LZ8A 4AICA 1IY2A 2AN5A 2DPIA 2V8OA 4WK4B 4ZCRA 4JH0A 4AD8A 4MV5A 1GCAA 1MENA 2JZNA 1P62B 4EMSA 1M5RA 1LSSA 3L8CA 2GPAA 1YZHA 4DLVA 4AMVA 2Z09A 3P0JA 1SEPA 1I50A 1RQLA 5KAPA 4GE3A 1JYFA 2FLLA 1K63A 3C3MA 1CS0B 2OZVA 3H6KA 4PGMA 3TOZA 1ZH8A 2X9LA 4BAGA 1Z62A 4QTYA 1YOVA 4KN8A 2WM8A 3AM4A 4MRVA 4OMUA 4BBAA 5B12A 3F98A 1R9MA 1NWCA 2JJYA 2NT4A 1MJNA 1YS9A 1E3EA 4ZAVA 1YTUA 2W0SA 4TSKA 3KHHA 3WE7A 5K45A 2NVYA 2WVAA 3HOWG 4YCJA 5DM4A 2IHBA 3DOHA 2EX4A 4GZLA 3BQ2A 3ZD6A 3VQTA 4QTTB 2O8CA 4M9SA 5HVNA 1JSRA 1T8UA 1YC5A 3ZBPA 2PJUA 4CG1A 3OM0A 1ZJWA 2XV1A 4B09A 2YCHA 5JDIC 1J8DA 3TH5A 5C9ZA 1RYDA 4TGLA 3CPJB 1POWA 1ZNWA 5AT1A 2PRIA 1MNAA 4E1AA 5EMJA 4WTOA 2I2WA 5HA5A 4N0DA 4ABTA 3T12A 4K0KB 1PAUA 2XTMA 4JEUA 1C3OB 1G3IA 4E6PA 3KSAC 4O3QA 3ROFA 4IOKA 1TEZA 2IUSA 4ZEWA 3G6WA 3A7EA 1CJTC 2GVDC 3BWXA 3GBVA 3I53A 3KOXA 1LVGA 3P2JA 2CFSA 5HS6A 4AN0A 1DCTA 5EZ6B 3UJAA 4EMTA 4XWKA 3WKCA 2I6GA 4YRPA 1P2UA 2JB9A 5FHRA 4U2DA 3MWYW 3V4ZA 2GEUA 3LT4A 3LVQE 4J2TA 4UUMA 4Y0AA 1L5WA 1CKNB 2NOAA 5BSHA 1O4WA 3DL0A 3QTLA 1O6BA 1OW3B 3SZGA 4D6YA 4RKYA 3FSRA 2C2XA 5JJIA 4NU0A 3QFHA 2BGNA 4X97A 3RJTA 4DR6B 1GYPA 5KFWA 2QUJA 2WRZA 3MEQA 1RJFA 2WPDA 3RASA 3PPVA 5HMMA 1B15A 4LGVA 2VSXA 2OV1A 3ZCVA 5K2OA 4Q44A 1ZCFA 3HK2A 2C98A 4LPKA 1MB3A 4DA4A 5ILGA 2F55A 2CKMA 3N0XA 3WWCA 2JBAB 1Z5GA 2R92G 1XFAA 1T8WA 1U7TA 4L78A 3DS8A 2B8NA 2H3HA 2XUHA 4Q1VA 1Z6QA 1YDEA 1SU4A 1E1QD 4MVJI 1MB0A 5CURA 2MHCA 2AH5A 1A04A 4DBZA 3ABZA 3ANLA 1K9VF 4ZQBA 1GUZA 3W4IA 1IVSA 5THXA 2D4AA 3GEMA 1MXHA 3H75A 2CMGA 3DUWA 4ZT7A 3EPJA 2Y8EA 1OI4A 3C8HA 4R51A 4DYHA 4KE9A 4ZODA 2H1VA 4NKRA 4PF1A 1EUCB 1EDDA 1Q22A 2CC2A 3TK1A 4Y1FA 2H9YA 2CWDA 2VNIA 5AW2A 1YAHA 2OHXA 4M1KA 4K9LA 2R3SA 5AW4A 2I3DA 1KOFA 2NU8A 4CCAA 2ZI5A 2LCQA 1BS2A 3EUWA 1BDHA 1A4UA 2GLTA 4EYHB 1EP1B 2BKXA 1P60A 4KKXB 5KKCA 5EE1A 4GKVA 5L9AA 3JAKA 2YCLA 1WB6A 1ODIA 5LBTA 4O2AA 3LM8A 3AEKB 2HQOA 3SK0A 4CGYA 2XD4A 3NJ8A 1EYZA 3ZTYA 3G8CA 1N8TA 3TNDA 1FUEA 1LLDA 2F3QA 2LPMA 5CT8A 1WUHS 5AK4A 2QHXA 1P4SA 4V2UA 4RTMA 1I9CA 4A15A 1A7KA 4ME6A 1NBMA 1EEHA 1JXMA 1AXRA 1KO4A 2QSZA 2XADA 3AF2A 3GJ6A 3QLEA 2INGX 2WSSA 4G25A 3V4FA 4MPPA 3ID6C 1QMGA 2XUPA 1UKBA 3C6XA 4IG9A 3I12A 4J7CA 2PVSA 1UDAA 2QTCA 5AIBA 3WLRA 3UJHA 5I51A 2ZRCA 1B00A 2OCDA 4U9HS 2JRCA 1UAYA 3PCRB 2FQYA 4WNAA 4YONB 1V35A 1I4OA 1Y7LA 3CSSA 6ABPA 1JG3A 2WNIA 4GOLD 2D3WA 4PHHA 1SG0A 3EQ6A 3HXTA 5A03A 1NW3A 3H11B 2BSQA 4TL9A 5FX2A 2EGUA 1P91A 4BNMA 2ZRAA 3HH8A 3LHKA 4DG5A 1Y48E 3RHFA 2N0SA 1TLFA 3WBKA 4E21A 2ZSHA 3AOEC 1NRWA 4CM4B 4D4JA 4MGKR 1G3MA 1ZM4A 1XAHA 1Y9JA 2XXBA 4TSFA 3QYAA 2WOOA 3E9EA 1N3IA 2OHVA 2CMDA 2IW1A 4QULA 5EJIA 3WZLA 3NATA 4BB6A 3MINB 3UG7A 1ZI9A 3LKZA 3TTUA 3N5CA 1FX1A 3E7FA 3AZOA 4BNWA 2E18A 1PUIA 1QHEA 1P1KA 5DNVA 3KP1A 4U0KA 4LFCH 3DPUA 3PNVA 4JUBA 3BAZA 2H11A 3H7AA 2DHEA 3V2IA 2DKFA 1TWFA 1GO2A 4PRLA 2FVYA 1CETA 1GARA 1QGAA 3HJAA 4GSKA 3SCZA 1D07A 4EY7A 4AO8A 4PO1A 3OCJA 5DXAA 5HZKA 4AG6A 1R12A 1D4FA 5EPEA 4D5EA 2G82A 1JG2A 4TYPA 3O4VA 4DY4A 2XYQA 4HADA 4MCAA 3L1JA 1SFRA 4TLBA 5DLEA 4FSHA 3EVTA 2EX0A 4MQEB 2X13A 4FDMA 4MUXA 3U9TA 1SVSA 3S2FA 3DFFA 5D1OB 3GG9A 2O03A 1YD7A 4A16A 1K7SN 5B30A 5EJ9A 2PTHA 3HA2A 3FWHA 4YRBA 2HGWA 5I8PA 4C9BA 2I6UA 2C9MA 3DM9B 1XMXA 1W87A 1U6KA 3G2PA 2EF1A 4PG6A 4OQZA 4KIUA 5TQ2A 4OX9Y 3GJXB 1Y7PA 1NTRA 3IMEA 3L4JA 1WHSB 1H2WA 3O91A 4P4LA 4ETNA 2Z9CA 4KDCA 2DKNA 3I1JA 3K4HA 1KETA 4AJJA 3NWPA 5GQSA 3CKYA 4JQCA 3OE1A 2J48A 3QVVA 2ZB8A 1UADA 1XMIA 1X1QA 1R66A 1T5DX 2IU4A 3AR9A 5CJ2A 3MWGA 4YCDA 4EPRA 4ZV4A 5CW2A 1AKRA 3OZSA 2CE2X 5ADUS 4HP8A 5H3CA 1EK1A 2GAOA 2VZEA 3RT7A 3VU9B 1DAFA 4ZOCA 3TKLA 3T38A 4K3VA 5C35A 4LDPA 4P4GA 2ACVA 3INRA 1XQXA 3S8EA 1Y8AA 2CFMA 3UT0A 4FJ0A 5B3JA 4U5QA 5IYDG 2I2BA 1IFXA 3H6GA 1BE6A 2C4KA 3DTVA 3EA5A 3QUCA 1JIXA 4J0IA 3UB3A 4B32A 5DQIA 2OECA 4Y2HA 4BV2A 5E3HA 3KLBA 3TCXB 1S3FA 5GIOE 2DRIA 1SG9A 3LPMA 3QLTA 4P8RA 3DLBA 1DIBA 3BREA 4M53A 5ELMA 2P4HX 5J4VA 4YXWA 1XC7A 1N32B 1YS6A 2JFGA 2OGZA 2QTLA 5KYVA 2HSEA 1UZAA 3RUPA 1Q1EA 4CMEC 3TR6A 3RNLA 2O8EA 1QDLB 2IYVA 3R74A 4S3MA 5B37A 3UM9A 1MBZA 1QVRA 4CM7A 1R7RA 1E3WA 1MXFA 5DQGA 1PFVA 1WWKA 2VI5A 3EC2A 1ZN2A 1NJ6A 1WM1A 3NBQA 2VSOA 5BVHA 3CMMA 3TFWA 3LFTA 5CFQA 3S2EA 4ZOQI 3HNOA 1XZGA 3O7MA 3WG9A 3GFVA 3OZXA 5KTOA 3C3BA 1KERA 4YUZA 3U3ZA 2HGZA 1MO6A 3IPLA 2BKUA 1DBIA 3D7NA 3I37X 1AGNA 3I2KA 3LDGA 4KQGA 4MUIA 4NCJA 2ZS9A 4C08A 1Z63A 3JZAA 2W2XA 1MIHA 4CKWA 1PR0A 2GJ4A 4MROA 4XDYA 4RXMA 1KP9A 4ENQA 2Q1XA 4DSZA 3ZX5A 1UDCA 5AFSA 2FSVC 5KVAA 1OBOA 3ZNQA 4YMWA 4XYLA 2LV8A 2HX1A 4OJQA 3RB6A 2YW2A 2NQ8A 3NBZC 3ZU6A 4BNTA 2Y1LA 2FQXA 3GHHA 2NU9A 2HFKA 4XUCA 2HWWA 3E2MA 1QTIA 4IDPA 4OOEA 5EP3A 1T1JA 1FSGA 2BI7A 2Q6OA 3ESAA 4JI2B 2OM2A 3CVJA 5ICMA 4ER5A 1PSWA 4LDJA 1RC1A 5F5LA 4R8VA 1OXMA 1U11A 2A88A 1KF0A 1R0RE 3Q11A 3ES9A 3HV0A 5K8LA 3ANYB 1PVDA 3QMMA 4RVGA 1MX5A 3LD9A 3M6XA 4NCKA 2J7KA 3SSOA 1SKYE 3KKNA 1QO9A 2ZJYA 3NH9A 4UDXX 5FOVA 5E9WA 2W9CA 5F5XA 3JQEA 4EATA 4IQ0A 3SN6A 2QZSA 2J3MA 3CEPB 1TF5A 3I42A 2ZCUA 1P4JA 1XTVA 2OXRA 4JYAH 3V97A 2Y6VA 4TKLA 4ZDIA 4LF7H 4EGAA 4JLNA 1ODFA 1Q21A 4D8XA 1UWCA 4EUFA 1J33A 3HDVA 2C57A 1B8OA 1U0LA 1CYDA 1M7BA 1O8BA 3P9PA 1HH4A 1OOEA 2P3OA 2JHGA 2OAQ1 2Q5LA 3BYZA 3ZY3A 1K97A 4Q43A 3ROZA 1P1FA 3ISJA 4HLCA 4FDVA 2VJPA 1JZTA 3AVXA 2IY9A 1QAOA 3Q8PB 4QOSA 1XR3A 2P9YA 2QS9A 1WUJS 2VPZA 3E3NA 3F90A 3GCDA 4MTCA 3S28A 4RU9A 5CM0A 3H42B 1S4MA 2H59A 4NXNB 2A92A 2QVLA 2OH2A 4IS3A 1U0TA 2GMWA 4JVOA 1SD5A 4KYTA 2BWJA 4NE2A 4X24A 4CTNA 2G71A 6CHYA 4BGEA 1VE5A 3L4KA 1A27A 3DE3X 2O8FA 3L0SA 3IUNA 4QX6A 1XVIA 2Q0HA 3QZ7A 1EZZA 2HA7A 2ZPAA 1ISIA 2PFKA 3EH1A 5ALSA 2WG0A 3WLMA 1CQIB 1ZAKA 4KO2S 5KFOA 2ZBDA 4OXNA 4WESB 2IOQA 4R8UA 1TQ2A 2IYRA 4QBHA 5FD8A 4YB8B 1EVZA 1M74A 4GNKA 5CEFA 3IH5A 3GVPA 2V7WA 5KHAA 5ALPA 5HTOA 1JXAA 1LZKA 2FP3A 3S70A 2CXOA 3P9ZA 3U62A 2QAJA 3WNZA 4X84A 1WCV1 4BLPA 3DVQX 4MUNA 4Q7MB 1IYDA 1W49A 3DUFA 4ZEXA 3ZDDA 2V55B 3RRXA 4NVRA 5ALFA 5DLDA 1JKJA 5LYJA 1JE0A 4Z7JA 2ECPA 3PBKA 5ALNA 1I4WA 1WF6A 2RIRA 3E48A 4KVFA 4TOIA 4B0OA 3GUZA 4WBNB 1D2EA 3ZDFA 2FZWA 2E1PA 5ALTA 5KIAA 4X8HA 5BWLA 3VPAA 1VC2A 1U63A 3X1WA 1CUHA 1TM5E 4MQ4A 2WFZA 4WWHA 3PXBA 3IIEA 1NASA 4FR2A 4PRKA 2RGRA 4MKGA 2P2YA 4CT0A 5CDUA 4JODA 3KPJA 1IATA 2HSZA 5JVDA 2BUAA 1XDNA 3RB0A 2UDPA 3PPWA 3WWEA 2XZOA 3HKEA 3WYFA 1V8FA 4OAPA 1RCFA 1R5NA 4MKRA 5HILA 1NR5A 3FF1A 2PYIA 4A1FA 4LYGA 3VNQA 3BK7A