2VPQA

Crystal structure of biotin carboxylase from s. aureus complexed with amppnp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
447
structure length
447
Chain Sequence
KKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLNIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKAEMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGFRMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEEAPSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVTEMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLAPGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIPFHIKLLNNDIFRSGKFNTNFLEQNSIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYL-COA CARBOXYLASE
publication title Structural Evidence for Substrate-Induced Synergism and Half-Sites Reactivity in Biotin Carboxylase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 146
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature ec 6.3.4.14: Biotin carboxylase.
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain
A PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain
A PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2vpqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2vpqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vpqA01
2PBZA 2VR1A 2NUAB 3BFPA 2YZGA 5GONF 3TW6A 3VPCA 4EABA 5K2MA 1BNCA 4ZHQF 1KJIA 1EUCB 3JZIA 2W6ZA 4XYMB 1PK8A 2R87A 3MWDA 5C8YF 4L1KA 5J2TF 5JQWA 2YS7A 4ZOLF 3MWEA 4M99A 4MV4A 4O82A 2DLNA 1UC8A 4ZI7F 4FFOA 3RV4A 3N8DA 5JQGF 5LYJF 4O7SA 4I50F 3VA7A 5IYZF 1SCUB 2J9GA 5I47A 4EA7A 3WNZA 2FPGB 2SCUB 2P0AA 2CNUA 3K5IA 2CNQA 4EG0A 5JVLA 1KUTA 1JKJB 3TQTA 4YAKB 5KX5F 1GSAA 1UC9A 5C1OA 3DF7A 2GQRA 5EZYF 4O7TA 4WD3A 3GIDA 2FPIB 1JLLB 1AUXA 2WYOA 1M6VA 4TUYF 1AUVA 4HNVA 4O7NA 5LP6F 2R85A 2YL2A 2Z02A 3OUZA 4EAAA 3GLKA 4FFNA 5J2UF 2YWVA 2DIKA 3QFFA 3WO0A 2Z04A 3KAKA 3G8CA 4GGMX 2GQSA 3R5HA 4O2BF 4E4TA 5H80A 4O4HF 3ORRA 4MV3A 3VMMA 4NYEA 3UFXB 1EUDB 2R86A 2GLTA 3MJFA 2NU6B 3SE7A 4TV8F 3K3PA 4EA8A 4ZQIA 1B6SA 2QF7A 2XD4A 1KJQA 4YJ2F 3HB9A 1VBGA 2XCLA 4YBZB 2VHEA 2YS6A 2I87A 2PN1A 3BSYA 2HGSA 2YZLA 1KBLA 2VPQA 3ORQA 4O4LF 2I8CA 2PVPA 2W6PA 1EYZA 1Z2PX 2FPPB 3U55A 1ULZA 1VBHA 1DIKA 3R23A 4HR7A 1GSOA 3U54A 1IOWA 3VOTA 3K5HA 3E5NA 3U9TA 3AX6A 4FGRA 1W96A 2YW2A 4XYLB 1T36A 4YAJB 1E4EB 1A9XA 1DV1A 2R7KA 4ME6A 1EZ1A 3KREA 1I7NA 1E4EA 4I4TF 3VPDA 5LOVF 4HNTA 5C1PA 4EGJA 1KJ8A 4MV8A 5HBRB 2YRXA 4RZQA 3ETJA 1M0TA 3WO1A 3NUAA 1EHIA 4O81A 1B6RA 4MV9A 5CB4F 2GPWA 2NPOA 1CE8A 2V58A 3RV3A 5DMXA 3LP8A 3R9RA 3N6RA 1CQJB 4MA5A 3KALA 2GPSA 4FFRA 4O4IF 2CNVA 4YJ3F 2R7LA 2ZDHA 4O7LA 4O84A 1CQIB 4O4JF 2X0SA 4O86A 1IOVA 1JDBB 1C3OA 1VKZA 2NU8B 2I80A 3OUUA 5D8DA 3KAJA 4EA9A 2YYAA 3ETHA 4IZOA 2FB9A 1DV2A 2C00A 1M0WA 2ZDGA 4C5BA 2YZNA 2NU7B 4HQ6A 3BG5A 3Q1KA 5BPFA 4O7YA 2R84A 4EGQA 3R5FA 4J6EA 4C5CA 1Z2OX 4O2AF 4I55F 1Z2NX 5JVDF 1GSHA 5CAEB 3TIIA 1C30A 3JRXA 5FNVF 1KEEA 4IWXA 5LXTF 3HO8A 4TV9F 4M9CA 4M98A 1I7LA 4MV7A 4O83A 3JRWA 3TINA 2QK4A 2NU9B 3V4SA 2CZGA 1PX2A 4XX0B 4O7VA 3G8DA 3LWBA 2W6MA 5HV6A 4O7RA 4FU0A 3HBLA 3AW8A 4WBNF 2CQYA 4QSHA 2HJWA 3V4ZA 4Y8VB 4DLKA 3BSWA 4FFLA 2ZDQA 4O7WA 5CA0F 5KKNB 4IWYA 2W70A 4MV6A 2YRWA 3RFCA 1BXRA 5LA6F 2R7NA 2W6NA 1W93A 1A48A 3RUPA 2DZDA 3TIGA 1CS0A 2R6FA 2FP4B 2VQDA 4FFMA 2YZMA 3JZFA 2W71A 4C5AA 3Q2OA 2R7MA 5BMVF 2V59A 3U9SA 1KJ9A 4MV1A 5BPHA 4O7ZA 1KC7A 2W6OA 2IP4A 4MAMA 5JH7F 1WR2A 1JDEA 1GLVA 1GGOA 3BSSA 4IHJF 4FFPA 2V5AA 1OBGA 4XZ3B 1OBDA 4YB8B 1KJJA 4MA0A 2R82A 3I12A 4IIJF 2DWCA 4HNUA 4M9UA 2OLSA 3R5XA 2W6QA 4FE2A 5CA1F 3VPBA 4DIMA
chains in the Genus database with same CATH superfamily
4JOSA 4JQOA 4C14A 2GEJA 4DWVA 2YCBA 1ZP6A 1BU5A 4G24A 1S1MA 3G5TA 3WOVA 5IYZA 3EPRA 4UOQA 1CZUA 1GYPA 2PZJA 3G2LA 4AYXA 3H9QA 4MHOA 5B3KA 4F06A 3TBHA 1EVJA 2IDKA 4PNZA 4MQBA 1EPUA 3ZWDA 5LN1A 1XMVA 1G6OA 3J7TA 4BNVA 5BOSA 2DLNA 3QA3E 2CXHA 2GBPA 3E58A 4ZI7F 2NN3C 1MJNA 2QPOA 1M2VB 3AF4A 4FONA 2TMYA 4L50A 3WQSB 4QJBA 3RHZA 4FDUA 3U60B 2GTIA 4MYDA 1KEVA 4KQIA 1ZM2A 1H4SA 2EXXA 2FZWA 3UVEA 2Q8QA 3WGYA 2M9MA 4L8VA 2O8CA 3DOOA 2BBSA 1QRTA 1TCAA 4Q5IA 3N0XA 1CR6A 3GW8A 2BH2A 2PM8A 4R4JA 3TQQA 4H17A 4BZWA 4EJ6A 1QGDA 3MW8A 1KF0A 2EFHB 1PFYA 5TGDA 5BRNA 4FZ5A 5CVEA 4IDAA 1SC3A 3DMRA 4IY1A 4GZ3A 5A7FA 1U2DC 3VBEA 4IW3B 2HRRA 4K9DA 1MC5A 3K2BA 1G9SA 3DE5X 5KNBH 1DC4A 1G3UA 2B0CA 1L7RA 1WLSA 4N48A 1OSNA 3WJAA 3RS8A 2AEJA 3P9SA 1EFCA 3LDAA 1H4TA 2AXEA 3GAFA 2VP5A 4RHUA 1PLKA 3FYUC 3FNRA 4KJXA 4ERNA 1U6JA 4MX8A 4HXGA 2UYOA 2DF8A 1VSQA 4HQOA 2HU7A 4OHKA 2PUEA 4PIVA 3AOGA 1XQYA 3ZXXA 4DR1B 2CN1A 1ZESA 4EGJA 3MLAA 1TKAA 2QRJA 4X6LA 4MPTA 4LPSA 5A5GA 4ESHA 1U0SY 1MU0A 3AP1A 5KFEA 2D5CA 3GARA 1UEJA 4RHYA 4IZHA 5BQ3A 4PDBA 1IBMH 4WOPA 4GC7A 4FI3F 3RVOA 4JL6A 3OUUA 4XUGB 3MJHA 3IVRA 2CNLA 2YYYA 2C7RA 2GEDA 4GBGA 3AY3A 1QZZA 2LCQA 5E0OA 1N5DA 2Z6UA 4BVFA 2BGLA 1N5JA 3JVUA 3L1HA 1RZUA 2JA6G 3FJ1A 1P1CA 4RZRA 3ZU5A 4HDNA 2OBFA 1A27A 3IAFA 1OKKD 2VQ3A 3ONDA 4P22A 4JQYA 4J91A 1BKDR 1FUKA 2QR3A 1SC4A 4LWZA 3I2FA 4EQ5A 4FOTA 1E77A 1NXVA 1TADA 4WQMA 4Q18A 3UMBA 3EPPA 5ILOA 4P08A 1KRXA 2VHQA 3DMPA 4JGBA 5HV6A 3DL0A 1VG9B 1B93A 2VH1A 5JMTA 3L7LA 3KLOA 3IUPA 1QP4A 4J2OA 4YJHB 1FY2A 4WN3A 5TV2A 4HY3A 4MGYR 2AIRA 1JJBA 1NVTA 4IIJA 1NQAO 2PZKA 4IV5A 1F5SA 3PGA1 3MT7A 4KQJA 4C0SA 1H2AS 3DH0A 4EIWA 1QV6A 3AR9A 5AVUA 3G6YA 3SHWA 1N1GA 3PQ8A 2UZ1A 4JWTA 5SYMA 3LGXA 3OKPA 3GDEA 1P5ZB 2W6CX 1DUSA 4YCDA 2W6OA 4E1BA 1KFEB 5EZ5A 2OBNA 3FCEA 5C53B 2E4ZA 2WJJA 4IHJF 4E30A 1SJ9A 1K97A 3LOQA 1HV8A 1O89A 3PEWA 4E51A 3I12A 3HO6A 1Y5MA 3QMVA 4DR7H 5T8KC 4YDQA 1BE6A 4NXNB 2Z4RA 3HDYA 4HTAA 1QHNA 3LQ4A 4UARA 1UNNC 1L5MA 2YUIA 1YHYA 5HF9A 2BEJA 2BFCA 2ZBGA 3VR1A 3LDGA 1EFTA 4MO2A 2JGJA 2IU0A 1JNYA 3EXHB 5HCIA 4M8NE 1SCDA 4XR9A 1XALA 3H1BA 2HNAA 3SNKA 5IT4A 4C30A 2IYUA 4BLSA 4QHSA 2BYTA 1JV2B 4X8OA 3GDGA 1C5KA 3SSOA 4KBYA 2SCUB 4AURA 1OBOA 3HYSA 4QGSA 3IKTA 4R84A 1BXKA 4HQLA 1P2TA 2XA1A 5DKFA 1O95D 2GQRA 2CJYA 4L7QA 1UAYA 1TYAE 3WBKA 5F2EA 2HCFA 3PPIA 4AJEA 4YP9A 3INRA 2CLEB 2NG1A 1DRUA 2ZU6A 5JZBA 2R66A 4KPUA 1VI6A 4LV6A 3KHRA 5LP6F 4FJ1A 1ET0A 5B3LA 4X62H 3GLHB 5KYYB 4O4LA 2AVNA 1AV7A 3G0GA 5DTIA 2YIVX 2HHJA 4HXFB 1PS0A 2QZSA 3NH6A 1PEAA 1ZEMA 3KZKA 3K9FC 2MOKA 3LC0A 2XXAB 1R0RE 4OL0A 3P27A 3T1NA 4TWJA 3BSFA 2C4VA 1KO5A 2IHUA 4B83A 4ALNA 1QFYA 4UFNA 2JFQA 3AUUA 4C0QC 2IYLD 2PS3A 3OLQA 4UNPA 1KOGA 1CV2A 2J0VA 5EQDA 1HR0H 1XZKA 3Q7RA 1YXMA 1KQOA 1T43A 2E9SA 1TQ2A 3VOTA 2GERA 1CRPA 5CD1A 2PDAA 4KSYA 3WKCA 4AQYH 4YRZA 2IX9A 4GYKA 3DPIA 4BQPA 3KEQA 2FW0A 2ORIA 3W9BA 4DOMA 4WZZA 4Q44A 1QPGA 5JAHA 1R12A 4G01B 2ID8A 5KT3A 2JB9A 4R2KA 4YMLA 3AHCA 3L9WA 5DM70 1ZRSA 4MW2A 2JIPA 3BAFA 5MGBA 3HKCB 2IKSA 4G5OA 5DEOA 1BXZA 3G2IA 3H0KA 1P81A 4CRWB 4PS0A 4AUKA 2TS1A 4O4IF 5CBKA 3A2NA 4ZI5A 5KJEA 3D4IA 2QUAA 4L2IA 1FP4B 1F17A 3PQ4A 4INJA 2PRYA 3AERB 1XMSA 2B5OA 1AB6A 2J07A 4MW7A 2OCGA 1WUYA 2H7XA 1M0WA 1IQUA 3HZOA 2DR3A 3JSNA 4HN2A 2XLBA 3ADBA 3I9FA 4DC0A 3H5TA 4N3BA 4DDWA 1ZJYA 3G5LA 3DDCA 1YS7A 3FLBA 3R7SA 3I9LA 4BO2A 2H52A 1EU1A 4QNRA 4AWBA 3KKKA 2ZBDA 3H40A 3W79A 1T2FA 2AZTA 2QT1A 4U2FA 5K3DA 3PDCA 3BHNA 2BGUA 4JA0A 1BHQ1 4CQJA 3P9KA 4FVTA 1HYGA 2WHQA 4KXXA 2FLWA 1PWXA 3I62A 13PKA 2HLDD 2NUTA 4YYZA 2MSEB 1GNLA 4FHDA 5IKPA 2Z09A 3AL3A 5AKHA 3MWYW 2I6SA 2HMTA 4CKXA 4GPAA 2A3RA 2QL7A 4TQGA 1EIZA 3PFFA 3CT4A 2AE1A 3ROFA 4O4HA 5EHIA 4P93A 4QBFA 5A06A 1X92A 3AETB 4MR7A 3FCOA 1D8AA 5C1DA 3R6TA 5E2AA 3DCIA 2MHCA 3AU8A 2W9AA 2OO7A 4FN5A 4QJ5A 4EFEA 4FGWA 3A4IA 5BMVF 4X7MA 1TGYA 2H4JA 2ZXFA 2XYHA 1O6BA 4IQ8A 4YCAA 1FQKA 4Q3NA 1QYDA 4MTLA 3E9MA 1N5IA 1KH2A 1EVIA 3NOQA 3G0OA 1Y8CA 1OFGA 1VXRA 2R92A 4QGFA 4A3EG 3R0IA 2LNDA 3FRIA 1IRIA 3PPXA 3MMXA 2CBGA 4FK8A 1DG3A 1MFPA 2BELA 1LRKA 2FWAA 5FLYA 5K05A 3HP1A 2WZCA 4DXDA 2YICA 2XMDA 4H18A 2QJOA 5LOVB 4CKWA 4DL5A 3NEJA 1ISSA 2F9MA 4E70A 4RZXA 2XITA 2R8ZA 4ZZ2A 3F98A 2XVMA 4PWZA 3A1CA 1FFXA 1UPUA 1KNQA 3KB8A 2VSXA 3H7IA 5BXQC 4WI1A 4D41A 4MQLA 3CH7A 3KKOA 1DBPA 4EARA 1AMUA 1DTWB 2JLUA 4TKVA 4WV3A 3RNLA 4RC9A 3VX3A 4QM6A 5A4KA 3D3KA 3THYB 2J6BA 1YFKA 1SULA 3LE8A 3SEZA 4OXYA 4Z9AA 2CFTA 2Y3IA 4RD3A 1H85A 4I66A 3K70C 1DIOB 4KPGA 3BS4A 1CR2A 3GBPA 3OOJA 1MBZA 2JFOA 4LOKA 3AP3A 4B2PA 4DCPA 3JQGB 1FNMA 3U5ZB 3L02A 3PNMA 1KZ1A 4K81B 2D2IA 2JF0A 5BSWA 3MUOA 1K7FB 3AOEA 2IPMA 4NNJA 5SYNA 4RPLA 1JH9A 1U1DA 3HN6A 1FVOA 1XDDA 2GKGA 2VDKB 4R31A 4XIIA 5E3JA 1GZVA 4F86A 2V6JA 1U2EA 2HSJA 3EFOA 4Q4JA 3AF5A 3RBDA 4ZVTA 3E48A 3D0KA 4U2KA 5DTJA 3MWKA 4J9VA 1E3EA 2WEKA 4NX2A 3M4YA 3HDHA 4R83A 5KTYA 3HZHA 3BMQB 5DHUA 2WT8A 3IXQA 2AYYA 3I28A 3GFGA 1B8NA 4CMEA 1O94D 1CUHA 3VJRA 4AROA 2OHGA 4JI7B 2I33A 1I3LA 2JGDA 1DKQA 1RPJA 2RC6A 2YQZA 4WLOA 3LPMA 3KQSA 2JW5A 1P1JA 1RXIA 2IOFK 4TLBA 4ITVA 1WXIA 4FGUA 2GWRA 3ZH2A 3T35A 4E7PA 5EE3A 2HLPA 4G5SA 1ZHSA 4ZIRB 3EXEA 1Y89A 3MR3A 1S10A 4IINA 2QP3A 2VNJA 5BN3A 3JALB 1YR1A 2ZQYA 1GGMA 3BKXA 3FR7A 4EATA 2O57A 1NDQA 3REQB 4O81A 1WOMA 3AWDA 3EWNA 1U0LA 4ARBA 2B8TA 1E63A 1THTA 2ZSFA 2PMCA 4S2UA 1FX0B 4GX0A 2O6HA 4UBNA 1NJ5A 5I5GA 3I3OA 2D5LA 1VB5A 2OKGA 1Z28A 5LL6P 1Y6RA 4OI0A 1U3CA 1D2RA 2DWQA 1UOOA 1R3DA 2PSJA 1TM7E 3NHJA 2VF7A 4RFSA 4A0GA 1DCFA 1R64A 1GRRA 2WU0A 1SRQA 2JHPA 1VE9A 4FKZA 2REXB 5IWAB 3TL3A 2YWDA 3KOMA 4V02A 4D4IA 2GA8A 1IFXA 1TEXA 4O3SA 3I45A 3BK1A 3GEGA 3HO8A 4QPPA 4MV7A 3SDSA 5ALVA 4FB5A 1P7WA 3HCAA 3PC7A 4WLEA 3GC6A 3L0YA 1N3IA 2GEKA 3BL8A 3K0FB 3NT2A 1K8YB 3WK9A 4N3NA 1X1TA 3PC4A 4D96A 4IIBA 1X1RA 4WW0A 4B3TB 1RAIA 5AVKA 1ADFA 4XGKA 3U3KA 1O5OA 2IX3A 3TLCA 1PCXA 5JTUA 2PR2A 5AJWA 3BAAA 3QVTA 3G6KA 5EXEA 3SR3A 3IUNA 5BQXA 3L6EA 3IE0A 3NO4A 4YAGA 2ZIWB 3TIFA 1JFTA 2A9JA 5FOVA 4PAMA 3RUIA 2WC1A 2NV6A 3A8TA 4MQ5A 1BGXT 1Z5OA 3T41A 4CF7A 3B1FA 5ED4A 1OBDA 1TU4A 4MAFA 4GVPA 2LPMA 1SMKA 1WG8A 3V8NA 3C6ZA 4ZK6A 2WF9A 1XKQA 1EFHA 1ARZA 1L5RA 3C48A 2ZRBA 3IAM1 2BEVB 3I01M 1GV0A 4MH0R 3IT2A 3MWDB 3GFQA 1N8KA 2DLDA 3QH4A 1KU6A 2FEXA 5BQ5A 1YB2A 1ISIA 1Y1SA 4W5TA 1T4DA 5L40A 1PIWA 1UZAA 2H9IA 3BK7A 4KTVE 2JANA 1VCOA 1WA5A 4XYBA 4NK4A 1RHJA 2YHIA 2VUMG 1NMQA 1M7JA 1I01A 3BGIA 3O26A 2FPRA 4TTSA 4XD2A 4XFDA 2FWNA 3WGOA 5CVJA 1ZJ5A 2CHFA 4AICA 2CZCA 1D6NA 4HX9A 1WRBA 4MWBA 3SWWA 5I5SA 1ZOPA 3IQXA 1KORA 1E59A 3BCRA 3Q8MA 5FTJA 3DCNA 4A1OA 2J9FB 2FPIB 1TIBA 1N36H 4OXNA 4MDFA 5A5FA 2CB0A 1QAOA 5FORA 1NLFA 1KSFX 1WEHA 1J2EA 2ZRGA 1Z6GA 2QN1A 5FNVB 2BKLA 2JAWA 2Z9BA 2YWGA 3P9YA 1MW8X 5J2UF 1WP4A 4NTZA 3KPVA 5CYFA 1ONSA 1Y14B 4BO1A 2DKNA 2OE2A 3D1JA 2HF9A 2XIGA 4RVNA 3I4CA 1ZD8A 2XWSA 1K7SN 2UUAB 5AD1A 3H97A 1YBAA 2IVFA 3PXAA 4BMCA 5IF9A 5F35A 4ZQIA 4PV7A 5FA5A 1F06A 1NL3A 4PZCA 1LI7A 1ID8A 3U3XA 2QWXA 3A1NA 1GTSA 1LD3A 1ZSYA 2D5IA 3WYGA 4PC2A 3ZE8A 1O3YA 4Q05A 1YVUA 3FLEA 3OY7A 3TLYA 4WKPA 1E4YA 5AIAA 4RPGA 4GU5A 2M98A 1Z0ZA 4ZT5A 3N8IA 2XLCA 3DBHB 2Q4BA 4MVJF 1CSEE 4RF3A 4DANA 3H2SA 2ZYAA 2Y1XA 4CMIA 3CX7A 1HRDA 2XYPA 1JDSA 1XTPA 3QKRB 4JLNA 1HNNA 4BBPA 2QR5A 3WSWA 4QC2A 4XTRA 2WB2A 5TQVA 3E81A 5A7GA 4IUCS 3R3JA 5A4JA 4XQ9A 4PPFA 2CKZB 1B76A 1YRHA 4YP5A 1P17A 2H85A 2FEPA 2ZSJA 5CVCA 2BL4A 4XTCS 1CQIA 3KZCA 3ADPA 3P5BA 3GLGA 2JI6A 4P92A 3HWSA 5FOQA 3QY0A 2E1PA 5A5DA 1BFUA 2PPVA 4BFYA 1DBWA 5AI4A 1SD5A 4JLJA 1ZRNA 3CG4A 3QE3A 3M3HA 2WWYA 5KFOA 4C20A 3TQRA 1YB1A 4UUOA 3M34A 5K7SA 4TV9F 2CL0X 4D6PA 2WAOA 4YLEA 2CSXA 2O19A 1GV1A 4C3VA 5A4MS 2AFIB 1C8BA 5E8JA 1BE0A 3SLKA 3T3IA 2A58A 1JBQA 3E9DA 4I9HA 2C7PA 4UCTA 4JFRA 4RM2A 2BFAA 3RYHB 4QTYA 4ECWA 4IHKA 1T2VA 3NFYA 3SVZA 2AZ4A 3MTBA 4Q4AA 1A7JA 2DZDA 3PJRA 5K09A 2OXIA 2QSUA 4URXR 3L7IA 4LF9B 2KS6A 3KHKA 5KVCA 4UHFA 4I19A 2OBLA 3Q7SA 4OQQA 2B1JA 5C81A 4J9NA 1L4MA 4OHPA 3TNLA 5ALHA 2ZUTA 3CCCA 4MYHA 5FUQA 3ITKA 4I5EA 1BEUB 1OU4A 3EHEA 3VHXB 1C7ZA 2ECPA 2V4RA 4OAOA 1GG9A 2ATXA 3JWHA 4H1VA 1ST2A 2BFEA 2XWJI 1YONA 2D3WA 3K4PA 2OXCA 4X62B 5ERYA 2V0CA 3HDVA 3ZPXA 4DW8A 5GVSA 1JFLA 5AT1A 4URHA 4LTNA 2UVQA 4U1RA 1U3TA 2ZJAA 4HH0A 3GVHA 1XZDA 3LQRA 1UFOA 3ENZA 5C5IA 5JQWA 4YCMA 2ZTSA 1MFZA 2H1HA 4YAEA 3E2PA 3ROXA 1RQ2A 3HDGA 2FQQA 1YMVA 5EQJB 2TMDA 1DQRA 4C7VA 2ZU0C 2RCYA 1NBIA 4X6XA 4O2LA 2FWRA 3NZEA 3VYUB 1YDWA 3S2UA 1AJEA 1BROA 4H08A 3BKWA 4GI3A 3OE5A 2BE9A 3CEMA 2H2HA 2XUDA 1HR0B 4UE6A 1CY0A 1GNTA 4QIWE 4JBWA 3SVTA 1OH6A 2HF7A 4A0SA 2RGDA 3QLTA 1OZ0A 4B6SA 4EI9A 1FNCA 2QJRA 3VSEA 4AQYB 2C2XA 2PZGA 2OM6A 4TT3D 2O0LA 5FBZA 3FHTA 4AJIA 5L3SB 1IG0A 1SEPA 4P5PA 2J9YB 2Q7XA 2CJFA 3DV9A 3S8YA 3QLEA 1J33A 2IXAA 2FYTA 2ZREA 2WAXA 4HGZA 5B64A 5ERGB 3HWWA 5JNLA 2PH7A 4RANA 4U7JA 4AU1A 1L7QA 2QRZA 2PIDA 4NZZA 1XR3A 4IQFA 1RQLA 3QOWA 1RPNA 3P97A 4JXUA 5K0FA 3I4NG 1MAVA 3U80A 1A9YA 2BE7A 1EZ4A 5FWXA 3LUJA 4GI7A 5I5WA 3CC8A 3W3AA 5FUXA 1DIKA 1TU0A 2X22A 3G7SA 1TA4A 1PGNA 3MTEA 2CWWA 9LDBA 4DA7A 1VJTA 4CC5A 4P32A 1Y3DE 1AUOA 4P7GA 4D9BA 1GRNA 1M9NA 1RHQA 5LL6b 1PS8A 3AHGA 3CURA 3MAAC 1KI9A 1FU8A 4NCHA 5KSWB 4BX2A 5J43A 3ZHXA 1YJBA 5TX7A 2ROQA 2QQ5A 3EMVA 3IR7A 4AJPA 2XCOA 2ASJA 2I99A 1QOQB 2YWEA 3K2QA 4HQFA 2WJPA 5DRYA 2PNJA 4B3XA 3SZMA 1M1NB 2GEUA 3MGGA 2FF5A 1PJRA 4IUDS 4F4XA 5JJBA 1NU6A 4TS4A 1K3TA 3H0GA 3ZV5A 1LWNA 1VJ5A 4X3PA 3JASA 1R9MA 5ABPA 2AG0A 3ABZA 2WDPA 3H8WA 3NNDA 4LJ4A 2OT3B 2Z08A 2IUFA 1HT1E 1FRVA 3SG0A 3W5DA 1YV9A 1HZZA 4ZVMA 4OK6A 2EFEB 3RVNA 3LH5A 5JSZA 2WR8A 1FTQA 1W85A 1VG0B 2IHVA 4LQCA 2B2NA 2HN9A 4WK4B 1KHHA 1WUTA 2BR3A 3O8RA 5DWDA 3F9CA 5DOVA 4EYOA 4OQYA 2WSIA 3SJ7A 1XPUA 1OAKA 2IJGX 2EZ9A 3GFRA 4HWGA 4QJFA 3EY4A 4YQZA 4FD3A 1UDAA 2R8XA 4MV6A 3DFMA 4F2DA 1DHRA 1O0BA 4ZA2A 2I4OA 2ZLBA 5J4VA 1SQ0A 1XUOA 4YMGA 5BRJA 1ZVVA 2FEAA 4R1NA 4C4ZA 2X8WA 2R48A 3OE7A 3RROA 5A7HA 4G1FA 3U81A 1TVMA 3IEPA 3ZIUA 3MF4A 4KWCA 4IG4A 2J3HA 2WAMA 3CPHA 1C9EA 4NXNH 2F1JA 4RXUA 4HS9A 4K1XA 4BFZA 2BOVA 3B3QA 3MT0A 4YUVA 2O8DB 4G0ZA 1G2WA 1Z4MA 1PR2A 2QQFA 3JU3A 4E12A 3LW8A 4NNOA 2JZNA 1OXUA 1PI3A 5KVQA 2I8LA 4OBBA 3JQFA 4IXNA 1X86B 3AM5A 4EG5A 5AH0A 5DP2A 1W19A 5JBNA 2HUNA 2FW9A 4YO8A 5ICGA 5CTAA 4B4VA 4DLXA 3MWEB 3SKYA 4MYSA 2F43B 5LQRA 5L3VA 2I71A 2AG6A 1QE0A 2IXEA 3UJAA 4NYMQ 1ECGA 1SBHA 3IBTA 2PX0A 3DMHA 2QTLA 3ZWYA 4CTKA 4MGIR 3UMRA 4TLCA 3QFRA 1TCBA 2Y66A 5AKLA 1XRLA 4RW0A 2DPIA 3IBFA 1G8GA 4D4KA 4JJEA 4QRIA 1JEAA 1U3GA 4HLUC 4PYQA 4JXJA 5TGZA 1ZW6A 1W34A 5KUTA 3NAQA 4L3VA 2R4UA 2WWRA 3NX4A 1MPXA 3N7AA 5B6JA 2OPBA 4F71A 2Y0DA 2RHDA 1F0KA 4C6HA 4YV7A 5EKSA 4Q3BA 3T7IA 1T6YA 4Z1OA 1XZNA 5GOTA 1XIVA 5FWNA 1TVKB 1W5BA 2AOXA 4IRXA 5EMMA 5G0VA 4MV3A 3D64A 1ZGBA 4JSYA 2EQAA 1WXGA 5AJHA 1W59A 2O0MA 2YU9A 3MR5A 3IOMA 3CO5A 5I7HA 3STYA 3AI1A 2ZIAA 2FJ0A 2BP7B 3HH8A 3RWOA 3BSYA 4CEHA 5A0FA 4P4TA 3O3OB 3AR5A 2YVAA 4NULA 3CNEA 4N0DA 1Y8AA 4GHWA 4II3A 4G4GA 2JCYA 4LZOA 5DBIA 3H18A 3PKIA 1K75A 1XZGA 3U54A 1Y7HA 3I5UA 4UBIA 3MAJA 2ZM6H 3NI2A 3C7AA 2YWCA 3QV2A 2Q29A 3NHYA 4KV9A 1U0RA 2VWHA 4AK9A 1R4ZA 1DS6A 3L7YA 2HSWA 4F3YA 2X7HA 2HSGA 1QOPB 4HFMA 1EX7A 2CXNA 5CVUA 1U7DA 4LTMA 4TTPA 2C9BA 3H2IA 3KDAA 3KBBA 4ER3A 1ADYA 1OFHA 3J7AK 5FEMA 4D3XA 3C3DA 1FLNA 4KUEA 3LA8A 4O2AA 2FCRA 4HRXA 5DW0A 2SBTA 4ENSA 4Q4DA 3RRXA 4R8MA 2LE0A 1RM3A 5H83A 1F8FA 3R6DA 2C28A 2O8BB 3ACDA 1U81A 4DADA 3HNOA 3MPUA 4EEQA 2I2WA 1TXGA 2R84A 2EJVA 3M3PA 4YI3A 2A1IA 1UEXC 2V4MA 1TF5A 4A6EA 1ZZEA 4GP7A 4EKNB 1II9A 2P3QA 3Q88A 1KO1A 1YC2A 3TW8B 2GYYA 4AYBA 3P32A 2DTDA 3Q5GA 5EXDA 3QE2A 2JIMA 4O8CA 1NQTA 3CLRC 4CG2A 1XG5A 2YQ4A 1H3FA 2BFOA 2Q4DA 4LJ8A 3WMRA 2MYPA 3HJCA 5FD6A 4LXHA 5EPOA 4AXXA 1JFSA 5DHSA 2P75A 4CMAA 1CB0A 2Q1SA 2XUZA 1S9HA 1T3NA 3FKSA 3H5RA 1SRRA 5LA6F 5CX1A 1WQ3A 3MIZA 2PLWA 3D8RA 3HKBA 3PWKA 4NYIR 4EUSA 3T7TA 2Q07A 2C2WA 3VC3A 2O2CA 4XFJA 4RPHA 1FP7A 2PX4A 2AE2A 3ILXA 2PL3A 1G21B 3TRJA 3KVRA 1SM4A 5KG5A 1HI9A 3BJEA 3NFRA 3WRXC 1A88A 1V6CA 2OGWA 4LY6A 1UBTS 4P7KA 3WADA 5KOHA 3IQIX 1DLJA 1P0CA 5AJYA 5AW2A 2OGTA 5BVHA 4RIFA 3GP3A 1LVGA 2E89A 1IOZA 2BAGA 5K6AA 2PRKA 4KXQA 5AKGA 2Y92A 4QPJC 1IPEA 1VMDA 1JB1A 3LX6A 3R0JA 2EW1A 4PLWA 1MO4A 2YY6A 2BZ1A 4AZVA 3GUCA 3T5BA 1ZAYA 5L7WA 1A9TA 5E4TA 1XLTA 5ARBA 1DI0A 4EHAA 4FILA 1ACLA 2EKPA 3PC8A 2FPGB 2ZYSA 4FYJA 1CK4A 1V3TA 3VO9A 2CNQA 1YWGO 2QDKA 1OGJA 4RFVA 4DUYB 1Q1QA 3GI1A 1KGSA 1RWMA 2JGMA 5CP8A 5HR5A 1RNLA 4WD3A 4D8YA 5J4HA 1Z3CA 2OLJA 4QTZA 5K8TA 4E11A 4K6GA 3WK8A 4HQ0A 2VP9A 2K4MA 3W8NA 4BY9E 1VSTA 1X19A 2CHGA 2P6PA 2W2KB 1JHZA 1T6ZA 2GAJA 2FFQA 4BBZA 4FNGA 1HF3A 1PTKA 2JD0A 2H11A 4M7PA 2YINC 4Y9TA 3S1AA 3I9MA 3DZHA 2Q5QA 5GMOA 1QGED 1N32H 3PQ7A 3LZ6A 1D07A 5F51A 2PCJA 2R1VB 5F77A 5DYYA 2J32A 4L5IA 1EGHA 1ZM7A 2CVFA 4Q1VA 2BGIA 5DBHX 4KYTA 4FMCB 4DMKA 3X3HA 1XA0A 1ZCZA 1MB9A 2GN9A 2HK6A 2HJ9A 3G2QA 1VFNA 3TLXA 2NZWA 3C3YA 5F9HA 4GKKH 2YC4C 1F2UB 4ECRA 2O3QA 4EY5A 2IC5A 4UAUA 1GD1O 4Y3UA 4J94A 1O5TA 3RYIA 1W73A 1UMCB 5BV8A 1MNAA 1JSXA 4MTEA 3FFXA 3UMJA 2LR0A 1Z4IA 1B00A 1AIPA 5LOVF 3FI0A 2ZUUA 1N9KA 2C0PA 3T3EA 1XLVA 2CCJA 4CQLA 3NJRA 4XE5A 1IULA 2PKXA 4H7HA 2HH9A 1PU2A 3TTWA 4EBDA 1SOAA 4XXHA 4FFRA 3VH2A 5B1HA 4DKXA 4UM9D 5L1LA 4E2YA 2PT6A 2D0IA 1L5VA 2DSTA 5HUHA 3DAAA 3TVDA 1TFRA 4KRGA 1NQXA 2RHBA 4BZXA 5BWUA 2QMEA 4AY5A 1R5OA 4XJSA 4E5NA 3KQOA 1RLOA 5BPFA 3VR5A 4LHWA 2PVCA 2UUCH 4J6EA 1BVHA 3FPBA 4Z3KA 2BZGA 3UMVA 3LY5A 5JZOA 2ZPTX 4U02A 4ZCQA 3LC2O 3ZDZB 1M7GA 1ESZA 4PSKA 1CYEA 1MZPA 4B3TH 4L8LA 2NTYC 3KOXA 1BCRA 4JLOA 5A9SA 1Z73A 3RYIB 5FTLA 5HZGA 5JCJD 1JQEA 5HCNA 4R8UB 4OREX 4F38A 4Z0TA 1QKJA 2WYWA 1LDNA 1Z5VA 3C5HA 3BSWA 3T61A 3E4DA 3TBFA 2X8JA 2NO7A 4XW2A 1F5NA 2VUMA 4H35A 5BWNA 4X0EA 2X19A 4LC0A 2Q5IA 4W1PA 2RGGA 3RFUA 3TIGA 3IRVA 4BXOA 3Q7TA 3FUWA 4AB1A 4Z1MD 1DSSG 3NKVA 4NHOA 4A15A 3GCXA 3JARB 3IV7A 2P3SA 1J5XA 3Q8QB 1J1ZA 2VCHA 4BB0A 1FVIA 5EIEA 1C3VA 3S68A 1DKOA 3ZZ0A 3ROQA 3E3NA 4R9SA 2X6TA 4URFA 4DC1A 1QU3A 5HW0A 4G8JA 3A9WA 5IYZB 2DR2A 4C03A 2X76A 1E4OA 2JJ1D 3CXUA 1K86A 1MRZA 5BMOA 4DCMA 4GRAA 1NVAA 1I0ZA 4P4SA 4NAUA 2FPXA 2D1YA 2J3MA 3O8QA 1EBFA 4EJSA 3GYGA 2I0FA 5BOSB 1OKKA 4ED1A 5AHKA 3DMTA 3PEFA 1J0DA 4TKZA 2O4CA 1OX4A 1S2IA 3HY4A 3D1VA 4XWGA 3M89A 1U9ZA 3RB6A 3SCZA 1V7CA 3GXOA 4M0PA 4UNIA 4K9OA 5HG0A 1K06A 1O97C 1BVRA 4IRMA 5BR1A 2CNNA 4QXQA 1RWXA 2WIBA 2GXQA 2O8CB 1XL0A 1YRWA 3L8DA 3F0TA 5CW2A 3HCOA 2UUOA 3O0DA 3M8KA 3ZI4A 4CM8A 4OX9B 3ZV3A 3UGKA 4EB0A 3IIJA 1H0HA 3FHOA 3U4CA 1Y3AA 3T3DA 2IZOA 4V2IA 5JHGB 3KZVA 2R60A 4ECZA 4O7NA 5JBQA 4ED3A 2UUAH 1NASA 5IWCA 2VLIA 4PZPA 3VYRB 4Y6QA 2DFNA 4CGZA 2FSVA 1BKYA 3BJMA 1KH1A 1SU7A 1XP5A 1HEYA 3K6SA 1OX5A 3ZKAA 3I5MA 2JCXA 4EQZA 3IBGA 1BRTA 1OJ7A 2XYVA 4JR2A 4HDSA 2QI9F 3BD9A 3N2ZB 2PN1A 3W6NA 3ADKA 3MJRA 4FR2A 1E7YA 1O5IA 3GRZA 3N2YA 3T5KA 1CUDA 2UXCB 4QBIA 1AA9A 1HE2A 3KSRA 2CNBA 4OGKA 3IAXA 3R44A 1NC1A 5IJWA 3UGTA 5C52B 4LGYA 2X3FA 1PJZA 5D5PA 3VTKA 4F4FA 3DR3A 3EAFA 4XYLA 2GPTA 2FSIA 2HSEA 3QTBA 3VPDA 1DDGA 3HUTA 1ULUA 1WDKA 3QEAZ 3U44A 5AI5A 3GBSA 4EZBA 2DBRA 5D1PA 4LYHA 4D5GA 3U6BA 1IXSB 2FTKE 4JI5B 1CY7A 1EP9A 1DWUA 1U1IA 1B8OA 3PR4A 4PYRA 1NMSA 3I30X 1VJ0A 4PX2A 4B09A 3H0GG 5CFOA 4OB8A 4LI3X 3VSAA 1RWQA 4QFMA 2EC5A 3L6DA 5F5XA 2HYIC 2YQ5A 1SWWA 3ZTWA 1JDJA 3RC9A 3KC2A 2WW8A 2COKA 3NIFB 1QYXA 4YCNA 2A7QA 3GU3A 1V71A 1ESCA 5E9QA 2XNJA 1Z9BA 4RGVA 1HDRA 4BX8A 1VTKA 2QYSA 4HDNB 3C6XA 4C7OA 4U7CA 1C3XA 1K68A 3EWAA 2WHEA 2ZT7A 3O47A 5EJFA 5FNVF 1FDTA 2ONZA 1EDZA 1KIFA 1SVKA 3KJZA 1MX5A 1WAMA 2H16A 4EPWA 4KIUA 3T9DA 4PANA 1VIYA 1XZHA 2F4NA 4IIJB 4LF9H 5BUSA 3TFOA 3W2FA 1PQPA 3TEMA 5KKNB 3CTPA 1F9AA 4BQNA 1AUQA 1IMJA 2PQ6A 1PL0A 1E3LA 5FB3A 2UZ1B 4GSYA 5T41A 1X8XA 5KYNA 5IBPA 1VPTA 2OUIA 4MDYA 1TZBA 1QQAA 2HGWA 1Z4NA 1ODCA 4U3JA 1DQYA 3AHJA 1Z5PA 3TTVA 4MKIA 1KGDA 5JH7F 1T5SA 3BJZA 1PT9A 2A92A 3CXRA 4PO9A 1IOLA 1LBSA 3HLKA 4YGXB 2W8BA 1UFVA 3EVAA 3BTVA 3AY7A 3T3PB 2VHJA 4QUDA 5KFSA 5CK5A 5IM4A 4KFSA 2Y1GA 5DM0A 3N8NA 4QVGA 2QGZA 1U3VA 4ZK2A 2H1RA 1NWCA 3OQBA 4P0QB 2Y4OA 2XOKA 1I1OA 3ZS9A 2BFCB 3WSVA 4NPCA 3HB0A 3RM3A 1NHWA 1FRFS 5KQSA 3JR3A 2JA5A 2B8JA 4M8IA 2GVDC 4J1SA 2WT4A 5D6OA 2ZBRA 4MRRA 4LJ5A 3PHJA 4MB0A 1AS2A 3I4LA 5AW3A 1DGQA 2HA2A 3TZBA 4RD4A 2JGLA 4XGQA 3F1LA 4XEHA 4Z7NB 4INOA 4Q1CA 1E0KA 3MS4A 3V8BA 1YR9A 2C5LA 4Q37A 4GI5A 1KUTA 1PZXA 2PKWA 2CYBA 4U3JB 1H22A 3MZ0A 1U7UA 5IZCA 5KDLA 4YYEA 4ZAFA 2AG5A 3DMFA 2Z1NA 4ED8A 4KPUB 4CCSA 2ZM6B 3EH1A 4CEJA 3H87A 3UKDA 3KYHC 4GICA 3RC7A 3MMNA 1I14A 3V46A 4O4LB 4R7RA 3LCMA 1ZHHA 3F7MA 2QRMA 2CHEA 3DVLA 2E5LH 2YL2A 1EWRA 5EXSA 3Q2IA 4BNGA 1XD2A 1I24A 3DLPX 1LFDB 4W9RA 1JR3D 3WO0A 5GV8A 3T94A 4WUVA 5D7BA 1ACJA 2FFAA 3ONVA 2D0PB 1OI7A 4DCCA 3H17A 4PC1A 3H05A 3NTVA 2Y1KA 4ESEA 1M1YE 2Q6TA 4ZVVA 4J3JA 3KHTA 4YI5A 4F1WA 4NC9A 2MSWA 3QX3A 3Q8PB 4YMUA 1JSZA 4PW0A 5FAXA 1VJDA 3FZYA 1UM8A 3DZ8A 1IN5A 4NARA 2O0JA 3CVOA 2ZXUA 4GPTA 4IJVA 2PG3A 2ZKLA 2DVMA 3NHWA 3M70A 2J5KA 3E5RA 3CZ4A 3LKVA 7REQA 2RIRA 5ES3A 2XB6A 3JYHA 1KC3A 1FLDA 1IYEA 1UPTA 4HUQA 5EC8A 5F7XA 3OFSA 4W6ZA 1B1CA 2P91A 4RZUA 3BE8A 1Y1RA 2PUAA 1M10A 1TVEA 1SCNE 1WHTA 1B6RA 3RREA 1Z8DA 1LVUA 1B6TA 3KOWA 1CJTC 2GS9A 4ZPJA 1JAZA 4L2IB 2FR8C 2TECE 2PKQO 1RJDA 5AQEA 1CY1A 3GUZA 2MINA 1E2QA 2KMLA 2YFQA 3DBVO 3BAZA 2VQSA 5HE8A 3W5VA 1FTGA 2KX7A 3TLGA 3TUZC 4QNMA 3GD5A 1JXAA 4CCYA 3ML1A 4WLFA 3AEXA 4G8CA 5DYGA 1C9KA 3OKAA 4MUYA 1LDGA 2P65A 4TRNA 2YFKA 4F11A 1ODJA 1I2KA 4R9VA 1H6AA 1XX6A 2W4QA 1J7KA 5JYDA 3BIWA 1Z4QA 1I7LA 1M7HA 1NXTA 1GGJA 1J5EH 3LUPA 5ALZA 2FJZA 2NUTB 1NJFA 2DBYA 1ZKDA 1YUMA 2A57A 5AVSA 3RAXA 3RSFA 2ONJA 1JU9A 4L8WB 4M0KA 1YVPA 1Z88A 2BEUA 3N41B 5FOSA 4XWKA 2AZDA 4RIIA 5DSXA 1TO1E 4O4HB 1K1EA 5KFIA 2EYQA 4MR7B 1NJ1A 3EIHA 1QGOA 4WKOA 1CPYA 5MDHA 3ZWOA 4JV1A 2WU1A 1NVFA 2QSYA 4YXWA 2P8JA 4H7EA 2YASA 4AUNA 3N59A 4DRZA 3THWA 3IULA 4IGKA 1FDUA 2X6RA 3HEAA 1EKPA 1EAMA 3PCTA 2AX3A 1ISRA 5FOXA 1QTIA 3SFZA 4X63A 1H3NA 1DBQA 2WF7A 3BFPA 4MKZA 5EMHA 2MYTA 4CKWB 4EBFA 3TW6A 1PYGA 3MYYA 4J9RA 1RTKA 4NMMA 1OFUA 1FFXB 3QEOA 2ZWVA 1E3SA 1E2BA 3A4TA 4P9NA 4L1KA 3V2UA 1FMJA 1BA3A 3E53A 4MMZB 4TKVB 3U62A 1N32B 3PW4A 1CZRA 1NVEA 4EVQA 1GFSA 2X8BA 1E1QD 4ECXA 4YJGA 5INTA 1TIKA 3C1TA 3IIMA 2XNDA 3PXDA 3AVUA 5C4MA 3FUXA 4F12A 3D7MA 3OX2A 5H3LA 3PVSA 4GKKB 3BHMA 4TLMB 4AN1A 4Q16A 2RK3A 4MV0A 3T1OA 2Z43A 4YJKA 4ZVLA 5AVWA 2CW7A 2H3HA 3N5CA 5K3AA 5D1HA 4HPWA 5AKKA 3O8NA 5CEFA 5D3QA 4EF6A 8OHMA 4RTNA 2G9NA 2LCIA 3EFOB 4Q4JB 3OM0A 1P5RA 2EHJA 2FDRA 3JTEA 4G25A 1R9GA 3BZBA 3X1XA 3P52A 4DQLA 3C39A 5DGHA 4OJQA 2EFCB 4HTFA 3RB3A 3PXEA 2JGDB 3LL4A 2H31A 3FVQA 2EX4A 1L2ZA 1T1RA 5EEGA 1EP3B 1J90A 1Q50A 4NOMA 4Y0VA 2Z5LA 1NVVR 1E2EA 1G8YA 2UUCB 1K6MA 3JTMA 4N39A 3EXEB 4FGRA 4FSXA 2X4GA 4UBKA 4DCOA 5BN3B 2Z3VA 2ZRJA 3KXLA 1EX6A 3CPEA 4NMLA 4D79A 4JNCA 4L4YA 4HNTA 1E2JA 1NURA 3FTQA 2BMEA 1IATA 4MJXA 4W1RA 2YXPX 2PYDA 2IHJA 2Y6VA 1YL5A 3KO8A 3V7NA 4HDKA 2LCFA 4LCEA 2PX5A 5KTPA 3OOHA 1T8SA 1HT2E 3IUYA 3RJ0A 2XECA 4NFLA 4RTKA 3OTHA 3K96A 5CHYA 2HBRA 2QD2A 4NR0A 2OHIA 2X0SA 4LRXA 3T1HH 1JDBB 1XD9A 3QHPA 4RFSB 3VOBA 5T4EA 3LUBA 5K8CA 1A7AA 5KZMB 1LX7A 3EF3A 4WNCA 2J33A 2FDCA 5U9CA 3QA9A 1Q19A 5IASA 1JQDA 3BG5A 1I4EB 1JHRA 1G5FA 3K7EA 3T1VA 2H2AA 4KLCA 4LXYA 5JPDA 4MUAA 3KOZA 3ZC3A 3K0AA 1C50A 2J3IA 3PYXA 2QK4A 3IOCA 2WTAA 3T7DA 4F84A 3IQFA 2AK2A 4UM7A 1GPBA 4P0TA 3ZZUA 2C31A 4AZ0A 3AFIA 4TSRA 1JDUA 2O3TA 2E4XA 3GNLA 1FW8A 1J22A 1N0HA 3MT9A 5D1OA 3W1BA 3UH1A 3MR6A 1UFQA 1VLLA 4U9HS 1CNMA 4PGAA 2Z95A 4Y6RA 3PRJA 3TOZA 1WDLA 2PO7A 3MTDA 2V9ZA 2VSOA 2EP7A 4PSAA 1S0OA 4E3ZA 1RR6A 2CD9A 4HZUA 3K4QA 2ZRNA 1AMOA 3T52A 1L7NA 4EKIA 1EVEA 1T6XA 1JW9B 1QWSA 3DQZA 1TQHA 1B33N 3UZBA 1D8TA 5K01A 2Y1WA 2ZJFA 2XT6A 5ETJA 2C96A 4XYGA 2ZJ4A 3KUXA 4XQGA 3TM4A 5JEEA 1OJLA 2FAXA 2FQWA 5TQ0A 3M4NA 3P9IA 3UGQA 4CR6A 3GDFA 4JITA 1SHLA 2ZWAA 4AKHA 1SOWA 2YHIB 4FQ8A 2C20A 1NG1A 2QQEA 3KL4A 2OSBA 4DUYH 3LWNA 5J4LA 3TIXB 3TG2A 4FQ5A 2J1LA 2P9ZA 3N8DA 2BT4A 5FTWA 2D1TA 3O6VA 5AWFC 1TM1E 4C3UA 2H59A 1ZMXA 4KAXA 3GCZA 3V1KA 4PGFA 4GZMA 5HUJA 1PL8A 1G8MA 2HA7A 5JMPA 4D5EA 5IKEA 1U2TA 4J0JA 3OF2A 2BGTA 1OPRA 4CWAA 1P4AA 4K9RA 1D5CA 5ES4B 1IHOA 1RYRA 2PVSA 1Y82A 1V95A 4ZJYA 4Q9NA 4YPFA 4PX9A 5H70A 1E2DA 2NGRA 2QQ0A 4U2GA 2QAGA 2CE2X 1EDBA 2AJDA 4B84A 4RACA 3N44B 4LDQA 4IH1A 1GN8A 5B36A 3O2QB 3NVAA 1ZVKA 1E3DA 1Z0JA 5ALNA 4A73A 4JIMA 5C7YA 4GH5A 2C2RA 1OILA 3R9WA 1PVVA 4LMYA 1G0OA 2HGSA 3ELUA 1HL7A 5C4GB 3PYLA 2HWWA 4E2XA 3FZQA 2PSDA 4ZYYA 4YCLA 1SUWA 1N6PA 2WKRA 3HCFA 1M8KA 1I1LA 4BZQA 4EHFA 2G5PA 1U2QA 1MRSA 1H05A 1OCEA 4HLNA 4CMIB 2BKUA 1AC5A 4O4JA 3AI7A 1ULBA 1YB7A 2OC9A 2Q5FA 1TVCA 3L8GA 1SKYB 5JCOA 1PZMA 1HNWH 1OB5A 4C4YA 2WM9B 3L7OA 2H4ZA 1CZHA 2ZRDA 2ODAA 1PFKA 2GPWA 5JDCC 5TS3A 4HATA 3R0XA 2FEOA 2GVNA 1JEYA 2PUGA 4EH1A 1TAEA 4MKHA 3W7AA 5CG2A 2DBQA 3WG9A 1C7QA 3V48A 3NDRA 4JI4H 3B20A 1CQIB 3N86A 5CM0A 5ALQA 3GEIA 2ID7A 5I9TA 3GLGB 3D8SA 4J29A 4OPMA 1JWBB 3FIUA 2VPWA 4RNOA 4OVKA 3WOHA 3OEHD 2WWHA 4DR6B 3RF7A 2CFOA 1VE5A 1V26A 3T0IA 3PX3A 3U4GA 5DNDA 3RE1A 4EYSA 4HXYA 3V1YA 1KFCB 3K94A 3DP9A 5E6UA 1TMYA 5LB2A 3DULA 5BW4A 1G5QA 3R8XA 3SHTA 4F9FA 5EPEA 3TB4A 1AHIA 3PDIA 3PXBA 2DJIA 2FK8A 1J5PA 3JSXA 3BRWD 3UQYS 4URUR 3OIWA 4BYGA 4AY2A 4Q4AB 1JHAA 3IP1A 5HMLA 1ISGA 1L4UA 2GHTA 1QVRA 3NUGA 3C8DA 1ZH4A 4M83A 2I22A 2IYPA 2ZE5A 4KXYA 1TWFA 1IK4A 2HQSA 1JMYA 4TROA 3IL2A 2R65A 3IVCA 3I76A 2FPOA 4X1OA 2CV2A 1E2NA 5C32A 3VR5H 1YR3A 1J56A 4EMUA 2HHCA 4LOAA 2ZSEA 2I62A 1FRNA 4LBVA 4OI1A 1Q92A 2BFEB 2H2IA 4DE5A 4B4KA 3T7CA 1L4NA 1IM2A 4BO6A 3NWPA 4M1OA 3S81A 1ZLXA 2JA5G 4WWHA 3MS7A 2E5LB 4BBRG 3O8DA 1Y42X 4EUFA 4L9WA 2J3JA 2P27A 3AR8A 1EKVA 1F12A 2WAAA 1X8KA 2JH3A 3RS2A 5IG2A 1FSZA 1TUGA 1EEHA 5JU6A 4B6FA 4ZYXA 5FOTA 1TUBA 4HLCA 4TKMA 4J90A 1VPDA 2YVQA 4A8JC 4JL5A 2O3UA 3HVRA 3AW9A 1IHDA 5K3WA 3FTCA 1OY1A 1NX6A 2YVUA 3STTA 2XQFA 4S24A 4I8XA 1M2GA 4JN6B 3U3ZA 3D6MA 4HZIA 5KSPA 4BDTA 1W2WB 4OX9H 5EUBA 2R68A 5ER6A 4BNJA 2A94A 4NIMA 4RTOA 1GL7A 3ZV7A 4JSRA 3E3AA 3JD1A 3GLTA 3H5NA 1DO0A 3SBDA 1O0CA 3RABA 3TRIA 1BQEA 3D4PA 4Y98A 3UA4A 4JLDA 1TL7C 1JE0A 1V9PA 1QR6A 1NM5A 1AGNA 3DKRA 3EVGA 1PSDA 4HAOA 1F0NA 1ZRMA 4EW2A 1W0KD 2P7HA 3CUUA 2KI5A 3U61B 3DOUA 3OMWA 1QFMA 4KIGA 2YHSA 2AG8A 4JCCA 4ECUA 5DX1A 1LSJA 5EINA 2JAOA 1F7VA 2OTCA 2UXCH 2IZZA 5FWXB 2C42A 2N9UA 2H54A 1IUPA 3RH0A 4CF3A 2DAAA 1JNXX 2ZIVB 3R3VA 2D0OB 1JKXA 4EZIA 1OLUA 4E5MA 5AK5A 4EY6A 5CB4A 5FA6A 3K05A 4DDUA 5LU9A 3OOEA 2QTVA 3CFYA 3U9TA 1AKMA 4K6NA 1UR5A 1DIGA 4KVFA 2K2QB 3EBLA 1B04A 4FN4A 3M6UA 1U7XA 4PRYA 4JI5H 1P7YA 4QAJA 2QIPA 1BN6A 3FJOA 1J5EB 2O5VA 5F7ZA 3UNXA 1YB4A 4BQRA 1L3CA 3EZNA 4F5ZA 3FCSB 5FLKA 1VHLA 4UVHA 3ESYA 1M0TA 3WRYC 1P1HA 4YRCA 5KFLA 4YRIA 5BN1A 1VYVA 3PF9A 3RBAA 3TR0A 1E9BA 2DECA 5AICA 4ED0A 2JFWA 4QTTB 1YDHA 2QD3A 2PFKA 3FAKA 4IFIA 3JASB 2WTBA 4G2TA 4H6PA 3DC2A 1RRFA 5BR8B 2WK1A 4DWOA 3WFJA 3OO0A 4M89A 2CBZA 2C00A 1ZWKA 1IU9A 2XCPA 4GS5A 4TVKA 1WPQA 4RCVA 3OTQA 1WL8A 1CJSA 3EA0A 4RVDA 2IXTA 5JSZB 3G82C 4KGXA 1W85B 3PGJA 1OYWA 3K9WA 2DPJA 5EPUA 1NC3A 1OFVA 3AF3A 2V6MA 3R2JA 1RHRA 1YJCA 2HA6A 3KB1A 2VUGA 1CUCA 1PR5A 1DQSA 2IS1A 4GMHA 5HQTA 3WLFA 2J6UA 3WGIA 3EYWA 4AUEA 2PMBA 2X1VA 4AKEA 4OB6A 3X43A 2QTNA 4L08A 4G89A 1NVUQ 2O1SA 1R27A 5J5CA 2FE1A 3VM6A 4YBRA 4DCJA 3A0RB 4A4DA 2VRCA 2PQ0A 3K9BA 5CCXA 4C2MA 2Q8NA 1KJ9A 2SKDA 1AKRA 1U6IA 1KKUA 1F6BA 5JI2E 2PGDA 1XMPA 1QP7A 1GA4A 2FHSA 3RASA 2NACA 5CFMA 2X23A 3CRMA 3E15A 3O03A 1OXVA 3LHFA 1KQPA 3T38A 3RGWS 3UOWA 2C5GA 1U0TA 4BO0A 1Y3BE 4MI1A 1NLMA 1DADA 5CFRA 3EOZA 3GNTA 5HRUA 4BKPA 2WVAA 1Z7BA 1SG9A 2AZMA 1MQ8B 2QUKA 5ECYA 2C1ZA 1HE1C 2W9XA 2V6FA 4ZO9A 4Z4QA 5KG2A 5LZ7A 5LQKA 3R8CA 1WXDA 3SY8A 4CHIA 4RSHA 1Q91A 4PO8A 4J9UE 4KXUA 4WFKA 1WUIS 1ND5A 1RLIA 3DQQA 5I9MA 2PK3A 3L8MA 2NSHA 2O52A 1K92A 3ZXUB 4OHVA 4QUKA 4COKA 1G5PA 1NKVA 1NXQA 2C88A 3G2OA 2H8KA 3G68A 2CL6X 1BX3A 4LVUA 4B3DA 2A5GA 1ZS9A 2XW6A 3HLYA 3I01A 3W90A 3CF2A 1N4AA 4RXTA 3X44A 2FZ5A 1R6XA 4FGJA 4DQDA 4KO2S 3GLFE 2EGHA 4XEUA 3G88A 2UZIR 1LQUA 4AM8A 3VGJA 1I3NA 2AFHA 1D0IA 2VDWA 1PGOA 4CLOA 1E58A 3DQPA 1IIBA 2JLYA 4GGOA 3F46A 4DMLA 5CB8A 3JWIA 1CQZA 3AQ4A 3ZNNA 2HRQA 2AA3A 3L05A 4DLBA 1CQWA 2BTOA 5DX0A 1DARA 1SXIA 4NCJA 4R16A 3NBZB 4GC9A 5CMLA 1DAAA 3A6EA 2BR5A 2ADOA 4UOEA 4G67A 4NBRA 3LFHA 2ATLA 1THZA 2UKDA 3QV1A 5E9WA 4QVIA 3JSLA 4KHZA 1PL6A 2ACWA 3LHIA 4HAWA 3GJ3A 2QOEA 1NY6A 2GJAA 1Z56C 4P1ZA 4Z3OA 4WIAA 3KJHA 4CEHB 4UC0A 3KFLA 2DU8A 4JKIA 3T1YH 4L8FA 1PWYE 4PPNA 1L7MA 4GXNA 3CEBA 5KHOC 3M9MB 4I5IA 3FE2A 3T1HB 2DXIA 2QLLA 2JVJA 1DEHA 4LMBA 4BY1G 1NUTA 2EGGA 2IW3A 3G2MA 1QG6A 3GGCA 1LBEA 4GF5A 2GM9A 1WX1A 3RSZA 1Q7CA 3GR6A 3WZMA 4TYQA 5KQRA 1M0SA 3QPAA 1OVGA 4PYIA 4Z86A 5KT7A 3WB1A 3DT9A 1ULAA 3UY4A 3SXPA 4G36A 3H2JA 1L5OA 4TVOA 3TDNA 3ODGA 4N5MA 2R00A 1SU8A 2BZSA 1AURA 1C8KA 4EX7A 4PG6A 4IXMA 5DU2A 2Y1DA 3TX2A 3DTGA 4O2AB 1EFRA 3LBYA 3DAGA 2GASA 1D1TA 2SECE 1C9DB 1SA0A 4JHXA 3K0BA 4LQ4A 2IPAB 5E4YA 2D00A 1MRNA 5LZ4A 4ZFNA 2AL7A 4RESA 1AQUA 3I64A 2H1WA 1XZBA 4D92A 4GPEA 2KBEA 3VU0A 4D9GA 4E1AA 3PKJA 1NLUA 4F4ZA 2R8KA 3OCJA 3MCZA 5LBUA 1C41A 4ZGGA 3S2FA 1OI3A 1KWKA 5HZKA 1JLHA 3EEFA 4XUDA 5I9IA 3I0MA 3TD2A 4AI6A 2YDYA 4U7FA 2QU8A 4YACA 2YY5A 4E6PA 3U4HA 2XMQA 1DFHA 4QSHA 1IG3A 4F21A 3G9XA 2DE0X 3SXUA 1JA0A 2QVXX 3S5JA 5CX1B 2WQ7A 1ZISA 4GVLA 3HKBB 2WA1A 4UHHA 3K9GA 4WPGA 3HYLA 4UATA 1IN8A 4L6AA 4Y0NA 3N87A 1SZCA 3U7FB 3HU3A 5CEJA 1WW3A 3TSCA 3CEPB 2XMPA 1TPYA 4WZBE 1SHZA 3UJ8A 2AI3A 3RT7A 4MTDA 2FOXA 4PBTA 1GILA 3VC7A 4QBTA 1Q3KA 4HGQA 1AKQA 3O75A 1YA8A 2QX8A 1QG4A 4IO1A 2GPJA 1A5ZA 4IOLA 5KOHB 4A2CA 5BVHB 3VZDA 3M1LA 2ZQ5A 5ELLA 1DAPA 4HEJA 4NNPA 3F8WA 1XJ0A 3UMGA 1QLJA 2HV8A 4UXHA 2QN8A 1XFDA 2XMSA 4ZAZA 5AR1A 4QOHA 4H1HA 3FMIA 1GAEO 2L17A 1JSCA 4RJIA 1XVAA 3TPCA 1IPHA 1YU9A 4PQEA 3FG9A 1Q1ZA 4BY7G 5ESXA 4IEFB 3QWBA 3AUSA 1WCYA 3CB4A 3KYIB 2AD1A 4W9NA 2B9VA 2WKQA 1WB6A 4IBOA 4PLYA 3IB6A 2W2PA 2XSZD 1PDWA 4HGOA 1H6DA 1TQ8A 2NXCA 4JQSA 1M67A 4B45A 5HRCA 4ZQBA 3V6JA 1WXHA 3AINA 7AT1A 3NC0C 2GM3A 2HTFA 3TXYA 3TKYA 3PR5B 3A1DA 4AY4A 4DL7A 4BGUA 1JIHA 3PF8A 1W94A 4LWOA 4Z3DA 2BFWA 3IP3A 4XDZA 2NMVA 1HNWB 3S1AB 3KJQA 1Y3CE 3RVRA 4M1QA 2W42A 1KXZA 4DILA 1R9TA 1QDLB 3EEYA 4JYZA 4O4HF 3NQ41 4AJKA 1KMCA 1C2YA 1SELA 2FUG1 1IHPA 2ZSHA 1WZ2A 4LRQA 1WABA 2EQBA 5IKOA 4FS2A 1HH4A 3ZDEA 4JI4B 3GGJA 1ZNYA 2P6MA 5IAEA 1TD9A 4C7XA 1NJ6A 4DL4A 2D62A 2AC2A 5IXSA 3SMVA 1Y37A 3USZA 2ET6A 1H6BA 3DB2A 3TE7A 5EMKA 3OJLA 3RSGA 1FW6A 1USGA 3HUUA 3RGZA 1RAAA 5AMXA 4C22A 2QPTA 3QHAA 3C6QA 3DCYA 2O23A 2HWXA 2ZIFA 3RUHA 2I7XA 3STXA 4CQLB 3TNJA 1W49A 4RM3A 1KQNA 3F6SA 1P73A 1UDCA 2D7JA 3ZU4A 4W8HA 1Z5ZA 3E1SA 4J4BA 3OU6A 1OAOA 1GYRA 2XE7A 4M87A 3U4IA 2VPYA 2Z5VA 2ADMA 1CUEA 3IPYA 3R3YA 7MDHA 4EG8A 1L5ZA 2IYYA 4UEKA 1I6LA 2CNKA 4C6SA 1E7SA 5HS6A 1KKMA 4WN9A 3ETDA 1TC1A 4C3OB 2EZ4A 1GQ2A 4MARA 1TI7A 2QY6A 4DR5B 2CW8A 3KZXA 5HFAA 2C2KA 1ZI8A 4IOMA 2RE8A 4XGRA 1XU4A 3HRKA 4EGQA 3BZWA 3GTPA 5EIBD 2HJRA 5CNJA 4FT2A 3A58B 3D4OA 1JT9A 1BCRB 5A9SB 3WK7A 2O50A 1SCAA 3WY9A 3VR3D 5LZ2A 1BJRE 3OH8A 4FUTA 2Q5JA 2VEDA 5B1IA 1U28A 5ITWA 4V0KA 1PZFA 4PXSA 4D02A 2A33A 1JJVA 1ZGZA 3MMSA 3PW7A 3CUKA 4DT1A 2VKQA 3IHKA 2X8JB 5JC8A 1CZKA 2V7WA 5DISB 4ZI3A 2IUYA 4IX9A 4E03A 3WWPA 5TXGA 3WYDA 1FXWA 4BXOB 4I9GA 2F1KA 4GVXA 3K09A 3ZXSA 5SV2A 1DGSA 3ORYA 2RHHA 3QOFA 1A69A 2AJBA 2HR1A 4LKRA 1A72A 3KQNA 2WG0A 2HQBA 1WSAA 3RS3A 3BUSA 1AHNA 1GNRA 1Z4LA 4BAGA 3P2MA 1FU4A 2Y1LA 4R3UC 5IEBA 3CBGA 3FMOB 1QIFA 4CIBA 3I9V1 3JVIA 3CLRD 2RGNC 3H1AA 1VG1A 4WKCA 2QS9A 4AQ7A 5J2TA 5CURA 1L4YA 1SXQA 1PQWA 1J9ZA 3Q7IA 2ODTX 3IQZA 2O54A 4P4SB 4MEBA 1MXFA 1V51A 4ANFA 1H1LA 5FAKA 4C4RA 3K35A 3O8QB 2W0SA 1N2CE 4EJSB 3R0VA 2C77A 4Q7KA 3PFBA 2OHOA 3BFXA 5JY1A 2ZAOA 2IYZA 4F8EA 5JS1A 1OX4B 5EZYA 3OUTA 2XMGA 4S0ZA 4BNKA 2YJNA 4EYHB 4QO7A 2O0KA 3KXPA 1GPKA 4WOBA 2VNKA 4QFBA 4GM4A 4TWRA 4PG8A 1HG1A 2RHRA 4JB0A 3GEBA 5ALJA 3I6IA 4RU9A 4YJFA 4CW7A 1Z13A 2YRFA 4EJ2A 3L06A 3JAMA 3AV3A 3C8MA 5JG7A 4BCCA 4WXMA 1D6MA 3B2NA 3VVMA 3EVTA 1XROA 4CM8B 2OOSA 3TQHA 3TRHA 2C5FA 3DE1X 3NG1A 3A3NA 1BW9A 2GMWA 4YP6A 1ESMA 1O95A 4BV3A 1E1KA 1EFLA 3ABQB 1UC4B 5AK3A 2I4MA 3VO1A 5IUKC 1W8DA 4N9QA 2DM6A 1MH1A 5F73A 2CXQA 2NUPA 5BYJA 3PGKA 5LNK1 1GAQA 1J1IA 3ZCXA 1ZH6A 1W1IA 4YMHA 3K6SB 1MNQA 3RIEA 5M34A 3WIOA 4TTQA 4ZDKA 1GIAA 2PU5A 1RIIA 3TF5A 4HDSB 2R751 1K66A 3WSTA 2VFAA 4QUAA 3K16A 4O25A 1M6HA 4M7RA 3HOXG 3EQ8A 3H1GA 3BILA 1I4OA 1RC0A 1C0PA 2I5PO 4YFVA 1UBKS 4D46A 1ATIA 1LU9A 2BJVA 3D7RA 1KDYA 1BKSB 4CV1A 5F21A 4PCUA 1VKNA 4C2TA 4XCVA 1JIIA 2PGLA 3GB9A 4XYLB 2X1LA 3B1VA 2PJRA 1L5LA 1NW7A 1KI1A 3OPYI 2FLNA 3U44B 3FI9A 4G4JA 4V0SA 1IZZA 3WB9A 4ZU3A 1TWHA 5FQNA 4RX1A 4GLBA 4PVDA 4B3BA 1DAIA 3VU8A 2G76A 4D74A 3NTUA 3O1JC 3GWGA 4WCVA 4KN8A 2HYDA 2D4AA 3KJEA 3HKDA 3PBKA 2UZ4A 4DR6H 3F67A 4M2LA 1M2OA 3FNQA 1XT6A 2XGOA 4C7OB 4WADA 4NU0A 5C5CA 1P4JA 4UVDA 1M6NA 4HWPA 4TMFA 2QVLA 2NP6A 1BX0A 3BCUA 3TY5A 4I50A 2I2FA 5GPBA 3WX0A 2PZMA 4FJ2A 4BJ3A 1VFPA 4KPEC 1SIUA 2I6XA 3CLSD 3UC9A 2JGKA 3Q15C 4RGBA 2C2GA 2W2MA 2WZDA 3Q41A 1J24A 4XQ0A 4YECA 2B4KA 5DV9A 5ADVA 3N3BC 4WDRA 4AZWA 3VO2A 4ZV4A 3QG1A 1L2TA 1QYIA 3HJRA 3WYBA 2HLDA 3F8NA 4BVEA 2EX0A 1T94A 2G17A 2IDMA 2ZATA 1A0IA 2YJ4A 4PTYA 4E5DA 5LWHA 4LMAA 3DL4A 1XXHE 1NNEA 3ABSB 3V3TA 1QQ6A 1PR4A 4NLLA 1BVYF 1AGPA 3NNNA 4D0NA 1M2JA 2YCHA 1GG2A 2EBUA 3Q3GE 3C2QA 2H9YA 3I6ZA 1Q11A 4EMTA 2I6TA 2W8BB 4YJ2A 2R1TA 2OYRA 4OB7A 4P31A 5ALFA 1YF3A 3JYNA 4O02B 2XGGA 2Y1EA 4AMVA 4ZAVA 2C2YA 4TLAA 1G7CA 2Q3LA 4Y9DA 4CIWA 5C2JB 1FEZA 4A03A 2NYVA 2NSLA 3K2EA 1Z45A 2MSLA 1QMPA 1RC1A 3PHCA 4M0LA 2C4UA 2OHFA 1PJCA 4B4UA 3Q72A 2XVYA 3LS2A 1G8SA 1J7JA 3PRYA 2EDAA 2GD6A 1I7DA 1KQGA 3ZCRA 1EK0A 2WM8A 3E8XA 2H1OA 2O48X 5D5QA 5MN4A 2XR1A 2WZBA 4GC6A 4WEOA 4HYYA 3U7QA 1YHZA 4N3AA 5JYCA 3AJ9A 3IALA 3T1YB 2QSJA 4BBJA 4LJ6A 1KA9H 1JA9A 1Y6ZA 2JH9A 4CL8A 2B7BA 3YASA 1GNSA 5MN5A 1S7GA 3K92A 2W7PA 1YCHA 4CEJB 4ZCLA 1DC5A 2GK4A 4QLOA 1T0BA 2E55A 4FCCA 4BASA 3H9UA 3HGQA 4IJWA 2QJTA 2ZB3A 1XD2B 1J21A 5EJ7A 1EQAA 3BN3A 3B36A 3ZU3A 1V11A 1EK1A 5ALUA 5EWJA 4R8SA 4JP2A 4A3MG 1ZM3A 2CLDX 2LBPA 4PNEA 2WB1A 5BP7A 1EUZA 3ZX5A 4DAEA 3W3AH 3K6JA 4GI2A 2DSNA 1NVGA 3OA2A 2BH9A 2GD1O 4K6CA 4NCAA 2PFSA 3ITEA 4CT0A 4B3JA 1WVMA 2AGPA 2OGUA 3OWOA 4AT1A 2I87A 4ESVA 1Z2EA 4FZVA 4RIGA 1PEKE 3G8BA 4MRNA 2M6KA 1O94A 4UE3S 2C2OA 2PKQP 1YB6A 1OQAA 7REQB 4RPJA 3ZQUA 3L01A 5FWAA 4Q7LA 1T0UA 2HTEA 1V8DA 4HUQB 5EKDA 4IQ4A 4UUAA 8ABPA 4BQIA 2ZT5A 2I3AA 5LQSA 3BXHA 5DH9A 3S0JA 1WHTB 3STVA 3L7MA 4P58A 1ZHOA 1F38A 1EHIA 2QN3A 3VU3A 1B0ZA 5WRFA 5BR8H 4OXRA 2NTEA 1OHHD 3KWFA 2MINB 3E22A 1NBHA 3U39A 3CKMA 2XUAA 4RZ3A 1GNPA 3BK2A 1C3EA 3KPYA 2QLMA 1MB3A 4KI0A 3BA9A 3F3SA 3QXHA 2OZKA 3TLGB 2H3EA 5IF3A 5I7OA 2XRFA 2QM8A 4QODA 4CCYB 4MVXA 1QB7A 3PDWA 1R16A 4JI2B 3LXMA 2D6FA 5FUMA 1GYQA 6Q21A 1FUIA 1W8IA 1M73E 2MJLA 2O2YA 4G0NA 5IHXA 3VR6D 5G3YA 4X8LA 2XF2A 4A92A 4H6XA 4PINA 1KYQA 5JO9A 3FCUB 4M46A 5DNCA 4M0MA 3MN1A 2WFMA 3ZJTA 1Q7GA 4P8RA 4WLVA 1OWPA 2FCAA 2P9JA 3FFBA 1W0JD 1FSFA 3IP7A 3OHPA 5UKDA 3BERA 2BEUB 4KQ9A 2H1FA 2P67A 2CLOB 3PL1A 3S44A 1Z8NA 4W5HA 1YS2X 3IAS6 1ACMA 4DLKA 3T5MA 4M1ZA 4UHEA 2ZT8A 3URMA 3DFZA 1PWEA 1D2GA 3DCJA 1FUEA 2DUJA 4J16A 2ZYTX 3THWB 2OENG 4BFCA 1ZU4A 1VPEA 2YJ6A 1IBSA 3JQ8A 1CUVA 4JD5A 4K3UA 5AM3A 1B0AA 2QLBA 2PSEA 3U4MA 5C3EG 5KVVA 1NUSA 3DWEX 3B1WA 1KO4A 2ZRKA 1W4ZA 1TZMA 3Q4GA 1JXMA 2F3PA 1RYNA 2PKRA 1H0SA 2R82A 2OCBA 4R3WA 2RB4A 5E3HA 3NWEA 2MWMA 5DYNA 2DTEA 3WGUA 5IKMA 3CMMA 3W1GA 4B3CA 2Q5HA 1YMQA 1SBCA 3KEGA 1RI2A 5HBGA 1L4LA 1KYYA 4YRGA 3IKLA 1VB3A 3U4DA 4L0CA 4HRVA 4NS1A 5JRJA 1KY3A 5B1EA 3JQBA 2Q0XA 1UEIA 2PCLA 4YJGB 1XPJA 1HNXB 4GOND 2E4UA 1PJAA 1EINA 1UKCA 2LKDA 3RU9A 2RGRA 1YUBA 3UT6A 5G41A 3IJ5A 1G8KA 1U0JA 1I6MA 2JAQA 2W8ZA 3ZLUA 4X91A 2NQTA 2GDJA 3TE6A 1QO9A 4MUFA 4PXYA 1U1FA 5AW5A 3ZIDA 5DFAA 1P91A 1PV4A 5I4CA 3C3KA 4IMJB 2ZTUA 3FN4A 4LZPA 4CHGA 3R0ZA 3GDOA 2BLNA 4Q4LA 2B4AA 2C2BA 4M4SA 4QX6A 1I3CA 3L0PA 3AR4A 1ZSVA 2X2PA 1JQKA 3R5TA 4J8PA 2O2HA 4P7FA 5CDFA 1KMQA 3FKJA 1GOTA 4DQXA 2VJCA 4HTFB 2EX1A 2X0EA 4D3DA 5T14A 1E4GT 1MO2A 1Q77A 3ND6A 3IX7A 1M1UA 4XVRA 1MIOA 1R37A 4JLBA 1RLTA 4QOJA 3R09A 1H94A 2V7XA 1W25A 1O57A 4X84A 5DB4A 3UMFA 3L41A 4KEAA 4AF8A 4RPIA 3QVXA 1FBTA 3F5MA 1UOPA 3TZ6A 2I3GA 5J3JA 1LDBA 2WTEA 2JIRA 3R75A 3KZOA 3BWYA 4RSMA 3G89A 3IS3A 2MCTA 3L8ZA 3KQLA 2KSQA 2WUVA 1JPJA 4B46A 4YPOA 1NMZA 3HJTA 1XDWA 1MAWA 3BIJA 1GZ5A 4W63A 1GL9B 3MQFA 1XJQA 2WYIA 1MB0A 1E3QA 1Y9EA 2UVUA 1FIUA 4HDKB 1IHYA 3RIYA 4I7EA 1DLIA 4ALJA 1ZQ1A 4F46A 1FSSA 2XI4A 2GFHA 2BMJA 2Z1MA 2VA8A 4CV0A 1NBEA 4CIVA 4L74A 1IN4A 2HHAA 3CSUA 3MTGA 5DMHA 1RPAA 5I5TA 2CEKA 3F47A 2JI7A 2UVDA 2VNSA 2FB9A 5CT9A 4DMMA 3F49S 1E3TA 1IXZA 2FN7A 5BUCA 4LK2A 1Z5WA 1JVNA 4Y1GA 1EFVA 4TLEA 3FSEA 3LOUA 4QEDA 3LT5A 3K0AB 3EXG1 3LF1A 4YCSA 1BH6A 2OFWA 3FCXA 3ZWAA 2AN4A 2FFHA 4C2UA 1XLWA 5JMOA 1T9HA 1EVZA 4IGEA 4TQRA 4AZ0B 4GUAA 3MG9A 1UINA 3WGMA 3AVWA 2BWJA 2FMXA 4YN3A 1MXHA 4K86A 5D1OB 1AZSC 4L72A 1RXEA 3SQOA 4E5VA 3PTLA 3MJVA 3NXKA 1FNDA 1EXMA 2RGUA 4ZQHA 4KH1A 1QZUA 3A1TA 2N75A 4J2TA 1DKLA 1NRJB 1U0HC 4B1FA 4ALIA 1T1EA 3HA2A 4TS3A 4IIYA 4OLBA 4HZUB 4F6RA 4R1OA 1TWAA 2WSBA 1R4NA 4US0R 2WSSD 2I7CA 3LV8A 1YI1A 4L9RA 5H68A 5CJJA 3KU1A 3CW8X 2YCLA 2G82A 2AT1A 3L84A 2FLVA 3HY3A 1EE2A 4WLUA 2CVOA 3QMMA 1AX9A 3PL5A 1MZBA 5IC4A 5BSTA 3QE0A 4B8WA 2A3NA 4YB8A 3X1ZA 4JT8A 4PCLA 5TQ0B 5MHTA 3EBOA 4HJXA 3OEHA 1KVUA 1ZIOA 1USIA 4O2RA 3K70D 2GESA 4ZMSA 3DBIA 1LK5A 4GOXA 2DYKA 2X2FA 5AI0A 1D4FA 4ECAA 3SF8A 5A2QW 3KQKA 1TC2A 3F5FA 5FI5A 3LBNA 4AZTA 3HJHA 1OIWA 1E8MA 3O0TA 1N1MA 3RPEA 2HKIA 4FFOA 4FZRA 1UDRA 2O7QA 1DRVA 3QY9A 4PHTA 3EYAA 3WDLA 4BFTA 1R9NA 3VTFA 3EC7A 4DCSA 9LDTA 2WPDD 4DJTA 5LJLA 1MJGM 3KFXA 4DQVA 3L8EA 3RO7A 4R9NA 5ITZA 221PA 3DTNA 3ESAA 2Z5FA 4TTJA 2PZEA 3SS7X 3V8QA 4HHEA 3QBTA 3WLIA 5IJXA 4YONB 5K4HA 1X7ZA 3CUTA 3WIEA 4F0JA 1KOLA 4TT3A 4D9MA 2AWNA 1ND6A 2QAGB 3QPCA 2GSWA 2R8RA 1E1CA 4HH4A 1PAUA 1HMYA 4XPIA 5I7RA 1VQ1A 4PSCA 3T5GA 1RJQA 3HWRA 1XTBA 2RHLA 2Q3JA 1L5YA 2WIDA 1JIVA 5GIPE 3ORRA 4AMZA 1T3HA 1E1RD 2X9LA 2QGFA 1HQKA 4YX9A 3N07A 1XDBA 4ECEA 3K3PA 2I4LA 4CM5A 4Y2UA 4E21A 2QPAA 1TA9A 3LPDA 2E7ZA 1TRKA 2HPVA 3MLEA 1WUHS 1ZC4A 3OJEA 3ZWBA 1BTOA 4WVLA 2RGYA 3TFWA 3DL2A 2HL6A 4CN8A 1G17A 5K3CA 2QM0A 4UJ3A 5LLDA 4L3WA 4O4JB 3IO3A 4RQAA 4HBGA 3DXXA 1BHO1 2HDOA 3WR5A 3R7LA 4M3NA 1ISFA 3I2YX 3KTFA 1XHFA 1RQXA 4NPAA 1O08A 1C0EA 4O3NA 2JBWA 1EZ1A 1VE6A 1H5UA 3VNVA 2QTRA 3NGXA 3TQOA 1I0LA 4MWTA 1S03G 3L4SO 4K3VA 5C3UA 1JEYB 4FFWA 4EM6A 2QTZA 3I2IA 4LX0A 3GT0A 2ZRIA 1Z6QA 3LHKA 4FMCF 4IIEA 3PEEA 1UBCA 1T3GA 1RYMA 1Y81A 3NIDB 1AZTA 4KE7A 3SJBA 2GZSA 4DR5H 1KPGA 1JE1A 1U11A 3R6WA 3FA2A 1W0KA 5A3JA 4NABA 4MS1A 2ST1A 3VOSA 4H16A 3HCDA 1JWAB 3KEMA 2VDUE 3PB3A 4BV9A 3GTQA 3D5QA 4RCNA 4V1CA 3O82A 1DX6A 3V4FA 1JLMA 4LFCB 3A6DA 5FO0A 4NE2A 3OQIA 3C8ZA 1ULSA 4UEJA 1NR1A 3OEED 5E6UB 3GP8A 4J7UA 3H5WA 4X94A 3PE4A 1Z07A 3BA6A 2Q6OA 3UAVA 3OWHA 2IIQA 3JD0A 3I9JA 3WLJA 3PDIB 1K3UB 1R0LA 1JEOA 3AVOA 2B1GA 1PZNA 4IRKA 3IH5A 3PJEA 1KL7A 1NQVA 1YCFA 1R0WA 4D4MA 1OWNA 2X5KO 2B4YA 5KVSA 2CKMA 2OZVA 3OZGA 4J76A 1G18A 4X1KA 4DXAA 2AQ8A 3ETNA 2I6QA 3DD5A 3FETA 2HVSA 4BN4A 4LF6B 5KJCA 5BPHA 4I6EA 2UYGA 3EIFA 1VHQA 1G2PA 4RDXA 4JKYA 4JIGA 1JDEA 1BDHA 4DSOA 5F7JA 2XUHA 1BD4A 4B32A 3HCCA 4LWPA 4U0JA 1KAOA 3ORFA 2FOLA 3UBMA 1ZXBA 4RF4A 5I9LA 2X1MA 1I2CA 1ZOSA 2FUKA 1VKRA 5D00A 1F6DA 4IHAA 3UN1A 4M7EA 3M2PA 4NV3A 1GG5A 1OGIA 1ENZA 1TZKA 3HCBA 4CUZA 1TUBB 4BE4A 1ECPA 4MUMA 1N34B 4RPKA 2VP4A 1E98A 4CMHA 2BSQA 3KXKA 2JH8A 2X3YA 3DLAA 2HWKA 3O1LA 3DNMA 1K0UA 1M0EA 2WJZB 2GK3A 1E61A 5IYZF 3BXEA 4IJ6A 4B3RB 1E9DA 4C0KA 1K83A 2IEIA 4RTRA 3BCSA 3FYDA 5JZ9A 1UANA 3R41A 1RWOA 4NENA 5FBWB 1QR2A 4FIZA 1D6JA 3UG7A 2VJNA 4ZANA 2CC2A 3R7DA 2W48A 4HC4A 2PD3A 4PU0A 3ZXYA 4QPZA 1M34E 1LFAA 5EWLA 3EVEA 3UHAA 2QVZX 3E9QA 4J0GA 1UKEA 3ADOA 5FH9A 5KT6A 1S4MA 2NO0A 5BNFA 4ZVRA 3HFGA 5F2OA 5JALA 3TCKA 1T4CA 4R40A 3GJXB 3VNSA 1QC5A 1SIOA 3RGGA 1V9CA 2DIKA 4OKSA 4E2ZA 1N48A 4HL6A 4YUAA 3NHBA 1RQNA 3SU8A 2P5SA 2PMFA 4WFQA 1V48A 1YMUA 4H3KB 4L51A 4QEZA 4RAQA 4J9KA 3GJQA 1FTNA 3HKEA 1Z2DA 2ANCA 1JU3A 4Y2JA 1OLUB 3WC4A 2Z4TA 5HNEA 1SURA 3IUBA 4IIUA 5CB4B 4R9UC 4PYKA 3ABIA 3FROA 1KYTA 2QTVB 1XKLA 1YTLA 4CL2A 5EE1A 4GYYA 1LCIA 2GOYA 4EHIA 4QGGA 4O3FA 2CHUA 2R47A 4FMPA 3VNNA 1U4SA 4OG2A 4LHZA 5DLGA 5JE8A 3SX2A 4E4YA 4UNNA 3UWDA 3QQ5A 2XE6A 5FEUA 4QJ4A 2VAWA 2DWUA 4M1SA 3WLAA 4JVOA 2A9KA 3GD7A 4S1VA 2OMEA 1MO6A 1X7GA 2H4WA 5DMXA 1Z6ZA 1P3DA 5GONA 4D9EA 4AP9A 3BJRA 2QE6A 1QVZA 5EJ9A 3WL4A 2B61A 4DREA 5CXSA 1BFDA 5E95A 4DSAA 4Q4CA 1TD1A 1YDMA 3OCCA 3I0NA 1I1HA 1LUAA 1MAUA 1ESDA 4EW1A 3LKBA 1Q1AA 3DEZA 3LQ2A 2LWIA 3E7PA 4EPYA 3ET4A 5T4BA 1A3CA 4OHRA 1C8LA 5L95A 3I92A 3IESA 3ZE7A 1YZKA 1FQJA 1UAAA 4EO9A 3KZMA 1CEXA 5LD2B 2HPZA 1RP7A 5KKCA 5J40A 3TUJC 1NT2A 3OCYA 1T9CA 1AOXA 2C58A 5IT9W 1WD5A 5DI3A 5KNDD 5J23A 1FDRA 5L51A 3AW8A 1TUEA 5CLLA 5EE0A 4TYWA 4N0EA 2QN9A 4EF5A 1HL3A 1A4IA 1RSZA 3BWXA 2E49A 3AVTA 3ABRB 2CNOA 3UXYA 5COAA 1FFHA 3LK6A 1FFBA 1C9JA 1EZZA 4EG4A 3N5KA 3ZVKA 3M6WA 4QPCA 3KHSA 4M0FA 4X3OA 5G0WA 4RQTA 4HWKA 4ND8A 3NTLA 1SY7A 1PZHA 1FP2A 3NCTA 2G63A 4AWAA 1VGVA 3KAQA 3SQWA 3EZFA 5LYYA 4IIJF 4DCUA 1XXLA 4TM7A 5EHXA 5FF9A 1ECCA 1DKMA 4BKQA 4ZTBA 2R7AA 4CPDA 3IQHX 1WDTA 1Z4KA 4NDAA 1EHCA 3ZGLA 3N0TA 5DK6A 1KFKB 3K20A 3IAEA 2VA3A 3UMSA 2XOEA 5CM2Z 1V96A 1S3IA 3PK0A 4DV4B 2CNWD 1ZIPA 1SBIA 2JEFA 1K8ZB 2H17A 1CT9A 2GQ0A 3L82B 3WA7A 2NW6A 4XRRA 5HE9A 3LXUX 3N8GA 4XWTA 4EYEA 3C5EA 2JFPA 3UKOA 4PQGA 4MR9A 4UQOA 4KAFA 1X1EA 4W8GA 1OAAA 5FR1A 1AK2A 3PICA 1HSZA 2IWHA 4NP6A 3Q5EA 3ZD8A 2OCYC 4NFYA 1QRDA 3G3EA 2AFHB 2VDWB 1G291 4GE3A 4CETA 4CLOB 3H8VA 1B4DA 1A2OA 3P7MA 1N3BA 1W35A 1I4WA 3UCFA