2VPQA

Crystal structure of biotin carboxylase from s. aureus complexed with amppnp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
447
structure length
447
Chain Sequence
b'KKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLNIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKAEMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGFRMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEEAPSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVTEMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLAPGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIPFHIKLLNNDIFRSGKFNTNFLEQNSIMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYL-COA CARBOXYLASE
molecule tags Ligase
source organism Staphylococcus aureus
publication title Structural Evidence for Substrate-Induced Synergism and Half-Sites Reactivity in Biotin Carboxylase.
pubmed doi rcsb
total genus 146
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature ec 6.3.4.14: Biotin carboxylase.
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain
A PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain
A PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2vpqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2vpqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vpqA01
1PX2A 4DIMA 1UC9A 2OLSA 4DLKA 1KUTA 4XYMB 4YB8B 2GPSA 4TV8F 2J9GA 3R5HA 5J2TF 1DV1A 2DZDA 2YZNA 5LA6F 4HQ6A 3U54A 1GSHA 4EA8A 1EYZA 2Z02A 2C00A 1OBDA 4TV9F 1BNCA 4FFRA 4C5AA 3TW6A 3RUPA 1CQIB 1GSOA 3ETJA 4EAAA 2YYAA 1T36A 2ZDGA 1EZ1A 2W6PA 3BSYA 2GPWA 3V4SA 3OUUA 3ORRA 4HNTA 5JQWA 3UFXB 5KX5F 4O82A 5BMVF 5DMXA 2PBZA 2DIKA 1W96A 3VMMA 1ULZA 2QF7A 2CNVA 3QFFA 3VA7A 3VPDA 3JRWA 2NU8B 3WO1A 4O7NA 2YZGA 3DF7A 2NUAB 4MV7A 2VHEA 3VPBA 2R7KA 1GLVA 2CNQA 3TIGA 1OBGA 2X0SA 2R85A 3OUZA 3SE7A 1C30A 3KREA 4O7ZA 1PK8A 3GLKA 2W6ZA 1IOVA 5CAEB 3JRXA 5C8YF 4YJ3F 2NU9B 3K5HA 4O4IF 2R82A 4RZQA 5KKNB 4XZ3B 5GONF 3BSWA 1Z2PX 4HNUA 1B6SA 3WO0A 4ZHQF 1DV2A 2V59A 3ETHA 4TUYF 3RV4A 3RFCA 4XX0B 3KALA 3AX6A 2R87A 5H80A 5CA1F 3BG5A 3R23A 4XYLB 2ZDQA 3TIIA 2R84A 4MV6A 4EGQA 3LP8A 4IWXA 2VQDA 5CA0F 2R7LA 1A9XA 2XD4A 4YAKB 4Y8VB 4O7LA 3R5FA 4O7TA 2YRXA 2CQYA 3R5XA 3I12A 5C1OA 4YBZB 4C5BA 1Z2OX 2PN1A 4IWYA 3JZFA 3G8DA 3HBLA 1JDBB 4O2AF 2V5AA 1KBLA 5BPFA 1UC8A 5CB4F 3BSSA 1WR2A 4MV3A 1M6VA 2W6QA 3HO8A 4NYEA 2VR1A 1CE8A 4GGMX 5LXTF 4EGJA 1M0TA 4O4HF 5IYZF 3Q2OA 3N6RA 2FP4B 4MA0A 2YL2A 1DIKA 4O4JF 2ZDHA 2GLTA 4FFOA 1BXRA 4E4TA 4M99A 4WBNF 3GIDA 3R9RA 4ZI7F 1VBHA 2IP4A 1C3OA 1CQJB 3U9TA 2R7NA 2P0AA 5HBRB 2NU6B 5JQGF 3MWDA 5K2MA 4FGRA 4EG0A 4O7YA 2YS6A 4MAMA 1KJQA 2I80A 1A48A 3E5NA 3LWBA 2W6NA 1KJJA 4FFMA 4MV8A 4HR7A 4C5CA 5LOVF 2SCUB 2V58A 3MJFA 3G8CA 4ZOLF 4O2BF 4O81A 1EUDB 3VOTA 2HJWA 4IHJF 4M98A 1M0WA 4M9CA 4O86A 1I7LA 5EZYF 4EA9A 2W6OA 4IIJF 3MWEA 3N8DA 1E4EA 2YW2A 5LYJF 2W6MA 1KJ9A 4WD3A 4EA7A 1JDEA 2GQSA 3NUAA 4FFLA 2R7MA 1EHIA 4I50F 5HV6A 1IOWA 2YZLA 4O4LF 3Q1KA 1Z2NX 2FPGB 1VBGA 2WYOA 4MV4A 2YWVA 2CNUA 5C1PA 1KJ8A 3WNZA 2I87A 4O7WA 1KJIA 2FPPB 3KAKA 4J6EA 5LP6F 3AW8A 1EUCB 3K5IA 1I7NA 3RV3A 5D8DA 4O7RA 4M9UA 2GQRA 1W93A 3K3PA 4HNVA 5JH7F 2R86A 4MV9A 4FFPA 5I47A 3TQTA 3BFPA 1GSAA 2QK4A 4O7SA 1JLLB 3U9SA 2NU7B 2VPQA 2FB9A 2W70A 1KEEA 2HGSA 2YZMA 4O7VA 2YRWA 1CS0A 4L1KA 2CZGA 4O84A 2PVPA 4MA5A 1AUXA 5BPHA 1SCUB 3HB9A 4YAJB 1AUVA 1VKZA 2DLNA 1KC7A 2R6FA 4QSHA 3TINA 1JKJB 4YJ2F 4FU0A 4FE2A 4MV1A 3U55A 3V4ZA 3VPCA 1E4EB 4IZOA 4I55F 3KAJA 2NPOA 5FNVF 1GGOA 4EABA 5JVDF 2Z04A 3ORQA 4FFNA 5JVLA 4ZQIA 4O83A 4ME6A 2I8CA 2YS7A 5J2UF 2FPIB 3JZIA 4I4TF 1B6RA 2W71A 2DWCA 2XCLA
chains in the Genus database with same CATH superfamily
1A77A 3NBYB 4RNOA 2R96A 1XVLA 2XUGA 4DJFC 2UVVA 2FSPA 3IBCA 4TSKA 3V1YA 4IH1A 5KUTA 2PMCA 3PEVA 4PWQA 2Q29A 3E5RA 3PT9A 2XDYA 4OSEA 4UCXA 2F8TA 1F2DA 1IB6A 1CRLA 1UPAA 3H8VA 1OASA 1KQFA 1NM5A 4HGPA 1P74A 4AJLA 3TW8B 4EB3A 4EJSB 2I3GA 1HC7A 2H7YA 4PC1A 4R1MA 3ER9A 3B3AA 2D4AA 2J9GA 4KXUA 1RPZA 2AC4A 1O94D 4X66H 2VDKB 2CBGA 3QJ5A 4DDMA 5KX5A 1J1IA 4KQCA 2MR5A 3UBMA 5F7JA 5FLMG 5CM0A 2Q9AA 2WVJA 1QKKA 3OD5A 3FOWA 3I58A 4EA8A 3PEWA 2X0JA 5HOQA 1P1RA 2BWJA 4ZZ2A 4LJ9A 2HSJA 4C06A 1CEYA 1A7KA 1XF1A 2GBGA 3BJMA 4J4BA 4ARVA 3BQMB 4Z7JA 2VPPA 1MC1A 2Z2YA 2YIJA 1FNBA 1NQTA 4PS0A 1NJ6A 1TF2A 2QRNA 2FPSA 2J9FA 3D6MA 3TH5A 1NNEA 1CZNA 1T36B 2FPUA 4JV5H 1MA3A 1S2DA 2DQZA 4LSZA 2OB1A 4P8RA 1B14A 2DTDA 2B8JA 1FL9A 2P5TB 4OREX 3ICCA 2VDVE 4F6RA 4JI7B 2HIHA 3BD9A 3O9ZA 1M83A 5JDIA 1F38A 2AN9A 3H5NA 2JK0A 4JLKA 5JCJD 4EQ5A 16PKA 3VR3A 4M7EA 4FUQA 5KX5F 3KHSA 1ILWA 1XTZA 1Y9AA 3AF5A 1ZUNA 4NMLA 1IXYA 2DY0A 3UQZA 2F43B 2H0RA 4ENWA 4OYLA 2KB0A 2ZRBA 3PD1A 4HVTA 2GD6A 1E1LA 1RYZA 2J9RA 3KZ1E 3PNQA 4JUBA 5DBFA 1H6CA 1NYQA 4LV8B 3STTA 2C92A 5EKXA 3DHWC 5JV5A 5KTPA 1Z13A 2FN3A 2QT9A 4TZKA 1JIQA 2G82A 3SR4A 4E14A 4DQKA 1HNZH 3L6OO 3QEKA 4JQCA 4KQEA 1XRSB 1A9ZA 3ZX5A 1X39A 1JR3E 3GV7B 2VSYA 2WC1A 3O3MB 3R09A 4MVJP 1W35A 4ZOLA 5JAIA 4IDPA 2X9LA 3PNVA 4L51A 4UAUA 2WHEA 3SVZA 1SBQA 1GAJA 4YK7A 3AM4A 1QQAA 1L4KA 1XRMA 2XJ9A 3AERA 5IXSA 3WAGA 1J5EB 1UH5A 3S1AA 4IJKA 2R7KA 2PLNA 3ZWQA 2D2XA 3CKKA 1JAHA 4RIFA 3Q7PA 3F9RA 1FYEA 3HYSA 1S89A 2YVQA 4QREA 2O8CA 1OBGA 3S8YA 3ZWVA 1DXYA 2EGGA 4LYEA 3RK1A 1UBEA 1BRMA 3KREA 1SOWA 1AGXA 5FWYB 2XVYA 2Y1FA 4BVHA 4I1VA 1U7DA 4K9SA 4IAOA 1DHTA 2WE8A 5ECWA 4YMIA 2L82A 2FF7A 5JCOC 4OHCA 2VTDA 1MR3F 3KELA 4PX3A 1JJFA 3GH1A 4CRWB 1OIVA 4BV3A 4MUXA 3MJVA 5JD5A 5IANA 4ZT5A 3V8EA 1VKJA 3K0AB 4MS1B 1DXHA 3IBTA 4ZPXA 3CIFA 5CNKA 3M4XA 4ZYLA 3G8AA 1OX5A 4DSOA 1PKEA 5IAAA 1QTRA 4B3MB 2HY7A 3DO5A 1DX4A 3V8QA 1AN7A 1E1RA 1WW8A 3ML1A 3QE3A 4UOZA 5FPSA 4N0MA 1EWQA 1RWNA 2H07A 1NSTA 3M5WA 3L79A 4LDQA 3AH8A 4WHXA 3NOVA 1U0SY 5K6AC 4EPXA 3U60B 3BXPA 4XX0A 4XX0B 2JLAA 1V9SA 1VJGA 3K09A 3KALA 3GJYA 4IHJB 3HVIA 4QQKA 1U7UA 4KEAA 3VH3A 1WCXA 2Q8PA 2Z56A 9GPBA 2WY2D 3X2FA 4IEIA 1GGMA 3A1EA 4YASA 5GJWC 1V8DA 2A14A 2IIBA 3B1ZA 5JALA 1HPLA 3T1HH 1VXOA 1XGKA 3R23A 2GDZA 2BGTA 2D0OB 4PWZA 3DP9A 4Q9AA 1NATA 4C76A 2Q3MA 1XKXA 1UEIA 4DLAA 1AH2A 3C1UA 4HDRB 4ICIA 4UE6A 4KNYA 2B78A 4GR4A 1MX3A 3B8EA 4RUKA 1WABA 3KWMA 3LX5A 1JTVA 2FSUA 3A1WA 1V5IA 4RSRA 4Z0TA 3OZGA 3I92A 1U7TA 3CUEF 4OHZA 3UZBA 4OMUA 5ABPA 1BGWA 4L57A 2QE7D 2H8KA 1SQ0A 1VMDA 1U8ZA 1IAQA 5FUMA 1SKYE 1LRKA 4HAUA 2AQ8A 3RVMA 2HSWA 2HCBA 1Z7BA 2XHZA 1S2NA 4O7TA 5IYCG 4IFBA 3SP1A 3PWKA 3P2MA 5L1JA 4A6XA 4PRLA 4YC7A 3LXRA 3MEQA 3UHAA 2E4AA 5L45A 1S03G 2IEBA 4G0OA 1AURA 1LBEA 1X92A 2WYWA 4B4VA 3G1TA 3UXHA 5DG7A 2Q07A 2WT8A 3KE8A 1IOZA 2ZE8A 4O2LA 1M8GA 3NWJA 1IONA 4MQFB 4QPZA 3L2OB 3NP7A 3F8SA 4JZKA 1EXDA 1TIKA 2BBSA 4FZRA 4RD1A 4W9RA 5CP8A 1V39A 3DMDA 1H6DA 2H2WA 4IO1A 3UMCA 1KETA 3Q8RB 3ZIAD 2KW5A 2OESA 1BOFA 1VJ5A 4FOPA 4FMCB 1SMKA 2AR9A 1D07A 2WMOB 1FMJA 3OJLA 4KMMA 4DR7B 2EFJA 2ATLA 2GZ1A 3I01A 3O95A 1QNLA 1JLHA 1QR2A 1WXQA 1FFSA 2YFKA 4C4SA 2DHCA 4UMDA 3AP3A 3SQMA 3C16C 4L0CA 4F97A 4JCCA 1P81A 5J5VA 4MV3A 1ZJ4A 2J4DA 4BQSA 1RKVA 3BRWA 2CDNA 1ELOA 3I53A 3OCCA 1VE3A 3BXXA 4EEKA 2F67A 1BHSA 4AJPA 3PT5A 4WXYB 1R10A 5DU2A 4BMSA 5MDHA 4II7A 4CMEA 1PFWA 2BIFA 2ZJ8A 4GNKA 4NBRA 4AG5A 4EGJA 4YJKA 3CVVA 4GLFA 2IU4A 2JLWA 3EA5A 3NBKA 2ADMA 4QDJA 1K4KA 5HKAA 1OGIA 5KHOC 1RRVA 4X6YA 5LKRA 1UZAA 1OXVA 3FCAA 3FYUA 1D2NA 3I9V6 3L7IA 1MJHA 4XVRA 3MGAA 2PSSA 4AI6A 4ZRMA 4Y1FA 3DKVA 1V3QE 1VHLA 4AJEA 1WE2A 1ZUD1 1U28C 4KQFA 5KNDD 2JAXA 1Q7EA 2WFZA 4JJEA 3FYDA 1PJLA 2BE7A 2GPYA 4Y9UA 1ZMRA 3DCNA 4NG4A 4LBWA 4F3RA 2QTWB 2I4RA 4IX9A 3H6KA 4IV0A 5IM4A 2VDNB 1RM4A 3AY3A 3FCXA 3OQNA 3BWCA 2B35A 3KR2A 4EKYA 2BDUA 5J4KA 2E2IA 3PR1A 5JAQA 3W77A 5EPOA 1YDEA 3CG4A 3EY4A 3FGZA 2ZPAA 2C7GA 4FOLA 2BF7A 2C4VA 1Y98A 5AXBA 2VYVA 2Q8NA 1MX1A 2G72A 3BIXA 2BJWA 5DTIA 1VDMA 3ENVA 5AI9A 1JH8A 2A3RA 2BFCA 2SBTA 4QO7A 5CD1A 1RZ3A 3F4KA 4ZTZB 1GGKA 3OM0A 3CN7A 4U0JA 1YVUA 2A0KA 1PJQA 4A2CA 2HWKA 3WMEA 3B1FA 1F4LA 2JLRA 2BKXA 3EFOB 1QRTA 1F3OA 3IQGX 4MB0A 3U4AA 1YJBA 3FUCA 4QRHA 3WLNA 4E51A 5HBGA 2VQFH 1XQ6A 2APJA 4WE3A 2J6TA 3LCRA 1RI1A 3A6HA 3GNQA 5K0ZA 5KIAA 4CMHA 4UAVA 5L6LB 1SYXB 1RWWA 5FL7D 3ZNQA 3CLVA 1QMGA 3ELUA 3SKVA 2H00A 5AR1A 2XEXA 5K3BA 4AN4A 5JTTA 1H4VB 5EESA 2WTMA 2XE8A 3DYIA 4GI7A 1SG6A 2MYNA 1X13A 1YT5A 3T5JA 2WKSA 2ZQ5A 2H4WA 3UPUA 1J0BA 2CF5A 2WUEA 4NMXB 4PLYA 5DM60 1VBFA 1GRRA 1UPFA 4D98A 1H2BA 1DRWA 2QLMA 3SEQA 4FFMA 4P38A 3SQDA 3F5SA 1AVTA 5CJJA 2OR3A 2XNCA 4EEQA 4MRVA 3W2GA 1UPTA 4EPTA 1T1SA 3E7XA 4BOYA 5LOVF 5IKMA 3SGIA 2VQ6A 3BMNA 4IJUA 4NCIA 3P9NA 1JPNA 5DLGA 4D79A 1FX0B 3BMCA 5TMPA 5G3ZA 1P5JA 3KEOA 2YN2A 2HJGA 5EJIA 2WE7A 4GQAA 5AW8A 4RY8A 2GAAA 3WNCA 1V5EA 1D2MA 3UC9A 4FNMA 1A04A 4DLSA 1KO7A 4MQ5A 2P9ZA 2X8BA 2RCNA 2XUOA 4HCJA 1H8HA 4R40A 5E4YA 2CL0X 3T7IA 4A0QA 4D74A 5A4IS 3T3DA 4NSNA 1AMNA 4CL0A 2CJXA 2HA0A 3NC1C 4KWEA 3JD3A 4LTNA 4RY0A 4EGFA 2I76A 4YP3A 4KGDA 2HAEA 5GONB 5DPMA 5FV7A 3HKCB 2NTJA 4IHAA 3BXOA 3H6GA 5TT0A 1FDOA 3WL6A 5H3HA 3DYVA 3GC6A 4PSVA 2XIJA 1H05A 4Q1CA 4XA8A 1CUBA 2AGPA 4G4SP 4A3BG 1DC8A 3RFUA 3PHGA 3Q1LA 5TMDA 4ZYYA 3NV9A 2VWQA 3C6ZA 2VPSA 1V2GA 4KQ9A 4PTYA 2ANCA 3MHPA 4IVQA 4RD3A 5CE8A 1FP4B 4BV8A 1D8AA 2Z5LA 3PK0A 3MJ4A 4XXHA 1DKOA 4JLBA 4BEJA 1KL7A 1RADA 2XNJA 4XYMA 3U5ZB 3UEOA 2Y0EA 5F9LA 3OT1B 4YR3A 4KO1S 1GRCA 2O4CA 5I51A 5J4VA 2RHTA 2ZTHA 3I04M 3GAFA 1AQ6A 4H7FA 5AK4A 1PJBA 1T2UA 4KQ1A 1P7VA 1A4RA 2DTXA 1KSHA 2FPGB 1AUPA 2HC9A 2NU9A 4MS4A 4DA7A 4UD2A 5KTRA 2P0EA 4DA4A 3FVRA 1Y7IA 3ZLVA 4L5JA 1EXVA 3SDZA 1CW2B 1TYAE 3B5IA 3I72A 4ND5A 1J24A 4UOEA 3U3XA 1TTTA 2QR2A 2YASA 4NV0A 1D03A 2JF0A 2ZB8A 4R9NA 2H8GA 2I4MA 3RAGA 1KJIA 1FS4A 1U4NA 2EFYA 3FPEA 3FTNA 4U7JA 4DIOA 4FHCA 3PFNA 4FS3A 3REFA 1N0HA 1X7XB 1WDWB 3AW9A 2XQGA 1W85B 1WWKA 2G70A 4KRYA 1V3TA 2I9PA 1OWNA 2HA5A 3O5AA 3ADBA 4W5NA 1Y1VG 1EWTA 4KTTE 4KHZA 1T3TA 5D8DA 3LUPA 4N54A 2QM8A 3MXTA 4H1WA 4QDOA 4MS4B 1YZNA 5C18A 2J3IA 1CFZA 5JATA 4FE7A 6CHYA 4BV2A 1QXSA 3BGOS 3GJ8A 4A1OA 2GVDC 3FWKA 3IOBA 3MGBA 3VH1A 3UHJA 4FYVA 4EY5A 1QRSA 1PFUA 3VKVA 2P0YA 1JR3D 1S0UA 1F6DA 3O2QB 3RTCA 2JDID 2AOUA 3K15A 4ZV9A 1JLRA 4K0KH 3REGA 1TZKA 1YB1A 4IPTA 4Y7CA 1HDRA 1QVWA 4O4HB 5L9XA 4CQJA 2G77B 2Q45A 4NQZA 3AR4A 1EFLA 4IKPA 3LQSA 1GL7A 1NMZA 3T3NA 1WDKA 4BNLA 5JU6A 4NFSA 2XUJA 3RHFA 3FOAA 1RABA 2I3DA 3BRCA 4O5AA 4V0QA 3I37X 3W9BA 2Z8YM 1TT7A 1W59A 3HY4A 2B2XA 2PX0A 4PYRA 3ANNA 3L7MA 1Y1QA 4QO8A 5G3YA 5KYWA 3LGSA 1CZKA 5CNIA 1KSGA 5SZHB 4MQBA 3KQHA 2RGWA 1SEIA 2HMTA 1LEHA 4QHTA 1TO6A 3EFOA 2PKCA 2GEBA 4F5EA 2ZBDA 4AG3A 5J63A 3MJTA 4UTPA 1OA0A 3C8MA 1V8PA 4PZEA 4WJLA 4DJAA 5BPHA 2EBFX 5MN6A 5CLLA 4O3QA 2BKEA 4OK6A 2RIRA 4O08A 3JWEA 2LCQA 5K6RA 2V4QA 3QE4A 4TOIA 4NJMB 4XZ3A 1T6NA 3VDQA 4Z8YA 5GJBA 3DMGA 3FHCB 3QKSB 2P8JA 3OX3A 1FSPA 2ES4A 1TM2A 3E7PA 3D4IA 3GT4A 3RBAA 1OIXA 1UCFA 2VUMG 1WD7A 3I2JA 3OJCA 2KLHA 3CC8A 1H6AA 1V1RB 1Z8DA 2OFFA 4QAQA 3QG5A 2HM7A 2VQSA 3LP5A 2PMZA 1E4EB 3OJFA 5AOBA 1K63A 1X1DA 3I1YA 2BI8A 4OQPA 4LDNA 1LRLA 4PS1A 1YQTA 1GT91 2PO7A 2VKQA 3TY8A 3MWMA 3L4JA 3PQ4A 4M46A 4FXOA 4QDKA 3HABA 1OPXA 4YP5A 1OYOA 1CUHA 5DIFA 1G5QA 1ODSA 4FDLA 1R15A 1CEEA 2AX3A 3K2IA 4UBJA 3ZQ6A 4R01A 3ZXIA 3SSNA 3N2IA 3W5OA 1J8MF 3ORQA 2R8KA 3TAUA 2C4KA 4B3RH 3LM8A 3OJXA 1EESA 2VH5R 1J49A 3MJSA 3PIDA 3BDAA 4IQ0A 4ER7A 5ICEA 1UWLA 2UV8A 5LXTB 3OLXA 2C5AA 2P78A 1UOEA 2PO5A 3MTEA 3L7YA 1QV6A 1W47A 2FUNB 1A9TA 3LE8A 3WB2A 2XQFA 5FL7A 2VJMA 1DTSA 3U4QB 4I4TF 4UW9A 5DGCA 1PSDA 3DAAA 1LSSA 3U1BA 3KJZA 1JV2B 3MAJA 1IHXA 1UR5A 2VA8A 4TV9A 3LY8A 5AVTA 3HUDA 3VDRA 3UFBA 4YI3A 1V1MA 5GADl 1IBCA 3DWEX 2PV7A 2D62A 1FQOA 2EF0A 1PEAA 1RACA 4LGYA 2Z8XA 4DEVA 1IJEA 3AFMA 3HM9A 2BI7A 2VHXA 1Z17A 1Y3BE 2O0MA 4QQRA 5REQA 4QJFA 1GKKA 4MGKR 1A82A 1SBIA 3FHOA 1VLJA 2BUCA 4YPOA 1E6MA 2ENUA 3QU4A 4NCBA 1DT5A 5JFOA 3S2YA 4HNAA 3TTXA 1EZZA 2AHOA 5F7OA 5LWHA 2HW8A 4QJ4A 1ZW6A 4WNAB 2H18A 1U9CA 4XFKA 1I2AA 4DR4H 5FPHA 4IFTA 2ZAYA 3O31A 2YZNA 4JU9A 5G1PA 2XB9A 4XJVA 2Q5CA 3AI7A 1NOJA 3BFVA 1MJ5A 2NUPA 3E27A 4MKRA 5IN5A 2V3VA 4NQRA 1NE7A 5D5HA 3C6BA 1HL3A 3UXYA 1KI3A 2O2CA 4LW8A 1DB3A 5GONA 1E1QA 1FU8A 5I4CA 1R8YA 4ZP1A 5LBTA 3S0JA 4HOYA 1AG9A 1CULC 4KQ6A 2QVYX 2C2HA 4LECA 4MQEA 4QNNA 5F73A 1C7FA 2VZLA 2XGPA 3EOAI 1BXRB 1J8VA 1TAQA 4JEMA 5ALNA 2PYDA 1GUAA 1ZPDA 2DWPA 1KY3A 1RI3A 1GCAA 1YL7A 2CLSA 2WWXA 3EZXA 3MTDA 3QGMA 4GPAA 3IHLA 2QTRA 4AY3A 3S81A 3ZZMA 3EEOA 1KH3A 4D4GA 2R2AA 2J5BA 3DHEA 5THXA 2I2CA 3UJ9A 4Q03A 2P91A 4A16A 3M4ZA 2HIVA 2TYSB 1EK6A 2FYTA 4Q93A 3VAYA 4O82A 1EFKA 2OFPA 3ZVLA 3SYLA 4FJ1A 5C5DA 5JMTA 1ZWKA 1GPLA 5SZIA 5HZHA 1LH0A 4WTOA 5TQ0A 5MHTA 3U4GA 2CNVA 3SZ3A 1FPQA 2A1HA 1TK3A 5GOTA 5BYAA 3KKOA 2IYEA 4DR2H 1DKMA 4NARA 4OQNA 4ZEXA 3WE7A 4LFAH 1PWEA 4A15A 2JATA 3N7AA 1MX5A 5IBPA 1S3SA 4O8CA 4G9BA 3V1LA 3ADCA 3I32A 3HCFA 4F45A 1H0RA 1NDUA 1TAGA 4IYJA 1CY0A 3Q0TA 3F6CA 1E2KA 1GV0A 2AG8A 2HPAA 3RRYA 4H1TA 3F5DA 1N2ZA 3CMMA 2WWFA 1F9EA 1OLSB 4MWZA 5B5SA 2JJ2A 721PA 1FSZA 1E5XA 1FLDA 3EQ6A 5C4GB 2VBFA 1C9JA 5B3LA 4OK5A 3EPKA 2C4MA 2O20A 1O89A 2OCIA 1FP1D 1OFUA 4DXAA 4EQ6A 3AF6A 4DSAA 4YRKA 5HK9A 4QBIA 1GCOA 1GU1A 1ZA1A 5B1DA 5CYGA 4BBAA 4EX6A 3PVXA 3FH0A 3FJ1A 4OXYA 3TCNA 1PR5A 3C5EA 4WWHA 1UBFA 2G04A 5DGTA 2Z98A 1YGPA 2DHRA 3I4FA 4L3WA 1SHKA 1P9OA 3VR0A 5BN4A 3RVNA 1RMQA 4NK5A 1I4TD 3GLUA 2C29D 4HZGA 2HWYA 3HDJA 3UMYA 1CP3A 2I7VA 4PVCA 4U02A 1F8YA 2C9BA 3UAZA 2C22A 3BGDA 4RGYA 4Q9HA 3OFVA 1TXGA 1ZM9A 3GT7A 3S40A 3GCXA 4ZMRA 5F52A 1EIZA 1XHEA 2C99A 4KODA 3VNUA 5FUVA 5YASA 4DV4H 4L8GA 3ENZA 3OEYA 5A06A 1Y8AA 5JQGA 5FNZA 3IKMB 3LA6A 1UFQA 8OHMA 4JLJA 1U2ZA 3ZLTA 2EATA 2I3ZA 3CLRD 2PS0A 1UPCA 4R9RA 2OXFA 1H2XA 4N65A 3BUSA 2W4QA 4RA6A 4RA6B 3S2FA 1ODTC 1T5IA 3CQ9A 3U4HA 3UH0A 1I50A 1UZNA 1NNI1 2F3QA 4WOPA 2E89A 1G9XA 3FE2A 4N01A 3EPGA 1KE1A 2ZAGA 1CUYA 3R40A 1V16A 5C8VA 4U7HA 1RQXA 1SB8A 2PUWA 2GCEA 4HB3A 1QYCA 1R6AA 2Z8YA 3O74A 5EXEA 1NI4B 1IWPB 1UF9A 1JQJC 1ZD3A 4JFRA 4KMOA 4L15A 3U62A 4YRIA 2JI6A 1XELA 3H3FA 1IEWA 3DOOA 3PWSA 1AK1A 4MIKA 1G0NA 1UADA 1FVOA 3JQGB 1FK8A 3EJWA 4OOFA 3R5FA 4YRJA 4A8HA 2PSHA 4IDOA 2C97A 2BM1A 4BN4A 4IXDA 5LP6C 4CF5A 4GZ3A 2ZS9A 1UBUS 2VQFB 3Q0IA 4YBZB 4YRBA 5K2OA 1A2QA 4EBEA 2OM6A 3M9LA 2KJQA 4MUAA 3VZSA 2HA7A 4U7FA 3YASA 3R7WA 3SQNA 3PEFA 4FCVA 2ZRKA 3KV3O 1U04A 1WSWA 2FX2A 3HACA 2WUGA 3QX7A 1A76A 1XJWA 2NU6A 3D6FA 2W22A 3JQEA 3M4YA 4LMRA 2GXAA 5JNUA 3JAWA 2O3TA 5MFPA 1V6SA 1VDZA 2BISA 3GF4A 4KPEC 2HRDA 3B2NA 1OLXB 5D1OB 5FR2A 1SJ9A 2D8MA 2W6JA 3O8CA 1QWOA 1L0BA 3OICA 2E21A 3KO8A 3FSJX 4NNOA 3EUWA 3FGOA 4QE3A 3O73A 4OMDA 2CJPA 5JHGB 3VTFA 5FOUA 1WZ2A 3J7AC 3RR2A 1X3LA 2IBMA 4EO9A 4KHPB 1HTWA 3DTNA 4A8JC 2C57A 1G5IA 5BQPA 4CQMB 3R6DA 4O8ZA 2ZVQX 1E3TA 1WF6A 4YVFA 3W3AD 1ESCA 3ZN2A 3F6SA 2QRKA 4EMTA 4F06A 5CCXA 1UJ4A 1J9GA 3GQCA 3ETLA 3L1UA 1P4HA 1M6WA 4GGMX 1J70A 1RBMA 1CIPA 4UUPA 1NGSA 4F21A 2CN1A 5DM70 1Y6ZA 4F5WA 1T4BA 2VPIA 2C54A 1I4LD 2IUTA 5NLLA 2XMZA 5IYZF 2R6GA 3A4LA 4QPDA 5K0GA 1F5SA 4M1ZA 3TN7A 5DOZA 1X9IA 1Y5IA 3VR6D 1XZLA 4ZQEA 1V41E 2XUZA 4EBCA 5TVGA 5HQTA 3SK0A 1CF9A 2GN9A 4JLSA 4OX9B 2FHSA 3HL0A 2NGRA 4G67A 4V2IA 1ADCA 3IVMA 1MRSA 3EQZA 1PZGA 4EKEA 1P75A 1XTTA 2BFDA 1PLJA 3H5OA 3OPYB 4UHFA 4QUKA 5EQTA 2G1UA 4KE8A 1M72A 1XTJA 3L8GA 2O8BB 5ELXA 2YWFA 1GITA 4OM7A 2OG2A 2DB3A 1E0DA 4M99A 4G0VA 1QLJA 1P4SA 3JARB 3UV7A 1GTSA 2W43A 3FAZA 5GOZA 2V3WA 3A1NA 4EQ6B 5BWNA 3C4JA 3N2KB 3M2TA 3VKWA 3QTBA 4U2DA 1PZNA 4DJJA 4QLBA 3TDNA 1O5TA 4EY3A 1Z0UA 3RGZA 2UZ1A 5DI3A 3QE2A 2B4RO 4DMGA 3F1KA 5B3AA 2AH5A 3H1AA 3DM9B 3Q8WA 3VNSA 3HU1A 2VXOA 1IH8A 3O9VA 4ZALA 4TYYA 4ALJA 1WCIB 2EGHA 4DTCA 2NYRA 2QVZX 4BRZA 4YR9A 1P8JA 2PUJA 3QWIA 1SRQA 5HR5A 1Q16A 3ROKA 1D5WA 5C44G 3NDJA 4NOLA 5LZ9A 4JJGA 1LLFA 2DJ5A 3KQWA 3KQOA 3QBDA 4HGZA 3ANMA 4ND6A 1L1FA 1JHVA 1XD2A 4F4YA 2OORC 4WK6A 3KD2A 4YRPA 1R4MA 2W8BB 1HDCA 1I6WA 3CEJA 3Q9UA 4U5XA 1X1EA 4MCIA 3VHQA 5CDSA 3DHYA 5AO9A 2ABJA 1E99A 2W4MA 4KK4A 4R6WA 1SC6A 3RIYA 3T61A 4B6QA 2WF8A 5JROA 3QPUA 1XRQA 2WTXA 3OHPA 3IUMA 3U19A 1KJJA 2PRZA 2CW8A 1C30B 4XLLA 1LBTA 3H0CA 4AL4A 3SYNA 1G3QA 3PFCA 5FUBA 2PHZA 1VGQA 2GTIA 3GJQA 4FYKA 4JXJA 5DBOA 5E8RA 5F7ZA 2MCFA 4D9NA 3WK6A 2VS1A 2PLWA 3NALA 2G80A 4BMDA 3FTQA 3STWA 1I1HA 2V7QA 4IKOA 1W5BA 4EITA 3G8CA 2R751 3NHMA 1E7YA 2B6NA 4MUNA 3STUA 1O96B 2G7ZA 1FA9A 1V5FA 4B3BA 1G55A 5C8ZA 3K96A 1M2OA 2GRUA 1XA0A 4PIVA 5ALSA 2XQJA 4I3GA 4B87A 5GIPE 1UWVA 1RD4A 4GUAA 1G1MA 4GXQA 3L07A 2AYXA 4EMUA 5IPFA 1TPYA 2XODA 4EI7A 3AOEA 3K9BA 1X38A 4JI4H 2CUZA 2PKWA 4G01B 1JFSA 4Q7LA 2Y27A 4R71A 4W8OA 4CQNA 1BGVA 3HA2A 3DKKA 3EAGA 3MWEA 2YNMC 5KVVA 2H1WA 2UYOA 3MTIA 1W5SA 1IM5A 1VE5A 1WZNA 1NRWA 4YAEA 3VYVA 5ALKA 2ADFA 4GKKB 1MC5A 2DKNA 2XVMA 4MDHA 2Q0SA 1JDBC 1T5HX 4TSFA 4B73A 3TK1A 1NKTA 5CA0A 3LDUA 1A95A 3NQ41 4MTLA 1GCIA 4KMRA 4D8UA 4D0SA 4V38A 2JEFA 4YAUA 4H6XA 1KI1A 3D7MA 1SXQA 3NW9A 1U3VA 1Z45A 2Y0CA 3QOWA 5AK0A 1HNWH 1Z4LA 1TJ4A 4YGYA 3HB1A 5DBEX 3V1TC 3W4IA 5FUQA 5IN4A 4HNGA 4FYJA 1U0TA 2ASDA 3M5DA 1EHIA 1JJ7A 1Y9ZA 3GVXA 4P2GA 5TT1A 4CLOB 2JA7A 2JIOA 3WJ2A 3KSDO 4P5EA 2GF9A 2ORWA 5AI4A 5IU6A 3Q1KA 4RTJA 1NWCA 2B63G 4C3VA 4ECQA 4HZUB 3L8MA 4YP9A 3ZWNA 4GP9A 5IKEA 1X19A 2ZQYA 3JVEA 2OZLA 4ISBA 4S2EA 3S99A 3JQRA 3ZU2A 3BEDA 2CD7A 5LMNB 1DAEA 1YFZA 4KK3A 2O52A 3MCTA 4TTPA 3U3DA 1M5TA 4PO1A 3SN6A 1ICIA 3BWDD 4BRUA 3I0NA 2I4OA 3VTAA 5LQKA 3UT0A 5I9IA 4E6PA 5ALUA 1NP6A 2B8NA 2PCJA 1PDWA 2LXNA 1MABA 3OIDA 1D1TA 2E0IA 3EGOA 5DLDA 1RKXA 3I6BA 3EEYA 3EIQA 3P5SA 4RETA 3G17A 1ADGA 3J81k 1WUIS 4B3FX 1Q0PA 3PC6A 4CYMA 3C5WP 3KB6A 2G5GX 2RK4A 2HDNB 4BO5A 3O4RA 1EFCA 5CM8B 1N3BA 4Z3DA 2XX3A 4H0FA 2IHVA 3FJOA 1I9CA 2H59A 4H7PA 3LWNA 4CF4A 4JI1H 5FPTA 3A1DA 2DPXA 4DUZB 3WLFA 4BBJA 2EZ8A 2L69A 1ZXLA 1VA4A 3DZCA 3P2OA 4LJYA 2Z43A 3R5JA 4LSGA 2HNAA 2NNWB 1U7HA 2VK8A 4XR9A 5EHGA 4OQFA 4AZVA 1WZCA 4PBSA 3VDMA 1Y1PA 3A11A 3AUXA 1UUFA 4JXXA 1B8NA 1G3RA 2X76A 3H4DA 3V7NA 3DWGA 1C1DB 1NR5A 3QWBA 4CV3A 3D0KA 3EDYA 1D2HA 3L0SA 1JXMA 2PJDA 1D6NA 3OEHD 4RD0A 2JEGA 2JEIA 2ZYHA 1RCFA 1DTWA 1ZH4A 3LPCA 4A4DA 2C96A 4C6TB 3SMQA 2I65A 1UBSB 1R9MA 3QLTA 5JPDA 3IEVA 2JAOA 2FN4A 1WM1A 1XJ5A 4LF7B 1N5JA 4AX8A 1JKMA 4LC0A 3V46A 2BFMA 3PNOA 3KQKA 5CLGA 4WFKA 5G1NA 2WZCA 2QPLA 5HIMA 4Q05A 4EFMA 2YCHA 2QX6A 4Y2XA 4LYHA 3C3JA 2WTAA 1Q14A 4X54A 4QYSA 4QOFA 4DG9A 3URMA 4TXMA 4LZJA 1LTKA 1JPVA 4PONA 4BFCA 5ALWA 1JHOA 4BIIA 2W37A 4C2BA 3GILA 4OO3A 2PUAA 1Q20A 5UKDA 3RC8A 2WMDA 1EFAA 3BB3A 2ZE7A 3FNQA 4CMFA 1YIAA 2L42A 3NKLA 1H4SA 4US2R 1U2RA 2P2DA 4I4TB 1IBKB 4H3HB 3K70B 1JR6A 2I29A 2P3OA 3NHBA 4MR7A 2Q2TA 4RVHA 2IYXA 2CLCX 5AKHA 2WWHA 1TEZA 5EFOA 3Q8MA 1RYRA 4COKA 1EFRA 4XVCA 3SQWA 1XNQB 2JA1A 4CL3A 1WEHA 1K7YA 5AM3A 1ZY2A 3GLQA 3N40P 4IJQA 4D99A 4XB1A 5JVDF 1NULA 2BGJA 5AJVB 1Y0BA 1SU7A 3I04A 3E9CA 1BXZA 1EKXA 4JI8H 4DXHA 3CZQA 2ZJAA 1T0PA 4NBUA 4DCSA 2BGMA 1XWWA 2PVCA 1WKCA 3B8HA 4GSYA 2UYYA 1PNRA 1MEEA 4UM8B 4DREA 4E21A 4GRAA 3C3CA 4NH4A 2FWAA 1N2IA 4O59O 1E89A 4UEWA 4ZHQA 5CG2A 5CFLA 3MRXA 2ZATA 1D4FA 2WIGA 4DLWA 4MQLA 1G41A 4CIYA 5CX1B 2PRJA 2EW8A 1XROA 3EWIA 3C4VA 5MF6A 4C87A 5DT2A 1E1YA 1X80B 4EKNB 2IP2A 2LD4A 5HHTA 3C7CB 3GW8A 1Z73A 5JUWA 1DJOA 2REQB 4K86A 3UG6A 2GFIA 5E3IA 1FXSA 1K5DA 3X43A 5AK5A 4GP7A 4DLKA 4AO7A 2AFRA 2D1SA 1OBHA 3L02A 4QUJA 2V4ZA 2VH1A 1P6QA 4YB8B 3KXPA 2QG4A 2G88A 3A0RB 1DLIA 4ESOA 4KX5A 1R0RE 4DADA 5ICFA 1HRKA 3IODA 4NX2A 2XWJI 4I9UA 3UG7A 3WHLA 4TV8F 2EJTA 1E60A 1S8OA 4L0MA 5DGBA 3DCYA 5FO1A 1CBUA 4KR3A 1Y6JA 5ILQA 1GGEA 5K4GA 4H77A 5AKGA 3O7WA 4HQ6A 2SNIE 4NYIQ 3GV5B 3U54A 4M8SA 4B1FA 3E1GA 3GLIE 1IQ0A 3VZBA 2FWPA 4V0MA 1OBCA 1V2HE 2YRFA 3C3YA 1K5PA 2TSYB 3A6JA 1OT5A 3L0OA 4X7MA 3FLMA 3L93A 4XIIA 1V1RA 3RC9A 3LK7A 3T7EA 3TLJA 4ED9A 5CVTA 4IMPA 2JLYA 3LMLA 4QULA 2GBLA 1K0FA 2VNIA 1OGYA 1CQIB 1Z15A 3N86A 4QG7A 3ETJA 3N8IA 5HUQA 1DP4A 4P0QB 4I8DA 1JQAA 3QHQA 4XOIA 5KSWB 4TXNA 1IOLA 4IVPA 3MMSA 1V9LA 2ZDGA 1KEVA 4UHBA 2XB6A 1APBA 2O54A 2GAFA 2I6SA 1L7QA 4B76A 5LP1A 4B83A 1HG0A 4RVNA 2GPWA 3KCNA 2JA8G 1CU1A 1EWRA 2N42A 1UKZA 1GG5A 2FZCA 4TYQA 5ALDA 5KTSA 4OK3A 3EPIA 1YS4A 3PR3A 4PPYA 3WMGA 4DLRA 1VSBA 1B0PA 3UFXB 4NS1A 2JJ8A 3IR5A 3JVVA 3E2IA 2FEMA 3WIBA 1BN6A 1GLNA 5DMXA 2HT1A 1YJAA 3GR6A 4OA8A 3WL7A 4R1TA 4JGGA 4A3EG 2ORVA 3TVYA 2Z6UA 1OY1A 2YYSA 4H4DA 3A25A 2XBUA 3L0YA 3OTHA 2X6QA 1JQ5A 2E1PA 4TPKA 3CJQA 3D6AA 3SEAA 2E5LB 2NU8B 1DOAA 5TR9A 3O92A 1TEVA 2QT1A 4O4IA 3T4EA 4YRMA 1W2WB 5F5NA 5TX7A 1SXJE 4GR9A 3DH0A 2XA1A 2WB1E 3I0MA 4L22A 5AKXA 4UNRA 4EENA 3C45A 2D2IA 1T4GA 4D80A 2I0FA 2W6ID 4Y7DA 4EHBA 2NUAB 5A3RA 2O2XA 4BZQA 3W9UA 4C03A 2G08A 621PA 4ODIA 3UFXA 1MOQA 3NV7A 2B7CA 3BQNB 3KQYA 1GLVA 4NZ9A 4Q4HB 2R92G 4DNPA 4JJFA 2SKCA 4BRWA 1NXTA 2CNQA 4QDUA 1H22A 1U7OA 5DLFA 2UAGA 5C8YB 5FI0B 4LOLA 4GL2A 4L9SA 4BMYA 1AHHA 1AKYA 4DWVA 4KQXA 1WUHS 5ALGA 3AIOA 3IKLA 3W3ZB 1NVTA 2ZIXB 4LOIA 5BRAA 3KJHA 4A3FG 2FN9A 1Z47A 2GJ8A 2GN2A 2WTNA 3M4NA 4ZO4A 1R00A 4D9JA 5JARA 1JEYB 2PZFA 4F4ZA 2F59A 3P9RA 2PG3A 1Q84A 4LHEA 4J9VA 4QBHA 5HPYB 3INTA 4RU1A 4DNQA 4DHWA 3TG2A 1FNSA 5A6SA 3GMDA 4GF5A 3A1CA 3LFTA 1EDZA 1HLDA 1SVIA 4DCPA 4Z53A 2C9MA 3MGCA 1GLGA 1E2LA 1ZUIA 1V11B 5GONF 1NQXA 3LLMA 4XIJA 4BNGA 4UM9B 1XPOA 1QDEA 4B85A 3R8CA 1SR8A 3P0RA 4A93G 3D8TA 4JODA 3V6JA 2C5GA 2XRFA 2TMDA 2OPBA 4RQUA 1YMQA 3GN1A 3WYGA 1DADA 3BXEA 4IS3A 1IU9A 1MLDA 2GYVA 7AT1A 5FTLA 1YR8A 4YYZA 4P34A 4B6EA 3Q2KA 1IUKA 2JGEA 3KDAA 3LBIA 3FF1A 3B6MA 3EULA 4MWDA 4HWSA 3ZH9B 1PR0A 4BO3A 5AW6A 4UM9D 2Z6AA 2WP0A 4US0R 2I6GA 3ZUGA 4A5SA 3RYIB 3HJTA 1KH1A 4CLRA 1Z68A 2ZI9A 4JBYA 1WMBA 2NW6A 3VU9A 5BMVB 1GDDA 4X97A 1XZGA 1OFTA 4EUHA 4EF6A 2X7HA 1ZMBA 1JHXA 5DRTA 1O03A 3PUJA 3QXJA 4M89A 3Q8QB 3HJUA 4UZFA 4WUVA 1MPTA 1RQ2A 1E1CB 2V4UA 5FA6A 4QZVA 1BE0A 5AVUA 4PCUA 2CMKA 1B00A 3U49A 5HM6A 5BWLA 1BQEA 4JB8A 1OLUB 3ICEA 2GKSA 1UK6A 1FY2A 2HLDA 3AILA 5K4AA 3KQUA 1XNHA 2CMGA 3RRMA 4FD2A 2XTAA 3NC0C 2W2NA 1NVKA 3EXEA 3ILVA 3TQRA 4AUMA 5JNWA 5TIIA 1BX1A 1C8KA 4ED7A 2DG2A 5DF1A 5E1BA 3CF0A 3SJUA 3SYKA 2IS4A 4LF9H 3JVUA 4QWBA 1LUAA 4G07A 3T3HA 4DWJA 3IUPA 1TYCA 2Z83A 1I10A 2VNSA 1HBJA 1D4OA 4BMOB 3HKZA 1C7QA 1OGJA 3IC5A 3DD1A 4DG8A 2JCVA 3MQ4A 4D9HA 2ZVDA 2PBFA 1ZQ7A 4XFJA 2DX7A 2PX6A 3CNBA 3RVRA 1FLNA 5G1OA 2PN1A 3E61A 4KXWA 5AVOA 1TRHA 1A9QA 2I6FA 3D1JA 3DOFA 3MIZA 5A04A 5L7TA 2ZM5A 2VQEB 1US8A 1JXOA 1US8B 1W75A 1LZKA 2R6CA 2IYYA 1N9KA 4W9MC 1HE1C 1DT3A 3WZ2A 1JGTA 1IC6A 4YAWA 3TW8A 2W7PA 4LFCB 1RFGE 3WL4A 1G7SA 5DTRA 1S8NA 2DAPA 4DIKA 1K92A 2ALZA 1QDUA 2BMJA 1QTQA 3KU1A 1A2BA 1N2OA 1PN3A 5AW9A 2V5AA 5HQ3B 1QPBA 3NIWA 5DXAA 1FB5A 4IXTA 2IY8A 2W9XA 3P45A 3HK2A 4YMWA 1VL0A 3RH0A 1DX9A 2HRQA 5IYDG 2I67A 1KRHA 5C34B 1K6IA 3NWPA 2XCUA 4J76A 3VJKA 4QW8A 1I5EA 3JD4A 5B37A 1DXQA 1MO5A 3BDVA 3E18A 5A0FA 4AJHA 4TXHA 1SQGA 4OUKX 4ZREA 4PFJA 2WYVA 2ZWVA 4BMVA 5CBPB 4DAEA 3K9GA 1UC4B 1WVMA 5KNLA 2C77A 4WEQA 1IY1A 1QOPB 2CB0A 2GWRA 3HLTA 5EVCA 3SJZA 4EG1A 2M1ZA 1ZQ9A 4YJHB 1HY3A 3IJPA 2J7PA 4DUYB 3C6YA 1M1YE 3TTSA 2C0CA 3LYLA 4BE9A 4BVKA 2X1HA 4F8JA 3N6RA 4IRKA 4XB2A 1NVDA 1JB1A 4FDVA 1OE0A 4MUHA 3ZHSA 2QVLA 1UXKA 1YUMA 1QOZA 1O8BA 2ODWA 5GIOE 1IBMB 2BKUA 1OXSC 2BFFB 4PG6A 3FWPA 1R8XA 3D7KA 2EDCA 3GMTA 3DS8A 3QUBA 4EGAA 4C7OA 1YIOA 3MBKA 2BM9A 2GLTA 1I3QA 3OHAA 5TEVA 1OXBB 4UTOA 4EK9A 2C4HA 2RHDA 3VMFA 1LLUA 1SKUA 2P8SA 4NOJA 1CNFA 5KOHB 5CA0B 2FR0A 4J43A 3O26A 4NPAA 1K1SA 2Q3FA 1RK5A 3LXUX 2MT9A 1CUUA 3KFXA 3N42B 4JI6H 1Q74A 2EERA 3UKOA 3WK7A 4HL6A 4QVKA 2ATIA 4FBTA 1JXAA 3ZIUA 1YR1A 1NR7A 5GINE 3BH0A 2NAFA 2JPDA 4FJ0A 2HV9A 3F6YA 4YT4A 1M1YB 3ESBA 3TY5A 3P94A 3WGKA 2ZR8A 4HNAB 1S8AA 3TZQA 3QW2A 5BSWA 5F77A 4ATNA 4UFPA 3GLFB 1V6CA 1BRTA 2P77A 4GICA 4KQJA 4ND8A 3D4PA 3M3HA 2GN6A 1IXSB 5FX2A 3CM0A 2W2LA 3P2EA 5CVVA 5AT1A 4HMPA 5A03A 1WNFA 5FPKA 1DU4A 1RWPA 1Z7YA 4YJGB 1PFYA 3SVLA 3MC1A 1NQVA 5DSTA 1U98A 3GTOA 2HXSA 3OE7D 3UAGA 2ECFA 4LG1A 5KYGA 2IE8A 2IH4A 4WBXC 1CV2A 5BYKA 4MAMA 3QK7A 2BF4A 1AKMA 4R7GA 1P7WA 1M6YA 1MQSA 4MTEA 2J3DA 2Q4EA 2VJMB 2Z3VA 2BMVA 3LRXA 4IDCA 1U94A 1KZ9A 2XHEA 3BTVA 1BHJA 5EDWA 4IV8A 4O4JA 3EGIA 2WDTA 1HNZB 2P1RA 2RIPA 3IHKA 4MP3A 3NNNA 5KT2A 1GNRA 2DKOA 1OH7A 3LWBA 2B4YA 3KBBA 1XEWX 3T9EA 3G2MA 2JIBA 3PXBA 5EKTA 1CEXA 4YONB 2PD4A 2PR2A 5B55A 4R7RA 1NXQA 1KZ4A 2Z8ZA 5AICA 4L50A 2IPXA 3E9QA 5IT0A 3ZLUA 4CDNA 2P30A 4C5CA 3A6PC 1V8FA 3OZBA 4JJIA 5CXQA 5JZOA 1OHHD 1EINA 4Q34A 2W7OA 3QENA 1EG7A 4KIUA 5LDHA 2GK7A 3TTWA 2IZ1A 2ZSJA 1KZHA 3BA9A 5IJ0B 1EUDB 5TLSA 2FVYA 4TTAA 2IYOA 3VOTA 4R81A 1AQIA 1E1DA 4IHJF 3ILYA 4I6GA 4WHMA 3T94A 3WJ7A 4DPMA 1VSTA 2C31A 4MW9A 1NG1A 2DETA 3CNHA 4AYBE 3HZZA 2VRCA 1AKEA 2P4QA 4JI5B 1XFAA 4E6EA 4GM1A 5DWVA 5CFOA 3LO5A 4UU8A 3UWDA 2Y1EA 1JHYA 5EPEA 3S29A 3N2KA 4CIVA 1W0KA 3WA7A 1J2EA 3N2NA 1L8AA 2NPIA 2HMYB 4LKOA 5KYXB 5LYJF 1C1DA 2JJ2D 5DP2A 2VCHA 2W6MA 4WOKA 2JA6A 5BSGA 2O8BA 2LIVA 1T8RA 4IIFA 1C50A 2Q41A 3RS2A 5FOQA 1NY6A 5LOVA 2YV4A 5AI6A 2BR0A 1QVAA 1U0NA 1Y42X 4N7RA 4C6TA 3U09A 1RJ9B 5F33A 4X85A 1Y1WA 2JAHA 3KU4A 4FFLA 3QVGA 2ZRIA 4QTYA 1QHNA 1NVAA 1QF7A 1UJBA 2JIDA 3RADC 1N6IA 2VSQA 3HI6A 3OKFA 1JX6A 4Y0AA 1DC6A 2B36A 3H1GA 1R4MB 4HAIA 2ZR9A 4O4LF 1P1KA 1ZWLA 3FA2A 3STXA 4PYMA 4P5DA 1Z2NX 4WZZA 4C7KA 4EFLA 1TK9A 4NYIR 2FK8A 3FKSA 4RF4A 3WK9A 4BL5A 1ZOPA 3SD7A 1U0RA 2FLPA 2K2WA 4Z4EA 1P16A 2XUAA 3FM9A 1R37A 5T6MA 1XD8A 3W5JA 3ZHRA 2IPNA 4H7DA 3IJ5A 3DE4X 2A9KA 4L16A 4XWTA 2JIRA 3EMBA 3KB2A 4A0HA 1TQ4A 2NYAA 1CCWA 5DHPA 3N41B 1B43A 1XZCA 2AI1A 3GRYA 2A1IA 3OC0A 8LDHA 5U4QA 5KFHA 1SCJA 2P75A 3W8RA 2GXSA 1REQA 3A6FA 3ZCSA 3HH8A 3G2JA 1Z3CA 4IIXA 3W5VA 3GIMA 3Q3CA 5CH3A 1Z0IA 2JI4A 1IQPA 3CPSA 3WWDA 2AFHE 2I6TA 5ALJA 4RF5A 4NC9A 4EY4A 5BUZA 2GQ0A 2QSUA 1T5DX 2C8VA 2EJVA 1NTRA 4TQUS 5FA8A 3VVBA 3L7AA 3UZUA 1B93A 1AK9A 1O87A 3AESA 4L6IA 4C6HA 1N3LA 3HDTA 4AF8A 3S70A 5EJEA 1DVRA 1MT3A 5ALMA 2VXBA 3FDZA 3K8ZA 4WDRA 2UU9B 2DTEA 3HA3A 2QTLA 2OCDA 2IDMA 4KITB 3DTFA 3BERA 2GCPA 3DVLA 1DKRA 2GJKA 3MYYA 2L2QA 4U2EA 3BKXA 3DT6A 4RHCA 4XSVA 1SUAA 5FNVA 5LYJB 3WNDA 5BV2P 3D81A 4MDEA 4B0OA 5B57C 4UFZA 3TLMA 3H2BA 4ZVLA 5DAAA 1RE1A 5BWCA 1XALA 1HDXA 3RHZA 1JIXA 3IPLA 1FJXA 1T1EA 1Y1WG 4F1KA 4UCUA 1QM5A 1I4WA 4YBRA 1GZ3A 1ETHA 3UA3A 3BE4A 3KSZO 3O90A 1ACMA 4XDYA 3VTKA 1ZSYA 3T1HB 4P1ZA 3NBMA 4JQYA 4LJ6A 1E5LA 2ZT7A 3AKZA 5DEOA 5ARCA 4RNMA 2AQHA 2H1SA 3GB9A 5B4UA 3KETA 1BCSB 1Z6GA 2J5XA 3MCAA 3PQ7A 3C5HA 5E8JA 5EIFA 2N47A 3H9BA 1HE8B 3VI4B 4EHDA 4CLOA 4RB0A 3O7MA 1VGRA 3ODPA 1TC1A 2ILVA 4A0FA 3VC3A 4BX9A 1NP3A 4C4YA 4JQOA 1E69A 4FFBA 5SYMA 3EC7A 4J75A 3TZLA 5L1IA 5K7SA 5DO9A 3W8EA 1VKZA 2PIDA 4IEFB 3N8NA 2BTEA 2I2WA 1J6UA 4GVLA 3WGIA 1CZRA 1QQ5A 5CW2A 4JB2A 2HLNA 5KG1A 1V4NA 1WQ4A 4TQAA 5TGTA 1A9PA 3X1JA 1KTAA 4X8OA 3GAAA 4QU5A 1HNNA 1QH8A 1VJ0A 3JD1A 3PNMA 1WUYA 1ATIA 2D5BA 3LIIA 2G9UA 5B1HA 3WFIA 4D43A 4K03A 1CRZA 2ID4A 5D51S 1L1RA 2EOAA 1H4TA 3G7NA 3HNOA 3TLGA 3CE6A 1S9HA 2Q7DA 4EM6A 3GD5A 4WNAA 1WPGA 2VZ0A 1KVRA 1OD6A 2QAGC 3JQBA 3Q10A 3TIVA 2BFBA 4NZZA 3GYGA 3BXHA 3HXKA 2Z04A 3KXYT 1DRKA 3BHIA 3TFQA 2Z9DA 2ORED 2LKDA 3IRVA 2YHUA 2IBSA 5AFSA 4Y6GB 4J3JA 4DW8A 3MW8A 4AJNA 1G5HA 3CEAA 3R2JA 4JLMA 4ME6A 1N6NA 4O0LA 4WNIA 3ZXSA 4BAZA 4EY8A 1PE0A 2ZKIA 4PLGA 3N7UA 4D25A 4J9UE 4X95A 4FNAA 4PPNA 1DKLA 3RU7A 3SAJA 5AHKA 1WNTA 2OUIA 3OG9A 3E3OA 2QGNA 3X44A 1ZK1A 1X94A 3H20A 2WAAA 1C4KA 4HLUA 4Q48A 1JBEA 1E98A 2XT0A 3CS3A 4M1TA 1KAGA 3KJNA 2CVPA 2IUFA 3A10A 1Z5GA 1UC9A 3KYDB 3UA4A 1JSXA 1O9BA 1NMXA 1SVKA 1NKSA 1R9JA 2FW7A 1NZJA 2LPMA 2O3SA 4JYCA 3H3XA 4J29A 4YALA 1Q44A 2O03A 2VWGA 5EYPA 4K0RA 5DI3B 2EYQA 5DKFA 1OXTA 5AI0A 2O5RA 5CB6A 2GPSA 4QJIA 1OLOA 1XJ0A 3ZVKA 3E84A 3FMVA 1FOEB 2JIZA 5KAPA 3ZNPA 3AWDA 4FEGA 3I9FA 2CDAA 2XEDA 5KOJB 5LA6F 1W36C 3QVGB 3N0RA 2PA3A 1GSHA 3PUZA 1ZN7A 2M6SA 3I2IA 3P4YA 3QG1A 4GC9A 3MD9A 3DE0X 1PW5A 4RX1A 1K0UA 4QC2A 1GXSA 4TV9F 2IW3A 1Z2AA 2DFLA 3DZ8A 3A4NA 3RC2A 5AIBA 3HKBB 3ZOKA 2YDXA 2ODAA 1U63A 1YF3A 3K9FC 3JWJA 1Z4OA 4CUZA 3KQNA 3PE4A 3D4LA 3EXAA 1U1IA 2OGZA 4WL0A 1P9WA 2DAAA 1PX0A 2DPMA 1DMRA 2G9ZA 3RAJA 4CEIB 1IY8A 1KJYA 1QGUA 4ZEWA 2W6PA 3BSYA 4IZIA 1JZTA 4PQFA 2IXGA 4I08A 1KQGA 3T9DA 4ZRNA 4PSKA 3B9QA 3L82B 1YZKA 4I3FA 1XLTA 4RADA 3UJHA 2C84A 1JKXA 4YB8A 4C0LA 4CKCB 5KINB 2FCAA 3WZLA 1JHMA 1M1NB 1N7HA 3W5CA 2H2DA 3TSYA 2FWBA 1NVXQ 2DULA 2P2LA 2ZIZA 1XWFA 2I78A 4OXIA 4XTCS 4DS3A 1IXRC 3NWOA 5K8UA 5K3DA 3VA7A 3EF3A 3HUUA 2WVAA 2ENWA 1C41A 4R8VA 3B1VA 4OLHA 5LQSA 3RREA 2XGOA 4M0UA 1ZX1A 2DFDA 1DCTA 2FKLA 4WKGA 8ABPA 3TR5A 4IDNA 1FUKA 2R6ZA 3FPGA 3ESDA 4ALMA 4PAOA 3K0HA 4GW3A 5AJHA 4RTNA 4V39A 2J6IA 3O4VA 1S0NA 1K88A 1P73A 2V5UA 4U6QA 3TZEA 4Z4QA 2NWQA 1XD2B 2ZUVA 1Y48E 2B4QA 2CCGA 3MPOA 4ISCA 2R1TB 5D00A 4ARAA 3ZU3A 4ZIRB 1YJQA 2YC2C 3H9JA 3KAQA 4CMIB 1XU4A 3FIUA 1MOSA 4E3WA 4ND7A 4ETNA 1OAOA 1UXJA 3OP1A 3QVTA 4R7TA 3MIIA 5GM2A 3VHXA 1TCAA 2YXBA 1RJPA 1UANA 3KCQA 5I7SA 4DR5B 1QH1A 2PD3A 1FSSA 1P1JA 2ZULA 4OGLA 2EARA 5K8LA 4IQ4A 4F4CA 1WVIA 1PK8A 3GLKA 2X9QA 3MPUA 4RQTA 2HK8A 1IOVA 3BJIC 4L3OA 3VO1A 3HVHA 2BL4A 4AO8A 3AK4A 1EGVB 2Q99A 3AMVA 1XDNA 2ZRMA 3R76A 1SVSA 5AVSA 2QBYB 1PWZA 2GHTA 2Y1OA 2A5FA 3QW4B 1T24A 3V34A 4F5ZA 3AY7A 3ZQKA 3K71B 1TO1E 1GQQA 3UMGA 1XMQB 4ZICA 2PUTA 1L4MA 3OQMA 1D2EA 1NW5A 2WG1A 2PD6A 5A7FA 1Z28A 4KH1A 3BQ2A 3L7LA 2FP3A 4NATA 3VSEA 4BX0A 5LNK6 4ZHQF 2AKEA 3F67A 4NAVA 3R1IA 1H3FA 2HVQA 1DIOB 3HCOA 2ZBEA 4MWOA 1XE3A 1ZK2A 3QTLA 3KSAC 5JECA 1EVKA 3LUCA 3WDKA 5E7IA 2GSDA 3WV4A 3OQBA 4NYJR 4Z99A 3H9EO 2AGQA 1SA0B 4JZYA 2ZJ7A 4YLEA 3WJ1A 3MMNA 1HEYA 4C43A 4E09A 1N7IA 3D4OA 4MUJA 2ZDQA 3TIFA 4G0MA 1KS2A 5DTQA 1G1AA 4CT0A 5EWEA 4ZI7B 5J1SB 5CVCA 1CWUA 4KX3A 4HVAA 5CFZA 1YTUA 4DLTA 1X1SA 1XL0A 5IW8A 3H13A 1K3TA 5JDCC 5TDHA 1YONA 3QIAA 2GVNA 2JCYA 3A4TA 3AETB 3PB3A 4YRFA 5HILA 3VJLA 1BE1A 1YRAA 3O8NA 3SY8A 3D2LA 3IX7A 1CRWG 3K1AA 4S0ZA 1BS9A 5AQEA 4JJZA 2NACA 5IASA 4RACA 3QKWA 4P35A 1OLXA 4JV5B 3DNFA 4WZAA 1FFGA 1AN9A 1Q0HA 4QTZA 1DC7A 4AP6A 1G19A 1C4OA 3I2GA 1RKUA 4Q0YA 1UM8A 1XUOA 2FR1A 5DT9A 4BTEA 3PFFA 4AU1A 3NVAA 6LDHA 3B5EA 1QV7A 3B82A 3DUWA 4NP6A 3DC2A 5E6RB 4L85A 3DHVA 1XMJA 1RWMA 4R84A 5EXPA 5T8KC 5IM5A 1GYPA 3RASA 4OQEA 3ZU6A 3VAZA 1T8TA 2D13A 3H87A 3QKIA 5D5QA 4EAQA 2FWIA 2H3HA 4YCAA 3GDWA 3PS9A 4OMFG 5HIJA 5DVZA 4YT5A 4UATA 5L3ZA 3MCWA 1ISSA 2IEGA 4HDSB 5COBA 2P3QA 1KBLA 3E4DA 3PQ6A 1EFUA 2FW1A 1O6BA 2B83A 2E4ZA 3MWGA 4E11A 1UC8A 4DYDA 2R1VB 1OLUA 3C1OA 1JG2A 1WB9A 5C7LO 1WQ3A 1J2JA 2DR0A 1P0MA 4ZJUA 3TGPA 2HO4A 3HFGA 5EPUA 2K87A 2PGNA 2X2PA 4BLPA 1AMOA 2QOEA 3OOYA 1NONA 1WDMA 3KOWA 3ZGLA 3ZWPA 5K3EA 3K0SA 3LJKA 5F3RA 3IA7A 2F00A 4FGKA 3SC2A 1ZEMA 4CMBA 2VA9A 2XMBA 3OIWA 4S1OA 3T54A 1W0JD 3WB1A 4BFTA 4KOAA 5JC1A 3PQ8A 5CYFA 4XIGS 2BFPA 3BRWD 4QPJC 4P3OA 2YZ2A 3AUTA 2YN4A 4Q3CA 5IVKA 4RDHA 2QZ4A 4LY6A 1ZKDA 1O4WA 3PC3A 2GVZC 1XTBA 4H60A 2IHBA 4TMYA 3D6VA 3TOZA 3TUJC 1XDZA 2HPHA 4EYKA 2R60A 3EQ9A 1VLQA 1H2EA 3WNBA 1NPDA 2N1BA 2QT0A 2YL2A 2A9OA 2Z4SA 3D0QA 2QRQA 3IT1A 4BE7B 2QRMA 1T4MA 4GQBA 5D3MA 5H9WA 1DZ3A 1GN8A 2C4TA 3ZYCA 4D45A 3B13B 1T4CB 3PCXA 4ONEA 3VPXA 2X6TA 4JLOA 1ZVKA 4V3BA 1ULAA 3C1TA 3ECCA 3EVCA 5AOCA 1T0JB 1OT3A 4D57A 3GJXC 2O2SA 4O6VA 3R3XA 1U02A 3FFXA 4C08A 1J33A 3FMIA 3ZHVA 1F2VA 3S2EA 4WGGA 4RTRA 2IE0A 1D7AA 4AS1A 2C1XA 3FUWA 4X8LA 1SQFA 4P7GA 3V80A 3ZVNA 4F2GA 4ZHSA 2A1TS 5K0FA 3FDSA 5A1TA 1VKNA 1S68A 5LMUH 1N34H 5HBRB 1RYMA 3MFHA 3MOIA 3EARA 1QZZA 1KOGA 4FGSA 3JD2A 5C51B 1N33B 5ED4A 3JSLA 3ESAA 3UVEA 4CR6A 3IV7A 3CGGA 1NVWQ 1VMAA 1F5NA 1K75A 3L7DA 4WCFC 4CC5A 1NXXA 4H1UA 3UJPA 3WICA 2HRCA 2P4HX 1O54A 1OC2A 1Y5MA 2HU8A 4RXTA 5H82A 3FZEA 4N5NA 3U48A 2J9ZB 2AF3C 2UKDA 5T3UA 3RJTA 1SVOA 1P1HA 1BCRB 1G66A 2X8AA 5FJ8G 3MR6A 4GPD1 3TAXA 4BTLA 1C7IA 1JVBA 2J3QA 3GVHA 3TXYA 5JT1A 2I66A 4LRUA 3NHFA 3WGQA 5I9MA 3MTGA 3HMKA 3L8HA 4QYWA 4MUKA 1LK0A 1IDOA 1ZGCA 3FTCA 4F2HA 5HUHA 1WP9A 3IOCA 1CB0A 1Z07A 2JEOA 2OOKA 1R4NB 4G8CA 5M3BA 2OCLA 3CB4A 3KKZA 1UDRA 3FUTA 1LCIA 2XTJA 3MBIA 1CY2A 3K0CA 3CPJB 3TNJA 3F46A 5KFPA 3L5OA 4EG7A 1U3FA 3EXG2 5KSYA 1ET0A 1CF2O 4X1KB 4CEHB 1KBZA 3K8OE 2E87A 2JW5A 1VL8A 4IINA 1A69A 5FD6A 1BCRA 1E9AA 1HDEA 1K6JA 3ZCPA 3HN6A 5D7NA 1NDHA 4O2BF 2AXNA 4B3IA 1KWGA 1CHDA 1UMCA 4IILA 4QG3A 2YJZA 1NMSA 1A5SB 3FFTA 1OYVA 3JAWB 4TN5A 4K6CA 3U56A 2GKGA 3O1LA 1G18A 1PQPA 3CNQS 3OHMA 4E30A 2FZEA 4E2ZA 4EB8A 5JSZA 1RXYA 3DHNA 4TMXA 2ZTMA 3VFDA 1TQHA 1QYRA 1UZMA 2ISSD 1PZEA 4NG5A 1A3CA 5EZYF 3D4NA 1VB5A 3MJRA 2A9FA 3RKSA 1W19A 2O8DB 2Z1MA 4DLXA 3GHYA 2VUTA 3ZCXA 1UBJS 3W5HA 4DUZH 4URFA 2FMAA 1MZBA 3SIXA 2A9PA 1NN0A 3EZYA 1G2QA 3ECSA 4DBLE 2IYRA 4PSUA 1ODCA 4FDAA 3Q98A 3BJEA 4DM4A 4EPWA 4MRAA 4P92A 1Z63A 3OZDA 1UIRA 4RTLA 4FD3A 5TXGA 3IT2A 3NUAA 2E4XA 4IDEA 2MR6A 4R5HA 2BRUA 5FUWA 3QVKA 4F3TA 7MHTA 3DBRB 5A2QA 1FZTA 2CCJA 2EZUA 4RVGA 3CNNA 3OQIA 1N77A 5TS2A 4N0QA 1T8WA 4KH0A 3V97A 4Q3EA 1KI2A 1EFHA 4JT4A 2G8NA 2C28A 3LPMA 3DOHA 2BDTA 1LKZA 5KWEA 4E1AA 1G21B 2YV5A 2QMZA 3OOEA 3PFGA 1TA0A 1A88A 1J8DA 3JZDA 1V7ZA 2I6XA 3JTMA 4N0PA 3GEDA 3V5NA 4FCWA 5BQOA 2Q5HA 3ROTA 5KOYA 5JJBA 1GSIA 2QXYA 1GPH1 5KFFA 3WYFA 1ZC3A 5F35A 1P2BA 3E22B 1RQRA 3JYPA 4WQMA 4A3CG 4QQFA 5AVRA 5CVDA 3DCIA 2OWOA 2VPWA 3A05A 5FPQA 3EXIA 3ENNA 2OUKA 4WZAE 5AUPB 1OI4A 2DFNA 1VKHA 2W2KB 1ZESA 3T5AA 3L8YA 5BN3B 1XTKA 1T3GA 3O8QB 4MROA 2I6UA 2QQGA 2OSBA 1FDVA 3NBFA 4GDFA 1JE1A 4R8KA 2Z2JA 3O4IA 1C7EA 4JITA 3OTOB 4RFSB 2XC9A 1T1RA 2WTBA 3LUFA 4Q1AA 2NQ2C 4RFSA 3KR0A 4HNVA 2IMWP 4K2HA 4P3KA 1E59A 5G0SA 1E3SA 3JYQA 2BZSA 1K6XA 4RZUA 4PW0A 4R83A 3RKUA 2R86A 3WKDA 1YR9A 5D3MB 2WFAA 2Q46A 3BGSA 3B3JA 1CR2A 3I05A 1U2GA 3Q7TA 3N5KA 3T15A 5CU7A 1SC4A 1TLFA 1IUOA 2QK4A 4MQ4A 3SDSA 2GO1A 4E5DA 1SWVA 1JLLB 1I24A 1WCWA 1PCXA 3ANTA 4X00A 4BPRA 4XGNA 2OWDA 4F4DA 1JIVA 1OHHA 1XYVA 3TPZA 4CFZA 4QLOA 2VDOB 2WWGA 3HXTA 5K0CA 1I8TA 3BMOA 4QWAA 2CLMB 4J0IA 4JI6B 4O7VA 3HRIA 3HYRA 2YRWA 4X61A 1Y63A 5LBUA 1QO0D 4BO0A 4L1KA 2YWDA 3U7HB 3VDNB 1R3DA 1YQUA 2P9JA 1KZ7B 1ZIPA 3KZCA 1SKYB 2VP5A 4HQRA 2B82A 4DV0B 1LBQA 2OO7A 2PZGA 5GZ1A 1IL0A 5DI9A 5DH9A 4C20A 4X9XA 3IUBA 3AR8A 2QB5A 1IJBA 1NF8A 3SX0A 3NEPX 1QKJA 4AJ9A 4RORA 2H52A 1HMYA 1EP1B 3ZY4A 1U3TA 5EKUA 1S2OA 1RAGA 3EG9B 2QP4A 2QY6A 4ZU6X 4DV5H 4NENA 2C78A 3DBLA 2JFWA 3B7PA 1I9GA 1GUFA 1G6KA 1ND5A 3BB1A 4FQ5A 5EKDA 1RLTA 3D6UA 1RZRD 5CFPA 4I8XA 2WA1A 4ARZB 2Y71A 3HVKA 2AG1A 3IXQA 4RANA 2X4DA 3PXXA 2FFQA 2OFWA 2RHWA 1Z22A 2BEUA 4YR7A 2P9HA 3SX2A 2DR2A 3QF7A 3W2EA 1FKAH 1FF9A 1QO7A 1DIGA 1UJ5A 1W87A 3H5RA 2C9ZA 1Q1ZA 2WKQA 3CV3A 1CQWA 1RXVA 2D6FA 1TIPA 4FYWA 4E22A 2XE6A 3HDHA 5EL0A 1IRXA 1T13A 4R1QA 1GAEO 3CLTD 3SIRA 4N49A 3CB2A 1KEPA 1O77A 2EWVA 3G7UA 5K20A 5BR1A 1TUBA 1ADYA 1VJ1A 4ZA2A 4HH0A 4JP1A 3VVMA 1XAIA 2OV3A 3OCUA 4R2KA 3WIOA 1WO8A 3DZJA 3F1LA 3T38A 1KORA 4DR6B 2JANA 5F9NA 1ULTA 2CHVA 4L5IA 4I5FA 1K2VN 3EG5A 3LC2O 4Y6PA 3I5UA 3HUEA 4JROA 1SVWA 3RIEA 4LXXA 1HZJA 1I36A 4MB6A 2YMLA 2DSNA 1EKPA 1KVUA 3DSRA 3VHXB 4LA4A 5JCZA 4JDPA 2X9NA 4RFLA 2QENA 2XSZD 3CKMA 3TECE 1RJFA 2A67A 4GMHA 4BQPA 2V7GA 1POXA 3EEIA 4IIHA 3GFVA 4K3UA 4M1YA 1ZHOA 1CQJA 3IDOA 5TF4A 2DUMA 1YH3A 2J67A 4D82A 2VAWA 5HXAA 2IZ5A 4KN5A 3AU9A 4C1BA 3BA8A 3GK3A 3I52A 3OVMA 4ARSA 4B40A 4Z4GA 4WAUA 1SXIA 3EXFB 4ND8B 3T4PA 2C4WA 2XNSA 4IDFA 1Q2XA 5JLJA 4P98A 1MN6A 5B7NA 1N75A 5JOQA 1XNRB 3KQQA 3PRKE 2C61A 2Y1CA 3WLRA 1DAIA 1PTJA 5LLSA 1G38A 1XDUA 4BUJA 3SS8A 2H5EA 2IIQA 4GBMA 5KCMA 5BVHB 4D97A 2H57A 1E4YA 1L5MA 1WHTA 2CLEB 2BEJA 2HDKA 5CDUA 5T67A 2NT4A 1Z5NA 1ZN8A 2I03A 3HKCA 5JWHA 1BE8A 3O93A 3O4GA 4YHHB 1E2MA 4RIHA 1QQ7A 4UEOA 1NXOA 1KBQA 3FR7A 4EDFA 4DLYA 3UT6A 3ID6C 2OWEA 2AWNA 5T7BA 4MVJM 5HX7A 1ORHA 1Q0SA 5U1PA 4WECA 2WB1A 2CEAA 5JZVA 1JPUA 3WRWA 2C88A 1ZVJA 4GI2A 2FSSA 4HATA 3V7FA 2QMQA 5CVUA 1I2BA 1ZM3A 1NXPA 3P7MA 4HFMA 4C7OB 4EPVA 1SBZA 2AJBA 2YHAA 2LCIA 4GKBA 2WU0A 3JZMA 1Z4JA 2Q3JA 3PLNA 1XKQA 3D5QA 4N03A 4IV5A 4B3JA 3DLIA 2W57A 2QQ0A 4GKKH 1RAHA 2EG5A 4RB2C 2IKQA 3TDKA 1MVLA 2AD1A 3EGDB 1KSFX 4BB6A 5D1PA 1C14A 3BC1A 1ULZA 3PEYA 3A6ZA 2ISCA 4Y2PA 4YRSA 2HLDD 3ORHA 1TQ6A 2E3JA 4R68A 4UVHA 1SQ6A 3RT7A 1L4BA 5B2FA 3ZDRA 5DHAA 4NWIA 1JU9A 3VOSA 1EE1A 2FQWA 1YBFA 1X2BA 2GESA 1E3EA 1U5CA 3JQAA 3W9YA 4ALLA 3AI1A 4ZJZA 1KEZA 1YK0A 2QW1A 2NSLA 4DR1B 3AVVA 2KPOA 1UXIA 2JA5G 1Y8CA 2F8LA 3JQ6A 1E9SA 2Q49A 1DZIA 2B9VA 1CR0A 2OBMA 4CUKA 4DXDA 5EJ4A 1MJNA 2PBLA 1ZL0A 2MMGA 2DE0X 3GMIA 4IM7A 4JOCA 2OTCA 1JA9A 1SUCA 2J08A 2NV2B 1H2YA 2EKLA 3D1LA 4UM5A 2GPAA 2HSGA 3AHJA 4RHYA 4D8TA 5E2BA 4JUCA 5IAOA 2GJ9A 2ZVPX 4DJ5X 1KJNA 3BXZA 3CLTC 1RK6A 1DAOA 4DRFA 3KLMX 4I55B 4RULA 4U63A 2WIDA 4UCSA 2J46A 4OG2A 5A7GA 2I1WA 3UCXA 2QNIA 2V4RA 4HGRA 4ED0A 1ZSVA 3E35A 4QDXA 4Q3DA 2AC7A 5L40A 3GNTA 1GFIA 2I2BA 4MWCA 1SVUA 2E6KA 2XLBA 3AEQB 4F1WA 1GXSB 2V6IA 3VR5H 3GLRA 4AZ3A 5F76A 2IZ7A 3AVYA 1ONOA 5JJLA 1P5RA 4O4IF 2R82A 1BDMA 4MYDA 3G23A 4RZQA 5KKNB 2P9TA 1K98A 5FB3A 3H5WA 3PDJA 2H4XA 4XZ3B 4ESHA 3HWRA 4YA6A 1CVRA 3WGGA 3QKSA 3Q3IA 1EJ0A 3PIIA 3A9TA 2EP5A 2RHBA 4JWTA 5BSVA 2CVQA 3JARA 4I81A 3FY4A 2EP7A 3ETHA 2HWWA 3QWAA 2ZT8A 4W5WA 4XD7A 3T1QA 5AVQA 4LF8B 2FFAA 4Q16A 2GYWA 3IURA 4QIHA 3L6DA 1QLWA 1ISIA 1NUUA 2AZMA 4FMDF 4B6RA 3LVBA 3MTBA 3QRWA 5F78A 3JATA 4PZLA 3UK2A 3ZWWA 1SELA 5ICGA 1D6MA 2IEIA 3SPXA 3V8RA 1P0PA 3BG5A 5ULLA 3I9MA 4XYLB 1FDSA 1TCVA 4IUYA 1IEVA 1U4SA 2Q6OA 1SXHA 4HNRA 3QI7A 4LPSA 4DN6A 1KMHB 1OTXA 2WHQA 4G0ZA 1L4HA 5FJIA 2ZJ6A 4DPKA 1E2JA 3NPMA 2PMFA 4OIFA 3N3AC 4EGQA 4TQGA 4QOSA 5IJAA 3KE9A 4DCUA 2XRYA 3DPIA 3PRJA 4MVJG 2XDQA 2V7TA 3CX3A 4GG1A 2M6KA 4HB2A 4COOA 4KN6A 3RPEA 1QSGA 4OU4A 4MO9A 2XTNA 4JL8A 3BK2A 3MWEB 4D02A 2XD4A 4MVJF 2XT9A 2Z6QA 4JR1A 1ABEA 3JAMW 3PQEA 3MZ0A 3EGVA 3WQRA 3LUJA 4EF4A 2ID8A 4JP3A 3PQCA 2AFHA 3P32A 4X1OA 3EZLA 1FZQA 1AHIA 1KF0A 3G2HA 5EE9A 2X4IA 1CJBA 3DTVB 1TUGA 4LF6H 3WSVA 2R97A 2ST1A 4I50A 4DLZA 1Y4SA 4RHFA 1DQZA 3OA0A 1EP2B 4C04A 4J2HA 4KMSA 4URVR 3LVFO 4OUDA 4PYNA 3HB7A 4W6QA 3AO0B 1UT8A 2R9VA 1QRAA 4V2UA 2G6BA 4HN4B 2D2VA 5ITZA 2NTVA 5D5PA 4DLLA 1WSCA 1WPXA 3OAAA 2Z2IA 1USWA 3IERA 4DL4A 1RLOA 1ZNZA 3A14A 1WG8A 1DUIA 1QYXA 2D1YA 1NJGA 2HFKA 1CLEA 3CVOA 3N9IA 1ECPA 3MD0A 1S8FA 1VB3A 4ZZ1A 1YDFA 3ODGA 5KU7A 5B3JC 2Q7OE 2CV2A 2PZLA 4DPLA 1VPLA 4NYMR 4YNBA 1LJUA 1OB5A 1W0CA 2CW7A 3LPNA 2YMQA 3RVJA 3LCUA 4PICA 4ZO9A 1D09A 3HXQA 4C7VA 4U4AA 1ZIOA 1I6MA 3KJXA 4PXSA 2D7DA 5FPOA 4JI5H 2ZYUX 2MYPA 1V1MB 4G6ZA 4ZVVA 3P0IA 2FEPA 4CKXA 4UUOA 3CVZA 4ZYZA 4TV8A 1HLFA 2J7PD 1NYTA 2P2SA 1ZKMA 4JKOA 2O06A 5L51A 1E94E 2JNWA 3EVNA 1E2IA 3ZKAA 5DCYA 2JFGA 2JZOA 4Y8VA 2PNFA 3X1YA 1XTPA 2AUNA 2FW9A 2H51A 1GL9B 3ISTA 2BLNA 2PH1A 3IKVA 1UL1X 3MLAA 1U4OA 3ESRA 4R8UB 3WIVA 3I62A 1MEOA 1CS4C 2WTEA 4Q3LA 3IAAA 1X7HA 2VDPB 3AL3A 1M0TA 3I5MA 1BVYF 3FMFA 4ARBA 4OU5A 4PX9A 2XKKA 2JD1A 3PDWA 3OPYI 4GYJA 3A32A 2OV8A 2QTHA 4BGDA 2F8SA 3HTXA 3GJZA 3EOZA 1A50B 1V26A 3GGCA 4LJ5A 1WKBA 4Q9LA 1C7ZA 1H5NA 3DEIA 3G79A 5EQJB 1K4MA 3KWLA 5DK6A 2HVRA 1XEXA 2Y2VA 3JQFC 4WLNA 4B79A 3NGLA 3EQ8A 4U3JA 2EQ5A 2C3PA 1JG3A 3HCNA 2Y0PA 5DRYA 4E4TA 3L6UA 5FF9A 1B33N 3HYNA 2A9JA 3V8MA 1BWRA 1XPRA 4RPHA 2HD4A 1JECA 3TW7A 5BV7A 1CRQA 2XZOA 3D31A 4PGMA 1AIPA 2CNOA 3F71A 2J8ZA 1Q6ZA 1VJCA 5HA5A 5ALZA 3LX6A 1WD5A 4Q1DA 5AW5A 1YD7A 2WF5A 2WJ3A 4KI0A 4D42A 5L4SA 3RVQA 1WSDA 1N48A 2I2AA 4EGCB 4N5DA 1QCZA 2I5PO 5B4VA 1THMA 5KFWA 1DQNA 3H5AA 4AZ3B 2BCEA 3HWSA 2BM8A 3DL7A 2XMCA 2QUIA 5LFAA 1EXMA 3FMOB 2NYUA 1U2DA 4G0PA 1Z34A 4INAA 3E1SA 3TW4A 4R1LA 3UOWA 1ULHA 1LDNA 4QYTA 1P6UA 4RWEA 3TDMA 2DBQA 4A7PA 3JQQA 3K72B 5HVNA 3QX3A 1CETA 1KI9A 4QT0A 4G3IA 3HDVA 5B36A 5LQNA 2ZIGA 3DEFA 2ACEA 3CONA 4HDCA 4PLPA 3SJ7A 3KVRA 4RZSA 1OILA 4E1VA 2NZ8A 4M1SA 2JC3A 3GVIA 2GZRA 4UUNA 2VHYA 2YHIA 3OMXA 4FSDA 3KZMA 5KSOA 4YV7A 1R5BA 3U3OA 1SD5A 2YCBA 3UCFA 5I9LA 2C3MA 3M1LA 1DCFA 1P2UA 1N4DA 1PT9A 4FCCA 4HQKA 1LDGA 1K9SA 3NIDB 1PTJC 3OP4A 4ZQBA 2UYHA 5EVJA 4MV8A 2RH5A 1UBRS 1PJ2A 1RAEA 2CK3D 1K7FB 4MJXA 2QRPA 1QP4A 1L8OA 5I7UA 1Q21A 1E5DA 3IPXA 4JL5A 3AUFA 4M76B 1PR9A 4HRYA 3GEEA 3QYFA 2QTZA 2JZCA 4RW0A 1ONNA 2ZTUA 2GSWA 3VGJA 4TLAA 5MFZA 2ZPUA 1FSFA 4ZC1A 3NBQA 2ZJ2A 2QMHA 4FC6A 2MSDB 3HN2A 1WP4A 3PHJA 4JLDA 3W2FA 3ZPXA 1RHMA 1Y80A 3AVOA 2PNJA 3K9HA 4IIBA 3UF0A 1ECFA 1HNWB 2HVSA 4U9UA 1G20A 2CHUA 1BEZA 3OEED 1IB0A 1ZM2A 4YCDA 3LDHA 1GQRA 5ITZB 2GN4A 3C6KA 4GI3A 2OV2A 4ECAA 3X0DA 4HX5A 2VJAA 4INZA 4KPFC 4DKXA 1Q0ZA 3HB5X 3OFSA 5IJ9A 2UZ4A 1NDQA 2JZNA 4CTKA 3DTVA 1P29A 4L2IA 1R6XA 4OJYA 3ROMA 1TMOA 3RIHA 1G98A 5IABA 1A72A 4RHEA 4CKBB 3VC1A 5KG4A 3NGXA 4XDHA 2GQSA 3UB4A 2DCMA 2PZEA 3P8ZA 4LRTB 4AS3A 5ERYA 4JI4B 2HU5A 2V54A 5FBRB 1MNQA 3QY0A 3U26A 2JG3A 3GV8B 2CMDA 4KE6A 3OBIA 4G1MB 3G9XA 3WGUA 5U9CA 1W76A 4Z2YA 3UW1A 2ONKA 1V37A 3PJDA 2CVOA 2RGXA 4FIZA 4KIGA 3I6ZA 4RMIA 4ZJYA 1TJYA 1CVLA 3LOPA 4XPIB 1LFAA 5I5TA 1KMHA 5CX1A 4RDCA 3DDUA 3N8KA 2Q6VA 4PC3A 5JXGA 1XNGA 2XYVA 3DE5X 3S8MA 4TV9B 3SFVA 3K0EA 4HQFA 2J3LA 4IQ8A 4AAYA 1OWTA 2C4NA 3FDZB 2C2EA 5WRFA 2IS2A 4GPEA 5KJ6A 2EFEB 3AI2A 3OM9A 3H2SA 3LUKA 1U0JA 1TKRA 5CUQA 4Q4HA 1A2KC 1XRRA 2IYFA 2NV0A 3R4VA 3STVA 4JJ4A 3DTVD 4LBZA 2QMYA 3E9YA 4F4XA 1XXHE 5J58A 2DSTA 1IDN1 2JLZA 4KPYA 4G25A 3K3VA 1ESEA 3F0TA 2B7LA 3NLLA 4OOEA 1A27A 2DBYA 6REQA 5EGSA 3W2HA 5JH7A 2OFXA 3TSCA 4LZOA 1UBTS 1W93A 1VS0A 2GZAA 4G23A 4O2BA 1W30A 4FR2A 2GA8A 4OX9H 1XJQA 3VHRA 2DH5A 2HIAA 2JD2A 3WKEA 4EY6A 1PL6A 3KTMA 1OVMA 1W5AA 3IXMA 5JISA 1T35A 4ESVA 3GVCA 1AA9A 3HKDA 4YCMA 1GQOA 3CY6A 1YQ9A 2I3AA 1AM4D 1CR1A 1UOPA 4XEHA 5KQPA 1ICEA 1Z88A 2XAAA 3X2EA 5CBKA 1GD1O 2TMKA 2V7WA 4FHFA 4F3YA 4Z4FA 1PT8A 4O3RA 2ZYTX 1A8QA 1Y4ZA 3E8SA 1S9DA 3W6UA 3GLTA 2HTFA 2YZMA 3FZYA 1WBDA 2ZB7A 3C3MA 4H3VA 4RF3A 5KYVA 3RFXA 1OKKD 2AUMA 3GX1A