2VPTA

Clostridium thermocellum family 3 carbohydrate esterase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
201
structure length
201
Chain Sequence
KTIKIMPVGDSCTEGMGGGEMGSYRTELYRLLTQAGLSIDFVGSQRSGPSSLPDKDHEGHSGWTIPQIASNINNWLNTHNPDVVFLWIGGNDLLLNGNLNATGLSNLIDQIFTVKPNVTLFVADYYPWPEAIKQYNAVIPGIVQQKANAGKKVYFVKLSEIQFDRNTDISWDGLHLSEIGYKKIANIWYKYTIDILRALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Cellulosomal Family 3 Carbohydrate Esterase from Clostridium Thermocellum Provides Insights Into the Mechanism of Substrate Recognition
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords LIPOLYTIC ENZYME
total genus 75
structure length 201
sequence length 201
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2vptA00
2HSJA 1BWRA 1PP4A 4IYJA 5BN1A 1FXWF 1ES9A 4HYQA 3SKVA 4JKOA 3HP4A 1BWPA 3DT8A 1ZMBA 4LHSA 3DT9A 1J00A 1IVNA 4Q7QA 3DC7A 4XVHA 3DT6A 1FXWA 3KVNA 3C1UA 4K40A 4JJ4A 4OAOA 4RW0A 1K7CA 4Q9AA 3U37A 2O14A 1WABA 1U8UA 4OAPA 2APJA 4JJ6A 3W7VA 1ESCA 3RJTA 5B5SA 3P94A 1Z8HA 4K9SA 3PT5A 4HF7A 4S1PA 5JD3A 1VJGA 4K7JA 2WABA 2Q0QA 1YZFA 3MILA 3BZWA 4H08A 1DEOA 4RSHA 2VPTA 5HOEA 2WAOA 4TX1A 1ESDA 4JHLA 1DEXA 4K3UA 1ESEA 5A4AA 5CD9A 1V2GA 4M8KA 4DEVA 3DCIA 4PPYA 1VYHA 2Q0SA 4NRDA 2WAAA 1BWQA 1JRLA 4I8IA 2W9XA 4JGGA 3SLRA
chains in the Genus database with same CATH superfamily
3G79A 4ZXPA 3ZGNA 2QV7A 4P4NA 2R5WA 3OA0A 2PWPA 3PXEA 4DLUA 4IUDS 4A9AA 4HGOA 1E77A 3KHSA 4LA4A 3HP1A 3O7MA 1XVLA 1XEXA 1Z5NA 4NU6A 3LPLA 1P5HA 1IJEA 1QV9A 5JYBA 2CFIA 4JXKA 3SHWA 1MIHA 1WXFA 3DBHA 3OP4A 3TBFA 2OHOA 2NVOA 2YINC 1FFSA 4F97A 3GT4A 3JQ8B 3I9NA 1FNMA 1U0EA 4F11A 2JLVA 3RG2A 4D8UA 1C7ZA 4IDCA 4PGHA 2IH4A 2OA0A 2O3QA 1OX4B 4FINA 4OHBA 3CMMA 3EJWA 4XPIA 3LKVA 4HS9A 4WCDA 3CJQA 3O4IA 3U5TA 3QKRA 3C1UA 4Z2YA 1PGOA 3FMVA 4OAQA 5JCXA 1WZCA 3U7FB 4U02A 4YS6A 1P7YA 1YZKA 4OI0A 4M0UA 1WUYA 3Q11A 2YS6A 3WMFA 1E2UA 5TMPA 2GCOA 3TTWA 2WTMA 3UUGA 1Y89A 3OIUA 3O94A 2IYWA 2QPOA 5LQSA 4Z49A 5C18A 4PRKA 2H5EA 2JI9A 3CBGA 3NVAA 1W36B 4J16A 2RIPA 1E9FA 2PCJA 4TUYA 2QAGB 2YIJA 3HYLA 3PIRA 1NF2A 1HLGA 5IM5A 4LYAA 3VVLA 5F9MA 2G9VA 2IOHA 2Y1FA 3O73A 1E1QA 1RCTE 1M2HA 1ZQ1A 2Z3ZA 2OZPA 2QK4A 2X3FA 3HY4A 1V5GA 2FSPA 4ZAGA 5IMSA 3R5SA 1N2SA 1NVXQ 2P9ZA 4GR5A 3X1WA 2G9ZA 4M9UA 4U0JA 5A3VA 2XXBA 1VKRA 2GDZA 3H5LA 1GGMA 1M2EA 3TL2A 5IDXA 2ZI7A 2I3DA 3BE5A 3FZEA 1NW4A 3KJFA 4N5NA 3W6NA 4R2XA 4TMXA 5IG2A 2DTXA 3H5NA 4MA5A 5H8WA 1VLVA 1KSHA 3ZU2A 2CEAA 3D4IA 1DQNA 1N2BA 4FGSA 5HBRA 4JZYA 4EL0A 1BYUA 1JA1A 4FPXA 4I5GA 5CLJA 5K8UA 2XZDA 4EYOA 4EB6A 1NI3A 3DKKA 1L3CA 4H3KB 6CHYA 1GXSB 4BVHA 4LGCA 4RZUA 4OKIA 3O91A 1UDCA 4TVBA 4AIRA 3BDVA 4JDUA 4WVFA 2IV2X 3ZY4A 1Y6RA 4PV7A 4EPWA 1KJYA 5F98A 5DX0A 1DAEA 3M5PA 2EKPA 5JADA 1ESDA 2Y8EA 3KSMA 3L6OO 4BVFA 4JHLA 4CMBA 3VDXA 3VPSA 3C8UA 5DHFA 5EPUA 4V0SA 1U7OA 3VBCA 2HW8A 3NDBB 1DBPA 2XTNA 1L5LA 3BJMA 1EDDA 3QPAA 2A9FA 4KRYA 1E1CB 3GDHA 4RWZA 1LWOA 5LN1A 1LQUA 2AXPA 2WP0A 3E9RA 3ZWKA 3S2GA 1FW8A 1LI5A 4TL8A 2F9LA 4DSOA 1TQHA 1XN1A 3TVYA 4E5YA 3A4VA 4N0PA 1XROA 3F74A 1J49A 2DGDA 4UOQA 4BO3A 4MEJA 3FTCA 4YUZA 2CLFB 3M9WA 4I5FA 4PS1A 3BSYA 4D0LB 3I9V6 4D2IA 2P4HX 3WRVA 2Q6VA 4WKGA 2QN2A 3BCSA 2XD4A 4QEZA 1Y8RA 1EDEA 4MAFA 4LDRA 4RNDB 3NJRA 1P4HA 2VP4A 2J3IA 5TF0A 3U09A 4F2HA 3K0CC 3HXMA 1V16B 4Z9AA 5BXYA 1WXGA 5CTJA 4IYJA 4IS2A 1UJ6A 2AG5A 2D7DA 1W4RA 1ECFA 2QMHA 2YJ4A 3E9CA 3AF6A 4R0VA 1NVEA 2W2KA 4AS2A 1GTZA 1T13A 1R27A 1P4JA 2OORA 2YBDA 4CEIB 1DP4A 3EIFA 3T4EA 1NI4B 2FEAA 3WFJA 2IXGA 3AEUA 4KTVE 4O2AF 4IDDA 4NF2A 5D3ZA 3ZQUA 1QNFA 2XECA 3BTSA 2W7TA 3BULA 4FONA 4X6UA 4QUIA 5FA6A 2YL2A 4V0NA 5J5VA 3MMZA 1JFTA 4H1VA 1NUPA 4UHDA 4JJEA 2D5IA 1MHPA 3VPBA 3E3OA 4EP1A 5JTUA 1MO3A 2W6QA 4H6XA 3QY9A 4FFPA 4YASA 5DFAA 5IVDA 1JFVA 5TX7A 3ZDQA 1XN4A 1N3LA 4IHJA 5H59A 2IHJA 3T61A 4C7BA 3WP0A 3DMPA 5F3DA 3VAZA 3MUNA 2APJA 3SYTA 3DBHB 4AJNA 5C4GB 1FFHA 4RF5A 4BB0A 3G2IA 2IEGA 1AS2A 3C41J 4FGLA 4OX9Y 1Q57A 3V8QA 5J2TA 2WU0A 5JAHA 4AMZA 2D59A 4BP1A 3B1VA 4CM7A 1L5WA 3QKIA 1Z7BA 5CXUA 1MKYA 3BUSA 1WHSA 3LRPA 4Z4HA 5HW0A 4XPIB 5JPIA 2RCYA 3QHQA 4UM5A 2KPOA 1CS0A 5J2UA 5H02A 1W25A 3PV0A 1CNEA 1QYDA 4Q48A 3VPFA 3NG1A 4GZLA 2ERXA 1N9KA 3EXG2 4XQ0A 4JI5B 3U48A 3AZPA 4AB1A 3B3FA 3FFWA 2CVZA 1RCFA 3KOZA 4KPUB 1KL7A 2A9JA 2BEJA 2HJRA 4JB8A 4D41A 1F7VA 1OWOA 3WDKA 3L5KA 3LHFA 4FR0A 3O3CA 3SIPA 3TZ6A 2NN3C 3VPXA 2NPIA 1J99A 3DXYA 3PD1A 1KJJA 2J9GA 2ZYRA 1NBMD 3ZJVA 1Z4OA 4TTSA 4C4OA 2WNSA 4MI9A 4JI2B 5F5LA 2ZTVA 1S2IA 1OQAA 4H08A 3V4PB 1JR6A 3K0EA 1P5RA 1QV6A 5IP5A 2MYTA 3ICQB 1PDVA 4LZLA 3D6TB 4N5MA 1F1JA 3OF5A 4DNFA 4NV0A 3Q9LA 3KIPA 4QYTA 3FOCA 3E48A 5FNZA 3KB2A 4GKKB 4GICA 4D4GA 5PNTA 3W6OA 4YMSA 2ZSKA 1U2ZA 2NTYC 1EDZA 3FNHA 1HRKA 2WYHA 2YWRA 4E5NA 1QCCA 1A76A 4Q3OA 4YPOA 1EG2A 1UBHS 4C0SA 4GKBA 3WX0A 3EGEA 1L1EA 1C50A 1QKIA 3OE4A 4J1TC 4QWMA 4C0JA 5BV2P 4P54A 1F0PA 3TINA 1JX6A 3FM9A 1E6CA 2JD0A 3RHTA 4QPJC 2D1SA 4FIDA 4EKGA 1IK6A 1D6MA 1PFQA 2OGTA 2VR1A 5GZ3A 3AY0A 3VC3A 1A9OA 1WWKA 2AMYA 1V48A 4KLCA 2FZEA 2YRXA 1SVOA 1R0XA 1J6UA 2ZTHA 3KYBA 1NRJB 4PVCA 5JZMA 5EIWA 1PL0A 2C2BA 5D1HA 3U13A 1KOJA 5DW3A 5A04A 2X2PA 4MUMA 4OQYA 4XIIA 821PA 4MZXA 3WBBA 2G76A 1Y37A 5KVSA 5FIUA 3AZOA 2CFRA 3ME5A 1T4BA 1WR8A 3OPQA 3QY0A 3W3AD 5IAAA 3R0JA 4AF6A 4KQHA 2PTGA 1PZXA 3Q9UA 5AUOB 5KTOA 4BV3A 1DFIA 4DC1A 5FUYA 1CB7A 1M74A 2J3EA 2W2VA 3DOIA 3UMJA 4FM9A 1YF3A 4P4TA 2IY9A 2F48A 5AM0A 5FAXA 4CLDA 3RUCA 3TM4A 1WOMA 4F9TA 1E3EA 2ECQA 1B6RA 3NXKA 5B2EA 1IEVA 2GEBA 1VPTA 1XCGB 1J07A 5JCJD 3CG0A 3KT8A 4CIBA 3K6SB 2PL9A 4QBFA 4EJ0A 3TE6A 1KK3A 4IDPA 1I6MA 2XD9A 1BHO1 2AYZA 4O4HA 3RS2A 4AICA 1M75A 3N3BC 2PHZA 2WSIA 3U62A 5G41A 3PQ3A 1UJNA 3LXMA 4X54A 1SQ5A 3PUKA 2C5LA 3ZJYA 1Z47A 3FNRA 5A71A 1K98A 1P0QA 1BRTA 1M6EX 2A1UA 5DV9A 4YRIA 1QRUA 3L05A 4V0KA 1EXVA 1DOAA 5AHRA 4RTNA 3FDZA 1UQRA 4RV4A 1XCLA 2Y9MB 3DQPA 4RY9A 5FFFA 4MWOA 1YJ8A 3AKYA 4EG4A 1HDZA 1YCHA 3KO8A 4FMCF 2WI8A 4ZZ3A 1Y48E 4HAUA 5K0JA 5IYZA 1U0TA 3M4NA 2I29A 4E7PA 3HV0A 4XKJA 5A62A 2ZI9A 1P2SA 2BP7B 5AIBA 4BRWA 2ZTMA 4LXXA 1M2VA 5JZVA 3NBYC 3BMCA 5AW1A 5JVDB 1RJFA 1V9LA 1KDOA 3IRUA 2GF9A 1CY4A 3TLYA 2VDMB 1Y7LA 1DT3A 1JAHA 4C21A 3FGOA 3C5VA 4DILA 3SS8A 4TRJA 4EGQA 3EZNA 1QPGA 2DBRA 2M2IA 2QN9A 4ILEA 2OESA 2YW9A 5IFLA 2CNWD 5ALTA 4JL6A 2PPVA 3SZLA 5E2IA 1G63A 5CXSA 4WDRA 4F6CA 4QO7A 1A9ZA 2J5BA 3GXBA 1MHTA 2J0UA 4KR3A 4K03A 1ULSA 1EZZA 3RFUA 3PXAA 1BXRB 4L5AA 4R1TA 1JLLA 3T3OA 2D3WA 2GSDA 3OZWA 3QEMA 2BI4A 3DTVA 4Y1RB 4GKJB 3ASUA 3H2KA 1SVWA 1SEVA 5EMNA 4HWPA 4YCMA 1PO7A 2RHTA 3Q10A 1SXPA 4W9NC 2XYHA 3NTVA 1X2EA 4IOJA 2RI1A 2J5QA 3CE9A 3KFVA 4J2HA 4MLDA 3I4LA 4ASUA 1XZHA 3ZV4A 3HUTA 1MGPA 3R24A 2D0IA 3CURA 1P1CA 2AZTA 3FWPA 4TMKA 3DXXA 1Q77A 3QYFA 3EXHA 4OGWA 3OO0A 4QUHA 4YMIA 2PYZA 4W82A 4XD2A 5JU6A 3MAJA 3EEQA 1XJCA 4NMMA 4UBNA 5ALSA 3M6IA 1U2EA 1LBEA 1NG1A 2XT6A 4GLBA 4MUBA 5G1OA 421PA 4ZHQF 1T0UA 2BF4A 1G8HA 2HK7A 2D1FA 2IUTA 2XF8A 1QZ3A 3KEOA 4DV4B 3H13A 1QHFA 1K4YA 1E7QA 3Q3GE 3I1FA 3L2OB 1M2NA 2P9GA 5BN1A 3M2PA 5JJ5A 4Y6QA 1FSGA 1YRAA 4D8VA 3NZEA 1T36B 5G3ZA 4EY7A 1AKRA 1BCRA 2H2GA 2PZJA 2WK1A 2X0IA 1YRLA 3QEBZ 1U7UA 4RD0A 3WLSA 4MV1A 2JAWA 2UZ0A 2FWJA 2P2DA 4UKDA 1FJXA 2F8MA 4F7DA 4PBSA 1D9ZA 3BOSA 4YIKA 3RGGA 1QE0A 1WUKS 1DBQA 4IZIA 2ZGVA 4IIYA 4URYR 4ZOQI 4G1CA 3OFND 1LFDB 4M99A 3L43A 3UMSA 2IEYA 4P4GA 2FWNA 5FHRA 1J8MF 3DC7A 3DOOA 1XXHB 2C3YA 3QIAA 2A35A 1AKEA 3B89A 4XVQA 2F3RA 5TT0A 2GPNA 2O54A 1P8JA 5DNWA 4O5OA 1P45A 2JBHA 5AM4A 3E3NA 4LRXA 2W37A 5DK4A 2WE8A 2ZE7A 2CLSA 2H4ZA 4N01A 5JAIA 2VJPA 3FJYA 2Y0EA 4PZ9A 3W5DA 1AGPA 4DGQA 4KQ6A 4ER5A 2OV3A 3SVTA 5CDYA 2FQQA 3SSAA 1X9GA 4AZWA 1DRUA 4L2IA 4FVTA 4OSPA 2OWEA 4MI6A 3TZCA 3D2BA 1LQ2A 2WWGA 3FLAA 1CUVA 2A59A 2HEGA 2PEZA 4D5EA 4LOKA 3KPWA 4NQRA 4YJFB 4CU2A 3DSRA 2OQ2A 2XSZD 5ADUS 3EGWA 5DULA 1W4LA 2H1SA 1AY0A 5C8DA 5JZSA 4O2AA 1OY1A 1R74A 3MLAA 2RAPA 4A36A 2BN4A 4EYGA 1NVKA 3CYFA 4MR7B 4ZCMA 2C88A 3ENNA 1EX9A 1O6FA 2C2MA 3GJ6A 3FPFA 3MSXA 2NP6A 3JV7A 1VDMA 3UV7A 4BFLA 1H3EA 2I8CA 1G7CA 2V7QD 3GLVA 2FCRA 2RGDA 5IDQA 1P91A 4MV4A 2XY4A 1U2DC 3VZPA 1QQ6A 1OX4A 3BDAA 2EKBA 5DOVA 1OH7A 1DC3A 4EI7A 5ITWA 1Z15A 3PC4A 1XCJA 2IU0A 1I4LD 5I3ZA 5DGIA 3EC2A 1A8UA 4GRIA 1NMYA 4KFTA 1YI0A 3ID6C 1M33A 3ECCA 4IVQA 4DJJA 4UNRA 5HQTA 3LD9A 2VAVA 2ZVJA 3O5AA 2HHHB 5L6LB 2INGX 3CVXA 1A8IA 2WHYA 5D7NA 4ZTUB 1JR2A 2X41A 5EY5B 1MBZA 4OFZA 1Z2AA 4CMEC 1D2CA 4GBGA 4K81B 4RY8A 2FPPB 1QVZA 1P7CA 2PIAA 5EGNA 4B82A 4YV0A 2F8TA 2JLSA 3ZCQA 2UYOA 1RWOA 3SXJA 1IY0A 4W5OA 1K9SA 2XB6A 1N2CA 3BRSA 2H08A 3WI7A 4CI0B 2PUTA 1ZU5A 2GHRA 2NPOA 3ILHA 3NBFA 4YP6A 3ZWQA 2KX7A 1EB8A 5DI3B 4UHBA 5CBPA 2O2SA 4BXOB 2FPMA 3FFAA 4O3MA 2G09A 4TRMA 4UOEA 3TOXA 1Z82A 1NW7A 1TI7A 5AXAA 1UFQA 5T4HA 3T12A 4ZIRB 4BPBA 1XRMA 2QM7A 4KQ1A 4LC1A 1ZUIA 3G5UA 4RK6A 1S2OA 1SHJA 2ZKLA 1O95A 1BXRA 4II3A 3HNRA 3V8BA 4ZU6X 4F9GA 3T5TA 4I2NA 3VU0A 4YV1A 5LBIA 4EB6B 4QICA 2AOTA 2QU8A 4US0R 2FEXA 1HURA 1FDWA 2FRDA 3U4CA 5LR6A 3W8RA 1JB1A 1SY7A 3I01A 4HEA1 3ZTTA 3QRWA 4R2LA 4U7TB 4H18A 4HZIA 3HFRA 1H1DA 1NUHA 2XQJA 1OPRA 1E8NA 1LCIA 3HKCB 3DZKA 4ND6A 4EMUA 3EAFA 3RVQA 4RESA 4R05A 5DBOA 1VFNA 1GZDA 2CE2X 2C04A 3CH7A 5LQAA 2OD7A 1DKNA 1ZRMA 1MU0A 2AMFA 2DFPA 1Q7TA 4ZVTA 1FNNA 1RCUA 3V33A 4OEHA 1ECLA 3F8SA 1XRLA 5EMJA 4P34A 1JV2B 3KEQA 2EVWX 3QU4A 4LAFA 5EKDA 1T9HA 1NRIA 2QN6A 5EJ2A 4MJLA 3NONA 3NU1A 4LISA 3WB0A 4PYRA 3OHPA 2ZJ1A 5FWDA 5L95A 2DPHA 1N0VC 1VPEA 4NYJQ 2QP3A 2W2OA 4FKBA 3ZR4B 3I0NA 2C0QA 2DHQA 2XCQA 1NAIA 3FTFA 3D8TA 2NU6A 3B6EA 3I4CA 3MHPA 1L6RA 2XUFA 4C4RA 1I94B 2O0HA 4V0LA 2FUG6 3TUIC 4EPRA 5A7HA 1JR4A 3TQTA 2VF7A 4KN5A 5BQXA 1XZBA 4FI3C 4H3HB 4GH5A 1J5EB 1FTSA 1PR6A 3CLHA 3HI4A 1JQ5A 1OT3A 4BFXA 1PN3A 5HJ5A 4A73A 2W2KB 4A0QA 3IELA 2NZYA 3UT5A 1Z4KA 4PRZA 3EXHC 3VQTA 1NW6A 5I48A 4K9LA 1NI4A 1BFKA 3ZV6A 4BFUA 5GIPE 3SLGA 5KDLA 1JFFB 1TUEA 3AP1A 1QZUA 1XZMA 2UXDB 1ZVVA 2YWEA 4HH0A 3SGLA 2C4MA 2FFJA 2VSQA 3CE6A 4HAZA 4UASA 1DMRA 5A5VA 1O97D 3WGZA 1QQAA 4PHTA 2ZFUA 4MULA 1II0A 2XUOA 5KQLA 2NTJA 4P93A 2VVTA 2ZR8A 4ARUA 4QPDA 1R6TA 1A8HA 2AW5A 4IHJB 4ZYWA 4DHEA 5ICSA 3P1JA 1JTVA 2HXYA 2O57A 1DIBA 3G0OA 1YE8A 2EX1A 2H7XA 5TEVA 4CG1A 1CHNA 2OHIA 2AJ8A 4K0RA 3X1MA 3ZZUA 4F0JA 2DBYA 3ZNPA 5COQA 1C8VB 5HCNA 2HMUA 3Q7EA 4I99A 1XP5A 4FOSA 2V6IA 2DCUA 1FP7A 2RONA 1XEWX 1FDOA 1PS8A 4TYQA 3ZCPA 3BL8A 2YV2A 2VSXA 2C4VA 2Q4RA 3BYZA 1JZSA 3CJTA 3LCVB 2BHRA 4UHJA 3WK8A 4MKZA 4BCCA 4CN8A 1NI5A 4UU1A 5DW0A 4E5MA 2ZYTX 4ZJUA 2I2BA 1JLMA 1RXEA 1HYHA 2N1BA 2WJJA 3AF0A 5AVXA 3NMUF 4LHYA 3JWGA 1G6HA 3G59A 2GA8A 3TQSA 5A9SA 1QGAA 3EZ7A 4XLZA 1ADGA 1E2PA 4F1WA 3E27A 5E4TA 1ISGA 3FW1A 4UHCA 2FW0A 2B78A 1Q11A 2XRFA 1R8XA 2Y67A 3L7BA 4TN5A 3QEAZ 4EGJA 1S0UA 1QHNA 3CRMA 5K8TA 1SA0B 2GCEA 2PZLA 1P0FA 4IFTA 4R2IA 4QFCA 2IPNA 3X1ZA 3NHFA 3ILVA 3MJSA 3UKJA 1VE9A 1MPTA 1MOQA 3GEPA 1DG1G 1Z8NA 9LDTA 2A8YA 1PNOA 4UZFA 1TQ6A 2G80A 4Q93A 1P2BA 4DR5B 3DMRA 3NKLA 1E6UA 3IE0A 5EE1A 2H1VA 4RK5A 2AMVA 4M9SA 2WQ7A 4CUJA 3O21A 5H7XA 2XVYA 3DE2X 1M8JA 4QASA 4ZIRA 4JBWA 1W5BA 4OMDA 4F21A 1CF9A 5KSZA 1H8ED 3WMXA 3AG5A 1NV8A 1SM4A 5K2OA 4FBMA 5E2AA 1L7NA 2W48A 3SU8A 2W98A 1FLDA 1ZXLA 3QKWA 2E5FA 4MJXA 2GXSA 5TSDA 4DPKA 4XX1A 2WSSA 1FVOA 1POWA 2Q1XA 3K15A 3FCEA 3NHYA 1YR7A 1J7JA 4PRYA 3STXA 1C30B 5KAMA 4M1QA 3E0QA 3FUWA 1QX4A 4MP6A 4TT3D 1B1AA 4OAPA 1IN6A 2C96A 4JBIA 5FWYB 5FH9A 1A9XB 4QUEA 5JCJA 3S4YA 1S8FA 2WM9B 2B37A 4HDMA 4RS4A 1E4VA 1T6BY 3ZH9B 4ZEWA 3AEXA 4PX2A 4JUBA 2V0GA 4OHXA 4D46A 3HVHA 2P5TB 4Q03A 4RJKA 1MR3F 2H7YA 3IDOA 4QHTA 1T0JB 4Z8YA 1ZM7A 1ZZGA 4CV2A 4NCAA 1X1EA 2WJZB 2YDYA 3S3TA 1NBEA 1YNOA 4BNKA 2PK3A 4CG2A 4DNPA 2WWYA 1DO2A 4AYWA 2QTMA 4HB4A 3OURA 2BIFA 2BMDA 3TBKA 2EJVA 1E2HA 2JF0A 2Q3FA 3UAZA 4PN3A 1OI7A 3L4JA 3V1TC 4ND1A 3GP8A 4Y1EA 1ABFA 5LD2B 3LBAA 2IS6A 3EA4A 3UTDA 3MILA 1MX9A 4JY7A 1JWLA 1KHTA 4HVCA 2CD7A 2OV6A 1PNRA 3L7IA 3E1GA 2QQ5A 2Q2QA 5IZCC 3IQIX 3V8MA 1WW2A 4DY4A 2VNHA 1DBIA 1IUOA 4R0NA 4UJ5A 4DWJA 3D64A 5EMHA 4D98A 1ATIA 2XCTB 3GFFA 3OF3A 1V1MB 3M7IA 1R0CA 5ALWA 2FXIA 3W0LB 4B2IA 1A8SA 1KQPA 3H1EA 4RS3A 3RB8A 5CT4A 1U4NA 3QPWA 4QUGA 3FHTA 4JGBA 3BIWA 1YC5A 3RAEC 3GVHA 4IOMA 2AJDA 4ZVKA 4CZ2A 3AT1A 2YFYA 3LGAA 5JDCC 4UU0A 3Q6IA 3UFXB 2X58A 2O2ZA 5FLYA 3WMGA 1YBAA 2FSGA 2FW6A 2F6RA 3P0JA 2CJPA 4URHA 4M37A 4MGIR 1PHPA 4WECA 4K26A 4M1EA 5AVZA 4LYFA 1XLWA 4CT5A 2OHHA 1G0NA 1M6HA 3CGGA 4DRXB 1GEEA 1DDIA 1RWQA 2QPLA 2N0SA 3MTJA 3NIFB 4KIUA 1I1OA 4Z86A 2RH9B 1Y1TA 4GVPA 3ZD7A 2TMYA 4HQKA 2EWVA 2HSJA 4L9WA 3BJRA 2HGSA 5D7BA 2GF2A 1I6LA 2KQUA 1UM8A 2ZIEA 5CT6A 1GPAA 5EE3A 4BCBA 1QIKA 5T64A 1X7XB 1SCDA 3FRJA 1FXWF 1OLOA 4H16A 5H0IA 1NTOA 4RVHA 1KIMA 1YB2A 1J8YF 1B2RA 4JXJA 5JZBA 3AM1A 5LB4A 1PJ4A 2EFDB 1TLTA 3EOAI 5BW8A 5IPFA 3NKVA 5ILGA 4PFJA 1ONNA 2IP4A 4E46A 3K16A 3B38A 3IPCA 3EIEA 5EKUA 3FYUC 3ETCA 4A8HA 1FRQA 1EA5A 2JFHA 3NOOA 4ML3A 2JB9A 3L1KA 3L6BA 1VJDA 4G56A 4N1AA 4BV8A 4DR1B 3K7EA 5EIBC 3GL9A 3TTTA 4XARA 3EY9A 3PLNA 3X43A 1TJNA 7MHTA 1LDYA 4S1TA 3G2PA 3D6MA 3H75A 4YDRA 5F78A 2R6ZA 4UM8B 5KWVA 1CXZA 3DEAA 4UAVA 3K70B 1EUYA 1E32A 3L9XA 1YCDA 1OHHA 4GZ6A 3CX4A 4R1SA 5KSYA 1GQQA 2WB2A 3PT9A 1Z5PA 3EYWA 3ZGLA 1AA9A 1EFHA 1GL9B 1TADA 1TVCA 2FFBA 3FCUB 2GWRA 4KUGA 4LNHA 5IK2A 3TIFA 4F5WA 1GN9A 1WF6A 2EKQA 2OZVA 2PD6A 1ZMRA 2BFWA 3TFOA 4FSHA 1IE3A 3R2JA 4RJTA 3P9PA 3Q5EA 1GFSA 4DJ5X 1SHUX 2P6OA 4KBYA 1V4BA 2PGJA 4KQEA 1T6YA 2JHAA 1T36A 1D2MA 2RI0A 2CXUA 4IUBS 4YREA 1Q2UA 1ZLXA 3N07A 1XEFA 3FMPB 3R0ZA 2BGKA 2E6UX 2Z2YA 2VHXA 5FO0A 3T06B 2PRKA 1GCIA 2O8BA 1DARA 2C3PA 3LPAA 5HDQA 4DR4B 2EQBA 2XMPA 3B78A 3VRHA 1IH8A 2P4QA 2Q62A 1ZVJA 4LRYA 2X3UA 1Q0SA 1TCVA 4LBWA 4HK4A 4A4DA 4RTQA 1D8TA 3ESCA 3IMGA 3B82A 1AX9A 5FEUA 4CF3A 1H65A 4ZMSA 4JKYA 2FR1A 3AO0B 4QT4A 4PO1A 3T7DA 1RAEA 4A8PA 5I9BA 4NKRA 1IHYA 4JWKA 3RBVA 4OQFA 4O4JA 1G8AA 3EVFA 1I33A 5AVQA 1HQCA 4Z7QB 4OU5A 2ADMA 4Z5XA 4HGNA 4GPD1 1RHRA 4RABA 5U4QA 1L4KA 3LDUA 3F7MA 1TYAE 3ENZA 1DAFA 3LA6A 3W1VA 2OC4A 1CUAA 5D5QA 4GPBA 4NOJA 3P19A 4D4HA 2AC7A 2V6FA 3VPCA 2QRVA 3WL7A 7ABPA 4FNOA 1OZGA 5TQJA 3OQIB 3BBPA 3RYHB 4CG0A 2AKYA 2XVAA 3ZVLA 1QRSA 5IWCA 1G2PA 1N5IA 2RE8A 1DJNA 3LYUA 4I4CA 1FYWA 3OJFA 2JD2A 3DYVA 4JX8A 4M8KA 5FPTA 1VECA 5JSYA 4YRKA 5AW2A 1GPH1 4C4PA 4O2AB 2QTCA 1HEUA 2K6GA 4Q9KA 3O3OB 2ZBQA 3O1LA 4QFMA 3MRVA 4N5LA 1E2NA 2YJTD 2ZBDA 1BGVA 1ADJA 3TB6A 4Z99A 3FCOA 1C7QA 2FSIA 1L5VA 1GL7A 2O1XA 3LY5A 1O6CA 3EGOA 3PFGA 2OR3A 2VYND 3ONFA 3F5DA 3QVKA 4IO1A 4L7QA 4QX6A 4FJ1A 3ZKAA 5FLXA 3G0GA 1SVMA 3FKSD 3RREA 1SKYB 1XBTA 4BNLA 4Z4IA 3ZNNA 4XGKA 2IYVA 4JYMA 3DCYA 4MMZB 3H2HA 3Q15C 5EMLA 1SUIA 1QIFA 1E9CA 3FRIA 4M54A 2HZBA 4D92A 3OCVA 4Z9YA 1SBNE 1NYLA 1Y5RA 2IQIA 4BP3A 2UYYA 2QRPA 5FOXA 1ZMBA 4DRXA 4E12A 1B0ZA 4MV9A 4PC3A 1L1RA 2QDKA 3L1IA 3BD9A 2I2FA 3VNBA 3W6ZA 4K0KB 3RVLA 3STVA 1PT6A 1G5HA 2H52A 2CYCA 1XZCA 4UUBA 4CF4A 5H4GA 1L5NA 3RWBA 4DCMA 1PVVA 3W78A 3T4PA 5IT9A 3QBVA 2YBEA 1QR2A 3EZ6A 3LPMA 1G4AE 3MELA 2NPFA 1GKLA 1MPXA 2ZSIA 4YI5A 5GJCA 1HYQA 4DQDA 3ICWA 4JJIA 2DR0A 3G8BA 2B25A 1KJIA 3UUFA 2ETXA 2ACKA 3PHHA 1JJFA 4LJ5A 2XMCA 3FDIA 4TMTA 5CB8A 2ZETA 1AS0A 4YP1A 3T1QA 5K3EA 2PJDA 3QE9Y 3REGA 3AR8A 3ZI7A 2WU4A 3MRXA 1GGJA 5TNXA 2GZHA 4CMCA 3OLZA 3ZHUA 4RM2A 5FUWA 2JCSA 2PGDA 1AIPA 3ND6A 4E07A 1SIWA 1UC4B 2MMCA 2Q9CA 2XGGA 3C8HA 1CG6A 3VHQA 2XLCA 3PKJA 4UQOA 5DX8A 2OT3B 2V97A 1DX6A 3DOEA 1VQ1A 1XG5A 3KXIA 1S3IA 2YHSA 3C3DA 5L3RA 4DTIA 4D43A 4CTOA 4YMUA 5A3RA 2C8KA 3HKCA 2R7LA 5BNWA 1XU9A 1MC8A 3R7WB 4MIYA 5TS2A 4DA7A 2NYUA 1ZS9A 3BHNA 2JKYA 3HJCA 1ORWA 5FTWA 3RT9A 3WZMA 3ZIAA 5BWLA 4US2R 3NKFA 3KQKA 3BPSA 4AU1A 2KHZA 3GUYA 2Z5LA 4XFKA 5DEIA 1XMVA 1L5KA 3F5SA 3DWIA 4QYIA 3R3WA 3VGPA 1MO4A 4B9AA 1GQYA 1MCZA 2ID9A 3WTBA 1GTJ1 1JHRA 1VLJA 2ORVA 4NX2A 5JSKA 2FMFA 3X44A 5B57C 3T1HB 4CNQA 1K89A 5CBKA 1HE8B 2IC5A 3TOCA 2JHFA 3O0TA 2RKBA 1E1LA 5DTRA 2YMPA 1PZMA 3CLKA 1XDDA 1XO1A 2DPLA 2ZJBA 3E7DA 4JVMA 5AYVA 3FFXA 4OXIA 1XPJA 4NEGA 1A82A 1KKMA 1RPTA 2FK7A 2A57A 2KBFA 1NR7A 3IBTA 3K09A 1CKEA 4OB8A 1EUZA 4TWAA 2JIRA 3ECSA 1CNMA 4RMJA 1XKQA 1N9GA 1TYEB 2HPHA 2R60A 2GO7A 3ABZA 1WDLA 3VH4A 4DVJA 1WPGA 2ZSBA 4DCUA 4FCWA 4NBSA 3CRRA 1G5FA 2QYTA 3E1SA 4MHOA 5A1JA 2REXB 1KR2A 2FLVA 3NBXX 1RQLA 3ZNQA 4OXKA 1RQRA 4BATA 4LPSA 1GRCA 3NBQA 3EIOA 1WMBA 3PDIB 4PBTA 3F7NA 4B0OA 5U9CA 2GA9A 1SUAA 3C6XA 4AS1A 5E9QA 3EE6A 1JT2A 2O3SA 5F52A 3UG6A 2YRFA 4YCSA 5F1KA 1X8XA 3KP1A 1TYCA 2JIMA 3GJ8A 1IBMB 1E2DA 3GLHA 2GPAA 1P5JA 2C03A 4OLBA 1FTQA 3DVLA 3QJYA 3G5LA 3RYHA 2HF9A 3C5CA 3SYMA 2Z9BA 3KQSA 3G82C 4E32A 3C3BA 3NHKA 4EI8A 5K4AA 3E4DA 3G9TA 4AG6A 1YZHA 1SBCA 3S1LA 3FUVA 5JSQA 2HA5A 1A69A 4FR5A 1Q2XA 1OH5A 3A4TA 4WADA 2JIPA 3URKA 4ECAA 1TZBA 1H4VB 1CZOA 1R50A 2WTBA 4BO0A 4KDRA 3A6EA 3GDFA 3GELA 2NYAA 4GC9A 1N8KA 4MVCA 5BSRA 4J3NA 1K8ZB 4DCNA 4EVQA 2AL7A 1GNQA 4DPMA 4YLYA 3WYEA 5GM1A 2POQX 4PLZA 2XKBA 3VJMA 3QX7A 3WLJA 4EW3A 4OHCA 1E99A 2H17A 4YVFA 1XZNA 5K3AA 1DOZA 1JDBB 3IKTA 5JC8A 4OQQA 4DLTA 5FTLA 1FYXA 4DM4A 5A06A 4TSFA 5JO9A 1FNDA 3O83A 3VJKA 4INOA 3ZOKA 4PWYA 3LKDA 2IP1A 2VQ3A 2GD6A 1DI0A 3M1AA 4NONA 2VNAA 3G8AA 3MTBA 4H60A 5HS6A 1E9EA 3CPJB 2PMBA 5HTOA 2FP3A 3CIOA 4DWWA 3R4VA 2PY6A 1Q22A 3I2JA 2ZTUA 5KNCH 4N47A 3SQXA 3BWBA 1THMA 2DXIA 4LE2A 1FVXA 5KU1A 4NU5A 1ZNXA 1E2LA 1EQAA 1K5HA 1Z68A 3HG7A 4PNHA 5B4VA 3KT3A 3DDCA 5AKGA 3S28A 2Y2UA 1KEVA 4V3BA 5T4EA 5CB4B 3L7DA 4S04A 3K96A 4BMPB 2EW2A 4C76A 2ZPTX 5E3IA 4BFVA 3AW9A 2R1VB 5HOQA 3AHCA 1RMTA 2YICA 1NMXA 1SPBS 3B1WA 4GC5A 4M0DA 5DCWA 2YJZA 3RVJA 2J5RA 1CUYA 1Z74A 2EFCB 2P8SA 3CZQA 3ELBA 1MAUA 4H0CA 1SKUA 4JH0A 5DNYB 5DLYA 3WLTA 3H19A 1DEAA 2YIVX 3K9HA 4ZT3A 1DC6A 5T5QA 1PFWA 2A5FA 2BELA 1ULBA 2KMLA 1XVVA 4B3FX 2JBAA 4JT9A 1P39A 1M7HA 1Q50A 4KDFA 3TG2A 5KWIA 3U5ZB 4WNCA 2EHDA 2AN4A 2PLWA 2FZLA 3DA8A 4KUEA 4A0HA 2G0NA 3K5HA 2AZDA 3BL6A 3OAAD 4FNMA 3E18A 3RFVA 2LNDA 5A4KA 2PO5A 1C3XA 3ORQA 3EDRA 1JYEA 5LA6F 3ETEA 3LUFA 4J9UE 1FMJA 4UNPA 3A6ZA 1P60A 4JN6B 4NEQA 4HDMB 2BCEA 3WB9A 1Y4ZA 2R6GA 2XE6A 3BMXA 1ESEA 3IVAA 3KTDA 3DUWA 3MB8A 4KAFA 4FI3F 3ZUPA 3M34A 4KO2S 2BWJA 1NNI1 3WB2A 3QKRB 4GMKA 5KX5A 1AGNA 3DWGA 2F55A 1BO6A 4GNKA 1Z4IA 1I7PA 3ADKA 3DZFA 4LF4B 3T9FA 3LS2A 4ID9A 1UODA 5GZ6A 4LJRA 2ZRJA 4I3FA 2HJWA 3HZHA 3ZXXA 1OZAA 2EIXA 1P33A 3A26A 5A3SA 3D02A 3NTLA 2F17A 4JLUA 4E5DA 1VL5A 1E7SA 3SQOA 4XWYA 4A82A 1XK7A 1P1BA 3WGMA 4F84A 2QUZA 4M88A 1ZN7A 2DKOA 1RRCA 1YHZA 3GGPA 1A1VA 4XR4A 4XCVA 5F77A 5DM0A 2WYIA 1ORRA 1PR9A 3OLYA 2WUWE 3S44A 1EK2A 2QTWB 2FDRA 4YHHB 4DBLE 2PR7A 4KB5A 2QLMA 4NE2A 5AOAA 3BD8A 1X80B 3GLUA 1TVKB 3QU7A 2LXNA 2VP0A 4CLEA 1Q0LA 1ZICA 4EELA 4MQFA 4KWHA 4IJUA 2ZBGA 5GONF 4BLSA 4TRNA 1E2QA 2V45A 5K0NA 2QUIA 2X6TA 3UJ6A 4B3HA 3T1YB 2OBNA 1PX2A 3R5FA 2O7SA 1M2JA 2NU7B 2O50A 2OXIA 1SUCA 4JEUA 3AX6A 3BE6A 3G8DA 1LGYA 2BUCA 3LDHA 5LBTA 1SUDA 2JFBA 2FQWA 4JLSA 4L51A 4ZZ2A 3RU2A 4YRLA 1PGPA 2EZ8A 1J90A 5HM6A 4GSLA 1RYNA 3E8MA 3UY4A 5AUQA 2O0LA 1Q0PA 5LQCA 4QGAA 1JDUA 3ABRB 1N33B 3DE1X 5G1NA 3RG8A 1HK7A 1U3FA 3H8JA 4ZKDA 3GLIE 4X90A 1T26A 3I64A 4ZQFA 1YXMA 4OL9A 2XXAA 2H65A 2JCGA 2QUAA 2V96A 3KX2A 4TLCA 4BDTA 2C2ZA 2J6BA 2GPWA 2ZIGA 3MWKA 3ROMA 3WSVA 2AR0A 5DGHA 3WRXA 3U81A 2ZYGA 2OBLA 3DZ8A 3O8LA 5IXJA 1MJNA 2L82A 2SBTA 4KWEA 4BBAA 3TMKA 4BMVA 4JX9A 1XSEA 1VC2A 3DGEC 2HM7A 2OILA 4RY0A 2VYFA 3T9BA 4F3YA 1GGHA 3ZHQA 2BYTA 3GQBA 4XCXA 5IJXA 3DTVD 3X1XA 1YAHA 3P45A 1W5EA 2QLFA 4A6EA 3AUKA 4Y1GA 5B4TA 2OXFA 1J09A 3OVMA 4XPZA 5ALLA 5TARA 3IIEA 3U16A 1K27A 1QMGA 3CQ9A 3BQNB 3A2MA 4AY5A 1XKTA 3ZVNA 2J6HA 4EGCB 1E4OA 1A7UA 3DCJA 2BR3A 1DOHA 5KTMA 2JBAB 2VA8A 4INJA 3RC3A 3UANA 2QF7A 3OU7A 3PNBA 1T9BA 4BFTA 4CTKA 1NW3A 3I42A 1UADA 2JBWA 3RC1A 3FPCA 3DZGA 3N2YA 2YWHA 5KNLA 1L5MA 1XXHE 1HNZB 1WU8A 1TL7C 2Z2XA 1F12A 3IJEB 3TK1A 4KR2A 1W4ZA 4QU9A 2NSHA 1V41E 2QL6A 4E3ZA 1ISMA 4O4IB 6PFKA 1F8FA 1X9IA 2QTAA 1RPNA 1XDGA 3DGFC 5DO9A 1EP1B 3BF7A 4S0ZA 4MOWA 1R8YA 3FPEA 4N9WA 1SU6A 4Z1MD 3MQ2A 3IPYA 2HSGA 1RIFA 1L8QA 1RSZA 3ECAA 3FTNA 4QJBA 2ZJ8A 1UBCA 1K3TA 4HLDA 2Y0PA 3PK0A 1UMBB 4G0NA 2NVWA 4MGYR 5H9VA 2VRCD 2VSOA 5CFOA 3QQPA 4YCJA 2ZIVB 5J2UB 3JYQA 1DGQA 1XTPA 2WMDA 3RTEA 1KU6A 1PJ3A 1R1DA 2ISSD 1TQ8A 4JBGA 2F59A 3W2TA 5C8YB 3J7AC 4G4IA 2XDWA 2GK7A 4JNKA 1J2YA 4RVGA 2W5UA 5J4YA 2JFFA 2ZZKA 5IVHA 2AX4A 5EPEA 5EWJA 5HKAA 3WLPA 2QRVB 2AEMA 3NFYA 3R3UA 2H7CA 4MS3B 4OHZA 2NP7A 2QUJA 2GPBA 4HQRA 1RJDA 5HG0A 2HV8A 4F86A 3OT4A 2JVKA 1T3TA 2D62A 1IY8A 4IX9A 4BCDA 1KOGA 2B9EA 3F5QA 1Y6ZA 4AYTA 3I2IA 3I8OA 2E5WA 3MUFA 3WIEA 4A16A 3EF1A 1UBMS 1V96A 1WABA 5ALXA 5HS4A 1NR5A 2AV6A 1QSGA 4ZHQA 2CSUA 2P9TA 4AP9A 2I1LA 4NBKA 4NJOA 5BWBA 3B8HA 1HQYE 1GN8A 1G20B 3EXAA 3FYCA 4UM9D 4UUNA 1C1XA 5C5CA 3O31A 5F3RA 3IULA 1QVVA 5JXHA 4OKSA 8OHMA 3R9WA 1TPZA 3EDYA 3MBIA 4JELA 4RMGA 2X0EA 5DDIP 4DUYB 4BLQA 1NXXA 4B76A 1IPHA 3IBYA 4L08A 1OXMA 1X15A 5EJ8A 5SYAA 3DWEX 4YT5A 2EU8A 5CDTA 2QX7A 1F0NA 1MC1A 3BVPA 3K4PA 3Q72A 2OV2A 3NEPX 2V7XA 1INLA 4IIGA 1ULTA 2WNHA 3OIFA 3OJEA 4XUDA 5JXWA 3R7AA 4IWNA 4R7TA 2V58A 1Y6FA 4CR8A 3PRHA 2YR0A 2ZE8A 3PCXA 4K9DA 4KKXB 1OAOA 3HKDB 4MYUA 4WD3A 4ZREA 5EZSA 1KGSA 3H2IA 3MWGA 1R9JA 4HQNA 2L42A 2ZTSA 3GF4A 1KYYA 2JW5A 2ZZNA 1I4EB 4YAIA 5HUJA 1U2RA 3ACDA 2GF0A 5JALA 2FCAA 1U7ZA 1SD1A 3WE7A 3T9CA 4BKUA 3CVYA 4M21A 2QW8A 1JHAA 4JV5B 2QLNA 3F3MA 1EP2B 1DXOA 2ZRDA 1JTEA 3U6KA 4ZAYA 2D5LA 4HRVA 3MWDA 4MKRA 4AD8A 3RSCA 4XIFA 5J4HA 2OORC 4KIWA 4WT7A 3RSOA 4PXYA 2Q1WA 3GVPA 3W4JA 4AX8A 1Z7YA 3QVUA 2FMHA 3DMFA 3IQXA 5LNK1 1NQ5A 4S12A 2F90A 3R9IA 4LYDA 3RQIA 2XYQA 1Z16A 3L0PA 4QC2A 3L0ZA 1TA4A 2HMAA 1YACA 1HTBA 4L0DA 1N6NA 2EZ9A 3VC1A 3IJRA 3ZYCA 4RV5A 5TMEA 2I6XA 5HGXA 2QNBA 3C97A 5DYIA 1NJFA 4A0RA 3CMCO 4CGZA 3AXTA 2QTRA 3KDSE 4WESB 4DABA 2J87A 3GBSA 5KVQA 3IILA 1IJFA 3TGLA 2P65A 1YR3A 5JAUA 3OQHA 3LUPA 1M7BA 2AQIA 3BRQA 1OFVA 1ZH6A 3OPNA 3ILYA 1NXVA 4GPEA 4K2AA 1TTTA 1E6EA 3E7WA 2VZ9A 2RC6A 3AM4A 1NPTO 3QPUA 2FY8A 1XRNA 1U0LA 5BRJA 4MWCA 4WXMA 1QHHB 2QZ4A 3QUTA 4S1WA 1PDWA 4OPMA 3ZDXB 4A1FA 4DCOA 1YKGA 4EENA 2E55A 2H1OA 1VLHA 2XA9A 2HXSA 1JPJA 1XR3A 4KOAA 2HFKA 1L7VC 1NVWQ 2B0JA 2PIDA 4O8CA 1U2QA 3R0XA 3ZGVA 1EUCA 3AR3A 1ZMTA 1TXGA 1Z18A 2P0AA 5DNUA 1VPWA 1LF5A 3KXLA 5IYZB 2G07A 4IPTA 4H7PA 3N2IA 4MPPA 4R8SA 2D5BA 3OU6A 4WTOA 1T2VA 4WSOA 1MEEA 2A33A 3I5AA 3OEHA 5IAKA 4TLAA 3MCAA 3LG2A 4HDSA 4HN4B 2OM2A 1AZSC 1E94E 1N9GB 4J76A 2ACWA 3MTAA 5CW2A 1JYFA 4M0LA 4GMHA 5B6PA 5A03A 3IP1A 1RYZA 2WWRA 3MAAC 1QKKA 1UBGA 1LDBA 1E63A 3AYZB 3QF4A 4Q1BA 5ICEA 4Z4QA 3KVOA 3L4BA 3P5SA 3ZN2A 5JNVA 1QFMA 1VA5A 4WLUA 1YOBA 2JARA 3B9BA 1AC5A 4L8LA 1GADO 3PDIA 1QH0A 2FPLA 1W36D 2Q8PA 5SY6A 2V7WA 2O05A 4X0EA 5AIAA 1NXSA 3IEPA 4QYMA 1TD9A 2ATCA 2LIVA 3H11B 4R2MA 3TKLA 5CVVA 1YWGO 4AMGA 1JLLB 2J3LA 4TRRA 3GAZA 2H4XA 1Y7IA 1AM4D 5ER6A 4DIDA 3RFCA 3ITKA 3LBFA 3RI3A 1RC0A 5ED4A 3SJBA 2RSLA 4BNZA 1V45E 3OC0A 4YMTA 1O54A 1N5LA 1LPAB 4UMVA 1P75A 4XZ3A 3VBEA 4DHWA 3I5UA 1OXBB 3Q0EA 1F4LA 3DBOB 4YWHA 4GQAA 2I9PA 4NZ9A 3F6SA 3VR4H 5JD6A 4NEHB 3F78A 2Z5FA 4ID3A 4DUZB 2DQZA 5TRTA 2PU7A 3KQHA 1NWCA 3UHFA 3S1SA 1UK9A 3CSSA 3RUHA 2J46A 3KWJA 1QHGA 4LOHA 2Q41A 3USCS 1Q74A 3PVCA 1Z6PA 4YRQA 1R12A 4I9HA 2H1FA 2GESA 4G8CA 1BE6A 4HWKA 3SICE 5DLDA 3P20A 3EGDB 1Z35A 4S35A 1D1QA 2CVPA 3KV1A 2HO4A 1Q1ZA 3BC1A 5KC8A 1RJ9A 4J7UA 4QM6A 1CJSA 1RBMA 3ENQA 5C80A 3Q1KA 1HYBA 5LDGA 1G6Q1 1NBOA 5INTA 2E4VA 1JHUA 3HDVA 2FOIA 3MCVA 4NU8X 3U3JA 4KYUA 1JSXA 4Y6SA 3G7UA 3Q8LA 3QUAA 5J23A 4YCBA 3FPJA 3A2NA 3DXZA 3HEMA 4RM3A 4S3MA 2YXEA 3BHIA 4PLHA 2FUKA 1Z7WA 3AF5A 2XYRA 5AKJA 3U7JA 1YI1A 1RADA 2QE7D 4LJ8A 2WVAA 3UUEA 4HMQA 3MWDB 4B45A 1F4VA 3GEHA 1SFRA 3KOXA 1MTOA 3DDWA 1L5FA 4GWKA 1I13A 1ETHA 4IV8A 2VZ8A 4ZARA 3ADOA 1MV8A 5LQJA 3KNZA 3TLJA 5EHNA 3C8MA 1VG9B 2XVXA 5A5EA 4BX3A 4LK3A 4FDTA 2AXQA 4KQXA 4LZZA 4BAZA 3H99A 2CHQA 4R31A 2IP2A 2IT1A 5DM2A 3NXSA 3R8CA 4B73A 4PAOA 3DL2A 1WRBA 4TTQA 1U3VA 1PR3A 5G4KB 4WESA 5JRDS 3HNOA 3B12A 3LK7A 2GN2A 3DG9A 4HFMA 3VOSA 2UVPB 5FPYA 3A06A 5LBUA 4HEHA 4Z0NA 4F9FA 5BO5A 4EFKA 1CS4C 3AR6A 3OKAA 2R7NA 2WAYA 3EULA 4N0MA 3A10A 1MX5A 4NYJR 5IKOA 4C0WA 4LV5B 1IG0A 1VMEA 2WSSD 4DIBA 5CK4A 1YQGA 1K7SN 3JCZA 4QQFA 4QVKA 4ARAA 3DT8A 2DP4E 1AZWA 4C1NA 1CPYA 1NJ6A 3UJNA 5CG2A 1JXQA 3M81A 1P3DA 5AUNB 1X1RA 2A1TS 4HNHA 1JHPA 3EUAA 3Q0TA 3RIXA 5A6SA 1NQUA 1VFPA 1T1GA 4M60A 1XVIA 2DPXA 3MXTA 3M4JA 1KBZA 2EKDA 2P35A 3ROKA 2BR4A 4A5SA 5CEFA 2VDRB 3CKKA 1NT4A 3LOUA 2C2WA 1EUCB 1PSDA 4IIXA 4DSZA 2CLKB 3PI6A 3EZ9A 4RCZA 2W11A 4F12A 3CVUA 3ONVA 1IPFA 3GCGA 1GM5A 3A3YA 1RJWA 2YMLA 1L1FA 1IZ7A 1YRWA 2PZEA 3FZQA 3R6DA 2XB4A 4M0KA 1HZZC 2PNFA 4MUXA 4JLMA 2GXUA 3BN3A 4U4AA 4HC4A 3GP3A 5BR8B 2Q9BA 1KAGA 4XYBA 1YDWA 4HUQA 2FPPA 1G19A 5GJBA 3AL3A 5AOBA 3SK0A 6YASA 4FX5A 2FN9A 3WK7A 1ZI6A 2ZATA 5FORA 4L4SA 3DV2A 4XWOA 4Q1VA 2PYDA 1EWKA 2H31A 2HTFA 1PW5A 3DJYA 5DM4A 2HU5A 5FV7A 3OIGA 4A3SA 5ILQA 2BFOA 2AE2A 2JATA 2WLTA 2B35A 4U7PB 3PHCA 2H57A 4P5EA 5DCLA 1M1YE 2Q1SA 1XZGA 3LDFA 1KAOA 4JUCA 4RZ3A 4EIWA 1XFAA 2IYRA 4KAJA 1RHKA 4IDQA 4ZWNA 3NATA 3QQ5A 1ZUWA 2G5CA 3EQZA 2WIDA 4OBXA 5T41A 3TAHA 4D9HA 1IBKB 1QPBA 4LN1A 3JQEA 5CLQA 2PBFA 3C4VA 3D1JA 1Y3DE 4PFSA 3SZ3A 4AJIA 5JS1A 1G5TA 4OJQA 2WWFA 2ZR7A 3MYRA 4WK4B 4Y2RA 4D9FA 1NVTA 2P2ZA 3BZWA 4FMBB 4WBSA 5IWAB 3OQ1A 3D2LA 1HQKA 2NMVA 1A71A 2NU7A 4UD6A 4N0QA 5EEGA 3T4UA 4OYHA 4KITB 1XQXA 4ZANA 3B9RA 4O63O 2Y0BA 4DA4A 1D7OA 3V2IA 4TZTA 3PUZA 4JUAA 5CGQB 3V7UA 3H7AA 5EP4A 4XJTA 1OZ0A 1YULA 3R40A 5LZ2A 1FZTA 1JILA 5A1TA 2HJSA 1PEKE 3KOMA 2XADA 2QXTA 4PX3A 3WHIA 3WIVA 2BBSA 3EYAA 5PGMA 4G84A 2COEA 2AFVA 3A3PA 4BVJA 2D0OB 1MLDA 3A8TA 1YB1A 4K86A 4XR9A 3GRVA 1PUXA 5LC1A 4YLEA 2OQVA 2QAGC 4ZV7A 2QMOA 2ZRAA 1T6ZA 2R79A 2HD4A 3KZXA 4HNRA 4LHEA 4PYMA 3AEQA 4AECA 2XXAB 5G1PA 4UAUA 4BNTA 4EDHA 1IN8A 3KEGA 1D07A 2D1TA 1ODTC 2VIIA 4B7AA 2G1AA 5CURA 3GVXA 2DETA 4WZAA 4J2TA 3TW8A 4X71A 2BEUA 5FNVB 4KIJA 5KYYA 5GADl 2CBZA 3PG5A 2DQSA 3H05A 4UCXA 3MTDA 2G7ZA 3H5VA 3AUUA 1B6SA 4UPDA 3GLGA 3IVXA 4UVIA 4I1OA 1SXJB 3HK2A 2O9JA 5EE0A 1R4NB 1G38A 2C1XA 2A9RA 2R1TB 4IMRA 3VZCA 3FVTA 2X9NA 4CYMA 3O26A 4FS8A 1KVUA 1JH9A 2CXPA 4QQRA 5AK5A 1UL1X 2GQ0A 3LQKA 5TE9A 2V6GA 2EZ4A 3ANMA 4P3YA 4WOPA 5BSHA 5BURA 2A0FA 4BMYA 2Y0DA 1AKYA 1IXKA 3NBAA 3OICA 2DLDA 2FGJA 1W85A 3WYCA 2I03A 4AKSA 1O57A 4X95A 4KQ2A 1M8GA 5I9MA 2ONZA 1XMOB 3L7OA 5ESWA 4D8TA 1L7DA 3T7EA 1Z4QA 2CUKA 2MSLA 5AI0A 3GPCA 2X0NA 4AKIA 4RW0A 4JBNA 3PXBA 3JVUA 4Y98A 1KYTA 4HDRB 1AMOA 3FA2A 3GH1A 3FYUB 3LXRA 1NSTA 1VHDA 2E4YA 2GAFA 1L6IA 1J0AA 4YP0A 4DB2A 4O4IA 3LKZA 3DEZA 1X87A 4UHKA 1EFRA 5AJYA 5DTMA 1JP7A 1UKYA 3R20A 3AFHA 2AF4C 1WV0A 1Z2CA 2YV5A 3CKMA 1VXOA 5GGYA 2FU5C 3IA2A 3DVRX 4ZOCA 1R0WA 2QYOA 3OZVA 5A6SB 3RTBA 5HKOA 2P2SA 2JEZA 3HCOA 4CKEA 3ZG6A 1UK7A 1Z2NX 5DXFA 3RODA 3TKAA 5I6DA 4E08A 2WFMA 3SQMA 4PTLA 3RUIA 4RGVA 4EHDA 1NRWA 2XBLA 1IWPB 2R6JA 2QW1A 3TOZA 5HZHA 2GK6A 1CY2A 2IX9A 5SY9A 1AUOA 1PJBA 4AUMA 4GM4A 5CVEA 4G5YA 4ZOLF 2YZ2A 1NNSA 5EJEA 2BTEA 2YHUA 2XQVA 4XWAA 3UQYS 3PQ6A 1WY5A 3MINA 2AI3A 2XNDA 2C99A 1JWAB 3H1BA 3SOPA 5C1DA 4YRAA 4CMGA 4I8DA 3KQMA 4MKGA 3REQA 1XYGA 5T8KC 1CP2A 2NXCA 1BE8A 2FPSA 2H8GA 2P1DA 3EIQA 2PGXA 3UJBA 4FD2A 3I37X 3OPXA 5I51A 3IESA 4JP2A 1T2EA 1EEXB 3EQ7A 2C9DA 5IRCD 3OHSX 3TPZA 2WWIA 3TZEA 4WK0B 5CXQA 3BWMA 2PBLA 1JVNA 2OSVA 1QFYA 2PR2A 4Q9IA 2D13A 1I2BA 3E9NA 1S2MA 1LS1A 1XDZA 1JQLB 4MVWA 2CUNA 3VX3A 3B3GA 1NU6A 2B4AA 2DPYA 3BA1A 3BWVA 5B6IA 2WJGA 4O6VA 4B3DA 4LJ7A 1L7PA 4RX1A 4C0BA 1N3IA 3S8EA 4HNQA 3FI0A 2QLBA 3FY4A 1KEWA 3NWPA 4EY8A 1JTFA 3UB3A 2QM0A 5FF9A 1A7AA 2P79A 3ZDAA 4DREA 1B7GO 1YRQA 2CLMB 2ZUBA 2X5KO 2PL5A 2VPIA 2QUKA 4JP1A 3COYA 4B3IA 5BUQA 3NHJA 1UMKA 1BS1A 1G16A 1XUOA 2CZQA 5KWSA 4HSEA 3QWBA 2LDXA 2FHSA 2VDKB 2B2NA 1YFJA 1CUDA 1NJSA 2QQEA 4G4JA 1TDJA 3AY3A 2D4AA 1WSAA 1GA4A 2G36A 5FHQA 1FW6A 3ZTYA 5KB3A 4ITVA 4OHPA 4N3AA 2QNIA 4HAOA 4XIJA 1OXXK 1TKRA 1ZHHA 3OD5A 4CN9A 3EMVA 1OD6A 2QG4A 3AEQB 1ISSA 3T35A 3ZWMA 4C7KA 5IKXA 3E7PA 1IPEA 3ROEA 1UXKA 3O4VA 4AN1A 1IB6A 3O7WA 4JLPA 1U5CA 5FPSA 4EW2A 1AKTA 1TRHA 3Q5DA 4P80A 4W6ZA 5KTSA 2ZRHA 4WKCA 1GKYA 3IR7A 3TW8B 4B4KA 1KMIY 4WXHA 2OV8A 3U3XA 3H3XA 4BNXA 3IR5A 1AXEA 5C34B 4RDCA 2JIOA 1P7ZA 2ID8A 1SXJA 2Z08A 3G2QA 4TQ9A 3EXFA 1R4NA 1T2UA 3F4KA 1GAJA 4YP9A 2PWAA 2CXNA 4IMIB 3D8HA 1SCNE 2V98A 2J9RA 3FE2A 3K0AB 4W5HA 3CZ5A 4L4YA 4URFA 1A2KC 5BRNA 1BVRA 1QNLA 3DL4A 2O4CA 3L46A 4D79A 2CJYA 4DUGD 4LF7B 1T91A 2ZS7A 1W85B 1TFRA 3PCTA 4UE6A 3ROQA 5AW9A 2DFKB 4OV6B 3V97A 4GGPA 2ZUEA 4E5SA 4WZAE 5D87A 2FX3A 1A5BB 5C37A 1MA3A 1JHXA 1E1NA 3GQVA 4G86A 4MSUA 1SD2A 4N54A 4LQ4A 1T9CA 5I8PA 1DAHA 1J2RA 5IULC 1ZC4A 2C82A 3UJCA 1C4XA 3UYLA 1YCGA 2B5WA 5KQPA 3L41A 1OFHA 1G7SA 4LF5B 3A1FA 4FK8A 4WVLA 3RFTA 3FYUA 3MBOA 1G21A 2DLNA 4K05A 4MROA 1SKBA 2BI7A 2AN5A 2IHZA 1YB5A 3BFJA 2F67A 3GEDA 4QGHA 1T5OA 4TQGA 3ASVA 3SE7A 1QGYA 1AG9A 4HDSB 4GQBA 2OPBA 2PLFA 3PNQA 5K8VA 4JT8A 1N5RA 4RZHA 1R6AA 5JECA 3ETJA 1FTYA 2C2OA 3L6DA 1D1SA 2I7TA 1OIVA 1SCUA 4DBVO 5IFKA 3WOVA 1AV7A 4CKEB 1X7XA 4G9EA 5A9TA 3PGKA 2B3TA 1P3JA 1HE4A 1FU8A 2J5XA 4K1XA 1CCWA 4MUFA 4BFZA 2QTZA 1M83A 4JI4B 4FZ5A 4QU5A 3BTOA 4U3JA 2IEDA 4OYYA 1SUBA 4L0CA 4U2BA 4KR7A 2EAUA 1HFJA 4H35A 3DKVA 4HAXA 2X13A 1KI6A 1H9BA 2QTBA 1Z33A 5BORA 1R0RE 4INAA 5CT8A 4LXIA 1Z06A 1CR6A 1ZOIA 2I76A 3PJRA 4F93B 4PAMA 4DIEA 3IDAA 5WRFA 3P9SA 4MVXA 1XZFA 1VP3A 1Y5IA 2IXBA 2VDNB 1XGKA 3FBGA 3IT0A 3EWIA 1HLFA 1CR2A 2GBLA 5FTMA 3A4IA 4U2DA 2GYWA 4ZEOA 4B71A 5KHOC 1SWWA 1C3OB 2RBEA 2XCUA 4UXHA 9LDBA 6LDHA 2NNLD 2X5JO 2VO1A 1C14A 1CR0A 3M3PA 5AK6A 2FSVA 1NJ5A 2Y0CA 1J2UA 1T6NA 4HG2A 3NV9A 3H9UA 1NE2A 1ODSA 2F3UA 3IP8A 2IYAA 3L8HA 4L1KA 4MR8B 4X3CA 1GSHA 3OJWA 4C7XA 2C4NA 2DERA 3EA0A 4TL9A 3HXKA 1BROA 4I9FA 1GPNA 2FPRA 3ZKWB 1DHTA 1HZJA 2V7GA 3BB1A 4M9XA 4OSOA 3DV9A 4M7WA 2XCSB 3VO8A 4ODIA 5C8YF 1CYDA 1PQ4A 3N7UA 4MVJD 3B5EA 3A7DA 3KPYA 3Q87B 4RVUA 3WZ2A 4X1IB 3ZHZA 4RHYA 1U0BB 4GNRA 2ZUUA 1IY9A 5EXXA 2O8BB 3ER8A 2G1KA 1I0LA 3G2LA 2CK3A 2H1IA 3PNSA 3QBEA 1VJ1A 1JLRA 1YIOA 3EEIA 1HR0B 5EIFA 4XWGA 4AVYA 1JIQA 1R2QA 2J08A 1YRHA 3HU5A 4ZC1A 1WAMA 3SEQA 1G1AA 2Q0XA 4FYPA 3S0JA 2REBA 3FGNA 3STTA 5JSZB 4YUWA 1WQ4A 3K9BA 4NMLA 4R2HA 1COWA 1G8PA 4MRMB 1QAOA 1Z5OA 4X5OA 5L51A 4KHPB 2YX1A 5DMXA 3CVJA 1P9OA 4KKVA 4TVOA 2HWYA 1Z83A 5L4NA 1MRSA 4ZQCB 5KDOA 2YRWA 4IO0A 1VJ0A 2AOXA 5EPOA 5CDSA 1Q20A 1YTUA 3FLMA 2IHYA 2E6KA 2G77B 4NFLA 4XD7D 1EQ2A 3TX6A 3WSTA 3H04A 1TM7E 4K6HA 3T0FA 2QD4A 1L4BA 3PGXA 3RHZA 3DFMA 4G65A 1V7CA 3IV9A 4UC0A 2WHRA 3DEIA 1C3JA 4LF8B 2UVPA 1NW9B 2WF8A 4BVAA 3EVTA 3ZD6A 3EDMA 4J2OA 3NH6A 1HNXB 1SR8A 4IR7A 3LX8A 5T3YA 1Y1QA 3LC7O 5IN4A 3K6SA 2Q3BA 1IIBA 2PKRA 4CLOA 2JLXA 2PXCA 1YR8A 4QJIA 3DTTA 2I3AA 4PG6A 4UAJA 4RPGA 2WABA 3FETA 4H27A 4M1SA 4KRXA 4A8TA 3THWA 2C78A 2ZRBA 2QT1A 2P91A 4NAVA 1DINA 4FCCA 4QLOA 3LWZA 4PNEA 3UICA 1XVAA 4UREA 4OUDB 3N2ZB 4JMPA 1MDBA 2BF7A 2YWFA 3SSMA 4Q7LA 3U17A 2GBFA 2KLBA 4JI0B 3F7OA 4YT4A 2IEZA 4JHXA 1G8SA 3N8GA 4L0MA 4NBWA 5CLIA 3W8EA 1W0JD 1N8SA 4QRDA 3F8TA 4U7JA 2I4IA 4INZA 3RANA 5JANA 1CUGA 2IYXA 2V5VA 5CB6A 3KSBC 1A9RA 1JIVA 1G8GA 5EFOA 3BHMA 4OH7A 1PG5A 2W93A 4BLUA 3I9OA 4I46A 1SMKA 4CTNA 5JVDA 2VP9A 4HUQB 3L0CA 3OFNA 1KH3A 3AU9A 3N2GB 4F5ZA 3QE2A 1FRZA 4JLJA 4O0LA 3T8YA 2QU7A 4ZI7F 3DFKA 1SXHA 5BWMA 5FR2A 1SCUB 4MO2A 1DQZA 4OQDA 1I1NA 2ZVDA 2ABWA 1G2OA 4R9UC 5ALYA 4GLFA 1X13A 4PHHA 1DJPA 4MW0A 4TMYA 2Q2WA 2I66A 2HQBA 5FBZA 4NNJA 1AQIA 3H84A 1M67A 4C5BA 1E59A 2YWCA 2WTAA 3DMTA 4R4JA 4MQ4A 2E5LB 1IOWA 1JSCA 1LNQA 1ZGAA 1ID1A 2GVNA 3BCHA 3GI1A 3P2IA 5DMHA 4YUXA 1AQYA 1L7OA 1VBFA 2IYYA 1KO4A 2KI5A 3FLBA 4ARIA 1ZJ4A 2MSWA 3MF4A 4E6EA 3HUFA 1HE3A 3DTVB 4XRGA 1NVUQ 3RS3A 3TTUA 1IZ9A 1F6BA 2AD5A 2O5CA 2Z09A 1F48A 4GGMX 3X2FA 1IZYA 4B7UA 2XI4A 3SX0A 5LZ4A 2WU1A 2XYGA 3QKSB 4NICA 2EHJA 3CIFA 2ZXUA 1NNUA 1U94A 3IVCA 1SOAA 4MRVA 5CT5A 2FZCA 3EXHB 4Y2HA 5KYVA 2COUA 3P9NA 2ZT5A 3Q9NA 3GVCA 3QOYA 5FLKA 3C3MA 3R3ZA 3VZRA 2NZ2A 1J00A 2Q3DA 1IRXA 4QNRA 2IEAA 1N6OA 5BN4B 1DKMA 3GOHA 3H2BA 4PF1A 4F6RB 4I1VA 2YCBA 4YRPA 4HYTA 3CRQA 3KTFA 1W6RA 3CSDA 4NQZA 4URVR 2GM3A 4TUYF 2NUPA 3C6ZA 4OBWA 2B0CA 1V7PC 5CM8B 2AYYA 5AVWA 2G9RA 3X2EA 3LCRA 2VJDA 1V1JA 3K8YA 4BQRA 4Z4CA 4RNCA 3O2SB 4RLHA 2ZS9A 2WLSA 4X65B 3UJ3X 2YFQA 4CMHA 5ILOA 1K3FA 3VMFA 3U4GA 3PL1A 4X7PA 4F6LA 1YDFA 4WZ6A 1FZQA 3HJTA 1QLWA 2E49A 2X5OA 5J63A 3ZZNA 4AXXA 4MLCA 3HFJA 4MUKA 4BUJA 4U5QA 3HLKA 2WHEA 4ZYVA 5CEEA 2FWIA 4Y2QA 3PX2A 3ZCTA 2X6QA 1XEAA 2DPGA 2FGKA 3DQQA 3LT2A 4LV6A 4BYMA 3EPHA 4GOND 4DCCA 3ABOB 2JA1A 4XDZA 1D0VA 3PA8A 4FHGA 4CM4A 5CDUA 3FCYA 5C1PA 1XXHA 5IBCA 4RHCA 3JSXA 3AGQA 3P9YA 2EL9A 4J3JA 1E18A 4X6XA 2PRYA 4F3RA 4U7GA 3IUSA 1Q1AA 5D3QA 4KRGA 4WV3A 1AJEA 5ULLA 3FDJA 2QX9A 3PQ8A 2O8NA 2PX3A 1FRNA 2REQA 5ANRB 1BH2A 3RTGA 3SZRA 4JC0A 4C4TA 5CFQA 5IC4A 2Q50A 4R98A 1RHQA 3CN7A 3KKPA 2DUUA 3T7TA 5LCXA 3JQDA 2ZVQX 4L2IB 3EMKA 4M9RA 1G5IA 3MZ0A 3K9GA 3P9KA 3HRHA 4NR0A 4WERA 3AYXB 1RZRD 2ZITA 3UHJA 4J0JA 1JG6A 1NUTA 4P38A 2ZI5A 1UKEA 4RF3A 3OF2A 3TCNA 2JLZA 3JWPA 3FUTA 3MWLA 1QU2A 3NDIA 2GBCA 1PK7A 4M1YA 4KQJA 3H1GA 3PFFA 4MR7A 1RC1A 3F9IA 2X77A 1TZCA 4BX8A 2HSDA 4CLOB 5LKAA 4QVIA 2H51A 4RVOA 3EH2A 4FTWA 3SEFA 1FYVA 2I4OA 3C3CA 1I6WA 2RKOA 2XTMA 4R83A 2CV1A 2XGJA 1XZAA 1CY6A 3L0BA 3E3AA 2JG3A 3WY9A 3GOQA 2WD9A 3QW4B 4L50A 4QULA 2ADOA 5H81A 4CKCA 4D3SA 1MORA 3FD8A 3G2OA 5CD9A 5JAZA 3MBKA 1L0BA 3TIXB 4QEKA 3NVMB 5LU8A 1YGYA 2P2YA 1NXOA 4E5KA 1GQSA 1R9NA 1O95D 2D1YA 2OYSA 4JSTA 3TXYA 4CV3A 2PRIA 2VTBA 5CNIA 2EYQA 2OGWA 3BWXA 4H9GA 4LYJA 4MS4B 4Z1MA 3AHJA 4IH9A 2VWHA 5TJ9A 4J0GA 3PIDA 4GUAA 1U0GA 4YEDA 3OX2A 1WLYA 1RKXA 1BX1A 5J4VA 4MPTA 3JZDA 4P81A 3VTKA 1NF9A 1V5EA 3F67A 4NRDA 1Z29A 3OESA 2GNAA 4GXNA 3ZQ6A 3NEJA 5BWOA 1UFKA 3KUDA 1EH5A 3E7XA 4X3OA 1EFUA 5JZOA 3K92A 2VBIA 5CAEA 2J3HA 1RWMA 3D4NA 3BRWA 2OLKA 3A1SA 2BVNA 5MFZA 3VNUA 4TLBA 1N2CB 4J6FA 1P18A 1E60A 1C3LA 3SZGA 5CBPB 1KP9A 4PAGA 3IQHX 13PKA 1SIUA 4BXOA 3W5IA 4FGKA 3O84A 4MX8A 4PNPA 5T4FA 1R8QA 2R86A 3USZA 2J32A 3HA7A 1X8LA 2HV9A 2TMGA 3RADC 2H4WA 2VPZA 4D82A 4JJ7A 5G3YA 2IF0A 1ST3A 3T7AA 4QUDA 1W73A 3IHWA 4LHXA 4RSMA 4MQLA 2JJ2A 4O2RA 1CUHA 3A7EA 4PBRA 4EBFA 2A2ZA 4KV9A 4U7FA 5K2MA 3T1NA 2K5UA 1RXWA 1L7MA 4RMNA 1YE3A 4NCIA 1UDWA 4TMWA 2WVJA 3VH2A 4TYYA 4OAOA 3OLWA 1O3YA 3HR4A 2OXRA 1WBBA 1W5FA 1PS0A 3RC7A 2PG3A 5EAIA 3IT2A 5FTNA 4G8JA 1GZ3A 2GZMA 4QNNA 4QO8A 3NC0C 5A2GA 3PS9A 1DJOA 1AUQA 1FFAA 3A1TA 1XZDA 1X7YA 2WEKA 1RFGE 1HI9A 3OEYA 4DMUB 5C46F 4CCSA 4WY8A 4JJKA 4W5JA 4X8HA 4B6EA 1QJ4A 3O8NA 2YDXA 5IUNC 5JQGF 1VSBA 1M73E 4WXRA 5JMWA 1V3UA 2FLWA 2A3RA 4Y2PA 3NP9A 5KX5B 2EL7A 3J81A 4E1AA 3JPYA 4QJ3A 3I45A 4B6SA 1G9SA 2W70A 5I9NA 3F3YA 3N2KB 5HFAA 2O5EA 1W47A 3SI7A 4MKIA 3JQ6A 5F2NA 3PBKA 5F7XA 4IYRA 1B3BA 2BM0A 4I08A 1CZLA 4JFAA 4KGZA 4OJMX 4FYMA 5AI4A 3TSZA 5JRJA 4L5CA 3L0OA 1VLMA 3KRTA 1JDJA 4NH0A 4ARBA 3NS7A 3WIDA 3AFNA 1I2MA 2QRMA 4JBYA 1Y1PA 4L8GA 3SR3A 3MD9A 1LS6A 5L3QA 4N65A 2Y6UA 1OPXA 1QK4A 1Z4JA 1KJ9A 1P9RA 3O1IC 1TQDA 4S1NA 1X80A 1TVKA 2HSEA 1KMMA 1WY7A 1PI3A 3KFLA 3MB5A 3N2LA 1Q84A 4REOA 2H9IA 1RLMA 3Q3JB 4GXRA 5I9TA 1JFFA 4MQFB 3V42A 3HLTA 3VR2A 1DBWA 3KL2A 1BAPA 1NLUA 3CX6A 3H83A 4AJLA 4EI2A 2Z2KA 5FPHA 3I2FA 4AY3A 4CL0A 3SHFA 5FOWA 3AI1A 1EI9A 5CHYA 4DEVA 2DFTA 4HEQA 1WBJB 3KPJA 4MKFA 1V5FA 2LKDA 4OREX 2ZIZA 3ZDFA 3A27A 1K2WA 3CZCA 3RVMA 5A3JA 1PTJC 2DFLA 1RIIA 2QENA 2GPTA 3GEEA 3PFHA 1H94A 2JFXA 3BFVA 3IJ5A 4GU5A 1L4LA 3UHPA 1LPPA 1XWIA 4BX9A 1FP6A 3FCXA 1X70A 1RS0A 4FLEA 4LVUA 3M6WA 3AGPA 1PD1A 3WGOA 3DEJA 1WB9A 3RVSA 5H9WA 4D57A 2XLBA 4R8LA 5T6BA 5JY1A 5FBVB 1V35A 3VI4B 4WOCA 1HTWA 3N74A 2BH9A 2WOOA 3K73O 2XUGA 4KIFA 5AP9A 3TRDA 3VNSA 2CVFA 4CKCB 4MR9B 5E4FA 1J8QA 2ZR9A 2WU3A 4PIPA 1EIWA 2PMDA 3INNA 1XZQA 4BB9A 3SMVA 1RBYA 1F9AA 3ITNA 3ZLVA 2D54A 2DKFA 5BMVF 2ZJ5A 5K8LA 3I34X 1V5IA 3ND5A 2NWQA 1L5RA 4KO8A 3TZHA 1ZH4A 3SKVA 4BASA 4BOYA 1BX0A 3ORYA 3CS3A 1PFGA 2YYSA 4O4HF 2FRXA 1PR4A 3K5PA 3TR0A 5EVJA 4DADA 1VZ2A 3NTQA 1IVNA 3UHAA 2WWTA 1ITZA 3OTOB 2GPSA 1W6UA 1E20A 2LD4A 3CLRC 4DV2B 3TUJC 2AN1A 1UQTA 4FFOA 3HWSA 1UFVA 2VJQA 4XSHA 3IO5A 4CTJA 4Q4AB 3D4LA 1IEXA 4IRMA 1V43A 5DNDA 4NU0A 5FOUA 1YOVB 4TM8A 4N5IX 3GT3A 5T6MA 4GBJA 4AK9A 5EJ9A 3NW9A 3F4LA 4UUPA 3U6BA 3EZLA 3KKZA 3PDCA 4X1KA 2BKLA 3OSUA 5CLLA 3P2JA 1G7TA 3QU2A 3VVCA 2R4TA 2VRCA 3CWZA 1L7QA 2J59A 2W6NA 1K7YA 2OAQ1 3P2MA 4G63A 1UIMA 4LXYA 3AOEA 3MS4A 4G37A 2OXCA 2WPDA 4OD0A 4GI2A 2ZK7A 4J6EA 2QTLA 2G4LA 4X84A 4EX7A 3OI7A 2D00A 4I81A 5D3MA 2QSZA 1LSJA 4N0DA 4ROTA 3RKSA 3NQ41 1NF3A 2PGLA 1TT7A 1P8AA 1U90A 2BHNA 4P22A 3P97A 3OU2A 1O8BA 2WF5A 3U7HB 1U6JA 1Z08A 2SECE 4WUTA 1A9XA 4CQMD 4GYJA 1ZKMA 2CLDX 1X7YB 3OOHA 1BSVA 3S6JA 2YZKA 4BMZA 2Q5EA 3P0EA 5IF9A 3IDQA 2MSEB 2X4IA 1YCFA 4H7DA 4A2WA 1GTMA 1TLFA 4LRTB 4RHFA 3SIRA 3SBEA 4V0ME 1RTTA 2VRNA 3LQRA 2XKJE 3QVGA 1UMBA 3TFQA 5JSZA 1YV9A 1QGED 4Y1FA 2ORWA 1TU3A 3P0FA 4FDUA 4DYDA 3IIKA 1PF7E 4Q02A 3HEBA 1LPBB 1E8MA 1R7RA 5IVIA 3BM5A 1U65A 3OBBA 2IHKA 4BNJA 4G1UC 3AV3A 4DRZA 1KOFA 1SBZA 4GBMA 3WYBA 5JARA 5DX1A 3W2HA 5C35A 3FTQA 3G0BA 3WA7A 1CQIB 3QELA 3LF2A 2VZ0A 3H8SA 3AIIA 4MS3A 4QEDA 1T9ZA 4V0RA 3UO8B 3B1JA 3WBKA 1Y1KE 2HU2A 5JNLA 2HL6A 2IRWA 3KUUA 3BDIA 3OWOA 3TX2A 2E1PA 2HA2A 1G5RA 3RVDA 1PV4A 5FLEX 1EA7A 4KXQA 4RSRA 2G0AA 3JTEA 4GXQA 3L6CA 4KN6A 2VJNA 1TF7A 3G9UA 3PB3A 1LPMA 2Z43A 3DP7A 4GOMD 1DRKA 4BWVA 3DR3A 3KEMA 2CLLB 5HA5A 5ICGA 1SHLA 1PJZA 5BVHA 1K7FB 1C1XB 1KFEB 4YV7A 5AW3A 4BZZA 3THWB 4JQZA 2P2GA 4AW9A 1C8KA 4NDZA 2H16A 3V55A 1TC1A 5ERXA 3MCWA 5FT9A 3G2HA 2IY7A 3PICA 1E69A 3ZY2A 1DKQA 3KL4A 4WEOA 4WY5A 2NQTA 4YAFA 3U9TA 1KO1A 5E0OA 1P0MA 3T52A 5K3DA 4TTPA 5JNTA 2SKDA 4POOA 2P9FA 2VEDA 2DQYA 3UFXA 1ZXBA 1UBTS 2VXBA 4MYDA 3MJRA 3EFEA 4X1OA 4P4LA 2YFHA 1IHDA 5LQKA 2QUHA 4DTCA 4G0ZA 3JZMA 3UPTA 2JLQA 1GZHB 1Q1GA 3GLIB 2QV0A 4PQGA 2XITA 4KE6A 2CJXA 4IHKA 3BEOA 4YYEA 1I32A 1I3KA 5DE3A 4EUNA 1Q95A 2IGBA 3EHEA 5MN4A 1I7QB 4M98A 4WHMA 3GLFA 1AHHA 4MWDA 1CNFA 3E70C 3ON5A 3T5DA 3U26A 4Q9AA 1ZGCA 1MW8X 3UAYA 4A0GA 4B33A 4F2DA 2KSQA 2Z98A 4C3OB 4DB4A 4F6RA 1Y3FE 1YJXA 2CLEB 1YFKA 1JQJC 2YQ4A 1GYRA 1TW3A 1P5ZB 2GTPA 3CVVA 1TJPB 3RSLA 4RETA 3PEWA 2YY7A 4AN0A 4PGAA 4Z0PA 2JGKA 1M0WA 2XODA 1UM9A 4DJDC 4F8JA 4WFQA 5DISB 2XDAA 4LSWA 3C4JA 1I7LA 3GZJA 2AKAB 1I1QB 3QKSA 3NWEA 3KQPA 2AFHA 2GXQA 1SVLA 1BDJA 1O94A 4CE6A 1K0UA 1T2AA 2Y1KA 3W5BA 1YOVA 2BGGA 1BKDR 2I4LA 2PQMA 1SU4A 2CVHA 1TVMA 2QRZA 1KVQA 1P6XA 2NIPA 3MGKA 5IM4F 3ZUGA 4JOSA 1U2DA 1XWWA 4BO8A 2I6FA 3X1YA 5J4LA 2IOFK 3G6WA 5CYFA 1WXDA 1IN5A 4CRWB 1KZ4A 1KBQA 3CZAA 3NUZA 4KQCA 3TDNA 1UT5A 3N39C 2IHVA 4M1WA 1OVMA 3CN9A 3KHKA 5K9ZA 2W2NA 3WIUA 3QYJA 1H5NA 1T15A 4O4LA 1L9KA 1Z28A 3ZE2B 1AHIA 3O8DA 1CRWG 2Z3WA 4RD2A 3W3AA 4W8OA 3VDRA 2IIBA 4FWTA 2Y1CA 1Q3HA 3PP8A 2EV9A 3ZQ4A 4X97A 4CWAA 3HM9A 3OM8A 2G1JA 3WB1A 1BW9A 4HBZA 2NO7A 3N05A 2BEVB 4DZRA 2EARA 3QUCA 4CM4B 5A4AA 2RGGA 2XW6A 1ZD8A 3QEKA 5FA5A 1KEEA 4BDSA 2ZBRA 1MAVA 3AFGA 1DELA 3GJ3A 2QEQA 5IDYA 2OBYA 4QYWA 4Y6PA 5KVCA 4XB2A 1MJGM 4JLKA 3SMQA 1NC1A 1U2SA 1YK0A 4E1BA 3R7FA 1GG8A 1YKSA 3D3JA 4JFRA 3U49A 3CLUD 3ZIDA 1WMDA 3PX7A 3C8ZA 1EXWA 2REQB 1H2RS 2XQKA 3QWIA 2EGUA 5BWCA 3QELB 1Y9ZA 2V03A 4EPYA 3TW4A 4IVRA 1KO8A 5SV2A 5JS8A 1U1GA 1PYDA 1Z9BA 4HPXB 4EY6A 2VAPA 4NBUA 1UK8A 4GX0A 4L78A 1CVLA 2R8BA 2F4VB 3P9QA 1QFXA 1SVSA 4OQMA 1NP7A 4PSVA 1OKKA 4QPNA 2R5NA 3L7YA 3IAHA 3Q6MA 3A6HA 1N6LA 2G9UA 1OWNA 3EWAA 4C08A 3EEOA 1UOEA 1B41A 1QONA 2B92A 5TDHA 4YX9A 2LRHA 3VC2A 3N0XA 3TD2A 1N77A 3S81A 1N9ZA 4QM7A 1T1JA 4BN5A 1U8EA 1I30A 2OXEA 1QFSA 4EUKA 3GEGA 3PNVA 3JS5A 1MA0A 1CETA 1JEOA 1ADYA 2G25A 4C3ZA 1DC8A 4OL0A 1VIAA 5I47A 1ESZA 2YW2A 1ZD4A 4V0QA 4KLAA 1ZCBA 3EQ9A 1R8JA 3BK7A 3CO5A 3CEMA 4RELA 5AD1A 1F8GA 3FHJA 3HV2A 1DJMA 1CQWA 1G41A 1Q7CA 1VSUA 3IMEA 4R41A 3RNLA 5EERA 4UPEA 1DLJA 2PRJA 4Q3NA 3VH1A 1TM4E 1XRRA 3PR1A 4UCWA 1QF9A 5E7QA 2FEOA 3OE7A 4PLWA 1Q92A 2R6AA 4D9CA 5LPNA 4K9SA 1JXMA 4IJQA 4D1YA 4EHFA 1G59A 5KIAA 4PY2A 1JIUA 4HF7A 2CSXA 2V6BA 4MQMA 2X0JA 5KX5F 2WHXA 4E33A 5CAEB 3ZCSA 1XQVA 1OJLA 4ZQIA 2AN3A 3RARA 4B8YA 3TAUA 3CX8A 1YO6A 4ETNA 1QCZA 3NH9A 2WMNB 1O2DA 3ELUA 3KSUA 3OCZA 4JSYA 5IBPA 4C9BA 3CNNA 5CDGA 3ZHCA 1XMSA 2Q7DA 3S5UA 2G63A 3EASA 4HVLA 1LVGA 3E9DA 1ZJWA 3NM6B 2B6NA 3FVQA 2IZ5A 2RBGA 2YZGA 4BMSA 1REQB 2BM8A 4LSGA 1NPYA 3OMLA 3O90A 2C1ZA 3MRTA 3WWPA 4BE7B 1B23P 4ZQHA 3I9LA 3AINA 4GE3A 2XGSA 3ZK8A 3U4IA 3FSJX 4WZBB 3ZDDA 4II2A 1C0IA 1RAGA 4D8XA 4IRXA 4O5AA 4CCAA 1QK5A 2HCRA 3CCFA 4UEWA 3FUCA 3K6KA 5AVYA 4EYSA 3R6TA 2GLXA 3OCXA 4Y9RA 3AY6A 2IXFA 3A1EA 2VHYA 5BSWA 2AFHB 1HE2A 1TB4A 2D1RA 2PSSA 5CDFE 3N2NA 1I7DA 5CEJA 4F3KA 2WAOA 7MDHA 4Q00A 2J0EA 1IBRA 3USES 1RKBA 2H9YA 4IL5A 4NBLA 4PHFA 3VNRA 3R7WA 1GNSA 3GU3A 3GRKA 5CVTA 2X42A 4N7MA 3B3AA 5KNBH 2OCGA 3D1LA 1O5TA 4FYIA 5EHGA 3F96A 3UAOA 3CY6A 4JP8A 3LFUA 5K0SA 3ADCA 4IJKA 1U80A 3IMKA 3IAXA 2R96A 1QIDA 1M2GA 2HI0A 2GN8A 3R77A 1YZQA 2HKIA 2DKNA 2P9BA 5CGZA 2QL7A 4O4LB 2I54A 1O9HA 3C3WA 4ND4A 4MHSA 4PLTA 3IQEA 1GYQA 4GW3A 2ZUTA 2XB2A 2GJ9A 1XTBA 5KDDA 2WT8A 1HXHA 3DPIA 1UZAA 2QDXA 1WXEA 4PS0A 4B7CA