2VPTA

Clostridium thermocellum family 3 carbohydrate esterase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
201
structure length
201
Chain Sequence
KTIKIMPVGDSCTEGMGGGEMGSYRTELYRLLTQAGLSIDFVGSQRSGPSSLPDKDHEGHSGWTIPQIASNINNWLNTHNPDVVFLWIGGNDLLLNGNLNATGLSNLIDQIFTVKPNVTLFVADYYPWPEAIKQYNAVIPGIVQQKANAGKKVYFVKLSEIQFDRNTDISWDGLHLSEIGYKKIANIWYKYTIDILRALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Cellulosomal Family 3 Carbohydrate Esterase from Clostridium Thermocellum Provides Insights Into the Mechanism of Substrate Recognition
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords LIPOLYTIC ENZYME
total genus 75
structure length 201
sequence length 201
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2vptA00
4OAOA 3RJTA 2WABA 1VYHA 1PP4A 4NRDA 4Q7QA 2WAAA 4PPYA 5B5SA 4RSHA 4RW0A 3MILA 5A4AA 4XVHA 1DEXA 3SLRA 1FXWF 4H08A 4JGGA 2HSJA 4HYQA 1VJGA 1WABA 2W9XA 3P94A 2WAOA 4K40A 2O14A 1YZFA 3C1UA 1V2GA 4DEVA 3DT8A 4TX1A 3DT6A 3DT9A 4M8KA 2VPTA 1BWPA 5BN1A 4JJ4A 4HF7A 1ESDA 3SKVA 4K9SA 5CD9A 4OAPA 1ESCA 2APJA 4K3UA 4I8IA 5HOEA 1IVNA 5JD3A 4JKOA 3U37A 4Q9AA 3PT5A 1BWRA 2Q0SA 3DC7A 1DEOA 1ES9A 1Z8HA 1ZMBA 3HP4A 2Q0QA 4LHSA 3W7VA 4IYJA 1FXWA 4K7JA 1K7CA 3BZWA 1ESEA 1BWQA 3DCIA 1J00A 4JJ6A 4JHLA 3KVNA 1U8UA 4S1PA 1JRLA
chains in the Genus database with same CATH superfamily
2EU8A 3H16A 3AL0C 5KEIA 3G2JA 3KXPA 3M1LA 4Q3LA 1C9EA 3K2EA 2B4TO 2V5VA 3SF0A 3NOOA 3PGA1 4H6VA 4Q4HA 4PFKA 4N5DA 2WTNA 4YCLA 3ENVA 2FZKA 1I0IA 3FJYA 1T6BY 2FW9A 1X15A 4HADA 4HOYA 2JZOA 3MUNA 4JBLA 2L17A 5ALWA 2YXDA 3CH5A 3FNQA 4TLLB 4CMEC 2DEUA 4DMMA 3D7MA 5FUYA 1AHPA 2B78A 1ANKA 2H4HA 2PZKA 4O5AA 5KQGA 4JYAB 1RLJA 5ED0A 4CG0A 1L4MA 1QC5A 3ZK7A 2QNRA 4NK5A 3VMMA 1JG4A 4DLVA 2CXUA 1DAIA 4GYYA 2C92A 3R4CA 4YAJA 1GZUA 1I3OA 3VKHA 3NTVA 1XDGA 5CFZA 3T1NA 5EFZA 4TKLA 3RVMA 2ONYA 3OQMA 1J2UA 4LKOA 3HJTA 4LHXA 4H1HA 1GNQA 3VAAA 4ZT7A 1DGQA 2C20A 2CCGA 4FKMA 5CBPA 5ANRB 3TNDA 2QOEA 4TX1A 1R10A 4DV0B 3QEOA 4XVRA 2D5IA 2JAHA 3SMVA 4E21A 1FQJA 3INNA 2O2IA 4LXIA 4WCFC 5HJ7A 1AKVA 3ZZNA 5IC4A 4H77A 4Q1EA 1QFJA 4F84A 1CYDA 1XVTA 4MI9A 5BQPA 2ZE7A 4DWJA 2HREA 2YXEA 2J6HA 1NVGA 3SOZA 3IVGA 1Z5VA 3ZZUA 1KWKA 3U4MA 1O6GA 3GJSA 4GLFA 3O6VA 1X1RA 2HMVA 2GLXA 3QRWA 5F9FA 1E1QA 1WXWA 3HUFA 1TCBA 3FOFC 1RRFA 2PH3A 2Q4TA 3UWSA 3SWWA 1PEAA 3D7SA 1IPFA 1PX2A 3GJ3A 1DAOA 3KVYA 1Y82A 5JO9A 1X19A 4ZCLA 4NG4A 3OZ7A 4FB4A 3L4BA 4UNSA 4C4AA 3VJKA 1XRQA 1LB1B 1Z34A 4JGBA 1QUEA 1WHSB 1ZIYA 4BFYA 4BCCA 2A0YA 1Z6YA 4M6WA 1U7PA 2RONA 2CXXA 3A25A 1J06A 1V5EA 4GC9A 1NNEA 2LTAA 3H2KA 2WLTA 4KBGA 1SOVA 1CRQA 3LUHA 2OCDA 4RLHA 5F5XA 3N0RA 4R05A 1UJNA 2VHXA 4WXEA 4F91B 2GUGA 2JIQA 1COWD 1FUIA 2KJQA 2QM3A 2R5FA 3DHWC 4PZ0A 5IDWA 3IJPA 2G1PA 2UAGA 1UAYA 2P2NA 1U8EA 1V9CA 2XITA 3EAQA 3F6EX 4I19A 4J0IA 1X7ZA 2HKIA 1E2KA 4G2NA 4F4UA 5G40A 2Z4RA 4FOTA 1KYWA 2IT1A 2J7KA 2HXSA 3OIYA 4IOJA 4L9SA 4XM1A 4HQRA 2PV7A 3CZQA 4PHHA 3F6YA 5HWSA 4RSRA 1S96A 3OI7A 4JIGA 4XYMA 3VTAA 3RUPA 2AOVA 2YYZA 3FCAA 3GL9A 2FI1A 4UHDA 3GJZA 3F73A 4JYCA 2J9GA 1REQB 2YZNA 1BH2A 1VE1A 5CYFA 3PQEA 1QCZA 5E4YA 1TAQA 1B1CA 1E1RA 2PL1A 3TCNA 4BASA 3COJA 4CEJB 4B3GA 3C7AA 3CZ4A 1D9ZA 2AFIE 1J42A 4XX0A 1ONPA 5DSTA 4DSNA 5EAIA 2ZT6A 3OOYA 3TS1A 4BVHA 1U63A 2BEVA 4Q7QA 1Y42X 1PF7E 4IO0A 1FSSA 3CRQA 1Q0QA 2O0MA 5CLQA 4F60A 4IO1A 4R54A 3BORA 4WLFA 1EWYA 2QUJA 3LCMA 4I1UA 2P3SA 1RDFA 2OD2A 2A9VA 5DNYB 1VFPA 4LOAA 1E2BA 2AHOA 1EVZA 1S3FA 4Y30A 1CJCA 2W43A 1M1YA 1YB2A 1YJBA 1OXSC 2X9NA 3NWJA 2FUCA 4H08A 3PIDA 1FP6A 3KSZO 3PL1A 4QOJA 3ROGA 5ITSA 5JNVA 3DWGA 4BV2A 1E3WA 4A10A 1JZSA 2B8JA 1GHTA 2ECFA 1J56A 3TW4A 1MQSA 1RSZA 2R4QA 3DCYA 3FVVA 2NU6B 4X24A 3S2GA 2V0NA 5HF6A 4EKYA 4YJFA 1LLUA 4KK4A 3T15A 3OP1A 4JLWA 3GRCA 3KWLA 4B81A 9LDTA 3JZMA 4IILA 1WAMA 3WBFA 4ZAVA 1U3VA 3MMZA 2J4CA 2XMBA 3CLTD 1E3MA 1RHRA 1NJ5A 1U7DA 3COWA 3GT3A 3HUUA 1SKMA 4D4KA 2F3QA 2VTBA 5K3CA 3CNLA 4QU9A 5L8VA 3WK5A 2Q49A 1OGIA 2C2OA 3LP5A 4G4JA 1QCYA 3ZG6A 1WKVA 4PC1A 2QRGA 1FNBA 1ESCA 2PGIA 5IT9A 2KS6A 2F9LA 1AJEA 4E5YA 2HHJA 4JKOA 1YJAA 4B3JA 1DMSA 1KF0A 4YXWA 3ZD6A 1MGPA 5DPMA 4BE7B 1CUCA 4S05A 2XUQA 1AZLA 3PFHA 2W42A 5IVPA 2J3KA 3CH7A 1CS4C 2H1WA 2X23A 2NT3A 4FR5A 2IQ5A 2CN1A 2J3MA 4M60A 1G17A 4N3NA 4X85A 3PR1A 1DC8A 4PPQA 3WFIA 4RPJA 3VBCA 1K66A 2PVCA 1V3UA 3EZYA 3L2OB 4XGQA 1PFWA 4G5FA 4AZVA 4D3SA 2C2KA 3PHBE 2JAQA 4N7RA 3NONA 1O9HA 5DGIA 1IZ8A 1JQ3A 4IDQA 2CLEB 2MYPA 2OG2A 2UZAA 2XUFA 3EBPA 4IDFA 3OT5A 2W8BA 1EI9A 2ODPA 2HRBA 3JRWA 4UM9D 5AVQA 1RZ3A 1N2GA 4CT0A 3VC7A 4QICA 2IPMA 3IAEA 1T1SA 5FUBA 4K9DA 5EVCA 1D4AA 2NXNA 5CLFA 1KOLA 2IXBA 4C06A 1CETA 2OK8A 4HGZA 4KQ1A 5EZQA 4JYMA 3G17A 1ESEA 1QFYA 2JLXA 1N8TA 2UDPA 1T91A 4G89A 3UEOA 1IUOA 1NOIA 4DLTA 1YCFA 4O2BB 4TTRA 4WT7A 1J2YA 4GWLA 5FIUA 1BXGB 2ZYAA 1P7YA 4PN7A 4TXNA 1U2PA 4V03A 1BXKA 1R9NA 2GEVA 4NBVA 2H17A 1M2GA 2ID8A 3EW9A 4E2XA 1XTSA 3O3MB 4Q1DA 1ZZGA 1XJQA 5F73A 1AKUA 1YT5A 4YALA 4DSZA 4PG8A 9ATCA 5TB5A 1DO0A 1HYHA 1HKHA 3C39A 1PHRA 3GQBB 4NKRA 3SM3A 3LBHA 4BMYA 1HOXA 4BWVA 2PXAA 3O4GA 3RVJA 4BAUA 5C34B 4P7KA 5JD4A 4P9NA 3QH4A 3WL4A 4R81A 5JDIA 5KZMB 3TECE 1L8OA 3U3KA 3RRBA 1ZHOA 1N9ZA 4NATA 1ZC4A 4KGZA 5CCDA 4OGFA 5FNVB 3EVFA 3R3VA 2H07A 2Z98A 2ZROA 4K88A 1RYYA 3M4JA 1HM5A 1VE9A 3E7XA 4JB2A 4UD6A 3IVXA 3OJCA 5ECDA 2WDZA 2VJBA 3I05A 2IYVA 1FRNA 1OREA 3KKNA 1S1MA 4XR4A 3RIYA 2RC6A 3SLRA 5A3QA 2NUAA 2J08A 4PBRA 1WV1A 2DJIA 4MQFA 4XD2A 3QX8A 3V8NA 2WPDA 4ZQGA 2WKWA 3X0DA 3E05A 3VYTB 4AG5A 3KZXA 3OZEA 1WEHA 2CXOA 2EFEB 3BXGA 1XKTA 3I4LA 4H7FA 5D2CA 5H4HA 3VNRA 3V8PA 4DHWA 4Y9RA 4H6XA 2RAVA 4GRIA 4FZJA 1BW9A 3V1KA 1SU7A 4ABYA 4G0WA 2C5BA 1YASA 3CEHA 3MIZA 4CODB 3ZWMA 4JI0B 2A86A 2Z3WA 4WK6A 5H80A 4C6SA 3PJEA 5A04A 3CHYA 2EARA 4DW8A 4M8KA 4RAOA 2GD6A 4MJ7A 1P9NA 4N39A 4YCMA 3D6TB 1PEKE 1DOAA 3L5KA 4FYKA 5IBRA 1D0SA 4OH7A 5FL7A 1TW2A 1NY6A 3DZDA 4QQKA 3WLEA 2JGLA 2F1KA 1KEEB 2X7HA 4M9ZA 2IZ5A 5IVIA 1QHSA 3CX4A 4F3NA 3MTEA 3IV6A 1A2BA 1EFLA 1S3IA 2I4TA 2Z5LA 3CPEA 4QUBA 4AKEA 3E2PA 4WH0A 1HLFA 2A1UB 1GAJA 2WY2D 2CB0A 4BBPA 4DT1A 4KX5A 2EQBA 2YOGA 3EVNA 2HTFA 3L6BA 3L8EA 4AUNA 1AH2A 4ZO6A 3LRXA 4EG3A 2BM0A 3HB0A 2VQ3A 4JOBA 4MW4A 1ORWA 3I01A 2NP7A 3KB8A 5C4GB 3W6NA 5JLJA 5G2OA 3QJYA 2XCOA 1MC1A 2HNKA 4RHCA 3V9AA 2A78A 1N3BA 1IUKA 1L7MA 4W1QA 5FTWA 2RB5A 5B58T 4B3DA 1QIIA 4CG1A 4U02A 2EC5A 3WGOA 2GN6A 3BRQA 3IPRA 3N2KB 1UAGA 4XWGA 4YK7A 1F2UB 2IYEA 4ACBA 3W7VA 4LE0A 2I2BA 1WDWB 3S29A 4P4SA 1H2WA 2HO5A 4G01B 2FF5A 1SXPA 3IVAA 3S2UA 1YTUA 2E2WA 2O8FA 4RKQA 1CK4A 2Y1XA 2WDPA 3BCHA 3LCUA 5IN5A 3FDFA 1EINA 4A03A 4HAZA 4BMXA 3UH0A 3H9JA 5I9TA 3KALA 4H0FA 3QPWA 4BO4A 1L8LA 3MJCA 1TC1A 2XXJA 4Q3KA 4QRDA 3G2IA 3QFHA 4WW0A 1TTTA 4WKCA 2H9AA 4E2ZA 3RW9A 2AG6A 2M6SA 5F9MA 5FUXA 4EJ0A 5BNZA 5EP3A 2JGRA 4RH3A 1WQ4A 5AK3A 5J1SB 1Q0SA 2CLCX 1TCVA 1EX1A 3DMRA 1WUHS 3MB5A 5DLPA 3OZCA 1EP1B 5K03A 4YWJA 2FK8A 2QSJA 3DFKA 5EIAA 1Q57A 1KDZA 3ZHRA 5BV1A 3AHFA 4HQKA 3AHGA 2CXQA 3H9EO 1YOBA 4ZGWA 3IEMA 2PYIA 5I9SA 4U2FA 1G5PA 1OTYA 2ETVA 2DAPA 2WUEA 4GSYA 3CZRA 2HLHA 4JX9A 1C9YA 1CUDA 2AZXA 4RE5A 3B6MA 2Z2XA 3EOBI 2OVBA 4YONB 3TR0A 3ESYA 3NBZC 4C78A 2XQVA 3GH3A 2BFOA 4KQHA 4AECA 3PEUA 3UT5A 4MCHA 2EOAA 1HYEA 3AVPA 4AJLA 5EE3A 4Q05A 1A8IA 3KWJA 2Y1GA 1H23A 4GICA 4JT8A 1CKEA 2BMWA 2D74A 4ZREA 3VDRA 5HRCA 5DYGA 4XOUA 3SZ3A 3TLYA 4EB6A 2N47A 1DJNA 4BJ5A 1UJMA 1F14A 5F77A 3JY6A 5HZKA 2C7VA 3ZHYA 4HAIA 5JPCA 1JIXA 4INAA 2Y68A 2MU1A 4U9UA 4YDQA 2WV7A 2VHCA 1VIYA 3MQFA 3MJDA 3WV5A 4BNLA 4K8RB 2JFGA 2VNSA 4TLEA 2XW6A 3KP1A 5ER9A 4UPDA 3G2QA 5ALPA 1NW3A 2B8EA 4RPGA 3Q8LA 3EY4A 1BMQA 1J7JA 4O4LA 5JZVA 5A05A 4TYQA 4AP9A 2P79A 1IY0A 2HIAA 4MUJA 1RQNA 4V0OA 4C6TA 3BWBA 4LN1A 4RWEA 5LB4A 5NULA 3QLJA 2O8CA 1MW9X 5FI1B 3EODA 3WO1A 4CMHA 2A8YA 1BC5A 5DHAA 4DQUA 4KR2A 4MS3B 1TGVA 4QPPA 2OAQ1 5BR8B 1H4VB 3RSFA 3T95A 1MAHA 2AN9A 2JVKA 4JNKA 5CJPA 2V4ZA 3V97A 5BRJA 1NI4B 3LT5A 4QHYA 3K1JA 3O92A 1TEHA 3FD8A 3FPLA 3I2FA 4RLFA 5TPWA 3NBQA 3RAFC 3NT4A 3LYUA 3RT1A 1GZSA 3OCWA 4PTLA 4TSRA 5JRZA 2ANCA 1BKSB 4E4TA 1D2NA 3IOCA 1FL9A 1WM1A 4Y1RB 4BVFA 5IN4A 4DYHA 3EJWA 1A9RA 1DDIA 1Y4ZA 1YS7A 2NZXA 3UB3A 3H2ZA 1NG1A 3BK2A 3BWMA 1ZQ9A 5ITZB 2C2GA 2HNAA 1C1YA 1X7HA 2IGTA 3ROEA 4A0QA 2QN6A 5JUWA 1IHYA 1XU7A 1JFFB 3W3AH 4E33A 3T5TA 1RKQA 4FP9A 3FSEA 2W90A 4PIVA 4G0UA 3CTMA 3DEIA 3KFVA 4L3OA 1DAFA 5HUJA 1AO3A 1IDN1 2O5CA 3IERA 1ZI6A 2I99A 4MGZR 4ED9A 8AT1A 5DLDA 1G20E 3QY0A 1UBRS 2H1CA 4CCAA 1T8WA 4QT4A 3THXA 4IDBA 5CDFA 4PYNA 1E2GA 4MH0R 4Q1CA 5D1HA 1L7DA 5AUOB 2RGGA 1JB9A 2C42A 4PG7A 1UXOA 4Y0VA 2DBYA 1B6SA 3HNOA 3C6YA 4BBJA 1CUGA 2YS6A 4QRIA 4YCCA 2RIPA 1TZMA 4YMUA 5F12A 4MGYR 1IAVA 3LXMA 3NUGA 2NZWA 3SXUA 10MHA 3ZGNA 1QP4A 2I29A 2QKYA 3Q0IA 4HS4A 2F00A 3FPJA 5CH8A 5AJUA 4HRXA 4PZEA 4QDTA 2R6AA 2R44A 1MXFA 4IFIA 3SIWA 1YAHA 4D3XA 1JFTA 3KL4A 4Z9XA 4NU6A 4MW2A 4PSCA 1FP4B 3AXTA 3WMWA 1VCIA 3IALA 3OURA 2J1LA 1SBZA 4R3WA 1RBMA 1ORVA 2QS9A 1OZFA 3UJ8A 4U9HS 1MB2A 5DW0A 5HKBA 4KIGA 2R60A 4GBED 4YV0A 4ZI7B 4V3BA 2YIVX 2LKCA 3EQZA 3PT9A 3OQPA 1UMCB 5B5SA 4RSHA 1VMIA 1OMOA 2W2LD 2X8WA 1TO2E 3NBMA 3OX1A 2OESA 4J0QA 4LRWA 4X45A 4PC2A 2GEBA 1ZW1A 3NWPA 1UH5A 4P2BA 1BFUA 2RGEA 5CURA 4P98A 1AGRA 4OSEA 3CSUA 4ENUA 3G5TA 1KO5A 4HWOA 4LXQA 2O6HA 1Z13A 3GZNA 1USKA 1A88A 1M5RA 3C1TA 3GFOA 4LRXA 4XIGS 3I2KA 1KMCA 1F20A 5JARA 1ZMOA 3AVYA 2Z4TA 4J16C 3IA2A 4JVOA 3SYMA 1USGA 4F3RA 1A2OA 1QG0A 2MJLA 4CZ2A 2GR9A 3AERB 4QBFA 4ARZA 1X7DA 3BTVA 4GMHA 1AA9A 4KW7A 3IVMA 2O20A 3T9DA 3G49A 5DNVA 2Q21A 1KDVA 1PJLA 5AJVB 4EVQA 1RXSA 3IAM1 4RBNA 5FLYA 3WRVA 1NL3A 1KEUA 4G8JA 1QVAA 4Y2UA 3BWDD 5MHTA 2LXNA 4M87A 1YH3A 5JSKA 3UJHA 1V4NA 4NCXA 3ZHUA 4CU2A 1LSOA 4INZA 4L15A 1HQYE 5KWEA 3B7WA 4KXLA 3T1OA 1D04A 2VNHA 1YJCA 5DMHA 2AV6A 4E70A 1Q77A 3Q0TA 5LOVA 3L4SO 2UYYA 4RGYA 4TM7A 2D2FA 3VYSB 3HJCA 2C0QA 2X2OA 4RVDA 1PNRA 1U0HC 2UZ3A 2E6KA 3OD1A 5BSUA 4U00A 1O89A 2FXVA 4NDAA 3FYUA 3FZEA 2GOYA 4B6PA 1ECFA 2VK4A 4WCFA 2G36A 1J8DA 1KYTA 1CRZA 2QVGA 3PX7A 1VP9A 1R3UA 4QTTB 4YP0A 2NZ8A 3MMPA 1G8PA 2ZSIA 1NLYA 2EYQA 3K70C 3P0EA 2OMKA 3BFPA 1AB5A 2I6XA 3PCTA 4RK0A 5LA6B 1XDWA 1FU4A 3L07A 3CF4G 3Q4GA 2B5WA 3QE4A 5F76A 2GA9A 2ODQA 4H6WA 1VHQA 2I0FA 3HACA 1Z56C 1E5XA 1FJHA 3AGPA 4LHSA 5KHAA 2XWJI 1JQBA 4JLJA 4QELA 5EHZA 5EOVA 1HNZB 1KGDA 1A76A 1XBTA 5D6OA 3M2TA 1E6LA 3H75A 3HYCA 4Q9HA 2B37A 1C0KA 1UBHS 1M1UA 2VYNA 2VTVA 1GOTA 3MOIA 1I01A 3PNLA 2J5RA 4LUCA 1NJ6A 1SHZA 1NW7A 1W85A 2FHPA 2K4MA 1O5IA 3D3JA 1Z63A 1C0IA 3S5UA 2BP7A 2BFDB 1U8XX 5EIWA 4LXUA 1AQUA 5DGTA 4WN9A 4AY6A 2RI1A 4PCAA 3AEKA 2NUTA 5C8DA 5K8IA 2OXTA 3QEAZ 1FFSA 3D64A 3EVTA 4B4UA 1OLUA 3GPIA 3HBMA 1BDJA 2J07A 5FUMA 5JH7B 3WYEA 4HVTA 4A0SA 1FS6A 5BN4A 1MC5A 1YK1A 3C98A 2J6CA 4II2A 4OOEA 3ICEA 1MDFA 3HVRA 3ICPA 1MAVA 1Z29A 1JAHA 2WYUA 1Y6FA 1WG8A 4RVUA 4N18A 1B14A 2PFSA 2XKBA 4BWFB 5K51A 3TNJA 3FTEA 2J8ZA 1TOAA 1W4RA 3UW1A 2HWWA 1KVSA 2CNDA 2ZWVA 3GUUA 3PEEA 3TLZA 2IOHA 3C2QA 4HAWA 1KOJA 3ECSA 4RS3A 2IHBA 3ZK8A 3M9XA 2QZ9A 2X13A 5CB6A 1D2AA 1PQYA 4RQUA 4IW3B 4RV5A 4LYYA 4BQEA 4R2KA 1U9YA 3KTAA 1V41E 3A1VA 3MINA 4HDNB 1M10A 1JV2B 1Q0ZA 1S3GA 2ORIA 4GYWA 3ELDA 4LJ9A 4P82A 4ZZ2A 1W44A 1TAGA 4Q7EA 3WXBA 5K0BA 4CEHB 5BV7A 3LY7A 5LP6A 4AJJA 1EESA 3PC2A 5AI8A 3HWSA 3THSA 4GIBA 1TZKA 3T6KA 4EJ6A 3D2BA 3LA8A 4IOMA 4YRQA 3UGTA 1MEEA 1RLUA 2C97A 3H2SA 3PTAA 1S4MA 1RE0A 3KD2A 4YMIA 5IKOA 3MRTA 1M1ZA 3IBSA 3PWSA 4OYYA 4Q6WA 3TTXA 3X1XA 1NMXA 3ZI0A 1AKWA 3OEHA 4ZT5A 2I4MA 2PMDA 3AF5A 5AVKA 4Z0PA 3LUAA 5E9AA 2C1ZA 4HVAA 2YHUA 3F6PA 1UJCA 4FOSA 3CWZA 3PCRB 3UMJA 3WLSA 5B7PA 2VDNB 1Z45A 2JD1A 3A7EA 4TT3D 1ZM3A 1OF1A 3QNMA 1NLUA 2RJNA 3LUGA 4PYMA 4DGQA 1YOVB 2FUKA 2TMKA 2J5KA 2REXB 3IUYA 2HYDA 2DECA 1GTSA 2B1QA 1US8B 1G16A 3CLUC 5LQNA 4F93B 1UDWA 1XEXB 2BCJQ 3F5DA 1XTTA 4BMZA 2ICAA 3F9CA 2XTAA 5CD9A 2EV9A 2H57A 2IYWA 1R4AA 1G2PA 1UDAA 2BC9A 1U5CA 3C7DB 1N0IA 3GP5A 3NC4A 3T61A 2OFWA 1RHUA 3RGGA 4D0GA 3ZGLA 1JJFA 2B2CA 2C31A 1WUIS 1JDNA 4KCGA 2D6FA 4GI2A 1NU8A 2ARKA 2QU8A 2C2BA 2X0RA 3C3BA 3TQIA 5JO0A 3NHSA 3TW8B 1UZAA 4DHEA 2Z8YM 1ZGGA 3FRIA 5EWJB 1X86B 2IUTA 4UDNA 5B6IA 2C2XA 3KQMA 3GCWA 1QCDA 2CYCA 5EKUA 3WBKA 3ENNA 4IQ0A 2UYCA 2CV2A 1HY3A 3T9BA 2JS7A 2Z08A 2XJ4A 3B1FA 1ZMBA 5HE8A 3BEOA 3SLKA 2C7PA 3WRYC 2PYDA 1ZJZA 3ABOB 2WJ6A 2A9OA 4Q48A 3ITNA 4P4LA 2Z6QA 4FDTA 1TCAA 2J4FA 5ILOA 1M74A 2NU7A 2PO7A 3Q72A 2REQB 4M1YA 4LZLA 1Z6GA 1JU3A 2NN3C 1GZ7A 5P8WA 1NPYA 4JN6B 4QGFA 4YTEA 1T8RA 5I9MA 1KY3A 3FZYA 3HCWA 3LDUA 4PM4A 2IZZA 4UJ5A 4PYOA 5A9SA 3KSBC 4QATA 2G8NA 1U9JA 1LW7A 2B7LA 3R6TA 3NV9A 4B3RB 4XWAA 3ZXIA 1TLTA 4EJFA 2GPTA 3RUCA 5BV0A 2I67A 3A3KA 4CVNA 2LWIA 2B4YA 3TX6A 1HF3A 1TYEB 3E81A 5J2UB 1PT5A 4ZYWA 5L3ZA 1ZYUA 1HE2A 1SKQA 3M7IA 3PYXA 3HR7A 4DLRA 1OHHD 5BV2P 2CJWA 2C3OA 3PF8A 1L1EA 2C3MA 2OCKA 1RC0A 2HJGA 2HQBA 2CLHB 2I55A 4GSLA 4WBNB 2EX1A 2PSFA 1O0SA 1KAQA 1I33A 1U2GC 4A27A 2C59A 3P9PA 4J94A 2ZBVA 2A0WA 3M5WA 1S9DA 3ORHA 3AFIA 2FWRA 2UXBB 5C51B 3BL6A 2Q6TA 5JU6A 4ZDKA 2AFIB 2I1QA 2AFVA 1T9CA 1S2MA 2QNBA 4GKVA 4S1TA 3AINA 3CUSA 3EXFA 1CF9A 4YXWD 4ARBA 1BMFD 4XQ9A 4NH4A 1E9EA 4FN4A 1N4DA 2NTYC 1RADA 2ZSUA 2ONCA 4FEAA 2ODNA 1PLKA 5E4TA 3CU5A 3KR9A 3OETA 2EXXA 4ZANA 1ZPDA 3CB2A 5A6SA 5JEDA 2PVSA 3QELB 2G63A 4WV3A 1U1FA 4S1OA 2IUSA 4MRNA 4XQEA 3GO4A 1IG3A 1UJ4A 4JUAA 1R7RA 5KU7A 3EVZA 3L0SA 2H9IA 2LV8A 2IOQA 2IPLA 1KAHA 1YCHA 1YZFA 2J45A 1A9PA 1MV5A 2FRDA 1Q83A 4JITA 2XODA 3ABZA 1H4TA 3DMDA 1Y3IA 3DMTA 3HCFA 3L04A 5HOQA 1G4UR 3I34X 4UCQA 1MVOA 2X58A 5H59A 1YUBA 1CQPA 4G5RA 4AS1A 1SVKA 2H2GA 4EEZA 2Y1FA 5CFOA 3MCWA 4RELA 2ZRBA 4MJLA 4PGMA 4QYMA 4YAGA 4NEGA 2QV0A 3QE9Y 3CCCA 4RD4A 3ETNA 3KL2A 4QE3A 5ALKA 5CFPA 2K7FA 2AG0A 3UWOA 3DV0B 3OLVA 4BTLA 2CL7X 2VDWB 3R9IA 2JAWA 4HKTA 2Q9AA 2O1SA 2ZJ2A 3IAXA 4JI1B 4ZAFA 1NC3A 1XVAA 1L5SA 4XIFA 1IBLB 1O94C 1Z3IX 4YI3A 1RBYA 4CQNA 4GEKA 3OFND 1P0IA 4FM9A 1I51A 2JLSA 4YUXA 3IUSA 5IT0A 1CQIB 2W0SA 3DPUA 2IH4A 4OB8A 5C8YF 5F7XA 3CC8A 1J0BA 1GPDG 1WZEA 3CNBA 3W9BA 4NZ9A 1JILA 1Z8HA 2QG6A 1JEAA 1DLJA 1SOWA 2P78A 4B2PA 1N8KA 2VUTA 1NUSA 4IKPA 3A3NA 5CHEA 5CEJA 1ILWA 4PZUA 1CCWA 5REQA 2IYUA 4J1QA 1F17A 1H22A 2WJPA 3FH0A 4RDIA 2YWGA 1P31A 4W5QA 1FRZA 3UA4A 4C76A 5JS2A 1JIIA 2ZGVA 2C61A 4BNNA 2D62A 4D56A 3KETA 1ZI8A 1WPQA 1XROA 1CHNA 1VPDA 1GVHA 2A5JA 4KUHA 4MUEA 3W79A 2DR3A 4NDZA 1BGWA 4EB8A 1A9XA 3K9WA 5DLYA 3WQQA 1JGTA 2AW3A 4MITA 4BCDA 5L3RA 1XJ0A 5EUCA 1JNXX 1YB4A 2QM8A 3F5FA 4AD8A 1A96A 3VNBA 1AUQA 1PWZA 3O91A 2NZJA 3L02A 1T6ZA 7ABPA 2P2GA 3LBNA 2O2HA 1J70A 3PPIA 4EI9A 1ATIA 3RSOA 4ZI7A 5I48A 2MYNA 1HR0B 2I34A 3ELBA 3NTLA 2IJGX 1RWVA 2HA3A 1OX6A 1Q21A 3SR4A 1DBQA 4OUDA 2P4HX 4MV0A 3A1NA 2GF9A 3WGNA 1D5WA 2QQ0A 3TGWA 2XA2A 3PE6A 1AO0A 3R9XA 1GUZA 4M53A 4BFCA 2V0CA 4GMGA 4ENPA 1CDOA 2DZDA 5FBZA 1GA1A 1SA0B 3HV2A 3AEQA 3CLUD 5EHGA 4KR9A 3QFTA 5BYJA 2WUWE 3NHRA 4OB6A 4YCAA 3DZCA 1EHYA 1GA6A 1L7VC 4G0MA 3WQRA 1GGNA 3SMQA 5I47A 4NJOA 1BVYF 3KOUA 3A9RA 2VXYA 3OEEA 4RTKA 1HE5A 4YLEA 3NIGB 5EHXA 1XDBA 3GRPA 3OG9A 4I4CA 4QPDA 1EUYA 1PYGA 2F3RA 2VNAA 2IITA 3TZLA 1OOEA 5JEEA 4MUGA 1RRVA 1RPZA 3OQHA 3LO8A 2W0MA 1TDJA 3CRNA 3L93A 2DETA 1E60A 4P4GA 4IMJB 4OFXA 1TCUA 3KZ1E 4G5GA 4NESA 5AHKA 3REFA 3EX7C 2BGUA 1BVHA 2GYYA 1OWLA 3KC2A 3E9EA 2NYRA 3QEMB 3EIWA 4JS0A 3V55A 2HBYA 1O95D 3VKWA 5CCBA 2CLFB 2XQJA 3T41A 3M0EA 2QTRA 2WJGA 5K0GA 2ZSFA 4LJSA 3PI7A 2GK4A 1KDYA 2FPXA 3L06A 2X77A 1ORHA 4PZYA 2PGLA 1RPJA 1H6AA 1K0UA 2GHIA 2WYIA 4B73A 2NOAA 3FYSA 3HYTA 4UCFA 5F23A 3B2QA 3HDGA 3DVSX 4UZFA 1UK8A 5FLKA 5H16A 3WDMA 2HCTA 4UM5A 3VC2A 3B78A 4LK3A 3FPKA 3LQ1A 1PDOA 3IJRA 4IQ8A 2WP0A 4NZYA 1APBA 4LBWA 2PD6A 1S8FA 3E0QA 2JEYA 1WMEA 3I23A 3JAKB 4OHBA 2GETA 4LBVA 3JD3A 3TTVA 3WB0A 2ZAYA 4DDMA 2VF2A 4RJTA 13PKA 2J87A 5JDCC 1R6AA 1V6AA 1NRJB 3QKRB 4KQWA 4QBIA 4V39A 5A7HA 1YI8A 3GLSA 2F8SA 2NXWA 5D87A 3I09A 3OOJA 4MDFA 2IYFA 4CYMA 3HADA 2M6KA 1K89A 3DCJA 1IVNA 1ZD9A 3EEBA 5E7MA 2WINI 3U37A 1TJPB 1J1IA 5AW3A 2Q4RA 2RHLA 3QLEA 4JIMA 2Z2KA 1ZNWA 1R0KA 2QF7A 2OEPA 2XGGA 2YV1A 1LRJA 3D1LA 3GEIA 3ZLUA 3GDOA 3P52A 4CTKA 2OC9A 2W37A 4CE6A 2PPLA 4MLPA 2JEOA 3MSXA 4LWOA 2IFTA 2ZYSA 3DAOA 4ARIA 2ZJ7A 4FDLA 2WR8A 2J33A 3P9QA 1EU1A 1ZICA 1CY6A 1VPVA 1WU8A 3HQ4O 3IP1A 5J2TA 3Q5GA 5MDHA 3MRSA 1BU5A 2XSZA 2ZU6A 4URVR 1PQ4A 3VSCA 4E5KA 4K86A 2R62A 1X80A 3UWDA 2R2AA 5IJWA 1FMJA 2QM7A 2FX5A 4XVQA 3OQNA 2XCUA 5IM4A 3WLJA 2H54A 3BA6A 1TMOA 3KFXA 4OHWA 5KYYA 1PL0A 1F4VA 1UM9B 4JBXA 2IS1A 3B89A 3FPCA 2RAUA 3NC1C 1PNVA 4LSWA 1HDRA 1M8FA 4EGQA 3UMMA 2QGFA 5FYQA 1R27A 2UUPA 4Q03A 4F21A 1T0IA 4QAQA 4TUYA 1IN8A 1O96B 4M0PA 4DADA 1GG2A 5CTAA 1XN4A 2O2DA 5G1OA 2W6NA 2ZIUB 3U3DA 1XXHB 1FLVA 2QN7A 2V5AA 3H6GA 2ADMA 9LDBA 2ZYUX 5COQA 1NG9A 4JJFA 1ZW6A 1ZA2A 1SVNA 4KB5A 4WCDA 4ZKDA 1RTKA 3QELA 3GPCA 1GZVA 5JBNA 1KO7A 2YC4C 3ANNA 1JECA 5A6SB 2VF5X 2OZVA 3WWZA 3LXXA 1XA3A 2I66A 4LYFA 4HQNA 2C84A 1KYYA 4Y6GB 1FP7A 1LI5A 3PQ4A 4DCUA 1N32B 1TJNA 4LY6A 3CMMA 4TSFA 1NKVA 4I4LA 2TMDA 3CEMA 3F6SA 3I6BA 1FJ2A 3FFTA 3KYDB 3O21A 4RANA 1TAHA 4D5EA 5HSGA 5EGSA 2B6NA 1W52X 2XYHA 1EB8A 2ZE8A 3LUDA 5JADA 2RARA 1FJGB 2UYHA 3D9QX 4GRDA 3L7DA 4LNAA 4GU5A 4QTYA 4OHCA 1U9CA 1SCQA 2R1VA 4PSUA 5G02A 1JDTA 3H04A 3G5AA 4B2IA 3JWJA 1L4BA 3OTOB 4DA8A 2BL4A 2O14A 5LZ4A 4K9NA 2CJWB 2V7GA 1HV8A 3OZGA 2F43A 4QXAA 1FFAA 1LPMA 3TX2A 1TT7A 2J9YB 1TEXA 1DO2A 2P0EA 3LZ6A 3VKVA 2JH8A 4FDVA 4FYMA 4X1IA 1NBMA 1HSZA 2EFDB 4TLDA 5F2NA 1YVRA 1H2RS 2AVNA 2QU7A 3PQ5A 2Z30A 2BLNA 1X1QA 4KYUA 1DWQA 4FWIB 5BQ3A 5BWCA 3NTOA 4PS0A 3ZQJA 3K9FC 3BGOS 5HJEA 2QQ5A 4L0QA 2H1LA 3SICE 1NQTA 1FLNA 4FEEA 3VPAA 3S8EA 1JL3A 4XZ3A 4IHAA 4KQGA 3CM0A 1EX9A 1ZGHA 4QLOA 5AH0A 5M04A 1E4OA 4OX9B 1XTQA 2HHCA 3FDZB 3BILA 1FEZA 4GVLA 4HNRA 1JB1A 4AIIA 1M2OB 4WBNF 2I2WA 1HZJA 4REQA 3KZVA 4MZDA 4ZPJA 2VDRB 4L5CA 4RVNA 2I9PA 2I4RA 2QTZA 3K5IA 4IGIA 4KJZA 3SU8A 1E59A 1M76A 4UDOA 2JFWA 4RZQA 3WISA 4M1TA 3SSOA 3TTTA 2FPWA 3KYCB 4FT2A 3D8TA 4JAVC 1GUFA 3UN1A 4Q00A 5DM4A 2JASA 4ZVMA 5I01A 2BHRA 3QKSA 4GYKA 3O4IA 2Q9CA 3FJ1A 2PGJA 3SR0A 5I9NA 2RKOA 5KSYA 1X7WA 3SQXA 3DHEA 1HE3A 4US2R 4HLCA 4DVGA 2Q29A 5H70A 5GY7A 3WGVA 3CVOA 4ZQBA 2PTHA 1TK3A 1NQAO 1X7XB 4D8XA 2AI1A 1OBCA 3NDIA 4FZ5A 1GAQA 2IOFA 3OF3A 3UAVA 1G59A 2H18A 1XA4A 4MKXA 1XEXA 2IZ0A 4PWZA 1YZNA 2CHEA 1ML4A 1US8A 2H5IA 3BGVA 5ICMA 1RU3A 3VR0A 3ZHCA 4V1CA 1YFJA 4U3JA 1U2TA 1CY4A 2BISA 1YR7A 2XDQA 4LQ4A 3VXKA 5F1KA 2PM8A 4LOHA 1UUFA 4NU8X 2V97A 5FO0A 1YE5A 4BV8A 5DBOA 3A6KA 1E2UA 2ZKLA 3R75A 2XZDA 2WVJA 1T2CA 2H1SA 7MDHA 1KDTA 4LSGA 5IJ0A 2ZPTX 3E7FA 1SVUA 4F2DA 3DW3X 4XWTA 3UPTA 3RTBA 1QF7A 2IBMA 2SHKA 4Q9KA 5HK9A 1WCIA 1Y8QB 2O9JA 1K2WA 5ESDA 4DQXA 1MCZA 1YL5A 4ZVSA 2R4UA 4AF6A 3L82B 3LDGA 4ZHQF 2AOUB 5K6AA 1ZJ4A 1I1OA 4L9AA 1YGYA 2AB0A 1NNLA 1LJLA 3DFIA 4NMMA 2ES4A 3UWMA 3LI2A 3FWHA 4ALMA 1H3FA 1XOIA 2YWEA 2GXSA 2GPSA 2DSNA 1GFWA 1AV7A 2GNPA 1D7AA 2FDXA 2X5KO 3MINB 4FC7A 4GEGA 4I50B 4X3OA 1Z2EA 5CGQB 4XVHA 1VBNA 4B1FA 3EGOA 1L5QA 3GT4A 4W5WA 1FE8A 3VH4A 2I3ZA 3IAUA 4QJBA 1UPCA 2FPRA 3PHIA 4KGDA 4ALLA 2OOKA 4HB0A 4CKCB 2B35A 1VKHA 4LWZA 3MGKA 5KSOA 4JLVA 5CP8A 2NW6A 3ROXA 2C9OA 1QJCA 3B6EA 3NJRA 4IEFB 4HC4A 1UBSB 2QRJA 4RSGA 4KQCA 2VWPA 1L1FA 2G09A 3D31A 5G53C 4B6OA 4NQZA 4A8HA 1OWNA 5EXPA 3A04A 1L7PA 2XGSA 1O3YA 3CXRA 5IVDA 1AC5A 2P1ZA 4Q24A 3W34A 5BW5A 4AN0A 4B9AA 2J46A 4KBYA 1AKEA 3EGXA 4PF1A 2NUTB 4KUGA 2ROQA 1JR3A 2IL1A 3D7LA 4TWZA 1NULA 4BNUA 3JQ9C 3BWEA 4JY7A 6YASA 2F1IA 3RO7A 1VTKA 4QM7A 2CV1A 1T9DA 1T34A 3AU9A 5DEIA 5CA1B 1SXJB 1W85B 3FSGD 2APJA 4CL0A 2DRIA 4MUFA 4Q66C 1QDLB 1DCKA 1D8TA 3LT1A 3WL7A 4JT9A 1EDOA 4XSVA 2VJLA 5B3AA 4RA9B 1EA5A 4QL3A 1C8LA 1B42A 1YNSA 4BFSA 3VKGA 3DZHA 1Z4MA 1PJAA 2JCYA 3EGEA 4FMCB 1XAGA 1ZRNA 2UUCB 3RUHA 3DXXA 2Q3FA 1BX1A 3IQDB 4AKTA 1VKNA 4AURA 3FNRA 3UMYA 3QUAA 1FSFA 4G0ZA 4OJYA 3N2GA 4UQLA 2R6FA 1MTOA 2QTVA 4R83A 5FOWA 1KQOA 4ZARA 5HILA 5EJ8A 5J2TF 3GBVA 3K0FA 3N6VA 4HPJB 1G63A 1JW9B 4FPXA 3GUCA 2CNWA 1TECE 4OFBA 1EFPB 1SWVA 2G08A 3U3JA 4JSTA 4EG6A 5E3JA 5CXUA 4QQNA 5L3QB 3I6IA 2C7BA 3P19A 5DT9A 4Q3BA 2GA8A 3HY3A 1MUUA 1NNSA 5FV4A 1AN9A 3T7IA 2GXQA 4S0XA 5J4YA 2I2DA 3ZWPA 3EPKA 1JLSA 1GPMA 1U11A 2R11A 4JHLA 2CUKA 5C31A 2WWVD 2Q3BA 3OE4A 2OHVA 2LCQA 4AW9A 3P9RA 4ITUA 3UVEA 4DDUA 1U1IA 1ND5A 3ZCUA 3OBBA 4TUYF 5KYNA 1GTZA 5IF3A 2XYPA 3R7NA 1RQ7A 4J3JA 4WESB 4RD2A 1AVTA 4FYYA 3GNSA 1MQAA 4OUKX 4V0ME 3AERA 4WGFA 3ZTTA 1BEZA 5EZYB 1DXOA 1SG0A 2R8PA 1R00A 1RXVA 1L5VA 3NIBA 1QGDA 4B0PA 3ZDBA 4DNFA 3M6WA 3PNQA 1AM4D 2MR6A 4R9VA 2JJ2D 3F96A 4MJXA 4Y18A 1HFJA 1Z38A 2HA5A 3QLUC 2P3OA 5TQ2B 2E5LB 2AK2A 4ENQA 1AF4A 1AS2A 2BSXA 3AVOA 3B5EA 5F35A 4F3KA 3W3ZB 2WI8A 3P0HA 5HPYB 3LPDA 5KB3A 1P2SA 3WWCA 4AK9A 1H0HA 1GPLA 4N5HX 4J7XA 1I5RA 5ELLA 2Z8XA 3RJMA 2QD1A 4ZVPA 5C7IO 3OU2A 2RJOA 1C29B 1S7GA 2E37A 3QVUA 1G20A 4IUCS 4RYLA 5FTMA 2AHRA 3WGUA 5G0WA 5C7LO 3QPVA 1WXIA 3TFOA 3PQ6A 3QYPA 5HHTA 1P1IA 3V4PB 3BJEA 6PFKA 1FU8A 1U9IA 1Z7BA 1ZUHA 3H4MA 1PSWA 4LDNA 4O8CA 5KCZA 4RPCA 1JFVA 1C9MA 2VWHA 3R5TA 4AC9A 3ONVA 1NYRA 3OQ6A 2C7QA 3CJRA 4BMOB 3S1AB 4C0SA 2Q2OA 4FOLA 2CV0A 3RABA 3LHKA 2FFBA 4FILA 4DRXB 5DNEA 3D3WB 5GONF 3T1HB 2FPIB 1W25A 3IGFA 4YASA 4TWBA 3UOWA 2HCRA 2NGRA 1GGJA 4HF7A 3LTNC 5BN3B 4RY0A 3ROKA 1IJKA 2BMEA 2X0JA 3F7OA 2YW9A 3JQ6A 3P1JA 3BTUA 3MCTA 3OMLA 4C7XA 4E08A 4OQEA 2AMFA 1KZHA 5ICSA 1PWHA 2Z4SA 3N1UA 3JPWA 4HTFB 1AGPA 2C4KA 1OW3B 2XWPA 3WRXC 4E14A 5CB4F 4M0LA 2PQ6A 2P9CA 2VP3A 5DSXA 1G60A 3AILA 2XLCA 4P3KA 3AM4A 1NVMB 4JKIA 4Q7LA 4W1SA 3WP0A 3DG9A 4NARA 4CMCA 5I7RA 1RM3A 1PZHA 4UEJA 4TS3A 4UEOA 1XSEA 4DR1B 5IAGA 3NORA 2ZCJA 2BBWA 5LNK6 3CT4A 3HFJA 4MVJH 4GQBA 1YR1A 3RFCA 3OU7A 3VUFA 4J0HA 5CYOA 3WOVA 1YE8A 2IPAB 1TQ4A 2DFDA 2VDKB 1J25A 2P30A 2RI6A 1V3TA 5LM3A 4S1NA 5J40A 1E98A 3T7DA 3UPDA 3PC8C 2FSHA 1E9DA 2A59A 3ZWYA 5AXAA 3N9IA 1P4SA 4BLVA 1Y1LA 1L5FA 5AM5A 5JAZA 3G13A 3AUJB 2BI8A 4OL0A 4AAYA 1Y8ZA 2QR3A 3DL0A 2W70A 3GIWA 4MUNA 5JOQA 2DP4E 1FTWA 2WHQA 3EXIA 2DG2A 1DJOA 1LDNA 2H0QA 3A4MA 1HG0A 2WU3A 3HVIA 2ZRHA 2FWPA 4LZNA 1AGYA 5FFMA 1XZIA 4H35A 3V8QA 1RJGA 2V4UA 4RESA 4L2IA 4RTJA 2AJ8A 4H1TA 1ZK1A 3DVLA 3ROPA 1XV5A 3AR4A 4JK3A 5JCJA 4C6TB 4BMDA 1D2GA 3U4DA 2QRHA 4DMLA 1RYBA 3NTRA 4YRSA 3GOQA 1SHUX 5F64A 4PHCA 2W2NA 1UKYA 4FYHA 5JYDA 1P44A 4FLFA 5IH3A 3SYRA 2OGTA 4DEXA 3BXXA 1QIFA 2D1YA 5JTTA 2IU0A 4FMDB 3FHCB 3W2IA 3OZDA 3QEJA 3W7BA 3QVGB 4IYRA 3MBKA 2RB4A 3F3SA 2J3LA 2ZIZA 3J80A 1Z5NA 2GCGA 3TAHA 3MTBA 3S6JA 2IXTA 2BI4A 5EZ5A 1MX5A 3UAYA 1ZJJA 2PJZA 1UMDB 4KR6A 2JFZA 4HXEB 3RNOA 4HUQB 2CHGA 5FBWB 3SZUA 2P6NA 5CFNA 4RHUA 4GF5A 1FW8A 3UAOA 4AN4A 1HX7A 4OOFA 3PXEA 3AZOA 4PW0A 5CVJA 4ESOA 5EIEA 2DWQA 1U0EA 4FGSA 5DHPA 2DBQA 1Z8FA 3H1TA 1MXHA 1IULA 1PK9A 2ZBQA 5FPSA 3RASA 4C4PA 4RTLA 2ORWA 2C9YA 1F0PA 1PIWA 3U9TA 1UBEA 2HMSA 1GGEA 4DR7B 3NP9A 3OESA 2H2DA 2IYSA 2QJWA 1J97A 3MCVA 3LUFA 4L5YA 1NOKA 5CLLA 3A1EA 3IP7A 2PWAA 1MG0A 4J03A 2DQ4A 4FFWA 4B40A 4NBUA 3SNKA 4AKSA 1K97A 3MJSA 3BWYA 3QWHA 1P77A 1KKUA 2WOOA 4IG9A 3EXG2 2PSDA 4KNYA 3DB2A 3EFOB 3FYDA 2YNMC 3OCXA 1BDHA 1EBFA 1NASA 1V1MA 1YVPA 2K6GA 3C74A 4O4IA 1LS1A 2CVZA 1KS2A 1TU3A 3CW2A 1B0ZA 2EGHA 3EBOA 2ZFUA 4J4BA 4M7PA 3VU9B 4L8WB 1NI3A 3JARB 4V0KA 5KOYA 5CT4A 2HUNA 4G4GA 2BHLA 2YVAA 4KFTA 1XTKA 3I6MA 5CB8A 3WGZA 4DA0A 3ZZ0A 3PWTA 4K0KB 2GS9A 3NAZA 4TV9F 1CZLA 5ADHA 1E20A 1YBMA 3E70C 1XRLA 4ZYTA 2GEKA 1HETA 3Q7QA 4H7PA 3KKQA 3N2KA 5IF9A 7GPBA 1QE0A 5AVXA 4MVJD 5B7NA 4UVIA 1XT6A 2FYTA 5AK4A 4B17A 4R1LA 4LZOA 4RTRA 4FGWA 3C4JA 3AQIA 4R8SA 3A32A 5HM8A 4AX8A 2QLFA 2RGYA 1HL3A 4EELA 1VGRA 4NS4A 3O8LA 2WZCA 4EYSA 2X5XA 3HP4A 3PK0A 3ITEA 4P80A 4FQ8A 5J5CA 5LNK1 5HQTA 1LV8A 3F90A 4GPZA 1JKJA 1WCYA 3FKSD 1SBQA 4QXQA 2ISCA 3O9ZA 1U28C 1CVLA 3MSCA 5CA0A 3QA9A 3DW1X 4LW8A 5HIKA 1F4PA 3IE1A 3RKSA 4D6XA 4PPNA 2VJQA 1DIHA 1MC8A 2WKPA 3WLPA 1VBKA 2ABWA 3W77A 4Z9BA 4ZEMA 3HVJA 4UDXX 2MOKA 2AN4A 2RGNC 5TQ0A 1XRNA 1KY2A 3KJEA 4A4DA 2Y77A 2FUG1 1NXTA 2QSUA 1GZDA 2JGAA 4ROTA 3ZWNA 2VVTA 2W8ZA 4IDDA 2OFFA 3U0VA 2OV8A 1IQPA 3QEKA 3W6UA 3K1AB 3BDIA 4MRPA 4LZJA 1J8MF 1LW6E 4IPTA 2FZ5A 4ZIRA 4FFDA 4EHJA 2R6HA 4B34A 1U3UA 4PHFA 4UBKA 5LBTA 2EJCA 4QDZA 2X0DA 1G0OA 2ZK7A 1SXQA 5G4KB 3C6ZA 4R1MA 2PSEA 3G0CA 3TWOA 1JU9A 3LRPA 2AA3A 2GTPA 4D26A 3PFGA 3ND8A 3IO3A 1GKLA 3AKYA 4DRZA 1LPOA 2F3UA 4OI2A 3A6LA 3VAZA 2ZB7A 2ZETA 3TRIA 2ZKIA 5D3MA 2PMBA 1W34A 4CJXA 4I9NA 3AI7A 3DZ8A 3DJYA 1Y8AA 1H5NA 1BOOA 3JVUA 1H1LA 3OJ0A 3RVKA 3KTOA 1V95A 3ZH2A 4YRKA 5IDXA 1W36C 4H31A 1WABA 4JXXA 2ZVDA 4KYIB 4BV3A 5K3DA 3VDQA 3F2IA 1ZCAA 4MIYA 4HWSA 4L0CA 1A8SA 1OROA 5FNZA 1GCAA 2I4LA 3NH6A 4AWBA 4IOLA 1DKNA 3BXPA 5KCMA 3ZJTA 2W7TA 3VKFA 4RPKA 5FB3A 4MV9A 1G1AA 1GSHA 3TRJA 2Q4DA 1VCNA 1U3WA 4HH0A 1F3OA 1JAYA 3OE7D 4LGYA 2JD2A 3JQBC 2XUIA 3E48A 5CDTA 2ZJBA 4QQ8A 4RV9A 1XTUA 2O2YA 5KWSA 1WD5A 5JC1A 4MO2A 4Z3DA 2H2AA 3RD5A 5JC8A 1DRWA 5IUNC 3LSTA 1VLVA 4TL6A 2QPAA 5C1BA 1F7UA 3SSAA 2E1PA 2C1EA 1Z25A 2FLVA 4M49A 4J1NA 5FOSA 3ZX5A 4ZIRB 5C35A 5CB4A 3ACBA 1XZNA 2QN1A 3IV9A 1D6MA 3ZDDA 4HGPA 5FI5A 1V7PC 2IBSA 4M46A 4B6JA 3N8KA 3K1AA 3MNFA 4PNPA 2UVPA 4U4AA 1F38A 1KEZA 4X6LA 1OA0A 1ONBA 1QKJA 2JGMA 3DEZA 1ZCJA 2C03A 4OQQA 1PAUA 4UVHA 3NFRA 5FL7D 1BGXT 2WTEA 1EM8B 2BFCA 4BNZA 1MOZA 3CVVA 2DTDA 3AM1A 5HW0A 4CM9D 4IINA 2JHFA 4R1UA 2WMDA 3TW6A 5GM2A 4LWQA 5JPIA 1I1HA 3RU9A 2YCLA 4RK1A 2KMLA 4O1HA 3NNDA 4FE7A 3NVMB 4UHCA 3HY4A 3U6BA 5L4NA 1WKCA 1EP9A 2VH5R 2IWRA 4PQEA 1RJDA 2EATA 2GN8A 2PKQO 3OSZA 4MEJA 1Z6QA 1J1UA 2GYVA 1W5TA 2GEUA 3R6WA 4JR1A 2ZPAA 1NW6A 1S8OA 3OZBA 4IXDA 2UVQA 4X1YB 5FULA 3OPMA 1OYVA 1LDEA 4I36A 4B3BA 2QZ4A 2AEMA 2LDXA 3VGPA 4DNPA 1DQYA 4V3CA 1ISJA 1ZKDA 2H6EA 3GROA 2IZ7A 1UC4B 4P0PB 2FWJA 4P34A 1K8YB 4AQYB 3SDBA 2CXNA 4Q15A 3ELWA 1G6HA 5B2ZA 2AN3A 1SHKA 3VR1A 1K27A 3BJRA 1T0UA 4ZMSA 5BV8A 2J0UA 2MCFA 1IM5A 1DBIA 1A1VA 2PE5A 4RE6A 2FPGA 1XEWX 4NBTA 4QQFA 4IJWA 3CO5A 4LDQA 3SAJA 1S4QA 4GSKA 3L0DA 5HKKA 1MX1A 4BP1A 5E9JA 5KSWB 1E1RD 4OHKA 4OXIA 4I9FA 3BMOB 3K6RA 3ZDAA 1Z17A 2WZBA 4BMCA 1ML3A 2PS0A 4A5SA 1OJ7A 1UJ6A 3E5NA 3ADPA 3FX2A 4NENB 1AKYA 1GSIA 3JARA 5AFSA 2E4XA 2I33A 3FTNA 5F3RA 4H3SA 1CZKA 2FW6A 1NZJA 4LGVA 3ZE1B 4C4SA 3U5ZB 3A31A 5HFNA 3K0AA 1W59A 3NHFA 1YDGA 4G8CA 3E5RA 5ENVA 5EINA 2E48A 2FQXA 3V8MA 4BV9A 4DIFA 4DUGA 5KMGA 4L27A 4ZXFA 5DYIA 2XWQA 1JLLA 1ZEJA 2HJSA 1CWUA 4GR9A 2BEVB 1ZN8A 2XTJA 4DJFC 4DLAA 3KFLA 5C9ZA 1J33A 4YDHB 1K5PA 3VQTA 3IHLA 1FTYA 5F1OA 2OENG 2QVZX 2YRWA 1BMDA 2FEXA 4UMVA 4ZVQA 3QYJA 4BBAA 4DPMA 1G5FA 3VVLA 3EXEB 3K9LA 4RYDA 2R7NA 1JZQA 3NNNA 4EFKA 2C4TA 4F85A 4DV3B 1XZBA 3KZCA 3OLCX 2E4UA 2Y1WA 3LYLA 3RJZA 3PDUA 1T4CB 5IULC 1QXSA 3R41A 2YQ4A 1QOPB 1SQSA 4R1QA 6REQB 3WGGA 1GPWB 3HL0A 4KPYA 3KQHA 1IBMB 1Q84A 1JG1A 3K5HA 1UEXC 4ROSA 4JYZA 4WY2A 1TQ2A 2HMUA 4FW9A 5BSFA 1DPFA 1QIKA 1U2GA 4FGLA 4B84A 2H06A 5K8UA 1E1CA 5KX5F 2CFCA 5A4IS 4I55F 4OAPA 4RPIA 1CRPA 1OU0A 5CAEB 1EJ2A 5CDYA 2NVBA 2YVKA 3JU3A 4W5HA 5FUVA 1GZ3A 4NYIR 1TQHA 1H3NA 4MARA 521PA 4ZO9A 3UO8B 1TFUA 2YN0A 1I0ZA 1W5BA 4Q4JB 2ZBUA 1G3IA 1X3SA 4TMFA 1NE7A 1Y34E 3PGKA 2F62A 2J7PD 2O7VA 2RHOA 1DIOB 2ZE5A 3HLKA 3CYFA 2GAOA 3DLTA 4YN3A 1JI3A 4TMTA 4BEWA 3PDIA 5DBHX 1SXJC 3E3LA 1QQ5A 2POQX 2WWGA 3D7KA 4HEHA 2D8AA 3LCJA 3VYVA 4XM0A 5ALTA 1SQFA 2LPMA 4QM6A 3EUEA 4IWXA 1FOEB 1X1TA 2ZBGA 3NM5A 4OJKA 5IK2D 1O9BA 5EJEA 3J81A 2DWCA 1G38A 1QHIA 2O8BA 4WMLA 2X3YA 2HBRA 3AKDA 3CH6A 2DFLA 3GJQA 3I3SR 3QTTA 2Q0QA 4YCJA 3SLGA 4BTEA 5I7UA 3K6SB 4BDSA 3Q0EA 3A6ZA 3OJFA 1L3CA 3B1KA 1TM1E 3OT1A 1UK6A 1YZHA 1FNSA 1YXMA 2PZMA 3WSTA 4EHFA 3P9XA 4FFSA 5C1OA 3MGBA 1JX6A 3KR1A 2AD5A 4CKXA 1H65A 4CEIB 1I3NA 1FF9A 1RMTA 1EUDB 2R2GA 4OGGA 1XU4A 3HGQA 4BUZA 3RTDA 3IESA 4HWGA 2XT9A 2HF8A 3DB1A 2OB1A 3TG8A 1RAFA 1UXGA 3CGWA 4I9UA 2C2ZA 1WMDA 2W2QA 3GRKA 2QZPA 4OHVA 1FXUA 1DCFA 1KPGA 1EZ1A 3DAYA 1JEQA 1QO0D 3D3QA 1QR6A 1G8JA 1K6EA 3S81A 5KYKA 1BA2A 2PT9A 1O8BA 1VHWA 3OFNA 4FR0A 1X8JA 1XQYA 2Q5CA 3MT9A 2FB9A 3A37A 2CMGA 2ZIFA 4KO8A 4ME6A 4BJ6A 4BO9A 1QU2A 1A5SB 4MWGA 3PXBA 3I5XA 1JN0A 1Z0IA 1HEIA 3U2QA 2XLBA 1ZNXA 2CHVA 4K81B 4P93A 1IN4A 1XZQA 3G2LA 3PUVA 2H48A 4PYKA 4JP1A 1QC5B 2HWYA 3D8HA 1Z2OX 2O0JA 3GXBA 1AN0A 4O2AF 1FJXA 1MQ8B 4DJJA 2V74B 1U0NA 2FPIA 2I2CA 4G5HA 4R9SA 2QAJA 1VKJA 2ZUTA 3D3WA 1KETA 5E6UA 4U2GA 1JLKA 5KKAA 2KWIA 4EP1A 3EVAA 3INGA 2DY1A 1MNQA 2XEXA 3C48A 1A97A 3GA0A 3VU3A 1AD2A 4UU1A 3IP8A 1Y3DE 2OWEA 1CR0A 3EIHA 3T5CA 4A0FA 4LJ4A 4EHHA 1RKUA 3LKVA 2Q1WA 4L85A 3MJHA 3QNWA 3UJPA 3A36A 4YJ3B 1TFRA 1WULS 4A0RA 5F98A 3ORRA 3GBPA 2X22A 1GQQA 1JYFA 1NBIA 4IF6A 3EC1A 4BX2A 3MS2A 3PCXA 4FJ1A 1TK2A 2A9JA 5IBQA 4KRXA 1D4ZA 3OVMA 2HOQA 3EAFA 4MVJA 5HUHA 5E0KB 1QO9A 4UEQA 4CM1A 1DAPA 4GGMX 4JJ7A 3WADA 4EX7A 3SHTA 2VAMA 3QPDA 4UASA 3KJHA 3CY6A 4UBOA 3QOXA 3BSYA 3GLKA 2Y76A 3F7NA 4OXKA 2Z5FA 1PJZA 2OCIA 4FX2A 1ZK3A 1JIUA 1KK3A 3RFVA 3AFMA 2OD9A 1X2EA 3A7DA 1N6HA 1KI1A 2OILA 2NPFA 5BY2A 3KB2A 1DC3A 2WA1A 1SVOA 3B1JA 4MIKA 1I2BA 1QONA 1I2DA 1G6Q1 1I7LA 2GTIA 4JLBA 4YP6A 1DUIA 3CN9A 3OCZA 3HB4X 3VZCA 1T2FA 2AQKA 3SYKA 1LDYA 3EK2A 3FHOA 4QD3A 2XNJA 5TXGA 1Q3HA 1R5BA 1GRNA 3IUEA 1R15A 1T3LA 4GT1A 3VO2A 1QRUA 3SIRA 4OYHA 4N7JA 3P2EA 3TEMA 2V7WA 3ILVA 1SQ6A 2EEPA 1WZ2A 2VHJA 3OHMA 1SUFA 1YR8A 3A9CA 2QMOA 1NWHA 2PEZA 4WFKA 2Z2YA 4CW7A 4LOLA 4Z0TA 1BCRB 2VJYA 3RC9A 2OXIA 4BDTA 5ARBA 2HDNB 3KLNA 4OK3A 4K6FA 4NX2A 3SQOA 2XIJA 4MGIR 1N9GB 4MJ3A 3LO5A 4BB9A 4CM7A 1GKUB 3KKKA 2X8JA 1C1DA 3D8RA 3D3EA 3IDAA 3O03A 4A7PA 4CDRA 4ZCMA 3N2NA 4H60A 1PYDA 2OTCA 3A4YA 5I4KA 2I71A 3CJTA 5H83A 2XYRA 3LXUX 4O59O 1CP3A 4RIEA 3MJFA 1T2NA 2O2JA 2PS3A 4PAWA 4A1OA 4GMDA 2IOYA 3NP7A 3WMGA 1H9BA 1Y3AA 1NA5A 1SVWA 1VQ1A 2B1IA 2FSGA 2JAXA 2JGDB 4PFQA 5GZ6A 4ZZ1A 1FNNA 2PX5A 3I9LA 2PUFA 3NR2A 2CNWD 4UU8A 2HMYB 2IY7A 4GS5A 1E3SA 5LLSA 2CK3D 3OT1B 3P27A 1TJYA 1GQ2A 2P2DA 4OMCA 1LV7A 5DK4A 5JBIA 4PLPA 4CETA 2FAXA 3CZ9A 5IKPA 1SXJA 4Y1FA 1XTZA 1L5ZA 2QA5A 3K4PA 3RWBA 4UTVA 1FK8A 3LLCA 3NAMA 4ZK6A 3GEDA 1B2LA 3MQ2A 1V16B 4HAOA 5IDYA 2X6QA 4DDKA 3DL2A 5AHRA 5EE0A 3MILA 1KORA 4L51A 4RC9A 4DIUA 4OQFA 1GNRA 1A9YA 3G59A 4HQFA 5KHOC 3C6XA 4FLEA 3U13A 2AW5A 3V7YA 1R5OA 2X0FA 1ACJA 1H2AS 4JLSA 1WVIA 1Z4PX 4Q4JA 1DJPA 4GXTA 4M1MA 5KOIA 1JH8A 3FVWA 1GY8A 4KACA 2H5LA 1ZU5A 621PA 3GRFA 1G5RA 1OFGA 1Z26A 3LF1A 5ETJA 2CFTA 1QQBA 4QUDA 4DC0A 4OLAA 4XTCS 4M9UA 2DJ5A 4Z4FA 2EIHA 2QM0A 1OLXB 2NVOA 4IJ5A 2H2FA 4PLHA 1JSLA 4ZU1X 1F2TA 3FUTA 2QMQA 4I08A 1JT2A 3BH6A 1C4KA 4JJ4A 2XUZA 4JVMA 1FX0A 4DV4B 2O0HA 1CEQA 1ESDA 5ER6A 3U4GA 3JVDA 4BNKA 1YDWA 3ILYA 4ISBA 1XPUA 3A6DA 3ZNPA 4LOIA 1SC9A 1ISMA 3DO5A 5BVGA 1SCAA 4B7CA 5GONA 5TGDA 1JYEA 3GT0A 5IBPA 1TGYA 1KARA 4PNZA 3ZXUB 4DTIA 3IC5A 3KQKA 1C7ZA 1V1RB 2YNMA 2HW8A 1EB9A 1VIMA 2G40A 3RB8A 2CJXA 2B34A 1UOQA 3EZ7A 3LT0A 4YNBA 3UQZA 4BNJA 5I7VA 3HCBA 4LY9A 4NWIA 5ECYA 3T9EA 5JAPA 4IIVA 5JQWA 3ELUA 3TLGB 5KWVA 4V1CB 4YMLA 5K8VA 4WECA 3NDBB 3L8FA 1EVLA 3PFNA 4JBNA 5JCPA 5KTPA 3C8HA 4BHTA 3H4VA 3CXUA 3CV3A 3K05A 2FOXA 3MLAA 4F04A 1KJIA 2K5UA 1RC1A 3T3MB 1A4XA 3AL3A 5JFTA 4P7JA 5BQFA 2NO1A 1X7XA 1Z2AA 1NBMD 1OC4A 1TMYA 2C3PA 1KFJB 1OSNA 4IX9A 4UVGA 2A88A 3ZNQA 4EMSA 2Q46A 2D0PB 4A0GA 2R8XA 4BUCA 1UZLA 2VNIA 3I62A 1FTGA 3M5CA 1XFDA 1OIWA 2AZDA 2HPAA 4KHZA 4Q47A 3IPXA 2PJRA 2IYPA 2QG4A 2PVPA 3N05A 2DQKA 2P0AA 1LRKA 1DEAA 1QIJA 4YCDA 3U3MA 3DO8A 5KTKA 2C8JA 3IKMB 3RTAA 3KVNA 2V8BA 2PRZA 4JX8A 2YJNA 5ADVA 3SEZA 3DOUA 3RFFA 3SYTA 5CT5A 4BQSA 1OWOA 1GFZA 2H1FA 2VO1A 1NQWA 1RAHA 2EJWA 4LRUA 5GGXA 5CW2A 1ZA1A 2IXEA 4W8HA 1A5AB 2DKFA 4IIJA 1CDEA 5DI3B 3VNSA 4ZMRA 3GMDA 3B82A 5LDGA 2DYKA 1F48A 3LDHA 4C87A 4ZVRA 1U1EA 3DVRX 3OX4A 4NZNA 3EMVA 4NRDA 2YTZA 1W4AA 1ST2A 2P90A 3GA7A 3IIMA 4OU4A 4TTIA 5H3CA 5BN5B 1ID1A 3V4FA 5IMSA 1VIDA 2JLRA 5JRJA 2DFPA 2QTMA 2GHTA 1A5ZA 3B52X 1N3IA 1THTA 2E4VA 5B1SA 3VO8A 5IT5A 3KSAC 3K0SA 3Q8XB 2QN8A 1SULA 1D1TA 2PUVA 2NSLA 1P9OA 2B94A 3FNGA 1VGQA 4X1IB 3E9QA 3HKBB 1OH5A 2DUJA 3O94A 5K3EA 5BNIA 1J8VA 2QVBA 2WQ6A 1Y5LA 2UVPB 2G25A 4LA4A 4OHXA 5F7ZA 2G88A 3CVXA 4P32A 2QP9X 1MJFA 4QLAA 5C1IA 2C5GA 1Q1QA 2WWHA 5DNAA 5BMOA 4HMOA 3H1AA 2A3RA 4TWAA 5AJZA 3FCCA 3R5HA 3EF3A 5BSVA 1T9GR 1Q16A 1WVGA 4HR7A 2O2CA 4PG6A 1OFUA 4Y67A 4YGYA 2I5PO 4DMHA 4F6RB 1J0AA 1B8OA 4XAQA 3HUEA 5LQSA 1IK6A 1N2CB 1EGVB 2G1JA 2RHHA 2V96A 4NMHA 4RA6A 2P67A 4QGBA 3Q5EA 4TL7A 2CZCA 5BSMA 1CEEA 3LWBA 2XUHA 4MKHA 1GCGA 2DPHA 3IOBA 4QDOA 5L53A 1L5YA 1TM5E 4RMIA 1V2HE 4YWHA 4GG1A 3K72B 2WICA 1G6KA 3FPHA 1F2VA 3RVPA 2X1MA 4EHNA 1T0PA 1NX6A 5K0EA 4CLDA 2OQIA 4ZDIA 1Q0UA 4ZC8A 4M8NE 1T1JA 1X70A 3FWKA 1II8B 4PRLA 1JSRA 4WA7A 3TZQA 5JJCA 3RS4A 3VV3A 1Q7RA 2HK8A 1B41A 2VNJA 4IHKA 2GJ4A 3F9RA 5BVHA 1Z6AA 3PPYA 2ZUVA 3VPSA 4TTTS 1Q0PA 3SNHA 4EHDA 1N2CE 1VLMA 2QQGA 4Q21A 2C5LA 3H3XA 3TR6A 3PNOA 1JUDA 1TUIA 1XTIA 4CDGA 2QZZA 5EE9A 4KIUA 1IZ7A 3TRDA 5BR4A 1UM9A 3DAFA 2FZEA 3RF7A 3UK1A 1EZZA 2W2LA 1NP7A 1MP0A 3DJFA 3JQGA 4BFZA 4ZYXA 2O2EA 2AE1A 3FLAA 2G9QA 1ECBA 3OCJA 1XNQB 4N65A 3QU2A 4DZZA 5IVHA 1B7GO 1Q1AA 3EXAA 3HABA 5GGYA 5ICGA 1P62B 2LIVA 1F1BA 3IKJA 5CVUA 1YRBA 3LECA 5J2TB 1QR2A 4C88A 4D7AA 1X7YB 1WBJB 3TB4A 2D1TA 4UBNA 2RGXA 3O4JA 3ZHOA 4YUWA 1KTIA 1SC1A 1TF2A 1GQOA 1MNAA 5A7GA 1CF4A 4J0CA 1LPAB 5IJ9B 2KB0A 2O06A 2WYHA 1TLFA 3GFRA 3QVOA 3TZCA 5F2EA 1Z7YA 4INJA 4FS3A 4MRMA 3UENA 1Z0JA 2EF1A 1G64A 2HQ1A 4KRYA 1NTRA 2WF7A 2I8LA 3PFIA 2C78A 5KNCA 2QE7D 1PV1A 2HT6A 4WINA 1C3OA 3KEGA 4B6QA 4ND2A 1T1EA 1A04A 1LFDB 3M9LA 5GPBA 1LSJA 2QR5A 3H3JA 3IB6A 5C3UA 2C07A 4D8YA 4Q9DA 3KJXA 3HGTA 4ZVTA 2IDJA 2QP3A 2AD1A 1PTJA 5HKKD 4GP7A 4MCAA 1XQ6A 2CZQA 2XMSA 2HMAA 1HG1A 4CI9A 3AV0B 4UNQA 1L1QA 3TK1A 1VI6A 1PJ3A 1WF6A 3EN0A 2XA1A 4DR3B 1QQAA 3GRVA 3H2BA 2C7RA 1DUSA 2BIFA 1TRHA 2GM4A 1LBSA 1WOMA 3RVRA 3IOEA 1GPJA 5DDIP 1CNMA 3PUYA 3UMBA 3FCYA 2RIRA 1WY5A 2OHOA 2O8FB 4E0BA 2AXPA 4MWSA 2CHQA 2QDKA 4CM9A 4Q3EA 5TX7A 4I50F 4LJ8A 3C3XA 2H4WA 1P2GA 2BZ0A 3C3JA 4CM4A 1OI7A 2Q4OA 4LVOA 5K6AC 4D02A 1D09A 3QEMA 5CA1F 1N78A 4FMDF 2G82A 3I4CA 3IPYA 1U0RA 4KXWA 2GPJA 3LUJA 2ONJA 4J43A 3VR4D 3MT0A 2BSQA 3VR4A 3EXHB 1B26A 1C4XA 1H0KA 1K7YA 2H4YA 2A9KA 2IHTA 2R8OA 4K5QA 4RDCA 2F59A 3W9UA 1TTQB 2H7VA 4WOCA 1UDBA 2G4VA 3VHQA 3L8MA 3WP1B 4EPWA 4R6XA 1FYFA 1CXZA 2I87A 4YAEA 2GX6A 2PS1A 3BRWA 3CF2A 4MHOA 1L7AA 2A5LA 2I1WA 2QRUA 3STYA 4LTMA 4RM2A 4AMUA 4B31A 2IEZA 2OV1A 4AI6A 3OF5A 4DCNA 4U6SA 4R69A 1P0FA 2AKYA 3A11A 5KTSA 3LMKA 4DSUA 4CWAA 1GL7A 1FFWA 1I3KA 2GJSA 4K28A 4CU5A 2X19A 1O94A 4OUDB 2FFQA 3L6OO 4D3DA 3ZJYA 2H0AA 4LJ6A 2Q99A 4PR3A 2CJFA 3TRHA 1D2MA 3OJLA 1GPBA 3W5BA 2P2YA 2R1TA 4XLTA 2E4AA 2GD1O 3AXSA 5IASA 3RLIA 2Q0XA 3BT7A 3KUUA 1CF2O 4DMFA 3ZV5A 3WWEA 2ZAMA 3IDSA 5I8PA 1E3JA 1VRVA 1SUDA 4QSMA 1P4GA 1OXUA 1WPXA 3MJVA 2IZ1A 2WSMA 2J9FB 4MV7A 4FIDA 3TOSA 4RM3A 5HOEA 1I14A 1WZUA 3UGKA 3DKPA 1H05A 5FR1A 5BT8A 2VJDA 1E1KA 3R6GA 3E3OA 3I9FA 3PE4A 4UVDA 4X8LA 3SSNA 1RLOA 3KVRA 2HJRA 2WNIA 2EKDA 1RXEA 2H29A 3VPDA 2VJOA 2GN9A 2WJHA 1LQ2A 2XSZD 2ODTX 3ZWWA 3AVQA 3NDPA 1GLNA 4PZCA 1OAKA 2PPVA 4B35A 2BGGA 2G9RA 4A8JA 4YV2A 5I5EA 2QVXX 4G4SP 1QANA 4OGLA 4ZVKA 4EW3A 3C3CA 5DWVA 6ADHA 1IZYA 1P39A 3E8MA 5B30A 3EXIB 3UV7A 1HQDA 2X42A 2G71A 1SUEA 4MINA 3R77A 2WOJA 3H5VA 2DTXA 4I4NA 1TKAA 4ML3A 3G7SA 4RVGA 4DIDA 2H1OA 1FC0A 2VPZA 5AM0A 1PZXA 2VTKA 4KWEA 3CUVA 2O2XA 3QFCA 4C21A 3UK7A 1E92A 1XVUA 2CFRA 2W2PA 1W4ZA 3I2YX 1AB6A 5T8KA 1ISRA 3ZBQA 4P7FA 1AE1A 1WD7A 4OBBA 1ZRSA 1GGKA 2N42A 2XAAA 4R5MA 3L7IA 5AVJA 1TM2A 3QPCA 2FMHA 2JJ1D 2VZEA 3KR2A 2CW5A 2JLQA 4KFSA 4R8MA 4AKGA 5GINE 3G1TA 1B0PA 4N3GA 1RWMA 3RJ5A 3MJEA 2RHJA 5CDFE 1SO8A 3NGLA 5JE8A 3IODA 1KJQA 1W8IA 3ZCTA 1KI3A 1KO8A 1FRQA 4XD7D 4PGGA 2ZITA 1ZR4A 3H4IA 2ZB8A 1H8HA 4OJQA 3K0CC 4NYMR 3ZZ1A 2VJCA 2EZ9A 3H0EA 4ND8A 5LDHA 1CUXA 3PQCA 4AZ0A 3WL6A 2QP4A 1U3TA 4HNTA 4LIPD 2WHPA 1G5TA 1ZIOA 2R48A 2G0AA 2WSYB 4D9MA 5AW2A 2AFHB 3QLUA 1R5JA 2L69A 2PWPA 4JA2A 1K88A 5ALVA 4B3SB 4H1VA 2XUJA 5E1MA 3E82A 1L1RA 4X93A 4DCVA 1E4VA 5BQOA 1E96A 3JSAA 3TSYA 2IRWA 4XRRA 4LDRA 4WJZA 2WRZA 4AY5A 5C5EA 4CHTA 3ZDXB 3RS5A 5JSYA 1BDIA 1O03A 4M9XA 5FF9A 3IE0A 3DDNA 4KI0A 1O4VA 1FRFS 1ABBA 2QMEA 5I4IA 3DBHA 1P2BA 2ZS8A 3CPJB 1VL0A 1RQXA 2DHCA 3L79A 4WBNA 1QAMA 4DL9A 3AKZA 1BSVA 2ZRJA 1SUWA 2Z3ZA 3L4KA 2C9BA 3GIDA 4JBWA 2MIIA 3HCDA 3EIOA 3G8BA 1D2RA 5A3RA 1NF3A 5IAEA 2XADA 3RRZA 3DBOB 1KFCB 1VSTA 3DE3X 3Q3IA 4UREA 3QUSA 2HA6A 1UBKS 1EXVA 3JQ7A 4U63A 2QTFA 4A8PA 4BVLA 2IKQA 4AYTA 4M22A 1HFWA 1PFGA 3EDMA 4C01A 4XLLA 4CF7A 4JSRA 3RC8A 3U16A 2Q5OA 2P3LA 2XZOA 4Q93A 5A9SB 1GEEA 3KSUA 4O4HB 4UBMA 1YZVA 3HJHA 1Q22A 4PS1A 3R23A 5CNIA 5HBGA 1L5MA 4L4SA 4BC1A 3UPUA 4FOOA 3PVCA 1PU2A 4TMWA 4XWWA 4OB7A 1G8YA 3K2QA 3RVQA 3KLMX 3U1TA 3WLLA 3AETA 4ZAGA 3VU8A 4DA4A 4CFYA 4K7JA 4L4RA 1YZ3A 3VR3D 2G28A 4LOKA 1UZMA 4KOEC 4II7A 1ELOA 4J3NA 1BYUA 3ASVA 5EEHA 1HDOA 5AUQA 3CKKA 1UP6A 3WVNA 2YYAA 4A2CA 1E2PA 4JLKA 3FI9A 1RI1A 3LSYA 1Y9JA 1XRMA 5ADUS 1MO5A 3MPUA 1L9KA 5EWJA 3IRUA 1WZCA 1J39A 1P0MA 4EJ2A 2DWUA 3T3NA 5KPJA 4R9UC 4ZJYA 4TPKA 2WIFA 3TSAA 1TU4A 1QVZA 3GAAA 2WG1A 4L3WA 4LJYA 3ZU2A 4OAOA 4QEZA 4WKBA 5HGXA 4RK6A 4HRAA 5K8JB 2I91A 1GNPA 2GBCA 1Z4KA 2PL3A 4CF5A 5BMVF 2IS4A 2N9UA 3K0FB 4OL9A 4AFNA 1HH4A 2EIXA 1ZC3A 2J3DA 2UZ1B 3LDFA 1Z0ZA 4KNWA 1GQFA 3RROA 2EX4A 2BZSA 2R00A 5I7HA 3OEED 2W2MA 1IMOA 1BCSB 2ETXA 2ZRFA 2OBLA 3LIPA 4ITVA 4EO7A 1F0NA 1EBUA 2J5BA 4G86A 1HFKA 2OM6A 3KEQA 2LW7A 2HBZA 3PPWA 3S7TA 1KO4A 5C18A 3SC6A 2VH1A 2E55A 3L4EA 1N7JA 4RA9A 1KIMA 4BKQA 3RVLA 1NN1A 4M1QA 3LXRA 2JCXA 3JQ8A 4CQMD 3GP8A 3KV3O 1NMYA 2X8AA 2ZOSA 1HC7A 3L7YA 4KLAA 1LJ8A 3DUFA 4NTZA 4NZPA 4U0JA 4DJAA 3DDOA 2JIZD 2XT6A 1S8NA 2Q3EA 3O9VA 2GD0A 1ZIXA 3BULA 2GJ8A 4IIYA 4WKGA 3WGQA 2GN2A 5CA1A 3QMVA 3U3ZA 5LP6B 3RSSA 3UICA 1V3VA 2VYQA 1WSWA 1PX0A 3GX1A 1KS9A 1OLSB 1IQRA 3CZ5A 3KTAB 5GP1A 4CGZA 3LNTA 3TZHA 1PR0A 3DE4X 4LHVA 1RI4A 3FW1A 3R6LA 2G70A 1W5SA 2ACWA 1Z2CA 3Q10A 4LYAA 3A28A 3D1JA 2WPDD 1DX9A 2BFEA 3NOVA 3T35A 3JASB 4I4TF 1MT0A 1TD1A 5JNWA 3AR2A 4F2HA 3GU3A 5DASA 2E5FA 2B4RO 2JKVA 1A72A 3AFNA 3MWKA 3Q85A 4A8JC 1XCJA 3DDWA 5DRYA 5H1YA 3D6JA 1GU1A 1IC6A 1KYQA 1GV1A 3GLQA 1YJ8A 4I1RA 3GUHA 4R98A 4P0TA 3F4BA 3UJCA 4A3SA 3ER8A 4US1R 1GQSA 3FF1A 4RTPA 1X8KA 2BFEB 2EZ8A 4LHWA 4Q9AA 2X14A 4EG7A 3D6AA 4QTUB 4PV7A 2QD3A 1JHPA 1NIPA 4QYXA 5B1YA 4BZPA 1LTQA 3SZMA 3WJAA 3AEKB 4BKOA 1XPRA 1ZVMA 3UANA 1CY1A 3LQKA 3RYTC 1VRCA 4UNPA 3MWEB 4B48A 4PNEA 4EM6A 1UPTA 1H85A 4ZU6X 4EYOA 3FBGA 5LWQA 2VHEA 2AOUA 3GLHE 1YS1X 1N2JA 1RWWA 1RNLA 4JC0A 1OQAA 4Y1EA 4UM9B 1Z4NA 1N0VC 1Y8QA 1W2WB 3U1BA 4KLNA 3TXXA 3TQRA 2RK4A 1CUFA 2X2EA 3LPCA 4MTLA 4P3OA 3MW8A 4J16A 4PG5A 1K7CA 2QORA 3WNDA 5IBCA 4I66A 3PP8A 4J9VA 3E9DA 1A2KC 5TGZA 2IV2X 4CKBA 4EY7A 3GGOA 4HDRB 1F0KA 1BS1A 1LBTA 4F92B 2XF2A 3AC0A 2VZ8A 5B3KA 2VN8A 2XCRB 1NLMA 1BX0A 2O3UA 5AXCA 4DCMA 3I8XA 1QHXA 5JCXA 4WCFB 3DE0X 3P32A 1NATA 4EHLA 4YCNA 1WETA 2XEDA 2JPDA 3ZKWA 4OHZA 5EP4A 1BOFA 1Y8RA 2H1HA 2P62A 5ERXA 5KYUB 4IRMA 3THWA 4LSZA 4AO6A 3IMKA 2OHIA 4A5OA 4XQGA 4OGWA 2LCFA 4B76A 4AO8A 1KJNA 1ZMTA 4W1RA 3HDYA 1M0TA 2QMZA 2Y1LA 1IY1A 1Y4AE 4D6YA 1GAXA 1WPRA 1YVEI 2FEMA 2EGGA 2P77A 1X7WB 3V6MA 4BP3A 2II6A 4R41A 3RREA 3FOAA 2YC2C 3HBNA 5IAOA 1GZ4A 1H5QA 3IO5A 4QVGA 5HE9A 3DAPA 5ALZA 1IHDA 3KYCA 3P0IA 4GVXA 3PIRA 3O93A 4X54A 3DULA 4CM8B 2FNAA 1C1HA 2QVYX 3I30X 3NFYA 4YECA 3Q5DA 1STOA 1P3Y1 2WD7A 1N9KA 1PL6A 1KFBB 1M2OA 1VJGA 2WF5A 3AJEA 4MAAA 3NQ41 5HIAA 2WP8J 5JJKA 1GT6A 2CNBA 2AG1A 3A6EA 3BFJA 4JU9A 4M1WA 4E5VA 2YYYA 4NJEB 1EP3B 3LVQE 4N5LA 3TLKA 1P7ZA 4K6HA 4OP2A 2VKQA 3K0CA 3TFWA 4L07A 3ZGXA 3B1YA 3K9NA 3PRYA 4Z1OA 5LKRA 4EG1A 4OQNA 5HRUA 5JAOA 4KWCA 3UMRA 2DH6A 1Q0LA 3ETJA 3RYFB 1P2DA 1CP2A 3JYNA 2GO1A 1R0BA 1XDUA 1TZCA 2EERA 3KZNA 1J8FA 1VJ0A 3R3UA 4I0WB 1R6UA 4DQLA 3O95A 1E3DA 2YINC 3JQ7B 5ALDA 4B46A 1YF3A 4Z4QA 5ARCA 3HN7A 4GOXA 2PLNA 3DWFA 3J7TA 3FPBA 2ACKA 1KE2A 3IKTA 4BGDA 2GK6A 4Z2YA 3INRA 1OXMA 1AXEA 2F43B 2P8SA 2QGNA 3BGIA 3ZOZA 3B70A 3CNOA 2G9VA 2DFTA 3D81A 3IJ5A 3PEFA 4XIIA 4DFDA 3Q8MA 4Z4HA 3KAQA 1GUYA 2IELA 3U61B 1E5VA 4OLJA 3DBHB 1L8XA 1ADBA 2NSYA 4K9QA 5EJAA 2Z58A 4EO4A 2XHZA 2P69A 3IR7A 5CNKA 5EMMA 2ZSDA 2FWMX 3VC1A 4RPLA 3GG2A 3REQA 1O58A 1O97C 1BEUB 3G7UA 3WX0A 4BNMA 4UCWA 1WOYA 1K6IA 2KLHA 1R4MB 1T9KA 1TF5A 4JBIA 3K1ZA 4H4DA 4JP5A 2XVZA 1X9HA 2RHDA 2WFMA 1YQTA 1SEVA 2NO7A 4Z1MA 5K3OA 3K71B 4JI8B 5PNTA 3PC7A 1FP2A 3CH4B 4EENA 9ABPA 2OFPA 3E5HA 5DXAA 3VR3A 4GH5A 4REOA 4P4NA 1LPSA 3KPVA 3ZV3A 1X2BA 5DX0A 1Y33E 2XECA 1MQ9A 3IUJA 2AG8A 1I6LA 1BX3A 2GCIA 3GD7A 3C70A 4NNOA 4TSFD 3TIXB 4YUYA 3K32A 3C5CA 4LKRA 4IIHA 1QFXA 4R8KA 4WXHA 2PRYA 4WZBE 1GWNA 1ZISA 4INPA 1H6BA 4HGRA 4O4IF 3G0OA 4DZRA 1ZD5A 4I5EA 3DWEX 2AOWA 1TI7A 5ELMA 4J0KA 4YO7A 3PDCA 1G9SA 3PFCA 1GRCA 1LF0A 2JFYA 3VH2A 2NM0A 3LK7A 1IONA 1SZCA 2HLDA 4YDRA 3CWQA 3SHQA 4NBRA 1EE9A 2PG3A 3HCEA 3KS9A 3QKUA 2XVXA 4ALIA 4YMHA 1DZIA 1YRHA 2QG9A 3LW7A 5EZ6B 1B3BA 4JYPA 3PPXA 4AT1A 4MGEA 1E2NA 1RPTA 1YONA 4N7MA 3OHSX 4QDKA 3CIFA 4WPGA 5AOVA 3GLVA 5JVDB 7YASA 4O0LA 4FMCF 3DTTA 1ZOSA 4J4TA 4MUMA 4C2BA 2QAGC 1ORRA 1K98A 4HZIA 3JSXA 3N7UA 2W11A 3G8DA 3O2QB 4HXFB 1D4FA 5SZKB 5BMVA 3BVPA 3NVDA 5EUMA