2VPVA

Dimerization domain of mif2p
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
ENFALEIMFDKHKEYFASGILKLPAISGQKKLSNSFRTYITFHVIQGIVEVTVCKNKFLSVKGSTFQIPAFNEYAIANRGNDEAKMFFVQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN MIF2
publication title Structural and Functional Dissection of Mif2P, a Conserved DNA-Binding Kinetochore Protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 15
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11699 CENP-C_C Mif2/CENP-C like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vpvA00
3CEWA 3CF6E 4HSJA 2XHKA 1CAVB 1ZZ8A 5JSPA 1V70A 2D40A 1G6NA 2IXKA 4MUVA 3KGZA 2GZWA 5FCCA 1YFUA 4HN0A 3S7IA 2BNOA 3E6DA 1SQ4A 1VR3A 3PLQA 3MZHA 1DZRA 4KL1A 1SEFA 1LB2A 1IPKA 4HSLA 4HBNA 4I01A 3USSA 2Y0OA 2ETEA 3DN7A 2WFPA 2FMYA 2UY9A 3R6SA 2QCSB 3H7YA 3HIFA 5C6CA 3I7DA 3U0ZA 3FX3A 1DGRA 1CAXB 1ZX5A 2B9UA 2IXJA 4WZCA 4FAHA 4QM8A 3RYKA 3SXWA 1NZCA 3FHIB 3H1WA 4WBBA 3RZZA 2BGCA 1ZZ9A 1ZZ7A 2Z2SB 2O8QA 3OCPA 3WW4A 1OFNA 2EAAA 1OD5A 1EYBA 2UYBA 2ZKLA 3NKTA 4IEXA 5I8SA 3U10A 2K0GA 2MHFA 2PAEA 5LEJA 4KWJA 5JSOA 1RUOA 1ZZ6A 1YFXA 3HT2A 1CX4A 2P17A 1VJ2A 4LEJA 4YNIA 1Y3TA 5KHKA 4YYOA 4I09A 4X6RB 1J3QA 1ZZBA 5I0SA 2QNKA 5JSRA 4XETA 1WLTA 4XF9A 2Q30A 1H1IA 3M3IA 4ORFA 1RGSA 3IDBB 3H3ZA 4Z82A 4MZUA 2ET1A 4LUMA 1J3RA 1UPIA 4IEVA 3IDCB 2GU9A 4WVZA 3L2HA 1ZNPA 3H8UA 3MYXA 3LAGA 1FI2A 5EFUA 2OZ6A 5CADA 2H6CA 3EJKA 1CGPA 1CAUB 5D1IA 5I8TA 2VECA 1J3PA 2ET7A 4NVPA 4I02A 4LA3A 2IC1A 3H9AA 1X7NA 3I59B 2XLGA 3EO6A 3E5UA 1X82A 4JTOA 2PQQA 4J1WA 3MDPA 1Y9QA 1RUNA 2IXCA 4E2QA 1O4TA 5I0RA 2FQPA 4L2NA 2D5FA 4YRDA 3IBMA 3LZZA 3S0MA 3EHKA 4XFIA 4FT8A 4BH9A 5FLHA 1ZRDA 1YLLA 4ZU7A 4EWEA 4MGYE 3LA2A 4O9GA 2PFWA 2VQAA 1CAVA 4OFGA 3DKWA 4LULA 4J1XA 2OZJA 2UYAA 4IEZA 4QGNA 4XFGA 4R52A 2BYVE 4D7TA 2IXLA 4PIXA 4FAGA 5JR7B 4HVQA 1H1MA 4R8HA 4UBGA 4UBHA 1ZRFA 5J48A 4EWAA 3EBRA 1OI6A 1ZRCA 4ZU5A 4O9EA 3FZ3A 1GQHA 3H7JA 4L11A 4XFBA 2XL7A 2PHLA 4N9IA 2CGPA 4KU7A 4HVRA 4H7LA 3E6CC 3BCWA 2Q4SA 1O5UA 5I91A 2D5HA 4EROA 3H3UA 1O7FA 3OTFA 3ACLA 4PIYA 3KSCA 1VP6A 1I5ZA 3LA3A 2ATFA 4XF0A 3CO2A 4B29A 5J7MA 3NL1A 1CAWA 4XFAA 3SCHA 2CAUA 3QOPA 5FQ0B 2PTMA 1J1LA 5C8WA 5HI0A 1LRHA 2MPFA 4I0AA 4PIZA 3E5QA 1UIKA 4JV4A 1JUHA 3DV8A 3KGLA 1XE7A 4QM9A 5JAXA 4GULA 4MGZE 2I45A 1Q5OA 3E5XA 1O3TA 3QACA 1ZREA 1QY4A 2BEOA 5BXXA 3ST7A 4EV0A 5I93A 1O3QA 3SCGA 4AVAA 1QXRA 4E2SA 3ZDSA 1J58A 4BIFA 1HW5A 1RC6A 5BV6A 1GQGA 4Q0SA 1IPJA 3I54A 1YFWA 5FLJA 3BPZA 2OPKA 1Q43A 3SHRA 1RL3A 4YSFA 5K8SA 3S7EA 1U12A 1NXMA 3E6BA 5I0UA 3BALA 1Q3EA 2XGXA 3IIAA 4F7ZA 2GAUA 3WW3A 3H1MA 2PA7A 3JZVA 4K8FA 1YWKA 5FPXA 4XF4A 2MNGA 1CAUA 5J3UA 3LWCA 3D82A 1XRUA 3EQEA 1O3SA 2IXIA 2O1QA 2C0ZA 2QVSB 3I59A 1WGPA 3RYRA 2ZCWA 2H6BA 1EPZA 1YHFA 3PVBB 4KU8A 2HJIA 2K9ZA 2QDRA 4AXOA 2EA7A 3OD0A 1NYWA 2BNNA 2HKXA 4IEPA 2B8MA 1XE8A 3NVCA 1X8EA 3OGJA 4XEZA 3FWEA 3C3VA 3CJXA 4FBFA 2B5HA 1DZTA 4HN1A 4IEUA 1ZVFA 5I8YA 4XF3A 3CLPA 1QXJA 3SCFA 3UKNA 5LRSA 4F8AA 4MX3A 1SFNA 3RYPA 3O14A 2E9QA 3N4MA 1UIJA 4MGKE 2XLAA 4XF1A 2D93A 2F4PA 3RPQA 3B02A 1O5LA 2GC2A 2DCTA 4MV2A 3UKTA 3H1YA 3ES4A 5BPXA 5KBFA 4ONUA 4RD7A 4MGIE 3SMHA 4Q0QA 4XFHA 5CU1A 3HQXA 4N9HA 1CAXA 5AVPA 4QMAA 5E16A 3ELNA 3U11A 1I6XA 4D7SA 4IETA 1J59A 1ZZCA 4IESA 4X6QB 5FQ0A 3D0JA 5CVRA 1L3JA 3LOIA 4EWDA 1NE6A 1UCXA 2PAKA 3DL3A 4Z07A 4QGMA 5LEKA 4XFCA 3M70A 3G7DA 4LLOA 3LA7A 4QXKA 1OMIA 3WW2A 5BY5A 3RNSA 3FJSA 3HT1A 2GC0A 1YFYA 4I3PA 4AQ6A 2EVXA 4BYYA 5BUVA 1UW8A 4I0BA 2Q1ZB 4QX5A 3MPBA 3WW1A 4ZU4A 4UXAA 4DINB 1LKNA 5KHJA 4MH0E 3FFQA 2OYZA 3ES1A 4KWLA 1QWRA 3TNPB 3KCCA 4I2OA 1YUDA 2N7GA 3NJZA 1FT9A 1CAWB 4JVAA 2KXLA 5FPZA 1UD1A 1FXZA 3H50A 3ROUA 3BB6A 3NW4A 4HMZA 4P9GA 4LUKA 3VHRA 5LRRA 3PNAA 4AVBA 4META 1RTVA 3D0SA 4HVOA 4BHPA 5F1RA 3OF1A 5KHHA 4IERA 4HZFA 3TNQA 4AVCA 2CV6A 4A2UA 1LR5A 5JCTA 3BU7A 1TQ5A 4LA2A 2WC2A 1EY2A 2V09A 2XKPA 1PM7A 4KWKA 2Q0AA 4E2GA 4IEWA 4IEQA 2H0VA 1EP0A 2VPVA 4Q0UA 4AQ2A 4IEYA 3IWZA 4HLTA 2XLFA 5FDBA 2GC3A 1NE4A 1X8MA 4PJYA 5T3NA 3GYDA 5E1RA 3GBFA 4YARA 2CAVA 4OLLA 4QGLA 5I0TA 5KHIA 1DGWA 3FE5A 3RDIA 2Z69A 4Q0VA 3UKVA 2PYTA 5EZWA 4CYDA 2IXHA 2PHDA 3NSTA 2GH2A 3E97A 2QJVA 2PAMA 4Q29A 4LTAA 1ZRRA 4Q0PA 4TLFA 1WA4A 2XL9A 5FLIA 4XFFA 1O3RA 3KMHA 2UY8A 2GC1A 3CL1A 5KHGA 2BNMA 4JTNA 2OA2A 1PMIA 3ETQA 2XKOA 4IEOA
chains in the Genus database with same CATH superfamily
4Y4RA 5L9BA 2RMU2 2C9KA 2DCJA 3NNMA 2HEVF 1ZZ8A 2JD9A 1BYHA 2B42B 3HNBM 3THCA 3ZFGC 4BQ3A 2JICA 4XURA 1R1A3 3F2ZA 4G3YC 4BU2A 2VW2A 5IAXA 2GALA 2IXKA 1EAH3 1FOD1 3IIIA 1UOBA 2VCMA 5FCCA 2QQOA 4C1WA 2RDRA 2WA3A 2P3KA 4Q4V2 5FPVA 4R9CA 1W0OA 2BZDA 1NKGA 2NQYA 2BOJA 2XJRA 2JG9B 2VTXJ 3AK0A 3I2FA 2BP6A 2XH6A 1HX6A 4CEYB 2EAKA 1CR7A 2V4VA 2DUQA 3I2GA 4DS0A 3OBZA 5E89A 1IOAA 2G1MA 4X8PA 3M3CA 4YW7A 2VZRA 3V65A 4HSLA 3USSA 2RS52 2QBXA 3RZGA 1JHJA 2XMLA 3RVHA 5DZGA 3DN7A 1VAKA 2DFBA 4YZ1A 4PLOA 4L9BA 4P08A 4Z2WA 4IE0A 4S2HA 2D6KA 2R061 1DLCA 4QQ2A 3P6BA 1QJX1 1UAIA 3ZXLA 3ORJA 4CPBA 2W46A 3KLSA 3IPVB 4PDWC 5FZ3A 3AJZA 2RS11 2QQIA 4C0HA 2FCVA 1OUXA 1QQP2 1COV1 1H2NA 1XC6A 4IGOA 3HN3A 1AR92 4WBBA 5A7QA 2Y38A 2ZGLA 3VGIA 4RFT0 3KT1A 4LQRA 4YM1A 2BW8A 4P9YA 3GCWA 1S0EA 3WZ1A 2X5IC 4OVEA 3IT8A 3KV6A 2ZGUA 3LKJA 3T2TA 3OUHA 1OD5A 1ND3B 3P1IA 4IW3A 4IEXA 2X8KA 2K0GA 5A6QA 4JRLA 5JSOA 3O1TA 1GICA 1DFQA 1CX4A 3WNOA 4FPEA 3ZXGA 4AWDA 4COUA 4UFMA 4YNIA 2D3RA 2VUCA 1LCLA 5FPUA 3GHMA 4LR4A 2KM2A 1LOAA 3RZLA 1SPPB 3AP9A 4Q26A 4A45A 1GNYA 1J3QA 1ZZBA 1IHMA 2RR13 1X33A 2WA4A 1RHI1 1C1LA 5JSRA 1FMD2 2JB8A 4AL9A 4ARXA 2VZTA 1D7PM 4XF9A 2A6ZA 1ENRA 1UY4A 1FPN3 4ORFA 1RGSA 2WWJA 2ZBJA 3H0OA 4HKLA 1F4AA 4Q4Y3 1F35A 5EWSA 5DUXA 1AJKA 2WT2A 4C0BA 3BTXA 2ET1A 1LGNA 3KZ4C 5KXDA 4CPBD 3WDVA 4HG6B 2UWCA 4HFSA 3BKZA 1AL21 2F17A 3AKTA 3IDCB 2JE9A 3KD4A 4WVZA 4CDUC 1UU6A 3L2HA 1TEIA 3LAGA 1REFA 4OCTA 5JDBA 1A34A 3CHXA 2OZ6A 3ZIXA 4A6OA 1XQNA 2H6CA 2Y6HA 3EJKA 1QJU1 2XJTA 4YLZA 4RL7A 1CAUB 1GP4A 1WMDA 2HWE3 3OBAA 1PX4A 4PLMA 2PXJA 5F3GA 1QJFA 2D6PA 1IS4A 4ATEA 2B7YA 2PMWB 4LXLA 1X82A 4Y1UA 3WF0A 4DPNA 1C57A 4D69A 1Y9QA 2IXCA 4XUTA 2WJSA 2YBSA 5B2GB 1O4TA 5A3NA 1XNTA 4ARYA 1S2BA 4CU9A 4CXXA 4XOGA 4L2NA 2WNEA 4YRDA 4Y5TA 5DZFA 3SQOA 3UV9A 2VY0A 3EHKA 2R071 1W2NA 2WNVB 4XFIA 1OKQA 1LENA 2WS92 5FO8B 4QDQA 4KI5M 1UMHA 5FY9A 1AR82 5F7UA 3TEWA 2UURA 5FP3A 4OI0A 3H8RA 1EUTA 3LA2A 2EXJA 1WW5A 2PFWA 3JBG1 2VQAA 1NLRA 3D4KA 5FYIA 1WCQA 5CYYA 2UYAA 2W1UA 2WNUB 4UFLA 5FYBA 5ANQA 3A23A 2EF6A 4AFBA 5CFCB 2XBO2 4D7TA 5C3QA 3MV01 2ZACA 2VCBA 1VBC3 4KG8A 4ZXEA 2HBUA 3KT7A 1AYN3 1CZVA 4A3ZA 5FYHA 4EWAA 4CP9B 4B1MA 1XSQA 2V72A 2ES3A 1YRZA 2W87A 1DYKA 4XXAA 3ME2A 3N7JA 5FTTC 5HCHA 1PK6C 2ARBA 4QHBA 3WEZA 2ZXQA 4L11A 5LY1A 2YXSA 3ZSEA 2JIJA 1I5PA 1W99A 4NR1A 2CGPA 1EV13 4HVRA 1D4VB 1UN1A 1RUF1 3AP6A 1JYNA 5I91A 2Y64A 4EROA 3WNPA 3H3UA 3OTFA 4XQWA 4RHV2 4QX2A 1RUH2 4PIYA 1TMF1 2ZZJA 5FKCA 3SITA 1POV1 1IPSA 4QT6A 1PO11 1VP6A 4CXWA 2DYCA 3CO2A 5A32B 2QQPA 1SFYA 1ULDA 3JXSA 2WO3A 5C8CB 1ZBA3 4OHYA 2ZX0A 4GZ9A 3THTA 4E4ZA 5T50A 1W03A 4AVVA 4QX7A 1M4WA 3RS6A 3K4DA 5C8WA 4CZSA 4LBQB 3U1XA 5AC91 2QQMA 4EN8B 5C3SA 2ZMNA 4FOWA 4FXGB 3E5QA 2PLV1 1QQP3 4LE4A 3RWNA 2W1SA 1PNFA 4M4RA 3RSJA 2VULA 4DUXA 1OA4A 3I8TA 4HXCA 4MGZE 4NIIA 5AFBA 1Q8VA 4UW5A 3K3NA 2ORZA 4F83A 3N9OA 4AEDB 4HPKA 3RFRA 1O3TA 1F15A 4PBPA 1XNAA 1LAJA 2AUYA 1EAH1 1F9KA 1C5HA 2VL4A 5LK5A 4EV0A 3SCGA 5CKQA 2NN8A 1XB9A 2VCCA 4BIFA 1HW5A 2XWJB 3AVSA 3BTZA 2RS33 3PVOA 4IV1C 5AFEA 4NROA 4Q0SA 1RITA 4E8DA 5FZ4A 1LHWA 3O1SA 2CDOA 4N7IA 2VNOA 3VBHB 4TTGA 2QUOA 2WFF3 1RUI2 4BMBA 2OW4A 1W06A 2Y34A 1WWYA 3NAPB 3SHRA 1RL3A 3U14A 4YSFA 4NIAA 1XNDA 3S7EA 1G9CA 4I3GA 3NRUA 4Y20A 3A7QA 1RUD1 2RDQA 1HXS2 4KGGA 4JAAA 1KD7A 4AHWA 1A8MA 3IDEA 2X10A 2AGSA 4NRPA 3ZN6B 4YVWA 2YB7A 2AH2A 3POBA 1O4ZA 4K8FA 5FPXA 3AMMA 1H9PA 1KFUL 4XBLA 4BQWA 4LLFA 1GOHA 5BNNA 2Y6KA 5H9RA 3N7KA 2ZCWA 4XIOA 1VAVA 4UFJA 3S5AA 1OHFA 4BQ4A 4QDRA 2XDVA 1IQAA 2P6HA 2BBVA 4FSJA 2EA7A 1AR71 1Z7S2 1DYPA 1W04A 2VVEA 1SG3A 1JYCA 4UF0B 4ZZ8A 5HV0A 4IE7A 4D0QA 4E4DX 3N7LA 3T0BA 4SLIA 3OGJA 5IWFA 4IXLA 4RSUA 3FWEA 4XEZA 4R9BA 4WM7B 1URXA 3CJXA 4OI1A 5A1LA 1DZTA 2VMDA 1HRV1 1QH6A 4XF3A 5FYZA 5IVVA 2IFRA 3O0VA 3VBRA 1FOD2 1KJLA 2F6BA 1LULA 2VH9A 2ZKNA 4RS5B 3AXDA 1UZWA 4E8CA 3LEKA 2JG8C 2YG0A 3ZFGA 1JYTA 4RN5A 5A6ZA 2A7AA 1UY1A 3PU8A 2E9QA 4FXKB 1SLLA 1V6LA 1BQPA 4FP2A 3VBSC 1K5MC 2FBEA 4MLOA 1HLCA 5FP7A 2MEV2 4QDSA 5A33B 4AFDA 1Q8OA 2X29A 1W2UA 2R30A 5HCBA 3T0DA 2RJLA 1YNAA 2ARCA 3RPQA 5SV8A 2ZGRA 1O5LA 2GC2A 2R062 4UWDA 2DCTA 5IHRA 1QJX2 1QOOA 2WN2A 1XU2A 1QDCA 2HWE1 3NNGA 4ISQA 3T09A 2YV8A 2RS12 4GKXA 5GJ6A 1CN1A 4FPKA 4K9SA 3OYWB 1COV2 1LJ7A 1VBB3 1JMUB 2DCZA 4FPOB 4QHZA 5LATA 1MQTC 4XYXA 5FZDA 1RVF3 3A0KA 4N9HA 5AVPA 1RUE1 5E16A 5A6XA 1ND2C 3VB9A 4AEJA 1UKGA 5BNPC 2XUEA 2FCUA 5FQ0A 4MADA 2GSYA 3LFIA 4PDWA 2R16A 4X6QB 3FBMA 1QNWA 3T2QA 3LSEA 3RQ0A 1W05A 3OOXA 4Z07A 5FZ1A 5E8AA 4PLNA 4XFCA 2KA3A 2CHHA 4LLOA 1OT5A 1JOBA 5FZHA 2FDGA 3ZYGA 3OBRA 1ACCA 5FOJB 3HBKA 3ZXEA 1QOSA 3VN4A 1BBT3 3HT1A 5J98B 4CE8A 5GZCA 1BCXA 1S55A 4GALA 4OUMA 2W2IA 4COYA 3VBUC 4QX5A 4P02B 4FPLA 1VBD3 5FZ0A 2R0HA 4CCJA 4QWNA 3POFA 4MH0E 4Q1RA 3RJRA 1MS1A 3ES1A 3TNPB 3NJZA 1FT9A 4LK6A 1HB1A 1Y4WA 2VNVA 4YZ4A 5DDJ1 2BGPA 5FY0A 1LEMA 1UXXX 1JN2P 3CJIB 2GP3A 4NJ4A 5FPZA 3VL9A 5J09A 4SBVA 3ATGA 2HWB1 3H50A 1AL22 1A78A 3LF7A 5FY4A 3BB6A 2BV4A 4XC9A 1C1FA 3AZXA 3NW4A 3ZYIB 2AEZA 3FMGA 5GLZA 3OUIA 2V4AA 1YJLA 4S2GA 5FZEA 2VJXA 3PNAA 4AVBA 2HYKA 1QJU2 3FUOA 3APBA 1DG6A 2W08A 3WQBA 1Y7BA 2Y6GA 2EIGA 4AVTA 3V0BB 1NX9A 1Y9GA 5KC6A 2OQ6A 4I0WB 4K40A 3MHZA 4RR3C 2ZGTA 2OVUA 3LDBA 2VMCA 1YQ2A 4IGQA 4CDUA 4CP2A 4IERA 4HZFA 5C9AC 4E4SA 3TNQA 2GNDA 3D8CA 3CKHA 4WVWA 1V9U3 4LKDA 1PVC2 5HBAA 2A75A 3ZMOA 5FJHA 4B4QA 5K0UB 3V64A 1TQ5A 1WD3A 3KT4A 4WVVA 4LA2A 4NO4A 3O1UA 1AL0G 3VUOA 2R072 2E7TA 1NQDA 2DBIA 1AYM3 2JDPA 1G9BA 1EY2A 1LU1A 5DPNA 1OUSA 5IFPA 1I1EA 1PM7A 2B4KA 3ZIWA 1VB4A 2Q0AA 4QX8A 4QPYA 4QPWA 4QX0A 5C5TA 3JBG2 4IEWA 4Y1YA 5CKMA 5JI7A 4Q4X1 3VKNA 2VU9A 4CVUA 5A7SA 4AHXA 3ZXJA 3AP5A 1VBE2 3IWZA 5FKBA 4CDQC 5A7PA 2I07B 1PM4A 5T3NA 4C90A 1S4CA 3GYDA 2RJ2A 1RUC3 4R4ZA 5KXCA 1DQ0A 1RUJ3 1YEWA 2CAVA 2RVAA 2XONA 2ZJCA 1V6KA 2B39A 3AMPA 3MIBA 3PVEA 3WVJA 2A6XA 1VBA1 2UWAA 3M2MA 4OI2A 5KHIA 3Q8FA 1LU2A 3SNMA 4DINB 3DPRC 1OQ1A 3HMYA 1UY3A 3N7MA 3MV11 4H14A 2IXHA 4UW4A 4FFHA 3NSTA 5JIUA 4DUVA 3N35A 3R4DB 4N8MA 3WLUA 4ZPIA 3W20A 3UJQA 1LEDA 1DCSA 5FBZA 4B8EA 4BQ2A 2PN5A 1ZRRA 4NUBA 2W92A 1ZBE1 4TLFA 3WDTA 4GMP3 1JS9A 5C4WC 5A7WB 1PK6A 2MEV3 3SH5A 5A3PA 4M4PA 1YQ6A 2OA2A 2WLPA 4MGQA 3WF4A 1PMIA 1K3IA 1H8TC 3AKQA 3ZSMA 1ZA7A 1HRI1 3OGRA 4MGKE 4RQPB 3CEWA 1U5YA 1UZ0A 3CF6E 4H7MA 1LGCA 2E6VA 4JX0A 1GV9A 1PO23 3RI8A 5JXIA 1JYVA 5K9YA 2OX0A 4BK4A 2E26A 4LOSA 4Q4W1 3GXUA 1RYYA 4FVVA 1V0AA 5AC92 1G6NA 3KF5A 1K45A 2GZWA 2PLV2 2YUEA 3MF9A 4YFWA 1YFUA 5BYNA 5KXBA 1JZ3A 2ID4A 4R9DA 5FFOC 4HN0A 4KNCA 1NCQC 4FOYA 2CDPA 3NV4A 2VW1A 3LEGA 1W6MA 2R043 2X09A 4LBQA 4BISA 1MR5A 4NE9A 3RWKX 1DZRA 5LASA 2VUAA 5FUIA 5CFDB 3B9CA 1A8DA 4KL1A 1GLHA 4DRVA 5FYCA 1IPKA 1RUG1 4LHLA 5HXMA 4QXHA 4HBNA 4K7JA 4LHNA 5DAPA 2E63A 3OD4A 3I49A 4Y3OA 4DNYA 2FMYA 4XJAA 3GHNA 3HIFA 2VBDA 2BFUL 2JKBA 5C6CA 3U0ZA 3ACIA 3FX3A 2VZPA 4GB32 1NA1C 2OPWA 2B9UA 1AJOA 1YIFA 2A70A 3PTYA 1MZFA 5F5CA 3RMYA 3SXWA 1NZCA 1X9PA 2QQWA 3LD8A 4YGDA 2FDIA 1RUD2 3C8XA 1DGLA 4XCAA 3W9AA 3IAPA 4AK3A 2J7MA 1TME3 1GU3A 1ZZ7A 2HH9A 1MEC1 2O8QA 3J7HA 3OCPA 3QBQA 3TEZA 1W6NB 1ULPA 4E27A 4X8NA 4XVHA 4XZUG 3NKTA 3R4UA 3U10A 5LWBA 2WZR3 1IS6A 2VC9A 4OHVA 4ZONA 3H8XA 3AMHA 4KWJA 1RUOA 1ZZ6A 1RVF1 4ISRA 4U36A 2P17A 1H8VA 2WN3A 4QPIC 4HPKB 4L8QA 5DG1A 4LEJA 2ZHMA 4HOOA 1IG3A 1ULGA 1R1ZA 1XPWA 3KCXA 4UT5A 3SEEA 5FK7A 4WM8C 1Q8PA 5I0SA 1PGW2 2HWF3 2QNKA 1AR72 1GP6A 2NLRA 4GWMA 3C7FA 3JQWA 2IZWA 2Q30A 4OUEA 1CWPA 1GWKA 3CZJA 5A7OA 1PVC3 1W8UA 3U4SA 2W9XA 3HVDA 4ET7A 2J1EA 3K3OA 1NCRB 1AR62 4AZZA 4ASLA 1AF9A 1BJQA 4UF0A 4Z82A 4L97A 1WMXA 1HRV2 4LUMA 1JYWA 3FHAA 2W68A 4UAPA 1MS8A 5FXXA 1DYOA 1GBGA 1EPWA 4Y20B 5JLVA 1H1AA 3PVNA 3TBDA 2BJSA 1W9YA 3H8UA 3MYXA 3UT0A 3UGFA 1XXNA 3N3HA 2G9ZA 2CGNA 5CADA 4N90A 1PZ7A 2Q5TA 2VOKA 1PIV2 1D0HA 1VBE3 2VECA 1LHOA 4NVPA 4LA3A 3O1VA 4XUQA 3ZXKA 4N43C 4P9JA 4D6QA 4XMAA 3E5UA 5DMYA 2IVIB 3GDBA 1UY0A 4AGVA 1CESA 3X29B 1KDKA 2A5ZA 2JG8A 2AR6A 2WBKA 1LOGA 2VBBA 2HEWF 1RUNA 1MS4A 4HKWA 1OA2A 3PMSA 1W0PA 3VLBB 4M0NA 4QHOA 5A33A 2VQUA 3AMNA 2P3YA 3G6JB 3LZZA 1CJDA 1K5MA 3NV1A 3VBSA 4FT8A 1F5FA 1TVGA 1YLLA 2Y6JA 4N53B 2DTWA 3TN91 1F2NA 5GLVA 4EWEA 1DQ5A 3GF6A 1QKQA 3FFZA 1R093 5EQUA 5B4NA 1CAVA 5L36A 3DKWA 2PHXA 2WZ8A 3VBFA 4QXCA 4J1XA 5IYYA 5FYYA 1RB8G 3MICA 1BLZA 5JOXA 3ZR6A 4XFGA 2AYHA 4JGZC 3VBRB 4R52A 2HWD3 1DU3D 1GZWB 1L7QA 3RZMA 3WINE 2ZHNA 1U5XA 2BVBA 2DV9A 2DCKA 2IXLA 4PIXA 4FAGA 5JR7B 1MQTA 2DVGA 4QB2A 3VD5A 1UYYA 3WD5A 4BJ0A 3ZFGB 1LOEA 3QCWA 1ND2A 3EBRA 3J8F3 4TN7A 1OI6A 2CU5A 4GJYA 4DEQA 1US2A 4NWWA 4ZU5A 4M3CB 3PU3A 5BNPA 1GWLA 2A3XA 3ZMNA 2C24A 1JU4A 3FZ3A 3MUY1 5GALA 1QJY3 5JWPA 3H7JA 1QEXA 3SH3A 4CXYA 4Q27A 2VMHA 4N9IA 2BQPA 2O8OA 4AAXA 5LZ6A 1ODMA 2GNTA 4H7LA 5EP9A 1MVQA 2Q4SA 4MSVA 4OZOA 1RUJ1 2XJQA 2D5HA 4K1YA 1O7FA 3AYDA 3ACLA 3TRSB 3KSCA 2C6SA 4PHZA 5DDJ2 5T52A 1OPOA 1I5ZA 3ZYBA 4B7EA 3VBUA 1MS3A 1OVSA 4YWAA 1OOPC 3WCRA 5IATA 2HWB2 3R0RA 5J7MA 2O14A 2SLIA 1SMVA 1JBCA 4YW5A 1C8M2 4XUOA 4DMIA 4XFAA 1VRH3 1O8SA 2JD4A 3CJIA 1OXCA 3CQOA 3FN9A 5FPBA 5ACA3 2CAUA 3QOPA 4GMP1 5FQ0B 4Q2FA 1GANA 3I97A 4PDWB 3WSOA 2MPFA 1T6BX 4I0AA 3PIGA 1CIWA 1UIKA 1JUHA 3I3QA 3KGLA 1D4M1 1D0GA 1XE7A 4M3CE 1GP5A 5JAXA 3AKSA 4EQVA 4NMIA 2A6YA 5CAZA 1ULEA 2JDHA 4FCAA 4P9LA 3M8LA 1ZA4A 3V0BA 1Q5OA 1TE1B 3E5XA 3QACA 5FY1A 2Y33A 2X5IB 2JDYA 4AYUA 1BVVA 5BXXA 5HCAA 3OEBA 1OBNA 1W0NA 4MO3M 3ST7A 2L9LA 4AVAA 4QPGC 5FZCA 2TBVA 3J7LA 3T30A 2CGOA 5K0UA 4I30A 5C9AA 2BFUS 2FZ1A 5ABJC 4AG4A 1UYXA 5IVBA 1H6YA 3DCQA 5BV6A 1CZSA 1GQGA 3POEA 2HEYF 3UK9A 2XUMA 3I54A 2V5YA 2XVGA 4URTA 5A1AA 1ZYBA 2LUWA 4DY3A 1WMFA 4Q4X2 3CU7A 3S5QA 2OPKA 1W8TA 5K7PA 1Q43A 3GCXA 3DECA 1C28A 3VHNA 3WG4A 2QTWB 2DF7A 3DYOA 4OHWA 4XZPA 5C3PA 1NXMA 2GNBA 1JOJA 4Q8LA 3E6BA 4W65A 3MFCA 3BALA 1Q3EA 2VTXA 2D7FA 1PZ8A 4NN0A 5I0UA 1GQPA 1W2TA 2J42A 3HQRA 4CCOA 3H1MA 5L73A 5EJ3A 4YPJA 1S0CA 1X36A 3AYCA 3AZYA 1ODNA 3JD73 3BOPA 1SACA 4EN6B 3NO8A 4ASKA 4CDQA 1VMFA 2D3SA 2DFCA 2IXIA 2Z42A 1U5ZA 3LDRA 2C0ZA 1YXWA 4CDUB 3I59A 3GZUC 1Q56A 4QQLA 1WGPA 3KM5A 4Y1XA 3ZN4A 1AX2A 1TZOA 3V0AB 1YHFA 4HT1T 1S1AA 4TWTA 1NAEA 1L7RA 1TME1 2AZ5A 1PNGA 3IN9A 1REDA 1ZBE2 3ZXAC 4KU8A 1PIV3 3GBWA 1J83A 1RMU3 4JCKA 2DBNA 2K9ZA 3DPRA 3T3YA 1JW6A 1S0JA 1OPMA 4TYSA 1NYWA 1NUKA 2RDNA 3M4FA 3N9LA 4IEPA 3VKMA 2G19A 1XE8A 1HRI2 3NVCA 1OH3A 5A7WA 3K46A 2TEPA 1X8EA 2WO1A 2D98A 5FO9B 4JQRA 1SDWA 4AQSA 2J1RA 4Q4W2 5C4WA 3B69A 1ULFA 1ZVFA 1JHNA 4P5YA 4UW3A 3MZHA 5CNAA 4RQPA 1KITA 2ZOEB 3OBTA 1R081 3SCFA 1XSRA 2VMEA 3MBWA 4F8AA 1IQDC 1QHDA 1SFNA 3FUQA 4AEKA 5CA6A 1JZ2A 2BDRA 3O14A 4YGEA 4FFFA 1BEV2 4OMCA 1AX1A 3WOGA 4XAAA 3VZJA 2ZZQA 1DBNA 1QU0A 2RM21 1Y9MA 2RMU3 2XJVA 4OQ8A 2XLAA 4XQDA 1RUG2 5IUQA 3WHTA 4XAEA 1CIYA 1NCQA 5FZKA 5CFDA 2F4PA 1LHNA 4XTPA 3ZYJB 4JGYC 4Q4V3 1ASJ1 1UX6A 4MV2A 1UU5A 4PF5A 3H1YA 1UYPA 1G8WA 2SBAA 1PK6B 3ES4A 5IJRA 2B45X 4GH4C 3LQCA 2BPA2 5KBFA 1T6GC 5CG9A 2DDUA 4NPMA 5D2AA 4RD7A 3T2OA 3NMBA 2BOIA 4MGIE 4Q0QA 4IE6A 4OLLA 5FAXA 1KEXA 5DZEA 2RS53 1H2MA 1I6XA 1UQXA 4D7SA 1MEC2 4IETA 5E88A 4JKKA 1J59A 4IESA 4BIOA 1N3QA 1L3JA 3LOIA 2AENA 2AEYA 5HXVA 4NWVA 5LEKA 2WT0A 3M70A 3G7DA 3ZN5A 1C8M3 5IVJA 1W6NA 1AUYA 1UWWA 2Y26A 1W6MB 1R091 1MS5A 2PELA 3GBGA 1AHSA 3RNSA 3KV4A 5LA2A 2GC0A 2ZEWA 1YFYA 4AI8A 2EVXA 2HWC1 5FWJA 1AR93 1BMV1 5FZMA 1UW8A 3WUDA 1XNCA 2R49A 2XVLA 1UF2C 5FZ9A 4I0BA 4B4PA 3MPBA 3ZSLA 3WP3A 2QE3A 4LHKA 1YI9A 3LIGA 1R1A1 5KHJA 4XJ8A 1MVEA 2GMEA 5FP4A 2WZPP 2OYZA 2FDKA 4QPIA 4LBLA 5L9RA 5FMDA 3MGUA 4MVTA 4ZS3A 2N7GA 5F32A 4I2OA 5D8AC 3ZX7A 3LIHA 3JU9A 2JX9A 3PUSA 1CAWB 3MW4A 1WKYA 5F3CA 4WM8A 5APAA 1IZ3A 2KXLA 2YFUA 4CU7A 1LNSA 2VOVA 1BK0A 2VZ3A 2WUHA 3O0XA 4IDZA 4XTMA 4CTEA 5C33A 1NCRA 4IV1B 2VXRA 2UWBA 3VKOA 1QIQA 4P9GA 5F2WA 3EB7A 2ZA9A 1WCKA 4PT6A 1FMD3 5J36A 2VOWA 3VZKA 1XYOA 1O4YA 3WUCA 4CCDA 5HPOA 5M0TA 4PCRA 3EYPA 1A6CA 4W8JA 5F2SA 2K46A 4HVOA 2GH8A 2X53S 4YVSC 1HJGA 5F1RA 2ILMA 3KHBA 5LY2A 1CPNA 4XACA 3OF1A 4HL0A 3WF1A 1VMJA 3WNXA 3AM2A 2PHTA 5IVEA 3NAPC 1GKBA 4XJ9A 1UOFA 3WP5A 2AREA 3BU7A 2XB6C 2DU1A 1GMMA 2KD7A 1OQDA 5F5AA 2RV9A 4XHXA 1UKRA 4XDPA 3PUQA 5IVFA 3C7EA 2DUPA 2WLQA 1FATA 2JKXA 3TN92 1QF3A 4K21A 4P14A 4E9KA 5CKNA 1YIPA 1AX0A 3KVBA 5DN2A 4E2GA 1FX5A 4NHMA 3I4IA 4IEQA 3UGHA 4DUWA 3WDWA 4N53A 2VPVA 4AQ2A 2E33A 4H3WA 2QZ2A 1D2QA 1PZ9A 1S0FA 2ZHKA 4V2WA 4FP3A 1FNYA 2ZHLA 4IEYA 4V1PA 2J22A 1SHWB 5SV5A 5KXEA 4LPLA 5FDBA 4NHXA 4Y5Z0 1NE4A 3K4AA 4PJYA 1OD3A 2WS93 2RR11 2ZPXA 1EUUA 4C8DA 1GZWA 3P3PA 4QGLA 1AR83 3J7MA 1N1VA 5JI9A 4NPLA 2OT7A 2WQZC 4TXWA 3FE5A 4AR2A 4JGZA 2Z69A 1CD3G 1FPN1 5F5IA 3VBOC 4Q4Y1 1BXHA 3ZYRA 1OA3A 5J1XA 3JCIA 2GH2A 3QH7A 3Q8CA 1XNKA 4M3CA 3S6PA 3JUUA 3E97A 1OKOA 2JG8B 2QJVA 2XBO3 2ZX2A 3R05A 2PHWA 1W9WA 4LO4B 4Q29A 4Y1ZA 5EJ1B 2WAOA 4LTAA 5FV3A 3MLLA 2NP0A 4Y5SA 4CCEA 5CBLA 3VBSB 1K5MB 2JENA 4JC1A 5EJZB 2GC1A 3CL1A 2W0XA 3O0WA 4Q5OA 4Y22B 1IKPA 2VO5A 5L9VA 4JTNA 1QJEA 2BU9A 5LA1A 2XKOA 1Y43B 2IVJA 1UMIA 1JI6A 4YZ2A 2EIEA 2XHKA 1CAVB 2ZX1A 3VBFB 1BZWA 1YQCA 5JSPA 4XJZA 1TG7A 1V70A 4CCCA 1LOFC 4AEMA 3C2UA 1E5SA 1MS9A 2FDJA 1AXYA 1W6QA 3IAQA 5FZGA 2FZ2A 5LCWL 1JZ6A 1CPMA 5LBEA 4QKNA 4RHV3 1OOPA 1D4M2 1RUH3 1WW7A 3OJBA 1MQTB 3ZDVA 3WP6A 3E6DA 1IKQA 1ND2B 2VOXA 2QZ3A 4NIDA 5FY5A 1VR3A 3AJYA 4EN7B 1AXKA 3BTYA 4M0HA 4QX3A 5BNPB 2VR4A 2WZEA 2VZSA 5FXVA 1SEFA 3FLTA 5FREA 4I01A 4GWJA 3I2DA 5FZ7A 2V5DA 5KWRA 2Y0OA 2ETEA 2X5IA 4LHSA 3A21A 4HK8A 3R6SA 2DVFA 4CDXC 3B93A 2PHFA 4QAWA 4XBQA 5FXZA 1OQEA 5CZKA 1RHI2 3AFKA 5DAXA 1DGRA 3N9NA 4C91A 1VBC1 2PHRA 5DQ0A 1JUIA 1WD4A 1N47A 1AYN1 4WZCA 3LE0A 3HPNA 1NY71 3ETPA 4QM8A 3VBUB 1M06G 4QPGA 1SCRA 4P9XA 4ZXKA 1NOVA 2VMIA 3H1WA 4QU2A 5ABJA 5C71A 1MPXA 1AVBA 4MGTA 1LODA 4MGSA 4B3NA 4DXZA 1ZZ9A 1ZM1A 2DVAA 2YBPA 3POGA 5FIXA 2J1SA 1DIWA 3WG1A 1W9SA 2ZAAA 2WO7A 2Q8OA 4BQ1A 3D3AA 3AYAA 1EV11 3K75B 4QD2A 1W2OA 4GIQA 1EYBA 4G4FA 4C1XA 4CA9A 2P34A 2GDFA 3PDQA 5LEJA 1MACA 1W8HA 2VAUA 1RUI3 5J37A 4CUCA 1YFXA 1PMHX 4DY5A 3FHQA 5T5JA 5FJKA 3U78A 3ZKYA 1JZ4A 1Y3TA 3BTAA 1WCSA 3PHMA 1HXS3 4M01A 4X6RB 3W21A 3O1OA 1ZBA1 3V0AA 1YCIA 2E7QA 3OY8A 4RR3B 3OGVA 3WW4A 2C9AA 5C70A 1OF4A 1S0DA 5C9AB 2OS2A 2Y8KA 2NMNA 4GA9A 4AW7A 2HYXA 1H1IA 1SLAA 3F95A 2VZVA 3A22A 3IDBB 4AI9A 3H3ZA 3USUA 1QQP1 3DUIA 3UL2A 3W59A 4COZA 3GJAA 4ZHNA 1ENXA 4FPJA 4MZUA 1J3RA 5FZBA 2OUHA 3RMXA 4W4ZA 3HD8B 1UPIA 3FBYA 1QGLA 4AGRA 4OUSA 2YC4A 4CCKA 1R082 3TYJA 1NLSA 4BPZA 2CNAA 1N1SA 1HN1A 1ZNPA 1Z7S3 5EFUA 1P8JA 3VDDC 2K2SA 2YROA 4CEWC 5EIYB 2FCTA 5H9SA 2RS31 5I8TA 3TEYA 1J3PA 2RM22 1J84A 4LO5B 5DAVA 5EHDA 4CDQB 4CRQA 1WBFA 3KQ4B 4I02A 4AI0A 3H9AA 4W6WA 2VCAA 3I59B 2W94A 1JH5A 1GWMA 2WFF1 4JTOA 4DRRA 5IVYA 5EPAA 5JUVA 4J1WA 1DQ4A 1BHGA 3MDPA 1FOD3 4OULA 3WHUA 4BWOA 2LW8A 1JZ7A 1CVNA 4QX1A 1YQ8A 5K4LA 5CB7A 5I0DA 1HDKA 4LORA 1ASJ2 4YFZA 3NKGA 5I0RA 2FQPA 3DPRB 3NJYA 3ZFFC 2R7EB 1XNBA 5F3IA 2EIBA 1RUF2 1UYZA 1W8FA 3LEMA 5FLHA 1YYNA 4ZU7A 4PQQA 4F3JA 4JDMA 3P5BA 4YM3A 5FOBB 1HN0A 2YY1A 4MGYE 4EZ4A 4W6YA 1TMF2 4COVA 5CG8A 3KB5A 3N9PA 1RINA 1PO12 3M3OA 4O9GA 5ANNA 5LBFA 4JGYA 1B35C 3AMQA 4LULA 3WNNA 1WZXA 5C4WB 2OZJA 3PUHA 1GR3A 5T55A 5FP9A 3WR0A 3HWJA 4QGNA 4GH4A 1UPSA 4FQ4A 2BYVE 2R063 1IS5A 2WAAA 1O8PA 1RXFA 2XQRA 1H8TB 1QJX3 4HVQA 1E5RA 1H1MA 4R8HA 4UBGA 4UBHA 5GZFA 2EALA 2VNRA 3CBNA 3AB0A 2YU2A 2RS13 1YI7A 5KC5A 2F4LA 5CFCA 1H30A 3T0AA 3UNPA 1BVP1 3MIFA 1ST8A 3UJOA 1COV3 1DP0A 3BI3A 3MW3A 4BB3A 3C7OA 2JECA 1WW4A 3ACHA 4AQTA 3AL5A 1XE0A 5FWEA 4XFBA 3U07A 1LTEA 2DUOA 2PHLA 1NCQB 2WWUA 4KU7A 1R1A2 5A3UA 2QFEA 1PVXA 3B3QE 2D43A 2W39A 1MZ5A 3CNAA 3BCWA 3E6CC 1EAH2 2ERFA 1O5UA 4YG0A 3KVAA 5FMBA 4YGBA 1Z78A 3SKJE 5E6HA 1DGRN 2I2SA 1IG0A 5GLUA 2G9FA 1W3XA 2ATFA 4NHLA 4CSWA 4XF0A 3BOWA 3DXUA 5FR3A 4YZ5A 4GAZA 3NL1A 1V6JA 1CAWA 2XBO1 4Z1VA 4Q1PA 2VE1A 1RHI3 1F4HA 2ZGQA 1PGL1 1N3OA 3GZEA 3SCHA 3VDAA 5D8AA 1VMHA 4HANA 1NA1B 3SH4A 1J1LA 2G9GA 5HI0A 1OFSA 4IV1A 5DABA 5FYTA 2D6NA 1UMZA 4JV4A 2JDAA 2QQKA 3DV8A 3PUIA 5FZ8A 1OLMA 5JZGC 3N9QA 4GD4A 4QM9A 3S57A 4GULA 2R32A 4ES8A 4YG6A 4LNVA 4YW4A 3O7OA 3AZWA 4B1LA 1K42A 4DXRA 2P2KA 2Q8CA 1ZREA 1AL23 3ILRA 4BE3A 2BEOA 3RRDA 3O12A 1VBB1 2DVBA 2EXKA 3DF0A 2WQ8A 3TWIA 4INDA 4YGCA 4IE5A 4KH9A 2ZGKA 4FPYA 3WT3A 2FMDA 4LIUA 5I93A 1O3QA 5FPLA 4BXFA 3B94A 1QJU3 2P6CA 2W3JA 5BNQA 1N1TA 1W6PA 2C26A 4QPIB 4YG3A 1O6UA 5FZOA 4ZKTB 1OF3A 5LK7B 2FD8A 3ILFA 1YFWA 1C3HA 2QQLA 4O61A 1GOGA 3BPZA 5FZIA 4NIGA 1S0GA 4WM8B 4XIKA 2D3PA 3ENRA 3SEPA 1V00A 1W9TA 3AZVA 5K8SA 3URFA 4TSVA 1BBT1 4E4HA 4UFKA 4AFMA 2VUJA 1U12A 3CZUA 2ZTNA 3U75A 3HNMA 3E1F1 4NRMA 4F7ZA 2Y6LA 1WLCA 2G4IA 3WW3A 2R073 3MEPA 2LS6A 3INAA 3RGBA 1HQNA 1QNYA 3S30A 5BNOC 2BRTA 2PA7A 2DVDA 1VBD1 3B00A 4NAOA 3AP4A 4XF4A 2ZGPA 2IWGB 2MNGA 1DHKB 5J3UA 2RHPA 3POYA 1FPN2 2C1FA 3D82A 1XRUA 3EQEA 3IKWA 3JBG3 5L7OC 1O3SA 2Q8EA 2QVSB 2ZGNA 5B4XA 1R64A 1H9WA 5GZDA 1EPZA 1W3VA 3PVBB 5FUNA 1W90A 1V6MA 4LBMA 4EN0A 3VBOA 4QKBA 3OD0A 4YVWC 4N43B 4FQZA 2OUJA 3VD3A 3K77A 2B8MA 1GZ9A 2YFZA 4AVSA 2D6LX 3ZFEC 2HWE2 3JB4C 1XOYA 1SLTA 2O0OA 3H42B 4DEVA 4AAPA 1JU3A 4Y22A 4LKFA 4JDNA 5BNNC 4MHRA 3VHOA 2A1XA 4AI2A 3CLPA 4B7KA 1QXJA 1RUE2 1HQLA 1V9U1 1J1TA 3UKNA 1A3KA 5DAWA 2YYOA 1POV3 5FMCA 5T54A 1PO13 3PJYA 3SKVA 3ZKUA 3I2JA 4CDWC 2GMMA 2E32A 2Z5WA 3QD6A 4HKOA 5A3TA 5HCFA 3W58A 5JR2A 1AYM1 2DURA 3LFMA 5IVCA 3POWA 1LOCA 1JZ8A 3N4MA 1UIJA 3C7HA 4JGZB 4XUPA 2GMPA 3AZZA 2RJKA 1SFPA 1E57A 1E5HA 5L19A 4IV3C 3WNMA 1AZDA 4IL7A 5AC93 2JXAA 1SCSA 2PHUA 1ZRIA 4LKEA 4XF1A 2PLV3 3WF3A 3HNYM 4XUNA 2EXHA 4LITA 3GZAA 1KS4A 3ILNA 2R0FA 3O1PA 1CX1A 5JPMB 5DUWA 2W52A 2CTVA 2ZGOA 1VBC2 3NV2A 4BXSV 2WWSA 1RUC1 1JYXA 1VB2A 1AYN2 2FHRA 2XG3A 3EXUA 1NY72 1JZ5A 4ONUA 4YM2A 4BQ5A 1S2EA 2BWCA 1CJPA 3ZR5A 2ENRA 5CU1A 1WMEA 3RJ2X 2ZMKA 5C7GA 3DGTA 3NNFA 3D6EA 4AI3A 2IFWA 4CDXA 4QKFA 4QMAA 1DLLA 4LJHA 3ZLIA 3OB8A 1UY2A 1TNRA 2CYFA 2JG9C 4PBOA 1H0BA 3T4VA 4CEYC 1W6QB 1ZZCA 1REEA 4A7KA 1EV12 2YPJA 1DQ2A 4K8RB 1NE6A 1UCXA 2PAKA 1OOPB 4GB33 3AL6A 1RXGA 2C4XA 1H2LA 2LROA 3OPTA 2WO2A 1OMIA 1X9TA 3B7MA 3WW2A 1BKZA 4AI1A 5BY5A 1GSLA 2MEV1 4JHZA 3VKFC 1OLQA 4Y26A 5H9PA 4LBKA 3ACGA 1RUD3 3A4UA 3JQXA 5BUVA 2XPJA 4WVMA 1AXZA 3MIDA 1G86A 4N7UA 4XQ4A 1ZBA2 3WY6A 1SBDA 1PO21 2Q1ZB 3WF2A 4L0PA 1FV3A 4ZU4A 1H2KA 4UXAA 3DKQA 4QQHA 2XJUA 4FPFA 1LKNA 1UOGA 1DGWX 2CY6A 2WSVA 3VL8A 3FFQA 4KWLA 1QWRA 4OHXA 4RGAA 5JPNB 2BVVA 1NG0A 3I2HA 4JKLA 4RR3A 1QH7A 1POV0 2PQSA 1JXNA 2R041 1SBFA 1ND3C 2R6QA 4QPGB 2P37A 5LA0A 3VKLA 1DF0A 3ZXFA 5ABJB 4M3CF 5JXGA 1L7LA 2ARAA 4FO9A 1H6XA 1AR73 3ON7A 4DO0A 4XCBA 5LRRA 2YC0A 4META 1RTVA 2R1DA 1W6OB 2YU1A 4EN9B 2RS32 3D0SA 1LHUA 5IK5A 1AR63 2WFF2 5KHHA 1HRV3 1VBA2 3CIHA 1VPHA 2C5DA 5A3OA 4AVCA 1APNA 2CV6A 3L9JT 3KCYA 5JCTA 1JTZX 3VDDA 4LO6B 5A6YA 3RG0A 4JQTA 4CEWA 1KXGA 4YW6A 3B9IA 2P3JA 3T2PA 4A42A 1HB3A 4CP1A 1GFF2 1C5IA 2WC2A 2WYFA 3OY8B 4JKMA 2D97A 4QU1A 2DU0A 3OPWA 3ABZA 2WDBA 2ZGSA 1JYIA 3USUB 4D6RA 5FZ6A 1W2AX 1VAMA 3OG2A 2WZR1 2H0VA 2XXZA 4LIVA 1EP0A 4MXWB 4XDQA 5F8PA 4DFSA 4Q0UA 4EE2A 3ZFFA 2NM1A 2VD7A 1OH4A 3KWVA 5FPAA 3OGSA 5ISLA 4AF9A 2XLFA 2ZAHA 2QQVA 5FY8A 2GC3A 3J9SA 4WZFA 3TAYA 3ZXDA 1F31A 3DXTA 3GBFA 4YARA 2HWF1 2WKKA 1B35A 5D21A 4DXSA 3O1MA 3ZO0B 1H8TA 1DGWA 1IS3A 1RJ8A 3UETA 3RDIA 2XQXA 1RUE3 4GQ7A 4Q0VA 4TLGA 4CCLA 1PVC1 3UESA 2PYTA 4PF1A 4PQ9A 2VBPA 2WNVC 5DXDA 1ALYA 5EZWA 3WQ0A 3NV3A 4CYDA 2PHDA 1GUIA 5LBCA 5F37A 1CQ9A 4XMIA 2VNGA 1TNFA 3VD4A 3V56A 4P9WA 5AVAA 3VZMA 3IMMA 3PURA 5T5PA 4Q0PA 1QOTA 4Y4YA 4BZ4A 4CUGA 3I3EA 2KR2A 1WA4A 2VZUA 5FLIA 4H2AA 1O3RA 2WNUC 5JOWA 2FDFA 3AFGA 3KMHA 2B46X 2TNFA 3TB0A 5CFCC 2BNMA 4RGKA 3PUAA 3BGAA 4P00B 3ETQA 3U4XA 3BIEA 3VZOA 4IEOA 4GJZA 1YJKA 1VBE1 4HSJA 4QQOA 4JGYB 4DZGA 2XWBB 3PIJA 4OI4A 2GP5A 3I2KA 2E7AA 5TSWA 5CEHA 1PGL2 2D40A 4UW6A 1JOPA 4W6XA 2E31A 3I3BA 4GH4B 4YM0A 2A3YA 3KS7A 1KFXL 4MUVA 4MXVA 5DUVA 2JDKA 3KGZA 2W1QA 2B9VA 4RA0A 2XVKA 4EJRA 3THPA 2JE7A 3RI9A 3NNJA 3S7IA 2HLEA 3AXEA 5DDJ3 2WRAA 3WP4A 1NA1A 2BNOA 3ZM8A 2WT1A 3K48A 1SQ4A 4BM8A 3PLQA 4DIQA 2HWB3 4H55A 4OZXA 5GZEA 3MLKA 1VBB2 1LB2A 1RVF2 4FTEA 3T1MA 2ZX4A 3FL7A 1KGYA 3ZSKA 4IGPA 2JIGA 5JZGA 2WR9A 3HQUA 3HOBA 4YW3A 2J1AA 2WFPA 3GZTB 4NAMA 1B09A 2UY9A 4UYBA 2CSGA 2QCSB 3H7YA 5GKAC 5LW9A 2FDHA 2HWD1 4K3UA 5FBJA 3WG2A 5C8CC 1SDDB 1U5IA 3I7DA 3KV5A 3MUZ1 1MZ6A 4LMFA 4W50A 4ES9A 1CAXB 1ZX5A 2IXJA 4FAHA 2LRPA 3RYKA 2W95A 2DWRA 3BPSA 3J8F1 1BBT2 4OYUA 3FHIB 5FYSA 2V73A 4YW1A 5F39A 2YPDA 3RZZA 2A71A 5JOYA 1D2SA 1QJY1 2W1WA 2BGCA 4GWIA 4AHZA 5D8AB 4AEDC 2Z2SB 4LT5A 4KG0A 3UYJA 2Y6FA 5IK7A 1VBD2 1OFNA 1VLNA 2EAAA 2NMOA 1F8VA 1NXD1 2JB4A 2UYBA 2WL1A 2ZKLA 3CDZB 3MW2A 3NJVA 5I8SA 2MHFA 2PAEA 1FAYA 3T08A 4Q4X3 3AVRA 2D6MA 3TOJA 4D6SA 3HT2A 4GWNA 1VJ2A 2TUNA 4GXLA 4S2FA 5FP8A 1V6OA 2QKDA 4BOWA 2Q8DA 1HIXA 1XYNA 1OSGA 2YC2A 2UU8A 5DAQA 5BNOA 5KHKA 1G9AA 4QKDA 1Q8SA 3VBHC 2Y0IA 4YYOA 5JMCA 5ERLA 4I09A 4LK7A 1YQ5A 3WQ7A 1CZTA 4YVSB 2ZX3A 5L7OA 1VRH1 1UZZA 4AE2A 1H4GA 4XETA 1VBA3 1WLTA 2P5BA 4GB31 4CP0A 5ACA1 1W6PB 4NHYA 1QDOA 1US3A 5FZOB 3M3IA 5F9TA 2XJSA 3U37A 2BERA 1KJRA 1S0BA 1W39A 2A6WA 2ZMLA 3B01A 3BN6A 4N43A 4TZDA 5GM0A 4ZY9A 2NPIA 2WNOA 3H3LA 4UI9L 2GN3A 1WUVA 4XBNA 1V9U2 4IUGA 1ZBE3 4IEVA 1WLWA 1LECA 1GOFA 3WX5A 1OVPA 4CCMA 2GU9A 4NOTA 3ZFEA 4AHYA 4NPRA 1FI2A 3IB3A 1OLME 3BU0A 2QQNA 4CUBA 1AYM2 1X50A 3MIGA 4XILA 1CGPA 2QDNA 1HRI3 1UX7A 1NLQA 4Z8BA 5D1IA 2A6VA 3KHCA 2A73B 2ET7A 3WDUA 2AC1A 1WCDJ 1ONAA 3I3DA 2IC1A 1G7YA 1X7NA 4Q4W3 2XLGA 3EO6A 2XHNA 2RE9A 2PQQA 4CDWA 2VMFA 1PGW1 4KBBA 4UFIA 5JOZA 1UO9A 4E2QA 1VIWB 1V6NA 4BLIA 2XOMA 1W8ZA 2JEMA 5F3EA 3BYWA 4WM7C 3WXPA 4MG2A 3AYEA 2NYYA 3VBOB 2JDZA 2D5FA 3IBMA 3S0MA 3UGGA 1I3HA 1POQA 1RUC2 5FO7B 4BH9A 1BEV3 1AR61 1ZRDA 1UL9A 1RUJ2 4IV3A 1DZQA 3VV1A 3JD71 4LKSA 1HKDA 1Z0HA 4RS5C 1CONA 1RUG3 1W8OA 1WLDA 2I74A 4OFGA 1QJZA 3VZNA 2Z79A 4URAA 3EMRA 2XR4A 4IEZA 3J4UH 3ITQA 3N36A 3W5NA 2A3WA 3ASIA 3PMEA 1ULCA 1N3PA 2VG9A 1WBLA 3GM8A 4ZS2A 4J25A 1OC1A 4XJWA 4QQPA 1ZRFA 3SC7X 1BK1A 1PIV1 2P4EA 1LHVA 1RMU1 5J48A 3KF3A 4BA6A 4K6BA 3WDXA 1ZRCA 3J7NA 2JG9A 4BQYA 4CEYA 5A1FA 3IZOA 4O9EA 2WYSA 2WABA 2VOTA 1OURA 5A70A 1FYUA 3MFAA 1GQHA 4KQ7A 4FTSA 4FTBA 4AOCA 2XL7A 1PO22 3PJQA 1MEC3 3VBFC 4AFAA 5GZGA 4FFGA 4HK9A 1DDLA 3MIEA 4AFCA 1FNZA 5F6LB 1V6IA 4KBZA 1HB2A 2CWMA 4A44A 3IMNA 5DG2A 4Q8KA 5JXJA 4XHBA 5T5OA 2YDEA 3IPVA 3LA3A 1S2KA 3SISA 2R042 5G05L 3VDCA 5EXOA 4B29A 4KWUA 3M3EA 4HONA 3WNKA 2ADDA 1GNHA 4CDXB 2RMU1 1GYKA 2VQ0A 4YZ3A 4OMDA 2E53A 1WW6A 2XJPA 2PTMA 3JB8A 5GLWA 1SLBA 5LB6A 1VRBA 1LRHA 4PIZA 4D3WA 1ND3A 2ADEA 4LBOA 1HV0A 3MO4A 4Q4V1 4D8MA 1PGSA 3AP7A 1U0AA 1W6OA 3K51A 2RDSA 5KR7A 3AX4A 2I45A 3MF6A 1C4RA 4DB5A 5IK4A 1QY4A 3MPPG 3NQHA 1QXPA 3NJXA 3NWKA 4D94A 3QLQA 4WVMB 1SPPA 5FYMA 4YW2A 2QQJA 2RS51 2BTVC 3CJIC 1QXRA 1TME2 4R9AA 3ZDSA 3VZLA 4E2SA 1J58A 1HV1A 3MLJA 2RG4A 1RC6A 2W47A 3OSDA 4HETA 3J26N 5FYUA 3KQRA 5EV7A 3RZJA 1IPJA 2Z4FA 2WZR2 3ZPOA 1XBFA 1HQWA 4S2DA 5FLJA 3RZKA 1C8M1 2CWSA 2YZ4A 1O91A 4OHZA 2H0BA 4Z92B 5A3LA 3HBZA 1JODA 2R1BA 5FY7A 4O65A 4CU6A 1DQ1A 4MXWA 5GLTA 3IIAA 1AR91 2XGXA 3VHPA 2GAUA 5FZLA 1MS0A 4A7ZA 1YO8A 1UZYA 4QXBA 4P9IA 2X05A 1KRIA 2BBAA 2HWF2 4Y33A 3O1RA 2OKXA 3JZVA 3TN93 2LTNA 3D5OA 5CISA 5K0UC 1DQ6A 3BVCA 1PX3A 1YWKA 3GNEA 1WCUA 1CAUA 4UOJA 4GKYA 3LWCA 3I3MA 1LGBA 1SZBA 3PL0A 2O1QA 4O7XA 1SBEA 3ECQA 4A41A 3RYRA 5H9QA 2ZABA 4ATFA 2H6BA 4XPVA 4BK5A 2W91A 2WSUA 3VDDB 3HR9A 5FK8A 4CEWB 3ZYPA 5F6KA 4NIHA 3ZOIA 1O59A 2YGMA 4P5HA 4CU8A 2HJIA 2YHJA 2QDRA 4AXOA 5FZFA 1ENSA 2VTFA 3POJA 4ITCA 2BNNA 2WNVA 2J1VA 1FMD1 4DXTA 2HKXA 3T4HB 3T1LA 2QQUA 5FMOL 4QB1A 3GGLA 1N1YA 4B4RA 3A0NA 4LOTA 3TEXA 5EYXA 1NZIA 3HN1A 3C3VA 1LOBA 3ACFA 2B5HA 2D44A 3MIHA 4HN1A 4IEUA 3ZFFB 1STMA 2WNUA 3ZYFA 5I8YA 4LBNA 1OLRA 4JRAA 4IE4A 2WIIB 2YMZA 2E51A 5A3MA 5LRSA 3VD7A 3H8OA 4MX3A 5FYVA 1GZCA 3R4SA 3LOBA 3VDBA 3RYPA 4LO7A 5A80A 3N9MA 1IGOA 1B35B 3IM0A 4A6SA 1HJFA 4CP9A 4XABA 1YC61 2GN7A 3OEAA 4A3XA 3VD9A 3LEIA 3P3NA 2VM9A 2YBKA 1F5JA 3CMGA 4NHKA 1GZTA 4A4AA 1R092 3LDKA 5JMOA 3HJRA 4DOUA 4R4XA 2JDNA 2VZQA 5JIAA 2IUWA 4J6GA 3Q8AA 1UNBA 1FV2A 2HWC2 1BMV2 1PHMA 2D93A 3M1HA 4RQPC 4Z2AA 2LALA 2HWD2 3B02A 4FOVA 1D4M3 4KGQA 1Q8QA 4OQ9A 3UKTA 3OUJA 1QMJA 2ORXA 1UOJA 5BPXA 4RGGA 1LESA 2WS91 1SLIA 1C8NA 1K12A 4BCUA 5JVVA 3J8F2 1AR81 3SMHA 4XFHA 2VVFA 5A32A 3LGRA 1VALA 3LPFA 2EICA 3HQXA 1CAXA 5IAVA 1QJY2 3ELNA 4JDOA 5C8CA 5J96B 3FLRA 1S0IA 4WV8A 3U11A 3M3QA 3DEMA 4BMEA 4D7YA 3HAGA 2BGOA 1HB4A 2W5FA 5CFDC 2BUKA 4COWA 3D0JA 5CVRA 4FOQA 4K20A 5FUPA 4XXPA 1E5IA 1BEV1 3DL3A 3LPGA 4G9SB 4M00A 2EIDA 4QGMA 4EWDA 2WINB 4LO8A 4QXKA 3LA7A 1UU4A 5FXWA 4U2AA 1PMJX 3ZSJA 3FJSA 3PTRB 4AEDA 3KV9A 5CIRA 3MI8A 3POSA 2P3IA 3LCPA 4I3PA 4AQ6A 4BYYA 5JXHA 1G9DA 2J1TA 4QB6A 3BUCA 1RJ7A 3W5MA 1T2XA 5DUUA 3WW1A 1VRH2 5C3RA 4FI9A 5JZGB 5LBBA 4PI2A 5ACA2 5A7NA 1WA6X 3AKPA 4FPHA 4FFIA 5FZAA 4YVSA 3KCCA 4UFHA 3WCSA 1YUDA 2LM3A 3O5SA 4RHV1 1RUH1 3VBHA 1XYPA 2Y60A 4JVAA 1K5JA 4CCNA 1W8WA 2J1UA 2Q1FA 3BODA 3NAPA 5G04L 2CL2A 3WG3A 5IT6A 5FRAA 2ZEZA 3OGGA 4Y1VA 1UD1A 1FXZA 2VVDA 5HV4A 2WQ4A 3ROUA 2VMGA 4PI0A 2JDMA 2GNMA 4HMZA 4LUKA 3LSDA 2OQ7A 4GMP0 1ULOA 3VHRA 3ZN6A 1G9FA 3WV6A 3AC0A 1NQJA 1H4HA 2JWPA 1GNZA 3QH6A 4MOAA 4BHPA 2RR12 4LBQD 1W8NA 4XW3A 4LE3A 4CUAA 1SLCA 3Q9OA 2VQTA 3WNLA 5EYYA 5F5QA 4A2UA 1LR5A 3DYPA 3K2OA 3B5LB 1R083 2VXJA 4Q4Y2 5BNOB 3DYMA 1W9FA 2AACA 4JHTA 1NCRC 3K4ZA 5A3WA 2ZEXA 1KS5A 3ZVXA 4MYEA 1I9RA 4RYDA 2OXBA 2YGLA 5L7OB 3NNLA 2ZEYA 3FC0A 4FPGA 4XJUA 4V2VA 2V09A 2XKPA 4MHUA 3WDYA 5IFTA 3JD72 3C7GA 2NZ9A 3I2OA 4AGGA 2RM23 2JDUA 3POIA 4KWKA 4XDOA 4BDVB 5IK8A 1UZVA 2P1BA 4DQAA 3ZPYA 1XJAA 4JZRA 1RUI1 2DCYA 4L99A 4WM7A 2EXIA 4EZHA 4L92A 2D6OX 3ALQA 3SLIA 3I2IA 4YVWB 5IW0A 1MZEA 2ZGMA 4HLTA 1VE0A 3FLPA 4A7YA 4FPCA 1ASJ3 2BWAA 2VZOA 1XU1A 1X8MA 3ZFEB 1HXS1 2VW0A 2OIIA 4ZZ5A 5E1RA 4RS5A 3Q8EA 1ENQA 3M7AA 3Q8BA 5T5LA 1RMU2 3AKRA 1RUF3 5LA9A 3WQ1A 4K1ZA 5BNNB 1KDMA 2JE8A 2Q1MA 2VUDA 3L2YA 1TMF3 4NRQA 5I0TA 3IDAA 2VGDA 1KQRA 3HEIA 2JJ6A 3OPZA 4BQXA 2HBTA 3UKVA 3RZHA 3GALA 4KMQA 4N53C 1LOFA 1W28A 2ARXA 3LB9A 4CDWB 2VZ1A 4IQPA 4BLJA 5C5UA 4LBJA 2PAMA 3BIWE 4RFRB 3ZYHA 4EYUA 2XL9A 4XFFA 2UY8A 3THDA 1Z7S1 2ZS6B 3VBRC 4Y24A 4ASMB 4IV3B 3GJBA 1UXZA 4XE9A 5FMOS 5KHGA 2DTYA 1RIRA 1NT0A 2HWC3 4FBFA 3OYWA 5C3OA
chains in the Genus database with same CATH topology
2RMU2 2DCJA 3ZFGC 2HEVF 1ZZ8A 1BYHA 2B42B 2JICA 1R1A3 4G3YC 2VW2A 2GALA 2IXKA 1EAH3 1FOD1 5FCCA 4C1WA 2WA3A 2P3KA 4Q4V2 4R9CA 1W0OA 2NQYA 2XJRA 2JG9B 3AK0A 4CEYB 2XH6A 3MZHA 1HX6A 2EAKA 1CR7A 2DUQA 4DS0A 5E89A 1IOAA 4X8PA 3M3CA 3V65A 4HSLA 3USSA 2RS52 5DZGA 3DN7A 1VAKA 2DFBA 4YZ1A 4PLOA 4L9BA 4Z2WA 4S2HA 2D6KA 2R061 4QQ2A 1QJX1 1UAIA 3ZXLA 3KLSA 3IPVB 4PDWC 3AJZA 2RS11 4C0HA 1QQP2 1COV1 1H2NA 4WBBA 1AR92 2Y38A 2ZGLA 3VGIA 4RFT0 3KT1A 4YM1A 2BW8A 4P9YA 1S0EA 3WZ1A 2X5IC 4OVEA 3IT8A 2ZGUA 3LKJA 3T2TA 1OD5A 1ND3B 4IEXA 2X8KA 2K0GA 4JRLA 5JSOA 1GICA 1DFQA 1CX4A 4FPEA 3ZXGA 4AWDA 4COUA 4YNIA 2D3RA 1LCLA 3GHMA 4LR4A 2KM2A 1LOAA 4Q26A 3AP9A 1J3QA 1ZZBA 1IHMA 2RR13 1X33A 2WA4A 1RHI1 1C1LA 5JSRA 1FMD2 4XF9A 2A6ZA 1ENRA 1FPN3 4ORFA 1RGSA 2ZBJA 3H0OA 4HKLA 4Q4Y3 5EWSA 5DUXA 1AJKA 2WT2A 4C0BA 2ET1A 1LGNA 3KZ4C 5KXDA 3WDVA 2UWCA 4HFSA 1AL21 3AKTA 3IDCB 3KD4A 2JE9A 4WVZA 4CDUC 1UU6A 3L2HA 1TEIA 3LAGA 1REFA 5JDBA 2OZ6A 3ZIXA 1XQNA 2H6CA 3EJKA 1QJU1 2XJTA 4YLZA 4RL7A 1CAUB 1WMDA 2HWE3 4PLMA 2D6PA 1IS4A 4ATEA 2B7YA 1X82A 4Y1UA 4DPNA 1C57A 4D69A 1Y9QA 2IXCA 2WJSA 5B2GB 1O4TA 1S2BA 4XOGA 4L2NA 2WNEA 4YRDA 5DZFA 3UV9A 2VY0A 3EHKA 2R071 2WNVB 4XFIA 1OKQA 1LENA 2WS92 5FO8B 1AR82 2UURA 4OI0A 3LA2A 2EXJA 1WW5A 2PFWA 3JBG1 2VQAA 1NLRA 3D4KA 2UYAA 2WNUB 2EF6A 4AFBA 5CFCB 2XBO2 4D7TA 2ZACA 1VBC3 4KG8A 3KT7A 1AYN3 4EWAA 2ES3A 1YRZA 1DYKA 4XXAA 3ME2A 3N7JA 5FTTC 1PK6C 2ARBA 4QHBA 4L11A 2YXSA 3ZSEA 2CGPA 4NR1A 1EV13 4HVRA 1D4VB 1UN1A 1RUF1 3AP6A 5I91A 4EROA 3H3UA 3OTFA 4XQWA 4RHV2 1RUH2 4PIYA 1TMF1 2ZZJA 3SITA 1POV1 4QT6A 1PO11 1VP6A 2DYCA 3CO2A 5A32B 2QQPA 1SFYA 1ULDA 5C8CB 1ZBA3 4OHYA 2ZX0A 3THTA 4E4ZA 5T50A 4AVVA 1M4WA 3RS6A 5C8WA 4CZSA 4LBQB 5AC91 4EN8B 2ZMNA 4FOWA 4FXGB 3E5QA 2PLV1 1QQP3 4LE4A 3RWNA 1PNFA 3RSJA 2VULA 1OA4A 3I8TA 5AFBA 4MGZE 1Q8VA 4UW5A 4F83A 4AEDB 4HPKA 1O3TA 4PBPA 2AUYA 1EAH1 1F9KA 1C5HA 5LK5A 4EV0A 3SCGA 2NN8A 4BIFA 1HW5A 2XWJB 2RS33 3PVOA 4IV1C 5AFEA 4Q0SA 1RITA 1LHWA 4N7IA 2VNOA 3VBHB 2QUOA 2WFF3 1RUI2 4BMBA 2OW4A 3NAPB 3SHRA 1RL3A 4YSFA 1XNDA 3S7EA 1G9CA 4I3GA 4Y20A 1RUD1 4KGGA 1HXS2 4JAAA 1KD7A 4AHWA 1A8MA 3IDEA 2AGSA 3ZN6B 4YVWA 2AH2A 1O4ZA 4K8FA 5FPXA 3AMMA 1H9PA 1KFUL 4XBLA 4LLFA 5BNNA 5H9RA 3N7KA 2ZCWA 4XIOA 1VAVA 1OHFA 1IQAA 2BBVA 4FSJA 2EA7A 1AR71 1Z7S2 1DYPA 2VVEA 1JYCA 4E4DX 3N7LA 4SLIA 3OGJA 4IXLA 4RSUA 3FWEA 4XEZA 4R9BA 4WM7B 1URXA 3CJXA 4OI1A 1DZTA 1HRV1 1QH6A 4XF3A 2IFRA 3O0VA 3VBRA 1FOD2 1KJLA 2F6BA 1LULA 2VH9A 2ZKNA 4RS5B 3AXDA 2JG8C 3ZFGA 2A7AA 2E9QA 4FXKB 1SLLA 1V6LA 1BQPA 4FP2A 3VBSC 1K5MC 2FBEA 4MLOA 1HLCA 2MEV2 5A33B 4AFDA 1Q8OA 2X29A 1W2UA 2R30A 5HCBA 2RJLA 1YNAA 3RPQA 5SV8A 2ZGRA 1O5LA 2GC2A 2R062 2DCTA 1QJX2 1QOOA 1XU2A 1QDCA 2HWE1 4ISQA 2YV8A 2RS12 4GKXA 5GJ6A 1CN1A 4FPKA 4K9SA 3OYWB 1COV2 1LJ7A 1VBB3 2DCZA 4FPOB 1MQTC 4XYXA 1RVF3 3A0KA 4N9HA 5AVPA 1RUE1 5E16A 1ND2C 4AEJA 1UKGA 5BNPC 5FQ0A 4PDWA 2GSYA 4X6QB 2R16A 3FBMA 1QNWA 3LSEA 3RQ0A 4Z07A 5E8AA 4PLNA 4XFCA 2KA3A 4LLOA 3ZYGA 3OBRA 5FOJB 3ZXEA 1QOSA 3VN4A 1BBT3 3HT1A 5J98B 5GZCA 1BCXA 1S55A 4GALA 4OUMA 4COYA 3VBUC 4QX5A 4FPLA 1VBD3 2R0HA 4MH0E 4Q1RA 3RJRA 1MS1A 3ES1A 3TNPB 3NJZA 1FT9A 4YZ4A 5DDJ1 1LEMA 1JN2P 3CJIB 5FPZA 5J09A 3VL9A 4SBVA 3ATGA 2HWB1 3H50A 1AL22 1A78A 3BB6A 1C1FA 3AZXA 3NW4A 3ZYIB 3FMGA 5GLZA 1YJLA 4S2GA 3PNAA 4AVBA 2HYKA 1QJU2 3FUOA 3APBA 1DG6A 2W08A 1Y7BA 2EIGA 4AVTA 3V0BB 5KC6A 4I0WB 4K40A 4RR3C 2ZGTA 2OVUA 4CP2A 4CDUA 5C9AC 4IERA 4HZFA 4E4SA 3TNQA 2GNDA 3D8CA 4WVWA 1V9U3 1PVC2 5HBAA 2A75A 3ZMOA 4B4QA 5K0UB 3V64A 1TQ5A 1WD3A 3KT4A 4WVVA 4LA2A 4NO4A 1AL0G 3VUOA 2R072 2E7TA 1NQDA 1G9BA 1AYM3 1EY2A 1LU1A 1I1EA 1PM7A 3ZIWA 1VB4A 2Q0AA 4QPYA 3JBG2 4IEWA 4Y1YA 5JI7A 4Q4X1 3VKNA 2VU9A 4AHXA 3ZXJA 3AP5A 1VBE2 3IWZA 4CDQC 2I07B 5T3NA 4C90A 3GYDA 1RUC3 4R4ZA 5KXCA 1DQ0A 1RUJ3 2CAVA 2ZJCA 4OLLA 5CFCA 1V6KA 2B39A 3AMPA 3MIBA 3PVEA 3WVJA 2A6XA 1VBA1 2UWAA 3M2MA 4OI2A 5KHIA 1LU2A 3SNMA 3DPRC 1OQ1A 3HMYA 3N7MA 4H14A 2IXHA 4UW4A 5JIUA 3NSTA 3N35A 3R4DB 3WLUA 3UJQA 1LEDA 5FBZA 4B8EA 2PN5A 1ZRRA 4TLFA 1ZBE1 3WDTA 4GMP3 5C4WC 1PK6A 2MEV3 3SH5A 2WLPA 2OA2A 3ZSMA 1PMIA 1H8TC 3AKQA 1HRI1 4MGKE 4RQPB 3CEWA 1U5YA 3CF6E 4H7MA 1LGCA 2E6VA 1GV9A 1PO23 3RI8A 5K9YA 4Q4W1 4FVVA 5AC92 1G6NA 2PLV2 2GZWA 3MF9A 2YUEA 5BYNA 4YFWA 1YFUA 5KXBA 5FFOC 4R9DA 4HN0A 4KNCA 1NCQC 4FOYA 3NV4A 4LBQA 2VW1A 1W6MA 2R043 1MR5A 1DZRA 5CFDB 2VUAA 3B9CA 1A8DA 4KL1A 1GLHA 4DRVA 1IPKA 1RUG1 4LHLA 4HBNA 4K7JA 4LHNA 2E63A 3OD4A 4DNYA 2FMYA 4XJAA 3GHNA 3HIFA 2BFUL 2JKBA 5C6CA 3U0ZA 3FX3A 4GB32 1NA1C 2B9UA 1AJOA 1YIFA 2A70A 3PTYA 1MZFA 3RMYA 3SXWA 1NZCA 4YGDA 1RUD2 1DGLA 3W9AA 4AK3A 1TME3 1ZZ7A 3OCPA 1MEC1 2O8QA 3QBQA 1W6NB 4E27A 4X8NA 3NKTA 3R4UA 3U10A 2WZR3 1IS6A 4OHVA 3AMHA 4KWJA 1RUOA 1ZZ6A 1RVF1 4ISRA 4U36A 2P17A 1H8VA 4QPIC 4HPKB 4L8QA 5DG1A 4LEJA 2ZHMA 1ULGA 1R1ZA 3KCXA 4WM8C 1Q8PA 5I0SA 1PGW2 2HWF3 2QNKA 1AR72 2NLRA 4GWMA 3JQWA 2IZWA 2Q30A 1PVC3 1AR62 1NCRB 4ASLA 1AF9A 1BJQA 4Z82A 4L97A 4LUMA 1HRV2 2W68A 1MS8A 1GBGA 1EPWA 4Y20B 5JLVA 1H1AA 3PVNA 3TBDA 3H8UA 3MYXA 1XXNA 3N3HA 2CGNA 5CADA 4N90A 1PZ7A 2Q5TA 2VOKA 1PIV2 1D0HA 1VBE3 2VECA 1LHOA 4NVPA 4LA3A 3ZXKA 4N43C 4P9JA 4XMAA 3E5UA 4AGVA 1CESA 3X29B 1KDKA 2A5ZA 2JG8A 2AR6A 1RUNA 1LOGA 2HEWF 1MS4A 4HKWA 1OA2A 3PMSA 1W0PA 3VLBB 4M0NA 5A33A 3AMNA 3G6JB 3LZZA 1CJDA 1K5MA 3NV1A 3VBSA 4FT8A 1F5FA 1YLLA 4N53B 2DTWA 3TN91 1F2NA 5GLVA 4EWEA 1DQ5A 3GF6A 1QKQA 3FFZA 1R093 1CAVA 5L36A 3DKWA 2PHXA 1RB8G 3VBFA 4J1XA 3MICA 5JOXA 4XFGA 2AYHA 4JGZC 3VBRB 4R52A 2HWD3 1DU3D 1GZWB 3WINE 2ZHNA 1U5XA 2BVBA 2DV9A 2DCKA 2IXLA 4PIXA 4FAGA 5JR7B 1MQTA 2DVGA 3WD5A 3ZFGB 1LOEA 3QCWA 1ND2A 3EBRA 3J8F3 1OI6A 4NWWA 4ZU5A 4M3CB 5BNPA 2A3XA 3ZMNA 3FZ3A 5GALA 1QJY3 5JWPA 3H7JA 3SH3A 4Q27A 2VMHA 4N9IA 2BQPA 2O8OA 2GNTA 4H7LA 1MVQA 2Q4SA 4MSVA 1RUJ1 2XJQA 2D5HA 4K1YA 1O7FA 3AYDA 3ACLA 3TRSB 3KSCA 5DDJ2 5T52A 1OPOA 1I5ZA 4B7EA 3VBUA 1MS3A 1OOPC 3WCRA 2HWB2 3R0RA 5J7MA 2SLIA 1SMVA 1JBCA 4YW5A 1C8M2 4DMIA 4XFAA 1VRH3 2JD4A 3CJIA 5ACA3 2CAUA 3QOPA 4GMP1 5FQ0B 4Q2FA 1GANA 4PDWB 2MPFA 4I0AA 1CIWA 1UIKA 1JUHA 3KGLA 1D4M1 1D0GA 1XE7A 4M3CE 5JAXA 3AKSA 2A6YA 5CAZA 1ULEA 4P9LA 4FCAA 3M8LA 1ZA4A 3V0BA 1Q5OA 1TE1B 3E5XA 3QACA 2X5IB 4AYUA 1BVVA 5BXXA 5HCAA 3ST7A 4AVAA 4QPGC 2TBVA 2CGOA 5K0UA 4I30A 5C9AA 2BFUS 2FZ1A 5ABJC 4AG4A 5BV6A 1GQGA 2HEYF 3UK9A 2XUMA 3I54A 2V5YA 2XVGA 4URTA 1ZYBA 2LUWA 4DY3A 1WMFA 4Q4X2 3CU7A 2OPKA 5K7PA 1Q43A 1C28A 3VHNA 3WG4A 2DF7A 4OHWA 4XZPA 1NXMA 2GNBA 1JOJA 4Q8LA 3E6BA 4W65A 3MFCA 3BALA 1Q3EA 5I0UA 2D7FA 1PZ8A 4NN0A 3H1MA 5L73A 5EJ3A 1S0CA 1X36A 3AYCA 3AZYA 3JD73 3BOPA 1SACA 4EN6B 3NO8A 4CDQA 2D3SA 2DFCA 2IXIA 2Z42A 1U5ZA 2C0ZA 1YXWA 4CDUB 3I59A 3GZUC 1Q56A 4QQLA 1WGPA 3KM5A 4Y1XA 3ZN4A 1AX2A 3V0AB 1YHFA 4HT1T 1S1AA 4TWTA 1TME1 2AZ5A 1PNGA 3IN9A 1REDA 1ZBE2 3ZXAC 4KU8A 1PIV3 3GBWA 1RMU3 4JCKA 2K9ZA 3DPRA 1JW6A 1S0JA 1OPMA 4TYSA 1NYWA 3M4FA 4IEPA 3VKMA 1XE8A 1HRI2 3NVCA 2TEPA 1X8EA 2D98A 5FO9B 4JQRA 1SDWA 4AQSA 4Q4W2 5C4WA 3B69A 1ULFA 1ZVFA 1JHNA 4UW3A 5CNAA 4RQPA 1KITA 2ZOEB 3OBTA 1R081 3SCFA 4F8AA 1QHDA 1SFNA 3FUQA 4AEKA 5CA6A 3O14A 4YGEA 1BEV2 1AX1A 3WOGA 3VZJA 2ZZQA 1DBNA 1QU0A 2RM21 2RMU3 2XJVA 2XLAA 4XQDA 1RUG2 5IUQA 3WHTA 1NCQA 5CFDA 2F4PA 1LHNA 4XTPA 3ZYJB 4JGYC 4Q4V3 1ASJ1 1UX6A 4MV2A 1UU5A 4PF5A 3H1YA 1G8WA 2SBAA 1PK6B 3ES4A 2B45X 4GH4C 2BPA2 5KBFA 1T6GC 5CG9A 4RD7A 4MGIE 4Q0QA 5FAXA 5DZEA 2RS53 1H2MA 1I6XA 4D7SA 1MEC2 4IETA 5E88A 1J59A 4IESA 4BIOA 1N3QA 1L3JA 3LOIA 2AENA 5HXVA 4NWVA 5LEKA 2WT0A 3M70A 3G7DA 3ZN5A 1C8M3 1W6NA 1AUYA 2Y26A 1W6MB 1R091 1MS5A 2PELA 3GBGA 1AHSA 3RNSA 2GC0A 1YFYA 4AI8A 2EVXA 2HWC1 1BMV1 1AR93 1UW8A 3WUDA 1XNCA 2R49A 2XVLA 1UF2C 4I0BA 4B4PA 3MPBA 3ZSLA 3WP3A 2QE3A 4LHKA 1YI9A 1R1A1 5KHJA 4XJ8A 1MVEA 2GMEA 2WZPP 2OYZA 4QPIA 4LBLA 3MGUA 4MVTA 4I2OA 2N7GA 5D8AC 3ZX7A 3JU9A 2JX9A 1CAWB 3MW4A 4WM8A 1IZ3A 2KXLA 2VOVA 3O0XA 5C33A 4CTEA 4XTMA 1NCRA 4IV1B 2VXRA 2UWBA 3VKOA 4P9GA 2ZA9A 1WCKA 1FMD3 5J36A 2VOWA 3VZKA 1XYOA 1O4YA 3WUCA 4PCRA 1A6CA 4HVOA 2GH8A 2X53S 4YVSC 5F1RA 2ILMA 1CPNA 3OF1A 4HL0A 3WNXA 3AM2A 2PHTA 3NAPC 1GKBA 4XJ9A 3WP5A 2AREA 3BU7A 2XB6C 2DU1A 1OQDA 4XHXA 1UKRA 2DUPA 2WLQA 1FATA 3TN92 1QF3A 4K21A 4P14A 4E9KA 1YIPA 1AX0A 4E2GA 1FX5A 4NHMA 3I4IA 4IEQA 3WDWA 4N53A 2VPVA 4AQ2A 4H3WA 2QZ2A 1D2QA 1PZ9A 1S0FA 2ZHKA 5SV5A 4FP3A 1FNYA 2ZHLA 4IEYA 4V1PA 5KXEA 5FDBA 4Y5Z0 1NE4A 4PJYA 2WS93 2RR11 2ZPXA 1GZWA 3P3PA 4QGLA 1AR83 5JI9A 1N1VA 2WQZC 3FE5A 4JGZA 2Z69A 1CD3G 1FPN1 3VBOC 4Q4Y1 1BXHA 3ZYRA 1OA3A 3JCIA 2GH2A 3QH7A 1XNKA 4M3CA 3S6PA 3JUUA 3E97A 2QJVA 2JG8B 2XBO3 2ZX2A 3R05A 2PHWA 4LO4B 4Q29A 4Y1ZA 4LTAA 3MLLA 2NP0A 5CBLA 3VBSB 1K5MB 2JENA 4JC1A 2GC1A 3CL1A 2W0XA 3O0WA 4Y22B 1IKPA 4JTNA 2XKOA 1Y43B 4YZ2A 2XHKA 1CAVB 2ZX1A 3VBFB 1BZWA 5JSPA 4XJZA 1V70A 1LOFC 4AEMA 3C2UA 1MS9A 1AXYA 1W6QA 2FZ2A 1CPMA 4RHV3 1OOPA 1D4M2 1RUH3 1WW7A 3OJBA 1MQTB 3WP6A 3E6DA 1IKQA 1ND2B 2VOXA 2QZ3A 4EN7B 1VR3A 3AJYA 1AXKA 4M0HA 5BNPB 1SEFA 3FLTA 5FREA 4I01A 3I2DA 5KWRA 2Y0OA 2ETEA 2X5IA 3R6SA 4HK8A 2DVFA 4CDXC 3B93A 2PHFA 4XBQA 1OQEA 1RHI2 3AFKA 1DGRA 4C91A 1VBC1 2PHRA 1JUIA 1WD4A 1N47A 1AYN1 4WZCA 3VBUB 1M06G 1NY71 4QM8A 4QPGA 1SCRA 4P9XA 4ZXKA 1NOVA 2VMIA 3H1WA 4QU2A 5ABJA 1AVBA 1LODA 4B3NA 4DXZA 1ZZ9A 1ZM1A 2DVAA 3WG1A 3WW4A 1DIWA 2ZAAA 2Q8OA 4BQ1A 3AYAA 1EV11 4QD2A 4GIQA 1EYBA 4G4FA 4C1XA 2P34A 2GDFA 5LEJA 1MACA 1RUI3 5J37A 1YFXA 4DY5A 5T5JA 1Y3TA 3BTAA 1WCSA 3PHMA 1HXS3 4M01A 4X6RB 1ZBA1 3V0AA 1YCIA 2E7QA 3OY8A 4RR3B 2C9AA 1S0DA 5C9AB 2NMNA 4GA9A 4AW7A 1H1IA 1SLAA 3IDBB 3H3ZA 3USUA 1QQP1 3DUIA 3UL2A 3W59A 4COZA 1ENXA 4FPJA 4MZUA 1J3RA 3RMXA 2OUHA 3HD8B 1UPIA 3FBYA 1QGLA 4AGRA 4OUSA 1R082 3TYJA 1NLSA 4BPZA 2CNAA 1N1SA 1ZNPA 1Z7S3 5EFUA 3VDDC 2YROA 2K2SA 4CEWC 5H9SA 2RS31 5I8TA 1J3PA 2RM22 4LO5B 4CDQB 4CRQA 1WBFA 4I02A 4AI0A 3H9AA 4W6WA 3I59B 1JH5A 2WFF1 4JTOA 4DRRA 4J1WA 1DQ4A 3MDPA 4OULA 1FOD3 3WHUA 4BWOA 1CVNA 5CB7A 1HDKA 1ASJ2 4YFZA 3NKGA 5I0RA 2FQPA 3DPRB 3ZFFC 1XNBA 1RUF2 5FLHA 1YYNA 4ZU7A 4F3JA 5FOBB 4JDMA 4YM3A 2YY1A 4MGYE 4W6YA 1TMF2 4COVA 5CG8A 3KB5A 1RINA 1PO12 3M3OA 4O9GA 4JGYA 1B35C 3AMQA 4LULA 5C4WB 2OZJA 1GR3A 5T55A 3WR0A 3HWJA 4QGNA 4GH4A 1UPSA 4FQ4A 2BYVE 2R063 1IS5A 1H8TB 1QJX3 4HVQA</