2VPVA

Dimerization domain of mif2p
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
ENFALEIMFDKHKEYFASGILKLPAISGQKKLSNSFRTYITFHVIQGIVEVTVCKNKFLSVKGSTFQIPAFNEYAIANRGNDEAKMFFVQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN MIF2
publication title Structural and Functional Dissection of Mif2P, a Conserved DNA-Binding Kinetochore Protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 15
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11699 CENP-C_C Mif2/CENP-C like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vpvA00
3E5UA 2N7GA 3H8UA 3KMHA 3CEWA 4YYOA 2ET7A 3SHRA 2BYVE 1O3TA 1LR5A 5AVPA 5HI0A 4J1WA 4BH9A 4XFBA 2UYBA 4Z07A 5KHKA 1XE8A 4HN0A 3ES4A 4LTAA 4EWEA 4I0BA 4HZFA 4IEOA 3E97A 3IBMA 2IXHA 2XKPA 5KBFA 3SMHA 1XRUA 1CAXA 1UD1A 3TNQA 1RUNA 4AVCA 4CYDA 3ZDSA 3BCWA 4FBFA 1Q3EA 4I3PA 2B8MA 4META 1NZCA 4TLFA 5JSPA 1YFYA 1ZZBA 1O7FA 4E2GA 3S7IA 5LEKA 1UCXA 3HT1A 1NXMA 2EA7A 4MUVA 3D82A 1J58A 3D0JA 3RYPA 2IC1A 3I54A 3ELNA 4LLOA 3ES1A 3I7DA 1U12A 4LULA 3NKTA 2O1QA 2XL7A 3NSTA 4LEJA 4MX3A 4AQ6A 1I5ZA 5C8WA 4RD7A 2V09A 4X6RB 3SXWA 2WFPA 1VR3A 2EAAA 4IEPA 2D93A 4XFCA 3B02A 2XL9A 4OFGA 4AVBA 2D5FA 1ZRRA 3OF1A 2IXLA 2GAUA 4IERA 3S0MA 4H7LA 3IIAA 2ETEA 4PIYA 1ZZ6A 2D5HA 3OTFA 4R52A 4KWLA 1YHFA 2MNGA 1GQHA 4J1XA 2FQPA 2OZ6A 2Q4SA 3DL3A 2XLGA 4MGIE 4YRDA 3LZZA 4E2SA 4O9GA 2ET1A 3EQEA 5FLHA 3MDPA 4XETA 4PJYA 2GU9A 1ZRFA 2HJIA 2QDRA 2H0VA 1Q43A 3HQXA 4XFFA 5I93A 2Q30A 1VJ2A 5JR7B 1X8EA 2K9ZA 1Y3TA 1RTVA 2QNKA 4QGMA 1WLTA 5KHIA 4HVOA 3LAGA 1CAXB 4F8AA 4YARA 2HKXA 3VHRA 3H50A 2PFWA 3N4MA 4HSLA 3OGJA 1YUDA 4IETA 4B29A 1UIKA 5FPXA 3RZZA 1J1LA 1OD5A 3IDBB 4XF0A 1DZTA 3FFQA 5E1RA 5T3NA 3U0ZA 2BNOA 4HN1A 1ZRCA 2EVXA 1CAVA 2GC1A 3H3ZA 4E2QA 3CL1A 2MPFA 3FZ3A 5BXXA 3M3IA 4EWAA 1RL3A 3UKNA 1QY4A 4YSFA 1EP0A 2PYTA 4QMAA 4MV2A 2OA2A 4HVQA 2E9QA 1ZZ9A 3D0SA 1YFWA 3CF6E 4KWJA 2OPKA 1OMIA 1HW5A 4FAGA 1TQ5A 4Q0SA 1NE4A 3OD0A 3BU7A 1X8MA 5JCTA 3UKTA 1FI2A 5FLJA 4KU8A 4L2NA 2CAUA 1QWRA 4BIFA 4EWDA 3MZHA 3H1YA 2PHDA 3E5QA 5BY5A 5J48A 3TNPB 3EJKA 3L2HA 1UW8A 4JTOA 4LA3A 4HSJA 4R8HA 3C3VA 3E6CC 2BNNA 1RGSA 4XF1A 4D7SA 5BUVA 4ZU7A 5FPZA 1J3RA 3ROUA 3FHIB 2MHFA 4A2UA 4ONUA 4HBNA 2XLAA 2XLFA 1ZVFA 3RDIA 2I45A 1CX4A 1V70A 3FE5A 4PIXA 4D7TA 1YWKA 1NE6A 1RC6A 2CGPA 1CAVB 3CLPA 3FX3A 2PTMA 3H3UA 3NJZA 5KHHA 3H1MA 5I0TA 1ZNPA 4UBHA 1LB2A 3DKWA 3PNAA 3G7DA 4IEWA 1ZRDA 1OFNA 2KXLA 4Q0UA 4IEXA 2C0ZA 5I0RA 1YFXA 3FWEA 1EYBA 4MGYE 2ATFA 1ZZ8A 2B9UA 4XFAA 4JTNA 4L11A 2F4PA 3OCPA 2H6BA 2Q0AA 1J3QA 1LKNA 3IDCB 3PVBB 4EV0A 1SFNA 1NYWA 2QCSB 3GYDA 2PAKA 4NVPA 2Y0OA 4I02A 3RYKA 2GC2A 4BYYA 3U11A 4XFGA 2WC2A 5I0SA 3HIFA 3KGLA 1O4TA 1X82A 2CAVA 3NL1A 4IEQA 5KHJA 2IXIA 5CVRA 1RUOA 3LOIA 1Y9QA 1ZREA 2UYAA 5CU1A 1WA4A 3IWZA 3I59A 4UBGA 2XGXA 1O5UA 1QXJA 4BHPA 5I8SA 4XF4A 1ZZ7A 4O9EA 1PMIA 4FAHA 1GQGA 3WW4A 4ZU5A 2PAEA 2D40A 4XEZA 2GC0A 5BPXA 4I01A 4HLTA 4MGKE 5KHGA 4I2OA 3RNSA 3WW3A 5K8SA 4QX5A 4IEYA 3M70A 4WVZA 4IESA 1UPIA 1JUHA 5JSOA 2BEOA 3UKVA 4AXOA 4EROA 2Z2SB 1CGPA 4WZCA 2FMYA 5FDBA 3LWCA 1CAWA 1O3SA 5D1IA 5FQ0A 3PLQA 2Q1ZB 2VPVA 3E6DA 4DINB 1QXRA 2DCTA 1XE7A 3JZVA 5I8TA 3QACA 2PQQA 3H7JA 1IPJA 4HMZA 3MPBA 4Q29A 2QJVA 5LRRA 3SCFA 2H6CA 1O3QA 1ZX5A 5CADA 2OYZA 1H1IA 4WBBA 2PA7A 4XFHA 2Z69A 4AQ2A 3ST7A 1CAUA 4KWKA 3KGZA 5EZWA 3BPZA 4FT8A 1LRHA 3ACLA 1J3PA 4GULA 4AVAA 4LA2A 2ZKLA 3H1WA 5BV6A 3DV8A 4ZU4A 2IXJA 4IEZA 4F7ZA 2QVSB 2CV6A 3BALA 1WGPA 4Q0QA 2B5HA 4XF3A 3I59B 3DN7A 3O14A 4JVAA 4MZUA 3LA7A 3H9AA 4XF9A 5E16A 3E5XA 4HVRA 4Q0VA 1SQ4A 3QOPA 1DZRA 2GZWA 2OZJA 5JAXA 4QM8A 2UY8A 4XFIA 1IPKA 1L3JA 5I8YA 1Q5OA 2O8QA 1H1MA 4ORFA 1G6NA 3E6BA 2IXKA 3S7EA 2IXCA 1FXZA 3HT2A 5JSRA 4QGLA 1DGWA 4PIZA 1PM7A 4QM9A 4KL1A 1O3RA 2GC3A 2GH2A 4MH0E 2PAMA 3EBRA 3LA2A 1O5LA 1YLLA 1OI6A 1EPZA 1CAWB 3SCHA 2VQAA 1X7NA 3USSA 5FQ0B 3RYRA 4K8FA 1J59A 4QGNA 1FT9A 3BB6A 3H7YA 3SCGA 3WW1A 5LRSA 4JV4A 2BGCA 2XKOA 3KSCA 2P17A 4IEVA 3GBFA 4Z82A 3ETQA 4I09A 5FLIA 3CJXA 1CAUB 3EO6A 2BNMA 3R6SA 1YFUA 3FJSA 1EY2A 4I0AA 2ZCWA 4KU7A 5J3UA 1SEFA 4YNIA 4N9IA 4N9HA 1DGRA 4QXKA 3KCCA 5LEJA 4X6QB 5C6CA 4P9GA 4OLLA 2UY9A 4IEUA 3NVCA 3WW2A 1I6XA 1UIJA 1ZZCA 2PHLA 3LA3A 4LUKA 4Q0PA 5I0UA 3U10A 5I91A 3MYXA 4LUMA 3RPQA 5J7MA 4UXAA 1VP6A 2XHKA 3NW4A 2K0GA 3EHKA 5FCCA 5EFUA 5F1RA 3CO2A 4MGZE 2VECA
chains in the Genus database with same CATH superfamily
1NG0A 5C33A 1HQWA 5FWJA 1RXGA 4P02B 4CCKA 1UKRA 4YYOA 4PDWA 4ATEA 4CCDA 3SH5A 2ET7A 3LD8A 1OUXA 1O3TA 3FN9A 2ORZA 1VBA1 1QGLA 5F3IA 2OX0A 2BRTA 4XBQA 5CKMA 5DAPA 4RN5A 2Y38A 5CKQA 3WR0A 5F3CA 3OPTA 5ISLA 2UWCA 2WINB 1DHKB 1V6JA 3PUSA 4YZ1A 4EWEA 4BK5A 5LBEA 1V6LA 5FZCA 4HZFA 3JB8A 3ZFGB 4O61A 2ZMLA 1XRUA 1RMU1 5FY0A 5A1LA 3N36A 1COV1 1UD1A 2I74A 1QH7A 1GANA 4FPEA 3TNQA 2HWB2 4N43C 4CXWA 1DQ6A 5A7SA 5LK5A 1AL0G 4CYDA 1KITA 5FZIA 3U78A 1C1LA 3VZLA 2VNGA 3RZMA 4DY5A 2DWRA 3BCWA 1Q3EA 4I3PA 2VUAA 1I9RA 1GWMA 1WCKA 3EYPA 1L7RA 1FMD1 3JB4C 5BNPC 4JDOA 3WDYA 4E2GA 1J83A 4U2AA 1YRZA 4A4AA 4QKNA 1NXMA 1O8SA 4FOWA 4LO8A 2VMIA 2YROA 1KXGA 2JDKA 3ZXGA 1RUF2 5FZFA 4OMCA 1H2KA 4OHVA 3ELNA 3DPRC 5FJHA 4XXAA 5C7GA 3I7DA 2VOVA 4CVUA 4BQ1A 4MHUA 2WUHA 5KXDA 2WNEA 3NKTA 2HWB3 4LEJA 4L92A 2WNVA 3RZLA 1POV1 2JG8A 4BLIA 1LHWA 3VHPA 2WNUC 1QQP1 3VBSA 5HXVA 5IVBA 3VDAA 2LRPA 5LATA 4X6RB 2W46A 1SMVA 1QMJA 5FXZA 3K4AA 4NROA 5FPLA 3VD9A 4IEPA 2D93A 4XFCA 5LA1A 4IL7A 1YQ6A 5DDJ2 2OKXA 2CTVA 2VOXA 4IE4A 1JZ4A 1STMA 3OF1A 4Q2FA 4G4FA 1Z7S1 1LGCA 1IS6A 3LF7A 1KJLA 3LQCA 3S0MA 5CKNA 1RUF3 3IIAA 5JMOA 2R061 1IPSA 1MS3A 2ETEA 1IQDC 1RUI1 2VXJA 3ZYIB 1WCQA 1H4GA 1W2UA 1XNBA 3T1MA 2FZ1A 5C4WC 1UYZA 4J1XA 2FQPA 1JZ3A 3DL3A 3OB8A 3IDAA 4YRDA 4XYXA 2XUMA 4YW1A 2WWJA 3RGBA 2QE3A 2QQIA 1W05A 2P3JA 4M00A 5DDJ3 4NAMA 1AL22 2UURA 2Q30A 1V9U2 3VKFC 1NCRA 2K9ZA 1GUIA 1Y3TA 3OYWB 1GZWB 1RUH2 1W6PA 4QGMA 5F3EA 4AOCA 4HVOA 1F4AA 1IG3A 4BMBA 3GBWA 4NRQA 3VHRA 2A6VA 2JE8A 4Q4Y1 2ZHLA 1ASJ2 1UQXA 5F5QA 3OY8B 4HSLA 5FPXA 4IETA 2PELA 5ANNA 1J1LA 1OD5A 4RHV2 2EIGA 2IVJA 4AE2A 2G9FA 3IDBB 3M2MA 4AGVA 5E1RA 4A7KA 1OC1A 5T3NA 4SBVA 3HNBM 5ABJA 3T0DA 2AUYA 3PVEA 4JZRA 5IVJA 3K75B 1AL23 4AI9A 4CDQC 1UMZA 4DO0A 3IN9A 1CIYA 4E2QA 2JDNA 1LU2A 3MGUA 3WG1A 4XBNA 5K4LA 1D4M1 1QJY1 2RM22 1D0HA 4NE9A 1MS8A 5KXCA 3CZJA 3TOJA 1RB8G 1WW6A 5LBCA 3FC0A 2W47A 3ACGA 4ZS3A 3LPFA 1W0PA 1RL3A 4LOTA 2D3PA 1S0DA 3B94A 2FDGA 3USUB 3ZFEA 1EP0A 1WLDA 4BMEA 3O1VA 2PYTA 1S0EA 1W6QA 1NA1A 2XJSA 4MV2A 4RHV3 3I3MA 5A7PA 1ZZ9A 1D4VB 1H6YA 3BODA 4Q4X1 5IK7A 1L7LA 1W3XA 2OPKA 1OMIA 3ZIWA 3BIWE 1XJAA 1TQ5A 1XNCA 2VMCA 2WFF2 3OD0A 4HK8A 4IUGA 4Q0SA 3BU7A 4A6SA 4BJ0A 3RMYA 2DU1A 1WZXA 4WVMB 5A7QA 3C8XA 5FIXA 5L7OA 5FLJA 2QQUA 4XHXA 2W1SA 1PO12 5F3GA 1DDLA 3T2TA 4Q8LA 3OSDA 4L2NA 3POSA 2OPWA 1HN1A 1NY71 1S2BA 3OOXA 4YW2A 1QWRA 3WF1A 1NT0A 1IS5A 2VZ1A 5F5AA 4BIFA 1DF0A 4KI5M 2X5IC 3G6JB 1GMMA 5JOYA 3POEA 5A7WB 4QKFA 4YWAA 3OPZA 2R0HA 2XMLA 1BK1A 1DBNA 1LCLA 5BY5A 4MGSA 4GAZA 1Y9GA 5M0TA 2WFF3 2RJLA 5J48A 1MR5A 1ULFA 1H9WA 1ZBA2 1PHMA 3QH7A 4HSJA 3DXUA 3I2HA 4FPCA 4M3CA 2HH9A 4K3UA 1TG7A 4YVWA 2P37A 1PO13 3N7KA 4CU8A 3ECQA 1G86A 4OI1A 4NAOA 5IVFA 1J3RA 1IKPA 1E5HA 2WO7A 2ERFA 2MHFA 3B7MA 5J1XA 1GP6A 3BGAA 5FOJB 5C5TA 2E63A 2J1VA 1AZDA 4WM8B 5IVVA 2VGDA 4PIXA 5BNOC 1KFUL 3ENRA 1IOAA 3ACFA 4YVSB 2VCBA 1V6NA 1GR3A 3NWKA 4HPKB 2WAAA 1A6CA 5FZEA 4RS5A 2CGPA 1RUJ2 3AJZA 5JWPA 4AFMA 3H3UA 3NJZA 1ZBA3 1SLTA 3UT0A 1UYPA 2HWB1 1A78A 4AHWA 4CPBD 4UBHA 4OUMA 3ZO0B 4CXXA 2R16A 3DKWA 2WA4A 1A34A 2BVVA 1GZCA 1VB4A 5DABA 3ZSJA 1KD7A 1W2OA 1HRI2 3QBQA 3ZR5A 4IEXA 1JW6A 3CQOA 4NHYA 5FBZA 3NAPC 1VLNA 3OGGA 4INDA 2XH6A 3MIEA 4M0NA 3FWEA 2KM2A 2RS52 2ATFA 3N3HA 4JX0A 2B9UA 5T52A 2HEYF 1LHOA 4QX7A 5IT6A 1POV0 4FI9A 2VG9A 5GLZA 1MACA 2GNMA 2JB8A 4QQPA 1QHDA 5JZGA 3J7HA 2PLV2 1RUF1 5FKCA 2Y0IA 1J3QA 2CWSA 5DG1A 2JG9A 3S5AA 1RUJ3 1TZOA 3CBNA 4W6XA 5F5IA 3PVBB 2GP3A 4EV0A 4OULA 2Z4FA 4E4SA 4AYUA 2Q1MA 2VZOA 3IM0A 2QCSB 3WSOA 2SBAA 3HOBA 4D7YA 4YG6A 4U36A 2BU9A 3P3NA 3H8OA 1REFA 3LFMA 1HRI3 4DRRA 1BZWA 3WV6A 4AI1A 2WC2A 1W3VA 4GWNA 3UJQA 1PGSA 3KGLA 2CAVA 3VBHC 4IEQA 4UOJA 1OLME 2RS53 2WN2A 3I2IA 4JGYB 5DDJ1 3RJ2X 4A44A 1MS9A 5FPUA 3BN6A 5KHJA 5DAXA 5CVRA 1DQ4A 2D6OX 1WLWA 3HNMA 1S55A 3LOIA 3AJYA 3T2PA 4IGOA 2YC4A 3THTA 2XQXA 1YI9A 3IPVB 4ZXEA 1C5HA 2PLV3 1MPXA 1VAMA 1FPN2 3WXPA 2LS6A 4K9SA 1WMEA 4LO5B 3THCA 3Q8CA 4CDWB 2JEMA 3WCRA 1JODA 2CGOA 1UY2A 2BOJA 2VMDA 3LIGA 3NNLA 2XGXA 1P8JA 1OD3A 1O5UA 4FVVA 4RQPB 1QXJA 5JOZA 5JOWA 5FMCA 1WW5A 4C91A 5I8SA 3B69A 5A1FA 1SCRA 4AEMA 3D5OA 5A32B 2HEVF 2R1DA 1DQ1A 4HL0A 3RI8A 1C8M2 2ZKNA 4EQVA 3ZN4A 1AL21 4N43A 4RL7A 4YW6A 1W0OA 3ILNA 1CESA 4ZU5A 2PAEA 4EE2A 5LZ6A 4ES8A 2D40A 4X8NA 3WLUA 3BVCA 4AF9A 4HLTA 4DS0A 1WLCA 1FPN3 1FNYA 1C5IA 4Q1PA 5CFCB 3CZUA 3QLQA 3RNSA 5EWSA 5BNPA 1ASJ1 2YZ4A 4UI9L 5K8SA 2XUEA 4WVZA 2WQ8A 2ZGLA 3MF6A 1YYNA 4HONA 4RHV1 1LOCA 4CCMA 1ZM1A 1AR72 1GFF2 4RGAA 2H0BA 3WDVA 1XOYA 2X09A 1CGPA 3DPRA 3FL7A 2QZ3A 4MXWB 3H8XA 3WP3A 4CCEA 1CAWA 2GALA 1C8M3 4K20A 1QEXA 5FZMA 3PLQA 5F9TA 3SITA 2NM1A 4URTA 2WNUA 1MS5A 1JH5A 4FFGA 4DINB 5I8TA 3J26N 1IQAA 1XE7A 2VZRA 3POBA 3ZXEA 1IPJA 3DKQA 3BU0A 1C28A 3WG2A 4Q29A 2H6CA 2EIDA 5CADA 1W8FA 2OYZA 4JGZC 2V72A 1H1IA 3PVOA 4H7MA 1U5YA 5F6LB 3PL0A 4AI8A 1PZ9A 1Q8OA 1W9WA 2VXRA 4AQ2A 1AR73 1ONAA 4YM1A 5ERLA 3ACIA 3HN1A 3KGZA 4GIQA 2IVIB 4YFZA 3R4SA 3RVHA 2WZPP 3GHMA 1CVNA 1LRHA 2WFF1 4TWTA 3KCYA 1YO8A 1OOPC 1X36A 5C4WA 3AYEA 4AVAA 3ZLIA 4CCLA 4YW7A 4AFDA 1SBEA 4AVTA 5D8AB 1AVBA 2XQRA 2A75A 2R30A 2IXJA 1PO11 5C3QA 2CV6A 4QQLA 4Y4YA 4B7KA 3THDA 3ZIXA 3PJQA 4QPGB 4R4ZA 2QQLA 2JX9A 4YW5A 5A6QA 4XF3A 1OHFA 4Y1ZA 2VNRA 1SHWB 4JVAA 2ES3A 3PTYA 4MZUA 1GBGA 2A3XA 2WLPA 1BQPA 1SQ4A 4DFSA 5DZEA 1G9BA 3WF0A 2UY8A 1F31A 3RJRA 5DXDA 1UX7A 2DFCA 1BYHA 1SPPB 5FP4A 5T5PA 5JUVA 1VMJA 1YXWA 1GOFA 1H1MA 3VDCA 1N1VA 4XJUA 1ZBA1 2VBPA 3AM2A 2A3WA 2VBBA 5A3TA 4OI4A 5C71A 5JMCA 3E6BA 4EYUA 3GGLA 2IXKA 5FYZA 5LBBA 3S7EA 3PTRB 5CG8A 4IQPA 2IXCA 2JICA 3GZEA 2VZSA 3ORJA 1BLZA 4A41A 5E6HA 3VBOB 4M4RA 2HWF3 4GALA 1O3RA 2P3KA 3NV1A 1H0BA 3HEIA 3IIIA 2E33A 2GH2A 4GB32 4GJZA 4CDQA 1MQTB 4UFLA 3EBRA 3WNMA 4F83A 2ZACA 4NHXA 4CEYC 1YLLA 3RS6A 1K42A 5FYCA 1JOPA 1AF9A 2ZX2A 1RUJ1 3USSA 3AP5A 2NN8A 4CDXC 3KV5A 3VBUC 5FQ0B 2C26A 4HOOA 3NNMA 1K5MB 1TMF2 3CDZB 1ENQA 1LECA 1J59A 1GOGA 3BB6A 4IDZA 4Y22A 4JV4A 1VBB2 3KQRA 1HRI1 2ARBA 2BGCA 5AC92 1LOEA 3AMMA 5JXHA 4IE6A 4K6BA 2GNDA 3I97A 4IV1C 5FZ7A 2RS51 3HAGA 1UZVA 3KSCA 2P17A 3ASIA 3POFA 4Z82A 1WBLA 3ETQA 4XPVA 1DGRN 2NZ9A 2WL1A 2Y26A 4LPLA 2YC0A 4UW5A 1DP0A 4D6SA 2A7AA 1QJX2 1Y4WA 4H2AA 3K3OA 1AJKA 2PLV1 3AVSA 4KU7A 2EIEA 4V2WA 4YNIA 4CCJA 2VULA 4G3YC 5EHDA 1W28A 2X5IA 4N9HA 3PJYA 4QPIB 1TMF3 1US3A 3KCCA 3ZFFC 2AENA 2ZGKA 2LALA 4X6QB 3WNOA 2R1BA 3A0NA 2NQYA 2W52A 1VBB3 1CN1A 3LDRA 5AC93 3VZMA 1YEWA 2KA3A 5DQ0A 4K1YA 5K9YA 4LUKA 4S2GA 4BISA 5I91A 5IJRA 1E5IA 1JOJA 5J7MA 1JZ8A 1QJX3 1ENSA 2K0GA 2E6VA 3VB9A 4XUOA 3AKQA 4NWVA 3EHKA 4GWIA 5EFUA 2VL4A 5FPAA 4DEVA 4XAAA 1FPN1 1VMFA 1RJ7A 1EV12 1H8TC 1UKGA 2XWBB 1FYUA 5F1RA 2VECA 1AX0A 3ALQA 2RR12 1OQDA 4BQYA 5BNOA 5F8PA 3E5UA 3ZKYA 2N7GA 3H8UA 3VKNA 3DCQA 3LEKA 1MS0A 3CEWA 3WF3A 1SDWA 1W8NA 3GHNA 2BYVE 4UWDA 2LW8A 4KNCA 4P9IA 2A73B 1GP4A 1RVF3 1RMU3 1VMHA 1C8M1 3JUUA 4Z07A 5KHKA 4DXRA 2VZTA 4BXFA 1JYNA 5J09A 4I0BA 5T5LA 4IEOA 5FZGA 5KBFA 3AB0A 2WQZC 3OGSA 5IVYA 1JHJA 3SMHA 1CAXA 3FUQA 4TYSA 3O1TA 4ZONA 1RUNA 3WDXA 2RR13 2C4XA 1QJZA 2NMOA 4RR3C 2F17A 3SQOA 2YXSA 3ZDSA 1JN2P 1AYM2 4FOVA 3KVBA 1AR71 1O59A 2JD9A 2ID4A 4FBFA 2YBSA 4C0BA 2PXJA 3KV9A 1HDKA 2OUHA 3HQUA 3RQ0A 1ZZBA 5LEKA 1YIFA 4LBQB 2VVDA 3PU3A 3HT1A 4PF5A 1WA6X 1IGOA 4MUVA 1CJDA 2YGMA 3UL2A 2AACA 2YB7A 3W59A 3RYPA 2HBUA 4NWWA 2ZXQA 3D8CA 3I54A 4TLGA 4WV8A 4M0HA 3VBHA 1W6NB 2XR4A 3ES1A 1PZ7A 3DECA 3WQ0A 4WM7C 4YG0A 4AEDC 1U12A 2C6SA 3V0AA 2DFBA 4BQ3A 2VY0A 1DG6A 1AR92 2A70A 2O1QA 4FXKB 4XJZA 5FUIA 5A6ZA 3GF6A 1GYKA 1VBD2 2BDRA 2HBTA 5C8WA 4AI3A 5FZ4A 3AMHA 3TAYA 4RD7A 2V09A 2R073 3SXWA 4V1PA 5GZCA 3ZSEA 4DPNA 3KWVA 2RHPA 1CPMA 2XJPA 2R042 1R092 3OPWA 4EZHA 5CA6A 2EXHA 2XL9A 4LNVA 2ZHMA 2QQNA 1KS5A 4KG0A 1SLAA 4AVBA 1LOFC 3BOWA 3M8LA 2IXLA 3POYA 3VD4A 3WOGA 5K0UC 2D6NA 5HCAA 2Y6FA 4H7LA 4XCBA 3DUIA 3AKPA 1GU3A 4PIYA 1PX4A 1ZZ6A 2D5HA 2ZGUA 5T5JA 4AI0A 4DUXA 1ST8A 2HWF1 1D0GA 4XVHA 1AXKA 1NA1B 1GQHA 1DFQA 1V6IA 2J1UA 4ITCA 1AR93 2GH8A 2OZ6A 4CXYA 4DXTA 2XLGA 4D3WA 3POWA 1VBD3 2AH2A 3ILRA 3OBZA 5LB6A 5KC5A 4A7YA 1LU1A 2CWMA 1F35A 1JMUB 2GU9A 2PHWA 1A8DA 1Q8SA 4HG6B 2HJIA 3MLKA 2DCYA 3IAPA 4RGGA 4CEWB 2QDRA 3AP7A 1Q43A 1R093 1R082 2B42B 4XFFA 1T2XA 3N7MA 5FYMA 5I93A 3ZSLA 3D6EA 1BMV2 1DQ2A 5JR7B 1NXD1 1QJU3 1SLBA 2QNKA 1ULGA 2Q5TA 5KHIA 3M1HA 5F2WA 4F8AA 3V0BB 1H6XA 3ZXAC 5CNAA 2UWAA 1Y7BA 2WRAA 5GM0A 1PGL2 4QB2A 1F5FA 3H50A 4FPJA 4KWUA 3N4MA 1CZSA 1S0IA 3GZAA 3PU8A 4QPYA 3OGJA 2G4IA 5H9QA 3ZN6B 1UIKA 4JCKA 3ZXKA 5JPNB 2YV8A 2A1XA 1DZTA 4YM3A 3FFQA 4YGCA 4YW4A 3FBYA 1UAIA 5FO7B 1VBE2 1VAVA 4A42A 1ZRCA 2CHHA 2UU8A 5DAVA 5GLUA 3WD5A 4M3CB 5FZHA 2C9AA 2J1AA 2RDNA 3WNKA 1ENRA 3B9CA 4FSJA 1H1AA 1JTZX 1MVEA 4JGZA 4YVWB 1TMF1 3ZOIA 1IS4A 5FXWA 1OQ1A 5KXEA 3AC0A 4LIVA 1S2KA 2Z42A 4MHRA 1R64A 4NHMA 1VBB1 4FTSA 5AC91 4UW6A 3AL6A 3MLJA 2MPFA 3FZ3A 2VNOA 5GZFA 5BXXA 3ZFGC 3M3IA 4AL9A 5HCHA 3F2ZA 3L9JT 1DU3D 1OOPA 2QQMA 1SBDA 3ZX7A 4EWAA 3M3QA 1K5JA 4YSFA 4MOAA 1VPHA 5A7OA 4CE8A 3AVRA 4CP2A 1UY4A 3HVDA 3AP6A 4HVQA 4MGQA 1W2NA 2E9QA 3D0SA 1QJX1 1YFWA 1ZA7A 3GDBA 2BQPA 4RFRB 5HV4A 2VUCA 1VBE3 4FAGA 2J22A 2OIIA 4JQTA 2WT2A 5IVEA 1LAJA 3VZKA 4BCUA 3FHQA 2W68A 4UFHA 3UETA 1FI2A 2QTWB 4XDOA 3POJA 1E5RA 1XU2A 2NYYA 3UGHA 5C3SA 3PHMA 1H9PA 2YBKA 4KU8A 1JYIA 2ZHKA 2DVFA 4CP9B 1RVF1 4A45A 5C5UA 1JXNA 5EXOA 4S2HA 2CYFA 5EP9A 1RINA 2A5ZA 2W39A 4A3ZA 2PHDA 4FFHA 4UFKA 2WNOA 1GSLA 2ZEYA 5C8CB 1S0CA 4E27A 2XVGA 3EJKA 3PIGA 2E51A 1UW8A 2EF6A 5FZOB 3ACHA 3MPPG 1HJGA 2RR11 2GSYA 3OBAA 3RZHA 1XSQA 4JKLA 3VZNA 4P9JA 3HN3A 5E89A 5TSWA 4XF1A 2BZDA 5FPZA 2K46A 3U1XA 3CHXA 1LHVA 3FHIB 5F39A 3VKMA 1QU0A 4CDXA 1OF4A 2AC1A 2ZGMA 4LO4B 1CPNA 2XLFA 4B7EA 3BUCA 1GNYA 4BM8A 3U14A 3UGGA 4D7TA 4TN7A 4XMIA 4EN6B 4COUA 5B4NA 4LE4A 4AGGA 3OGRA 1NE6A 3RG0A 1GNHA 1K45A 1CAVB 3CLPA 3J7LA 3WEZA 4IV1A 5CIRA 1HB2A 1W9SA 2J1SA 4GWJA 1UN1A 2ARCA 3DYOA 3SISA 4LT5A 1V6OA 1PX3A 4PLOA 4LHLA 2KXLA 4QX0A 5FUNA 2R071 1UOGA 5I0RA 4XAEA 2XJVA 1O8PA 1OH3A 1YNAA 2WDBA 3H8RA 4PI0A 1QJEA 5FP7A 3VD5A 2VTFA 4LHNA 4XFAA 3BOPA 3R05A 4IV3A 4JTNA 4LITA 4RA0A 3DYMA 3ZFFA 1URXA 3TEZA 2BFUL 4ZY9A 5IAVA 2F4PA 4XDQA 4DNYA 3MW2A 3OCPA 3LFIA 3OJBA 4IE0A 3WINE 4NIAA 1W9TA 4R9BA 1AUYA 5CB7A 4AI2A 4UFIA 4AGRA 1SFYA 3S5QA 4DIQA 3URFA 3SKVA 2MEV2 4FO9A 3A0KA 4XQWA 1NYWA 1AR91 3U37A 5EYYA 1RUG2 1HQLA 3KV4A 4PLNA 3RRDA 2Y33A 1VBD1 1W2TA 2Y0OA 4AZZA 4CUBA 2ZX0A 2BBVA 2ZX4A 4BYYA 3F95A 3U11A 5JPMB 1B35B 5FMOS 5I0SA 3FLTA 4D94A 1H8TA 3R4UA 2IXIA 2OQ6A 1R091 2R041 4N8MA 5LA2A 4BU2A 3LSDA 4OHXA 1RUOA 4FP2A 1R1A2 2QKDA 5FO9B 1GWKA 1W6OB 1QJU1 4KGQA 1Y9QA 4E4DX 4AAPA 3JU9A 3LDBA 1ULDA 1OF3A 2DCJA 3LKJA 3OUIA 2X05A 3UNPA 1ZREA 3ZXLA 2JE7A 1HB4A 1PZ8A 1VIWB 4UW3A 2Q8CA 1UU5A 4UFJA 4W6YA 5DUUA 2MEV3 3AKSA 4CPBA 1RUG3 3FFZA 1V9U3 2V4VA 3ZYHA 3IDEA 1B09A 1UO9A 4O9EA 3VUOA 1RUH3 5C4WB 1SZBA 1PMIA 1HB1A 3J7MA 3FLRA 4LKFA 1ACCA 3WP6A 1ASJ3 1TEIA 3I2JA 2IFRA 5LASA 4BQ2A 4RR3A 4ASKA 1H2MA 3A21A 4AFAA 1GQGA 1R1A3 4GZ9A 3T4VA 1BK0A 3ZXFA 1BMV1 4Y20B 4A6OA 1VAKA 2GC0A 3MIBA 4ZXKA 4CA9A 3NJYA 4GH4B 4I2OA 1AX2A 2F4LA 2BP6A 2XOMA 2XDVA 2Y6HA 1JZ7A 3Q8AA 3NNGA 3IMMA 2LM3A 1JUHA 4JAAA 4E9KA 5L9RA 3VDDB 5FXVA 3SEEA 2VOKA 2FCTA 5A70A 1YJLA 2BEOA 5FYHA 2RM23 1VBE1 4D0QA 2FMYA 1UX6A 2B45X 2WLQA 3LWCA 4AEDA 4WM7A 1VRBA 3AMPA 3VBRA 3GALA 1FAYA 1KEXA 4XHBA 4NRMA 2FDHA 1J1TA 2IUWA 4Z2AA 2YPJA 4WM8C 2RJKA 3O12A 2PHTA 4IGQA 4JC1A 1HX6A 5A80A 4CRQA 2DCTA 2GMPA 1HXS2 4YVSC 3SEPA 2GMEA 4DB5A 2JIGA 4HMZA 2JDUA 4EJRA 4XBLA 1RIRA 1UMHA 1MZ5A 1W9YA 1O3QA 1ZX5A 3N9LA 3N9OA 2PA7A 4GA9A 1YCIA 1QH6A 1ND3B 2VJXA 4ZZ5A 1H4HA 5K0UA 3S30A 4HT1T 5EZWA 1BBT2 4AK3A 3KZ4C 2ADDA 1A8MA 1I1EA 3ACLA 4PBPA 2HWC2 2VR4A 3IZOA 4IGPA 1UY0A 4TSVA 1TVGA 1AJOA 4HK9A 4LA2A 4OI0A 4ZZ8A 1C57A 2VW1A 3EMRA 1UYXA 4YZ2A 1V00A 1GP5A 5HV0A 2VMEA 1HXS3 4AEJA 1OXCA 1ND2B 3D3AA 4YLZA 2HWD2 1AXZA 1PO22 3ZPOA 1JZ2A 3APBA 5HXMA 2BW8A 4GJYA 3I59B 3DN7A 3VHOA 1QNWA 1XSRA 2EAKA 3GZTB 4OQ8A 3R4DB 4HVRA 3RSJA 4P08A 5GLVA 3ZN5A 1DZRA 3BTZA 3A4UA 2OZJA 5JAXA 4XUNA 2I07B 1PNGA 1BBT3 1Q5OA 2O8QA 4AVSA 4AFBA 2HWC3 1U5XA 3T08A 1ULCA 1DGWX 5DZFA 1OLQA 3JD72 1JI6A 1EAH2 1MS1A 4JGYC 4BWOA 3NMBA 1HV1A 3V64A 1LEDA 1W6MB 3PDQA 4QAWA 5JSRA 5CFDB 3ZM8A 2HWD3 1PO23 5A33B 1YI7A 3ZSKA 3M3CA 1UWWA 2HWE2 3JBG2 3AMQA 2W2IA 4MH0E 2PAMA 2XONA 2Y8KA 2EIBA 3IT8A 4CDWC 1L7QA 1N1YA 4CU9A 1UOFA 2WKKA 1O5LA 3MUZ1 4RQPC 2PHUA 1LODA 1N3QA 5DMYA 3I3BA 4LBJA 3ZFGA 2ZAAA 3ON7A 2VQAA 1X7NA 2A6XA 1X9TA 3THPA 4CP0A 2WSVA 3O1OA 2R32A 3JD73 5F32A 1EAH3 1TNFA 2BTVC 2YY1A 3KCXA 3SCGA 3LGRA 5BNNB 4NOTA 4YGEA 1S0JA 1PK6B 1OT5A 1C8NA 3WZ1A 1C1FA 3QCWA 3SC7X 1W39A 4UAPA 5HBAA 1DYOA 2HWE3 3JBG3 4H3WA 4COVA 2JD4A 3TN92 3J4UH 5CFCC 4I09A 1NCQB 5DUVA 5FLIA 5LK7B 1UZYA 1CAUB 3D4KA 1AXYA 3EO6A 1UMIA 5FZ8A 4I0AA 2R7EB 3MV11 4OZOA 5A3OA 1SEFA 1SBFA 2ZX3A 1H2LA 2YFZA 4QU1A 5L9VA 4RGKA 1NLSA 2MEV1 2WZ8A 3AKTA 4UT5A 2RDSA 4HFSA 4YM0A 4CTEA 4MLOA 1RUG1 2OQ7A 3BTAA 1V9U1 4C8DA 2YPDA 4O65A 1EUUA 3PUIA 4R9DA 1RUH1 2GDFA 2QQPA 3BTXA 2DYCA 3CJIB 3LEGA 2ZMNA 4YPJA 2VVEA 2VU9A 2W1QA 1UIJA 3LA3A 3TN93 1S0FA 5A3UA 3A22A 3MYXA 3RPQA 2HLEA 2TBVA 1R1A1 2XHKA 3VBFC 3I2DA 3NW4A 2G1MA 2W95A 3BI3A 1LENA 1OUSA 1YQCA 3R0RA 4Y1UA 5K7PA 3V0AB 4CDUB 2P1BA 4BOWA 3CO2A 4Q5OA 5FYSA 1UXXX 4KH9A 1BHGA 4JKKA 4OI2A 4CCCA 3OBTA 4OMDA 4PBOA 5D8AC 2VTXJ 4BXSV 2BERA 1C3HA 3SHRA 4QKBA 3WNLA 3TEWA 5AVPA 2CY6A 2RM21 2W94A 3N9NA 4GKYA 4UF0B 5HI0A 4J1WA 4XFBA 2NMNA 4KBBA 4QB6A 2W91A 4Y3OA 5F7UA 3KHBA 4PQQA 4QPGC 3UGFA 1NLQA 1QIQA 1WKYA 4OQ9A 2YU1A 2GP5A 4HN0A 4LTAA 1OPMA 4LK6A 3IBMA 3OYWA 2A71A 5J96B 1F8VA 2GN3A 1AR82 4I30A 1ZRIA 3INAA 4DUVA 4AAXA 4XJAA 4AVCA 1CR7A 2NPIA 2W0XA 1SLCA 3OY8A 3VLBB 1UZWA 2TNFA 5A6YA 3H0OA 1V6KA 2A6WA 1HLCA 2O0OA 2PMWB 4OCTA 1PVC2 1OKOA 4META 1NZCA 5LW9A 5JSPA 4KG8A 4BA6A 2FBEA 3MICA 3ETPA 3O7OA 3VBOC 4DXZA 1O7FA 1HJFA 5A6XA 5IVCA 3O1SA 4FPOB 5FZAA 1S1AA 1CWPA 2ZOEB 3K4ZA 2VUDA 3D82A 1MQTC 2BVBA 1J58A 1HXS1 4FFFA 5JXGA 3D0JA 2FDIA 2WBKA 4BK4A 2IC1A 2IFWA 1AR83 2ZHNA 4BQXA 1V0AA 4LLOA 2C1FA 4LULA 1REDA 2XVKA 3NSTA 3MV01 2AYHA 4MX3A 4AQ6A 4TTGA 1I5ZA 1K5MC 1W8HA 4IE5A 3USUA 4LE3A 3J8F2 4QQOA 2V73A 1BBT1 2JXAA 1VR3A 2WFPA 1N3OA 1EUTA 1PVC3 1Q8VA 4JGZB 2AEZA 5FYTA 4BQ5A 2W9XA 2HWC1 2JE9A 5C9AB 1H2NA 3B02A 1KQRA 2J1RA 2ZGSA 4JRAA 2YDEA 2ZS6B 4OFGA 2BUKA 2D5FA 4WVMA 5F2SA 1ZRRA 3TRSB 2GAUA 2QQWA 4IERA 5FYYA 2ARXA 4E4ZA 3WNNA 4MGTA 1JYTA 2HWD1 4N53B 1PO21 4JDMA 1W8UA 1KS4A 1UY1A 1ZA4A 3OTFA 4Q4V2 4R52A 3ZMOA 1YHFA 2FMDA 2AEYA 5A3PA 2D7FA 1RHI2 5T54A 1OLMA 4LHKA 4S2FA 4YZ3A 4PDWB 2RS32 3HNYM 4QPIC 3LZZA 2Y60A 1W90A 2ET1A 1CONA 3J8F3 3EQEA 2Q8DA 2VVFA 3MDPA 1MVQA 2J1TA 4XETA 5A7WA 5IFPA 2ILMA 1OFSA 2IZWA 2QFEA 2ZJCA 5HPOA 1NKGA 4XZUG 1KFXL 4XE9A 2HYXA 3FMGA 4AWDA 1ULPA 5DZGA 5L73A 5FAXA 2C9KA 2VMFA 3JD71 2DF7A 1EAH1 4GB33 3ZYBA 4B4RA 4G9SB 1JBCA 3H3LA 2FDFA 2XBO2 1BCXA 3T1LA 3LAGA 2VD7A 1CX1A 1DIWA 4Q4V3 1IZ3A 3ZYGA 2W3JA 5ACA2 3I3DA 2PFWA 4J6GA 2HWE1 2BFUS 3JBG1 3Q9OA 4W50A 1RHI3 1WMXA 2L9LA 3M7AA 1JU3A 1WD4A 1YUDA 2RS33 4GD4A 4WM8A 4Y5SA 4FTBA 1N1TA 1XQNA 1QJFA 2OUJA 2Q1FA 4YVSA 1LEMA 3AP4A 4BIOA 5FKBA 2RVAA 4HN1A 3KS7A 2EVXA 4ZPIA 1GNZA 1OH4A 3X29B 1OLRA 3WX5A 2GC1A 2WZR2 3N9MA 2Y6JA 3H3ZA 1YQ8A 3CL1A 4PHZA 3Q8FA 4PLMA 2XBO3 4JKMA 3W20A 1BKZA 3ZSMA 5IW0A 1QNYA 1X33A 1D7PM 1XU1A 2E53A 4XIKA 3NNFA 1LOGA 3T2OA 2TUNA 2V4AA 2WNVB 1LOBA 4AQSA 2JG8B 1QY4A 5ACA3 2XJTA 2CU5A 4QQ2A 3TN91 3VBSB 4ASLA 5H9RA 4QMAA 2OA2A 1NAEA 3HBZA 5I0DA 1BXHA 3LEMA 1JYCA 1WW7A 3WG3A 3CF6E 4XCAA 1AHSA 1GLHA 1K3IA 1NE4A 1Z0HA 1COV2 3OD4A 2P3YA 5JDBA 4LKEA 1X8MA 2G9GA 4LR4A 4XQ4A 3SLIA 5A7NA 2WZR3 2PHRA 3P1IA 3UKTA 2FD8A 2OXBA 5JI7A 2DV9A 4CUGA 3PIJA 4COYA 3KT1A 2C24A 2B46X 4AW7A 3NAPA 4IV3B 1S0BA 1HB3A 2WR9A 1I5PA 5LY1A 4IE7A 5LY2A 2VW0A 1EV13 1GZTA 3MZHA 4ARYA 4CP1A 1F4HA 4QT6A 3VDBA 4JGYA 4XURA 3H1YA 4GQ7A 3N9QA 3VN4A 4MADA 2XWJB 5FZ3A 4QX3A 3AYAA 3E5QA 2WO1A 3IPVA 4JHTA 5HCFA 3KVAA 1MEC2 3GCXA 4XZPA 2Z5WA 3K2OA 4LA3A 4COWA 5DPNA 4R8HA 1FATA 1NCRB 3C3VA 5GALA 4CDWA 1QQP2 4LLFA 3E6CC 5CG9A 1DZQA 1W6PB 2D6MA 3NRUA 4FCAA 4RQPA 1RGSA 1R1ZA 2ZAHA 4QXCA 3LEIA 2EXIA 4ZU7A 1NQJA 3K46A 3ROUA 4BDVB 5D2AA 4A2UA 2RG4A 3SNMA 4LKSA 4E4HA 2KD7A 2XLAA 5A32A 5A3LA 4DRVA 2I45A 1V70A 2JDPA 3FE5A 3GBGA 1NA1C 1YWKA 3T3YA 3W5NA 4NIGA 2YBPA 1RUD2 3WDUA 1AYM3 1ULEA 2TEPA 2CL2A 2VZQA 5ABJB 4MG2A 5DAWA 3FX3A 1AR81 1HV0A 4QX8A 1MEC3 1RYYA 2DVGA 3IMNA 3KF5A 5CFCA 5I0TA 4ET7A 4CEWC 2DU0A 2P2KA 3KT7A 2Q8EA 4URAA 1LB2A 4CCOA 4B1LA 3G7DA 4IEWA 1QXPA 4W4ZA 4DUWA 3I3EA 4Q0UA 3O1RA 2C0ZA 2DCKA 1PVC1 3NO8A 4Z92B 1YFXA 2ZBJA 3ZFEB 1PIV2 2NLRA 4MXWA 4MGYE 3C7HA 4Q26A 4QDQA 1W6QB 4QHBA 5LA9A 3ZMNA 3O1MA 2BOIA 4L11A 3JXSA 3KF3A 2B9VA 4AHYA 2O8OA 4NIDA 1RUD3 3A7QA 4UW4A 5FWEA 1WMDA 4BPZA 2WIIB 1XE0A 5D21A 5FP9A 5L7OB 2WN3A 4EZ4A 2CSGA 2R043 1SFNA 3TEYA 4P9WA 4YVWC 2VZPA 3GYDA 2PAKA 3J8F1 3LE0A 3VBFA 4I02A 2GC2A 2JDMA 5SV5A 3VBRB 5FOBB 4XFGA 4DEQA 1XBFA 2F6BA 2YFUA 2WWSA 1PIV3 4NRPA 3KLSA 1XYNA 3V56A 3TB0A 1SLIA 4GB31 3OEAA 1VRH2 4CUAA 5D8AA 4LKDA 2JWPA 3U4SA 2GNTA 3DF0A 5CZKA 4QKDA 4Q4V1 2FDKA 2QQOA 3JQWA 4UYBA 5JXIA 4HKLA 1RHI1 1WD3A 1R083 4UBGA 4XUTA 4Y24A 1CZTA 2RS31 3NV4A 1OSGA 4NPRA 4Q4X2 4SLIA 5C3OA 3ILFA 4HXCA 4S2DA 3T0AA 5JOXA 4BHPA 1FV2A 1RITA 5A3WA 1QDOA 1TME2 5F37A 4NJ4A 2JKXA 5IYYA 1SPPA 1SDDB 2JECA 3MUY1 4KGGA 3RWKX 4FAHA 2GMMA 4M01A 4PF1A 4XIOA 5ANQA 3ZYFA 3ZYJB 1W8OA 3WW4A 5L36A 4X8PA 1VRH3 4YM2A 4PT6A 1LGBA 3POIA 4RS5B 5FXXA 5J37A 2VAUA 2XBO1 1NY72 4XEZA 3WNXA 5BPXA 4I01A 1LNSA 4MGKE 5LBFA 5C8CC 5KHGA 3MW4A 1Q8PA 3K51A 3L2YA 3VL8A 3W9AA 3WW3A 3VBOA 5ACA1 4QX5A 1NOVA 4IEYA 4IW3A 1RXFA 1XNDA 3M70A 3NQHA 1UPIA 4IESA 4XW3A 4LMFA 1S0GA 5FYIA 3Q8BA 1MQTA 3U4XA 4FPFA 1Q56A 5B2GB 1OPOA 4EROA 4AXOA 2OW4A 2Z2SB 3ZYPA 1TME3 3VD3A 1CQ9A 1QOTA 3WUCA 5FDBA 2FDJA 4AG4A 1SFPA 2R0FA 3AYCA 5D1IA 2WZR1 5FQ0A 1O3SA 3ZPYA 2Q1ZB 1K5MA 3LPGA 2GN7A 2P34A 4EN9B 2D44A 2VPVA 3E6DA 3N9PA 2XG3A 3JZVA 3HMYA 5C70A 1UXZA 5JZGB 2JG9B 4NUBA 3QACA 2PQQA 4AFCA 4C90A 3LOBA 1JZ6A 3BKZA 4RFT0 2RDQA 4XTMA 3VL9A 2W08A 1DYKA 5A1AA 3AZXA 1WW4A 2ADEA 2LTNA 1JUIA 5FY4A 5GKAC 3WY6A 4XJ8A 1EV11 4WBBA 2J7MA 5A3NA 2VMGA 4UFMA 3AXEA 4XFHA 2E31A 4B3NA 2QZ2A 5FZ6A 2B39A 3ST7A 2HEWF 4FOQA 4CCNA 4KWKA 5LWBA 4CEYA 2D3RA 4LBKA 2W87A 5JXJA 2W1WA 3SH3A 1G9DA 1J3PA 2WT1A 3VBUA 2JDZA 2WO2A 2OT7A 2YUEA 2ZKLA 2W92A 4QPIA 3DV8A 5BV6A 4J25A 4C1WA 4IEZA 1LOAA 4B4QA 1E57A 1UZZA 3Q8EA 4F7ZA 1RUC2 1WGPA 4Q0QA 4Y26A 2P3IA 5FBJA 4CU7A 1YJKA 4GMP3 2YU2A 4M3CE 3O14A 4XUQA 5FREA 5GZGA 3LA7A 5E16A 4XF9A 3E5XA 4R4XA 3AKRA 5F5CA 4Q0VA 3WNPA 5EYXA 3O0WA 4K7JA 2VQ0A 3T0BA 1ODNA 2R49A 4XFIA 1AYM1 2PN5A 3FLPA 1IKQA 1FOD2 5I8YA 4LQRA 5BNQA 4FTEA 5LCWL 4FPGA 3SH4A 1MEC1 4N43B 1US2A 1B35C 3H42B 3J7NA 4ORFA 1HRV2 3FHAA 2BGPA 2AZ5A 3BIEA 2BGOA 2ZA9A 4XDPA 3K48A 1FXZA 1D2SA 2VTXA 3M3EA 5E8AA 3DEMA 3WQ7A 1RUC3 4QGLA 3ZXDA 2QQKA 1DGWA 4OZXA 5BNPB 4PIZA 5CYYA 1GZ9A 1PM7A 3QH6A 1WCDJ 4I0WB 1PMJX 4QM9A 4KL1A 4HKWA 3V65A 5JI9A 4FFIA 2DURA 2VQUA 3N35A 4QDRA 2FHRA 1PNFA 3WHTA 3LA2A 1WUVA 3HWJA 3TEXA 3ZYRA 3ZKUA 5F6KA 3ITQA 4CUCA 1RUD1 2OS2A 3DPRB 3IKWA 4W8JA 5L19A 1OI6A 2EXJA 1FOD3 1CAWB 3B00A 3MO4A 5FJKA 5IAXA 3OGVA 3SCHA 2ZTNA 3RYRA 2P5BA 1XNKA 1HRV3 2DUPA 2WNUB 1W0NA 2BPA2 3MI8A 4K8FA 1FT9A 2ZABA 5LRSA 4AQTA 3SKJE 3HQRA 1OKQA 4MVTA 4PQ9A 4A7ZA 3AL5A 1LGNA 2XKOA 5KWRA 2WWUA 2XXZA 4GH4C 3IAQA 1KJRA 1PIV1 2FCVA 1ZYBA 4NN0A 3RMXA 2VQTA 1LESA 2ZZJA 1QDCA 3CJXA 4BQWA 2E7QA 3C2UA 4LBNA 5IHRA 4LBQA 4QHZA 3MIGA 2JJ6A 5J36A 2DTYA 1OVSA 3R6SA 3FJSA 1EY2A 1DCSA 3VDDC 1FNZA 4K40A 2XJUA 1NQDA 3B3QE 2AGSA 1G9FA 1W6NA 4P9XA 2V5YA 5FYBA 2G19A 3O5SA 1R081 2BWCA 5LEJA 2JDYA 2D97A 5FP3A 3UK9A 3NNJA 4GWMA 3MW3A 1UF2C 4XC9A 3PURA 3OUJA 4LIUA 4HETA 3NVCA 4E8DA 3RWNA 3WW2A 1PGL1 1AX1A 4H55A 2PHLA 1ALYA 4Q0PA 4LUMA 1F9KA 1BVP1 1VRH1 2W1UA 4Y33A 4DZGA 4N53A 1ND3C 2EICA 3PUAA 3ZDVA 3KQ4B 1QOSA 3AK0A 1W8WA 2GNBA 2C5DA 4XTPA 4MGZE 3NJVA 3KMHA 3C7FA 2RMU2 4XJWA 5CISA 1C4RA 1ODMA 5FZ9A 4ARXA 4AHZA 3B9IA 1LR5A 4WVVA 1TME1 2VM9A 1ND2C 3AFGA 4BH9A 4FPYA 2UYBA 4CDQB 3I2KA 1U5IA 4JRLA 4QXBA 5FZ0A 3AFKA 1POQA 3FBMA 1DGLA 3WT3A 4CEWA 3CKHA 1XE8A 2RJ2A 4YW3A 1OBNA 2X29A 4O7XA 3JCIA 3WG4A 1W03A 5IATA 1LOFA 3ES4A 3OG2A 3MEPA 2RS12 3E97A 2IXHA 2XKPA 3MFCA 2BJSA 5FPBA 3BTYA 3GJAA 1NX9A 2Y6GA 4W65A 4AEKA 3V0BA 3PMSA 1VB2A 2UWBA 4D6QA 4IXLA 3AX4A 4NHKA 2JB4A 1E5SA 4Y22B 5SV8A 1UZ0A 2D6LX 2RMU3 3ZN6A 3DXTA 1TNRA 4XUPA 2V5DA 2WJSA 1DYPA 4B1MA 4M3CF 3M3OA 2FCUA 4Q4W2 4XILA 2B8MA 3I2OA 5DUXA 4TLFA 5EJ1B 1A3KA 1J84A 5CFDC 1YFYA 3O0XA 4V2VA 5FY5A 3LDKA 3UYJA 4DY3A 5IK4A 3AYDA 1XNTA 3S7IA 1UCXA 1W2AX 4COZA 2EA7A 3NV3A 5AVAA 3OUHA 4QXHA 4P5HA 2X8KA 2RS13 4LBQD 3PUHA 4OUEA 3B01A 1W9FA 2X5IB 3M4FA 2PQSA 4GMP1 3EB7A 5FMBA 3BPSA 5LA0A 5EPAA 4JHZA 4H14A 5FTTC 2XL7A 3KV6A 2Y6KA 1BVVA 4NPMA 1JZ5A 2XB6C 2ZEWA 1M4WA 5FY1A 4Q4W3 2EAAA 4LJHA 1BJQA 5BNNC 4DOUA 4NIHA 4XACA 4AR2A 1PK6C 2VOTA 2ZGTA 1QF3A 2E32A 4D6RA 3WDTA 3MIFA 4OHYA 1S2EA 4P9LA 3W21A 4QB1A 1OA3A 5FYUA 1NCQC 5BYNA 4E8CA 2DDUA 3CIHA 1H30A 3K4DA 2Y6LA 1RUC1 2ZZQA 1FX5A 2Q8OA 1IS3A 5GZDA 4I3GA 1CD3G 2KR2A 1K12A 4KWLA 3C7OA 2MNGA 1YQ2A 3JQXA 5EV7A 3VV1A 1APNA 3N7LA 4CP9A 2RV9A 4L0PA 2Q4SA 3LB9A 4ISRA 4MGIE 1Q8QA 4C0HA 2ZEZA 4E2SA 4O9GA 2D6KA 2YC2A 3MLLA 3S57A 5FLHA 5C8CA 3KB5A 4PJYA 1FOD1 1GV9A 1GWLA 1WCSA 1ZRFA 3IB3A 5APAA 2H0VA 1SLLA 2EXKA 5JR2A 3HR9A 1OQEA 3CJIC 1HRV1 3HQXA 3PVNA 4QPWA 4YZ5A 5AFBA 4L99A 5EIYB 5FZOA 2B4KA 1VJ2A 1X8EA 1T6GC 3UJOA 3WCSA 4CU6A 3NAPB 1RTVA 4LHSA 1WLTA 2OVUA 3B5LB 4OUSA 1CAXB 1MZEA 1CZVA 5JIUA 5KC6A 4YARA 1H8VA 2HKXA 2DVBA 2JENA 4N7IA 2WT0A 2VCAA 4CDUC 3T2QA 5C3PA 4B29A 4C1XA 3RZZA 4D69A 2VUJA 2VCCA 4ZHNA 1Y43B 4KMQA 1VBC2 3AP9A 4QX2A 4XF0A 4K1ZA 1G8WA 1T6BX 3KT4A 3OEBA 5B4XA 3AZWA 3KD4A 3VGIA 3U0ZA 2BNOA 4Z1VA 4F3JA 5FUPA 1CAVA 2WO3A 4Y1XA 2BWAA 2DVAA 3GM8A 1DLLA 4OHZA 1MZFA 2LUWA 3MBWA 2JKBA 5JLVA 1AYN2 3VBHB 4PI2A 3HJRA 4Y4RA 3J9SA 4P9YA 2VZUA 2WA3A 3UKNA 1W04A 1X50A 4N7UA 1WWYA 4MYEA 4P5YA 5C3RA 2XPJA 1JHNA 1OVPA 1JYXA 2YYOA 2Z79A 5FZDA 1RJ8A 1VBC3 4KWJA 4W6WA 2WAOA 1HW5A 1YQ5A 3I3QA 2LROA 3ZR6A 2FZ2A 3AZZA 1MS4A 4NMIA 5JCTA 1IHMA 3LCPA 1XB9A 5JIAA 4P00B 1SACA 2ZGRA 2JDAA 3ATGA 4YZ4A 2A3YA 1AYN3 1OA4A 2CAUA 5H9PA 2WYSA 4NIIA 1GZWA 4LBLA 2EALA 2W5FA 4EWDA 1B35A 3ZXJA 1D2QA 1O6UA 4B8EA 1REEA 3CU7A 1JYVA 3AZYA 1XYOA 3O1PA 5AFEA 4K21A 5H9SA 1W6OA 2P6CA 3TNPB 3POGA 3L2HA 4JTOA 2CDPA 4BB3A 2WS92 3NKGA 2X10A 4ZS2A 3VBFB 3LSEA 5C9AC 1M06G 1OURA 2BNNA 2PHXA 5FY8A 2YMZA 2RMU1 4D7SA 1LHNA 3CMGA 5BUVA 1ENXA 2ZMKA 4GXLA 5CAZA 3RZJA 4YGDA 3P5BA 2JDHA 4ONUA 4HBNA 2DBNA 2WSUA 4YGBA 4N53C 3U07A 1GICA 1XXNA 1W06A 1ZVFA 3RDIA 1CX4A 3S6PA 4Z8BA 3W5MA 2J1EA 3QD6A 4PDWC 1PGW2 4L9BA 3NV2A 1RC6A 4Y20A 2RS11 5IK5A 5CBLA 2HWF2 3A23A 5G05L 2PTMA 4Y5TA 5KR7A 4GH4A 1BEV2 2R6QA 5KHHA 3WQ1A 3H1MA 2WS93 2VMHA 1WMFA 4QX1A 1QKQA 1ZNPA 4OYUA 1G9CA 1AR62 3WUDA 4FOYA 1CIWA 3PNAA 3VD7A 4EN8B 1OFNA 5DG2A 1ZBE2 5FZBA 3VDDA 4Q4W1 1OOPB 3B93A 3RZKA 4L97A 2CNAA 1EYBA 4EN7B 1O91A 2QBXA 4GMP0 2ZX1A 4R9CA 5FMOL 1ZZ8A 5HCBA 1RUE2 2YGLA 2ZEXA 3CNAA 1DQ5A 1IG0A 2H6BA 2VW2A 2Q0AA 2G9ZA 2B7YA 2P6HA 1CJPA 4XOGA 2VZ3A 1HKDA 1LKNA 5EJ3A 5DUWA 2BV4A 2E7TA 2X53S 3IDCB 1BEV3 2AR6A 3VKOA 5EQUA 1UOBA 1UY3A 1AR63 2E26A 2VH9A 4RSUA 3OBRA 4JDNA 4NVPA 3WF2A 2DUOA 3T4HB 1O4ZA 3RYKA 1ND3A 1ZBE3 2SLIA 2PHFA 3C7EA 4DQAA 2XVLA 2QQJA 3HIFA 1O4TA 1X82A 3NL1A 4CSWA 4Y1VA 2VE1A 5IFTA 1W8ZA 2WNVC 3UV9A 3EXUA 1WBFA 1RUE3 2HYKA 2JG8C 2ZPXA 3GNEA 4WVWA 4LBMA 5FK8A 5GLTA 3VBSC 2VC9A 1UNBA 2JIJA 1UPSA 4Y5Z0 4YFWA 1GOHA 2UYAA 1ND2A 4TZDA 4A3XA 4HPKA 1DLCA 2YG0A 1N3PA 4KBZA 5CU1A 1WA4A 2D3SA 3MHZA 3IWZA 3I59A 4CEYB 2VCMA 2A6ZA 5FY7A 5FRAA 5FZ1A 4P14A 3GCWA 3K3NA 4XF4A 1ZZ7A 4CDXB 1VBA2 3VBUB 3VHNA 5A3MA 2DTWA 5FMDA 2A6YA 4QDSA 5T55A 1VALA 1YIPA 3AMNA 5FV3A 2VZVA 4IV3C 4MO3M 2VOWA 1NZIA 1LHUA 4MXVA 3U75A 1F15A 1O4YA 4Q27A 4BLJA 4ATFA 4FP3A 1UOJA 4NO4A 2VBDA 4FQZA 4LO6B 4IV1B 5FO8B 5KXBA 1V6MA 1W6MA 1RVF2 1RMU2 4FPLA 2WZEA 5CFDA 5T50A 4BE3A 5A33A 4AVVA 3WP4A 4LOSA 4FPHA 5JSOA 4ASMB 4XJ9A 1G7YA 1NCRC 2P4EA 2ZGOA 3GZUC 1VBC1 3I4IA 4NPLA 2VNVA 3UKVA 1VBA3 2D98A 1WCUA 4WZCA 1GQPA 4MSVA 1W99A 1FMD2 3ZFFB 4ZKTB 1S4CA 3TWIA 4RYDA 3ABZA 1JOBA 1W8TA 4D8MA 3T30A 2ZGNA 1QXRA 1Z78A 1PM4A 3VKLA 3HPNA 5T5OA 3H7JA 1AYN1 1F2NA 2DCZA 5BNNA 3MPBA 1KDMA 4R9AA 5ABJC 1PK6A 2QJVA 5LRRA 2QUOA 5FY9A 3SCFA 1MZ6A 1COV3 1PMHX 1N1SA 1JS9A 3E1F1 5JVVA 3AZVA 4Q8KA 2Y64A 1X9PA 3ME2A 4XXPA 2D6PA 1NCQA 2Z69A 1DQ0A 3MIHA 3GXUA 1ULOA 1CAUA 1UU4A 4EN0A 4NHLA 2IWGB 4KQ7A 3BPZA 2DUQA 1VE0A 1H8TB 4FT8A 5GJ6A 1LTEA 4JQRA 1SCSA 2YHJA 1F5JA 4QHOA 1FMD3 2I2SA 2VO5A 2XJRA 4GULA 2DBIA 3WHUA 4PCRA 3FUOA 5FP8A 3WP5A 3ZVXA 2WYFA 3ZFEC 3H1WA 4DXSA 4BQ4A 4ZU4A 3KM5A 1PVXA 1Z7S2 1HN0A 5FR3A 2R072 2QVSB 2R062 2O14A 2RE9A 1RUI2 1JU4A 3BALA 2B5HA 2D43A 3DGTA 5FFOC 3NJXA 5FZKA 5IWFA 3BYWA 1SG3A 3WF4A 3CJIA 4ISQA 3H9AA 3PUQA 5L7OC 1POV3 5DAQA 4QWNA 1QQP3 3QOPA 1I3HA 5L9BA 2GZWA 1ZRDA 4QM8A 2ENRA 4NR1A 3MIDA 1IPKA 1L3JA 3T09A 5GLWA 1FV3A 3RI9A 4TXWA 3MFAA 3I49A 3VBRC 1G6NA 4RR3B 4CDUA 1Y9MA 4QD2A 2WS91 4LORA 2XHNA 3TBDA 1OA2A 3W58A 5G04L 1Z7S3 5IUQA 1XPWA 1QOOA 3RFRA 3HT2A 2R063 3P3PA 4M4PA 1RUI3 4XABA 4OVEA 2J42A 2BBAA 3P6BA 4N90A 4Q4Y2 3KHCA 3O1UA 4UF0A 2GC3A 1LULA 3HBKA 4Z2WA 3RZGA 1HIXA 1QJU2 2QDNA 5FZLA 1JYWA 4QU2A 1TE1B 1PGW1 5GZEA 3MF9A 4AEDB 1EPZA 4FQ4A 4WM7B 1KRIA 5DN2A 4BZ4A 1XNAA 1NLRA 1BEV1 1GKBA 4QQHA 1UU6A 1EPWA 4WZFA 4Y1YA 5E88A 4AHXA 1NUKA 3GJBA 4B4PA 4HANA 1AR61 1KDKA 4QGNA 3WW1A 3H7YA 4L8QA 4LXLA 3AXDA 5BNOB 1D4M2 1QJY2 2ZGQA 1ZBE1 4RS5C 5J98B 3VZOA 4XQDA 4XMAA 3N7JA 2ARAA 2K2SA 4Q4Y3 4HKOA 5FYVA 4IEVA 3GBFA 4QPGA 5FK7A 5K0UB 1RUE1 3C7GA 4Q1RA 1XYPA 2BNMA 4ES9A 1XC6A 1YFUA 2ZCWA 1UYYA 5J3UA 3WQBA 4YG3A 2E7AA 4N9IA 2Y34A 2QQVA 3UESA 1U0AA 1DGRA 4K8RB 4QXKA 2AREA 2WABA 2WQ4A 5EJZB 3I2FA 3WVJA 2CDOA 5C6CA 4P9GA 3TYJA 3K77A 1D4M3 1QJY3 5JZGC 4FPKA 4OLLA 4LBOA 2DVDA 2JG9C 3O0VA 5IK8A 2XJQA 2UY9A 4IEUA 3I8TA 1G9AA 1I6XA 3VZJA 2ZGPA 4DMIA 1ZZCA 3U10A 5C9AA 3HD8B 5I0UA 3I2GA 3PMEA 1UL9A 4UXAA 1VP6A 2NP0A 1YC61 1U5ZA 4Q4X3 5FPVA 5CEHA 3DYPA 4CZSA 4LO7A 3LIHA 5FCCA 4GKXA 2ORXA 4LK7A 4FXGB 2CGNA 4OHWA 2RDRA 3WDWA 1HQNA 1LJ7A 1N47A 1KGYA
chains in the Genus database with same CATH topology
1NG0A 5C33A 1HQWA 1UKRA 4YYOA 4PDWA 4ATEA 3SH5A 2ET7A 1O3TA 1VBA1 1QGLA 4XBQA 2Y38A 3WR0A 2UWCA 2WINB 1DHKB 1V6JA 4YZ1A 4EWEA 1V6LA 4HZFA 3JB8A 3ZFGB 2ZMLA 1XRUA 1RMU1 3N36A 1COV1 1UD1A 2I74A 1QH7A 1GANA 4FPEA 3TNQA 2HWB2 4N43C 1DQ6A 5LK5A 1AL0G 4CYDA 1KITA 1C1LA 3VZLA 2VNGA 4DY5A 2DWRA 3BCWA 1Q3EA 4I3PA 2VUAA 1I9RA 1WCKA 1FMD1 3JB4C 5BNPC 4JDOA 3WDYA 4E2GA 4U2AA 1YRZA 1NXMA 4FOWA 4LO8A 2VMIA 2YROA 1KXGA 3ZXGA 1RUF2 1H2KA 4OHVA 3ELNA 3DPRC 4XXAA 3I7DA 2VOVA 4BQ1A 5KXDA 2WNEA 3NKTA 2HWB3 4LEJA 4L92A 2WNVA 1POV1 2JG8A 4BLIA 1LHWA 3VHPA 2WNUC 1QQP1 3VBSA 5HXVA 4X6RB 1SMVA 1QMJA 4IEPA 2D93A 4XFCA 4IL7A 5DDJ2 2CTVA 2VOXA 3OF1A 4Q2FA 4G4FA 1Z7S1 1LGCA 1IS6A 3S0MA 1KJLA 1RUF3 3IIAA 2R061 1MS3A 2ETEA 1RUI1 3ZYIB 1H4GA 1W2UA 1XNBA 3T1MA 2FZ1A 5C4WC 4J1XA 2FQPA 3DL3A 4YRDA 4XYXA 2XUMA 4YW1A 2QE3A 2P3JA 4M00A 5DDJ3 1AL22 2UURA 2Q30A 1V9U2 3VKFC 1NCRA 2K9ZA 1Y3TA 3OYWB 1GZWB 1RUH2 1W6PA 4QGMA 4HVOA 4BMBA 3GBWA 3VHRA 2A6VA 4Q4Y1 2ZHLA 1ASJ2 5F5QA 3OY8B 4HSLA 5FPXA 4IETA 2PELA 1J1LA 1OD5A 4RHV2 2EIGA 4AE2A 2G9FA 3IDBB 3M2MA 4AGVA 5E1RA 4A7KA 5T3NA 4SBVA 5ABJA 2AUYA 3PVEA 1AL23 4CDQC 1UMZA 3IN9A 4E2QA 1LU2A 3MGUA 3WG1A 4XBNA 1D4M1 1QJY1 2RM22 1D0HA 1MS8A 5KXCA 3TOJA 1RB8G 1WW6A 3FC0A 1W0PA 1RL3A 2D3PA 1S0DA 3B94A 3USUB 3ZFEA 1EP0A 1WLDA 4BMEA 2PYTA 1S0EA 1W6QA 1NA1A 2XJSA 4MV2A 4RHV3 1ZZ9A 1D4VB 3BODA 4Q4X1 5IK7A 2OPKA 1OMIA 3ZIWA 3BIWE 1TQ5A 1XNCA 2WFF2 3OD0A 4Q0SA 4HK8A 3BU7A 3RMYA 2DU1A 4WVMB 5L7OA 5FLJA 4XHXA 1PO12 1DDLA 3T2TA 4Q8LA 4L2NA 3POSA 1NY71 1S2BA 4YW2A 1QWRA 4BIFA 1IS5A 1DF0A 2X5IC 3G6JB 5JOYA 3OPZA 2R0HA 1BK1A 1DBNA 1LCLA 5BY5A 2WFF3 2RJLA 5J48A 1MR5A 1ULFA 1H9WA 1ZBA2 1PHMA 3QH7A 4HSJA 4FPCA 4M3CA 4K3UA 4YVWA 2P37A 1PO13 3N7KA 3ECQA 1G86A 4OI1A 1J3RA 1IKPA 3B7MA 2ERFA 2MHFA 5FOJB 2E63A 1AZDA 4WM8B 2VGDA 4PIXA 5BNOC 1KFUL 3ENRA 1IOAA 4YVSB 1V6NA 1GR3A 3NWKA 4HPKB 1A6CA 2CGPA 4RS5A 1RUJ2 3AJZA 5JWPA 4AFMA 3H3UA 3NJZA 1ZBA3 1SLTA 2HWB1 1A78A 4AHWA 4UBHA 4OUMA 3ZO0B 2R16A 3DKWA 2WA4A 2BVVA 1GZCA 1VB4A 1ZRDA 3ZSJA 1KD7A 1HRI2 3QBQA 4IEXA 1JW6A 5FBZA 3NAPC 1VLNA 3OGGA 4INDA 2XH6A 3MIEA 4M0NA 3FWEA 2KM2A 2RS52 2ATFA 3N3HA 2B9UA 5T52A 2HEYF 1LHOA 5IT6A 1POV0 2VG9A 5GLZA 1MACA 2GNMA 4QQPA 1QHDA 5JZGA 2PLV2 1RUF1 2Y0IA 1J3QA 2CWSA 5DG1A 2JG9A 1RUJ3 4W6XA 3PVBB 4EV0A 4OULA 4E4SA 4AYUA 2Q1MA 3IM0A 2QCSB 2SBAA 4D7YA 4YG6A 4U36A 3P3NA 1REFA 1HRI3 4DRRA 1BZWA 3WV6A 4AI1A 2WC2A 4GWNA 3UJQA 1PGSA 3KGLA 2CAVA 3VBHC 4IEQA 2RS53 5DDJ1 4JGYB 3RJ2X 5KHJA 1MS9A 5CVRA 1DQ4A 2D6OX 1WLWA 1S55A 3LOIA 3AJYA 3THTA 3IPVB 1YI9A 1C5HA 2PLV3 1VAMA 1FPN2 3WXPA 4K9SA 1WMEA 4LO5B 4CDWB 2JEMA 3WCRA 2CGOA 2BPA2 4RQPB 4FVVA 2XGXA 5JOZA 1O5UA 5JOWA 1QXJA 4C91A 1WW5A 5I8SA 3B69A 1SCRA 4AEMA 3D5OA 5A32B 2HEVF 2R1DA 1DQ1A 4HL0A 3RI8A 1C8M2 2ZKNA 3ZN4A 1AL21 4N43A 4RL7A 1W0OA 3ILNA 1CESA 4ZU5A 2PAEA 4ES8A 2D40A 4X8NA 3WLUA 4AF9A 4HLTA 4DS0A 1WLCA 1FPN3 1FNYA 1C5IA 4Q1PA 5CFCB 3QLQA 3RNSA 5EWSA 5BNPA 1ASJ1 2YZ4A 5K8SA 4WVZA 2ZGLA 3MF6A 1YYNA 4RHV1 1LOCA 1ZM1A 1AR72 1GFF2 4RGAA 2H0BA 3WDVA 1CGPA 3DPRA 2QZ3A 4MXWB 3WP3A 1CAWA 2GALA 1C8M3 4K20A 3PLQA 5F9TA 3SITA 2NM1A 4URTA 2WNUA 1MS5A 1JH5A 4DINB 5I8TA 3J26N 1IQAA 1XE7A 3ZXEA 1IPJA 1C28A 3WG2A 4Q29A 2H6CA 5CADA 2OYZA 4JGZC 1H1IA 3PVOA 4H7MA 1U5YA 5F6LB 4AI8A 1PZ9A 1Q8OA 2VXRA 4AQ2A 1AR73 1ONAA 4YM1A 3HN1A 3KGZA 4GIQA 4YFZA 3R4SA 2WZPP 3GHMA 1CVNA 1LRHA 2WFF1 4TWTA 3KCYA 1YO8A 1OOPC 1X36A 5C4WA 3AYEA 4AVAA 4AFDA 1SBEA 4AVTA 5D8AB 1AVBA 2A75A 2R30A 2IXJA 1PO11 2CV6A 4QQLA 4Y4YA 4B7KA 3ZIXA 3PJQA 4QPGB 4R4ZA 4YW5A 2JX9A 4XF3A 1OHFA 4Y1ZA 2VNRA 4JVAA 2ES3A 3PTYA 4MZUA 1GBGA 2A3XA 2WLPA 1BQPA 1SQ4A 4DFSA 5DZEA 1G9BA 2UY8A 1F31A 3RJRA 5DXDA 1BYHA 2DFCA 5T5PA 1YXWA 1H1MA 1N1VA 4XJUA 1ZBA1 3AM2A 2A3WA 4OI4A 5JMCA 3E6BA 2IXKA 3S7EA 5CG8A 4IQPA 2IXCA 2JICA 3VBOB 2HWF3 4GALA 1O3RA 2P3KA 3NV1A 1H0BA 2GH2A 4GB32 4CDQA 1MQTB 3EBRA 4F83A 2ZACA 4CEYC 1YLLA 3RS6A 1AF9A 2ZX2A 1RUJ1 3USSA 3AP5A 2NN8A 4CDXC 3VBUC 5FQ0B 1K5MB 1TMF2 1ENQA 1LECA 1J59A 4Y22A 3BB6A 4JV4A 1VBB2 3KQRA 1HRI1 2ARBA 2BGCA 5AC92 1LOEA 3AMMA 4K6BA 2GNDA 4IV1C 2RS51 3HAGA 3KSCA 2P17A 3ASIA 4Z82A 1WBLA 3ETQA 4XPVA 1DGRN 2NZ9A 2WL1A 2Y26A 2YC0A 4UW5A 2A7AA 1QJX2 1AJKA 2PLV1 4KU7A 4YNIA 2VULA 4G3YC 2X5IA 4N9HA 3PJYA 4QPIB 1TMF3 3KCCA 3ZFFC 2AENA 2ZGKA 2LALA 4X6QB 2R1BA 3A0NA 2NQYA 2W52A 1VBB3 1CN1A 5AC93 3VZMA 2KA3A 4K1YA 5K9YA 4LUKA 4S2GA 5I91A 5J7MA 1JOJA 1QJX3 1ENSA 2K0GA 2E6VA 3AKQA 4NWVA 3EHKA 5EFUA 1FPN1 1RJ7A 1EV12 1H8TC 1UKGA 2XWBB 1FYUA 5F1RA 2VECA 1AX0A 3ALQA 2RR12 1OQDA 5BNOA 3E5UA 2N7GA 3H8UA 3VKNA 1MS0A 3CEWA 1SDWA 3GHNA 2BYVE 4KNCA 4P9IA 2A73B 1RVF3 1RMU3 4Z07A 1C8M1 3JUUA 5KHKA 5J09A 4I0BA 5T5LA 4IEOA 5KBFA 3AB0A 2WQZC 3SMHA 1CAXA 3FUQA 4TYSA 1RUNA 3WDXA 2RR13 1QJZA 2NMOA 4RR3C 2YXSA 3ZDSA 1JN2P 1AYM2 4FOVA 1AR71 4FBFA 4C0BA 1HDKA 2OUHA 3RQ0A 1ZZBA 5LEKA 1YIFA 4LBQB 2VVDA 4PF5A 3HT1A 4MUVA 1IGOA 1CJDA 2YGMA 3UL2A 3W59A 3RYPA 4NWWA 3D8CA 3I54A 4WV8A 4M0HA 3VBHA 1W6NB 3ES1A 3WQ0A 1PZ7A 4AEDC 4WM7C 4YG0A 1U12A 3V0AA 2DFBA 2VY0A 1DG6A 1AR92 2A70A 2O1QA 4FXKB 4XJZA 3GF6A 1GYKA 1VBD2 5C8WA 4AI3A 3AMHA 3TAYA 4RD7A 2V09A 2R073 3SXWA 4V1PA 5GZCA 3ZSEA 4DPNA 2RHPA 1CPMA 2XJPA 2R042 1R092 5CA6A 2EXHA 2XL9A 4LNVA 2ZHMA 1KS5A 4KG0A 1SLAA 4AVBA 1LOFC 3BOWA 3M8LA 2IXLA 3POYA 3WOGA 5K0UC 2D6NA 5HCAA 4H7LA 3DUIA 3AKPA 4PIYA 5T5JA 1ZZ6A 2D5HA 4AI0A 2ZGUA 2HWF1 1D0GA 1AXKA 1NA1B 1GQHA 1DFQA 1V6IA 4ITCA 1AR93 2GH8A 2OZ6A 2XLGA 4D3WA 3POWA 1VBD3 2AH2A 3ILRA 5KC5A 4A7YA 1LU1A 2CWMA 2PHWA 2GU9A 1A8DA 1Q8SA 2HJIA 3MLKA 2DCYA 4RGGA 4CEWB 2QDRA 3AP7A 1Q43A 1R093 1R082 2B42B 4XFFA 3N7MA 5I93A 3ZSLA 3D6EA 1BMV2 1DQ2A 5JR7B 1NXD1 1QJU3 1SLBA 2QNKA 1ULGA 2Q5TA 5KHIA 3M1HA 4F8AA 3V0BB 3ZXAC 5CNAA 2UWAA 1Y7BA 5GM0A 1PGL2 1F5FA 3H50A 4FPJA 3N4MA 1S0IA 3GZAA 4QPYA 5H9QA 3OGJA 2G4IA 3ZN6B 1UIKA 4JCKA 3ZXKA 5JPNB 2YV8A 1DZTA 4YM3A 3FFQA 4YGCA 4YW4A 3FBYA 1UAIA 5FO7B 1VBE2 1VAVA 1ZRCA 2UU8A 5GLUA 3WD5A 4M3CB 2C9AA 4FSJA 1ENRA 3B9CA 1H1AA 1JTZX 1MVEA 4JGZA 4YVWB 1TMF1 1IS4A 1OQ1A 5KXEA 1S2KA 2Z42A 4NHMA 1VBB1 4FTSA 5AC91 4UW6A 3MLJA 2MPFA 3FZ3A 2VNOA 5GZFA 5BXXA 3ZFGC 3M3IA 3L9JT 4EWAA 1DU3D 1OOPA 1SBDA 3ZX7A 3M3QA 4YSFA 4CP2A 3AP6A 4HVQA 2E9QA 3D0SA 1QJX1 1YFWA 2BQPA 1VBE3 4FAGA 2OIIA 2WT2A 3VZKA 4BCUA 2W68A 1FI2A 1XU2A 2NYYA 3PHMA 1H9PA 4KU8A 1JYIA 2ZHKA 2DVFA 1RVF1 1JXNA 5EXOA 4S2HA 2CYFA 1RINA 2A5ZA 2W39A 2PHDA 1GSLA 5C8CB 1S0CA 4E27A 2XVGA 3EJKA 2E51A 1UW8A 2EF6A 3MPPG 2RR11 2GSYA 3VZNA 4P9JA 5E89A 5TSWA 4XF1A 5FPZA 1LHVA 3FHIB 3VKMA 1QU0A 4CDXA 2ZGMA 4LO4B 1CPNA 2XLFA 4B7EA 4BM8A 4D7TA 4XMIA 4EN6B 4COUA 4LE4A 4AGGA 3RG0A 1NE6A 1GNHA 1CAVB 3CLPA 4IV1A 5CIRA 1UN1A 3SISA 4LT5A 1V6OA 4PLOA 4LHLA 2KXLA 2R071 5I0RA 2XJVA 1YNAA 4LHNA 4XFAA 3BOPA 3R05A 4IV3A 4JTNA 3ZFFA 4RA0A 1URXA 2BFUL 4DNYA 2F4PA 4XDQA 3MW2A 3OCPA 3OJBA 3WINE 4R9BA 1AUYA 5CB7A 4AI2A 4AGRA 1SFYA 3URFA 2MEV2 4FO9A 3A0KA 4XQWA 1NYWA 1AR91 5EYYA 1RUG2 1HQLA 3RRDA 4PLNA 1VBD1 2Y0OA 2BBVA 2ZX0A 2ZX4A 4BYYA 3U11A 5JPMB 1B35B 5FMOS 5I0SA 3FLTA 4D94A 1H8TA 3R4UA 2IXIA 2R041 1R091 3LSDA 4OHXA 1RUOA 4FP2A 1R1A2 2QKDA 5FO9B 1W6OB 4E4DX 1QJU1 4KGQA 1Y9QA 3JU9A 1ZREA 1ULDA 2DCJA 3LKJA 3ZXLA 2JE7A 1PZ8A 4UW3A 1VIWB 1UU5A 4W6YA 5DUUA 2MEV3 3AKSA 1RUG3 3FFZA 1V9U3 3IDEA 1B09A 4O9EA 3VUOA 1RUH3 5C4WB 1PMIA 3FLRA 3WP6A 1ASJ3 1TEIA 2IFRA 4RR3A 1H2MA 4AFAA 1GQGA 1R1A3 3ZXFA 1BMV1 4Y20B 1VAKA 2GC0A 3MIBA 4ZXKA 4GH4B 4I2OA 1AX2A 2LM3A 1JUHA 4JAAA 4E9KA 3VDDB 2VOKA 1YJLA 2BEOA 2RM23 1VBE1 2FMYA 1UX6A 2B45X 2WLQA 3LWCA 4AEDA 4WM7A 3AMPA 3VBRA 3GALA 1FAYA 4XHBA 1J1TA 2YPJA 4WM8C 2RJKA 3O12A 2PHTA 4JC1A 1HX6A 4CRQA 2DCTA 2GMPA 1HXS2 4YVSC 2GMEA 4DB5A 4HMZA 4EJRA 4XBLA 1RIRA 1MZ5A 1O3QA 1ZX5A 2PA7A 4GA9A 1YCIA 1QH6A 1ND3B 1H4HA 5K0UA 3S30A 4HT1T 5EZWA 1BBT2 4AK3A 3KZ4C 1I1EA 3ACLA 4PBPA 2HWC2 4TSVA 1AJOA 4HK9A 4LA2A 4OI0A 1C57A 2VW1A 4YZ2A 1V00A 1HXS3 4AEJA 1ND2B 4YLZA 2HWD2 1AXZA 1PO22 3APBA 2BW8A 3I59B 3DN7A 3VHOA 1QNWA 2EAKA 3GZTB 3R4DB 4HVRA 3RSJA 5GLVA 3ZN5A 1DZRA 3A4UA 2OZJA 5JAXA 2I07B 1PNGA 1BBT3 1Q5OA 2O8QA 4AVSA 4AFBA 2HWC3 1U5XA 1ULCA 1DGWX 5DZFA 1OLQA 3JD72 1EAH2 1MS1A 4JGYC 4BWOA 1HV1A 3V64A 1LEDA 1W6MB 5JSRA 5CFDB 2HWD3 1PO23 5A33B 1YI7A 3ZSKA 3M3CA 2HWE2 3JBG2 3AMQA 4MH0E 2PAMA 4CDWC 3IT8A 1N1YA 2WKKA 1O5LA 4RQPC 2PHUA 1LODA 1N3QA 4LBJA 3ZFGA 2ZAAA 2VQAA 1X7NA 2A6XA 3THPA 4CP0A 2WSVA 2R32A 3JD73 1EAH3 1TNFA 2BTVC 2YY1A 3KCXA 3SCGA 3LGRA 5BNNB 4NOTA 4YGEA 1S0JA 1PK6B 1C8NA 3WZ1A 1C1FA 3QCWA 1W39A 5HBAA 2HWE3 3JBG3 4H3WA 4COVA 2JD4A 3TN92 3J4UH 5CFCC 4I09A 1NCQB 5DUVA 5FLIA 5LK7B 1UZYA 1CAUB 3D4KA 1AXYA 3EO6A 4I0AA 1SEFA 1SBFA 2ZX3A 1H2LA 1NLSA 2MEV1 3AKTA 4HFSA 4YM0A 4CTEA 4MLOA 1RUG1 3BTAA 1V9U1 4R9DA 1RUH1 2GDFA 2QQPA 2DYCA 3CJIB 2ZMNA 2VVEA 2VU9A 1UIJA 3LA3A 3TN93 1S0FA 3MYXA 3RPQA 2TBVA 1R1A1 2XHKA 3VBFC 3I2DA 3NW4A 1LENA 3V0AB 3R0RA 4Y1UA 5K7PA 4CDUB 4BOWA 3CO2A 4KH9A 4OI2A 3OBTA 4PBOA 5D8AC 1C3HA 3SHRA 5AVPA 2CY6A 2RM21 4GKYA 5HI0A 4J1WA 4XFBA 2NMNA 4KBBA 4QPGC 4HN0A 4LTAA 1OPMA 3IBMA 3OYWA 2A71A 5J96B 1F8VA 2GN3A 1AR82 4I30A 3INAA 4XJAA 4AVCA 1CR7A 2NPIA 2W0XA 1SLCA 3OY8A 3VLBB 2TNFA 3H0OA 1V6KA 2A6WA 1HLCA 2O0OA 1PVC2 4META 1NZCA 5JSPA 4KG8A 4BA6A 2FBEA 3MICA 3O7OA 3VBOC 4DXZA 1O7FA 4FPOB 1S1AA 2ZOEB 3D82A 1MQTC 2BVBA 1J58A 1HXS1 3D0JA 2IC1A 2IFWA 1AR83 2ZHNA 4LLOA 2C1FA 4LULA 1REDA 2XVKA 3NSTA 4MX3A 2AYHA 4AQ6A 1I5ZA 1K5MC 3USUA 4LE3A 3J8F2 4QQOA 2V73A 1BBT1 2JXAA 1VR3A 2WFPA 1N3OA 1PVC3 4JGZB 1Q8VA 2HWC1 2JE9A 5C9AB 1H2NA 3B02A 1KQRA 2ZGSA 4JRAA 2YDEA 2ZS6B 4OFGA 2BUKA 2D5FA 4WVMA 1ZRRA 3TRSB 2GAUA 4IERA 2ARXA 4E4ZA 2HWD1 4N53B 1PO21 4JDMA 3OTFA 1KS4A 4Q4V2 1ZA4A 4R52A 3ZMOA 1YHFA 2FMDA 2D7FA 1RHI2 5T54A 4LHKA 4S2FA 4YZ3A 4PDWB 2RS32 4QPIC 3LZZA 2ET1A 1CONA 3J8F3 3EQEA 2VVFA 3MDPA 1MVQA 4XETA 2ILMA 1OFSA 2IZWA 2QFEA 2ZJCA 1KFXL 4XE9A 3FMGA 4AWDA 5DZGA 5L73A 5FAXA 3JD71 4B4RA 2DF7A 1EAH1 4GB33 4G9SB 1JBCA 2XBO2 1BCXA 3T1LA 3LAGA 1DIWA 4Q4V3 1IZ3A 3ZYGA 5ACA2 4AQSA 2PFWA 4J6GA 2HWE1 2BFUS 3JBG1 3Q9OA 5H9RA 1RHI3 3M7AA 4FTBA 1WD4A 1YUDA 4WM8A 2RS33 1N1TA 1XQNA 2OUJA 4YVSA 1LEMA 3AP4A 4BIOA 4HN1A 3KS7A 2EVXA 1GNZA 3X29B 1OLRA 3WX5A 2GC1A 2WZR2 3H3ZA 3CL1A 4PLMA 2XBO3 1BKZA 3ZSMA 1QNYA 1X33A 1XU1A</