2VPVA

Dimerization domain of mif2p
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
ENFALEIMFDKHKEYFASGILKLPAISGQKKLSNSFRTYITFHVIQGIVEVTVCKNKFLSVKGSTFQIPAFNEYAIANRGNDEAKMFFVQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Dissection of Mif2P, a Conserved DNA-Binding Kinetochore Protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords PROTEIN MIF2
total genus 15
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11699 CENP-C_C Mif2/CENP-C like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vpvA00
5J7MA 1O5LA 3PLQA 3OD0A 4ORFA 4IEUA 2BNNA 2B8MA 5AVPA 4FAGA 1VP6A 3EJKA 2XLFA 3O14A 4JTNA 3MPBA 1X8EA 2ATFA 1OD5A 4YNIA 3H8UA 5E16A 5KHIA 4HN1A 3LA3A 2QJVA 4CYDA 2C0ZA 3TNPB 2IXCA 2OZ6A 4MUVA 2PAKA 1ZVFA 2BNOA 1YHFA 2O8QA 4XFIA 5I8TA 1U12A 4QGMA 2IXLA 4XFAA 2H0VA 2Q1ZB 1Q43A 4I2OA 1QY4A 3R6SA 2IXHA 3ES4A 3FFQA 1SFNA 2OZJA 1GQHA 3UKNA 3S7EA 3H3UA 4HN0A 2PYTA 3EBRA 2K0GA 3RYPA 3U10A 4BYYA 2H6BA 1VJ2A 4BIFA 4LEJA 2XKPA 2ET1A 4YRDA 4BHPA 3LWCA 4XF9A 2Y0OA 2Z2SB 3FX3A 4MGYE 1J3PA 4LUMA 5LEJA 1GQGA 1PM7A 1LRHA 4YSFA 2Z69A 3GYDA 4UXAA 3M3IA 2Q4SA 1WGPA 3H1YA 1ZNPA 2UYBA 3MZHA 5JCTA 3VHRA 5C8WA 3SHRA 1O3RA 1QXRA 4AVBA 3I59B 3BPZA 3H7JA 2PQQA 3KGLA 2GC1A 3IWZA 3EO6A 1H1MA 4F8AA 4KWLA 3D82A 4QGNA 2CGPA 1WA4A 3B02A 3TNQA 4LA3A 1O4TA 5KHGA 3WW1A 4IESA 4Q29A 1UD1A 5J48A 1J3RA 4IEQA 3PNAA 3CJXA 5K8SA 4A2UA 1DZTA 4I01A 4Q0UA 3KSCA 4Z82A 3LA2A 3RNSA 4E2GA 4KWKA 3LZZA 2D5HA 1EYBA 2QCSB 1SQ4A 1V70A 2EAAA 2GH2A 4IEPA 5BY5A 4UBGA 1NZCA 3FHIB 1DGWA 4R52A 1Y3TA 2B9UA 3NL1A 5CU1A 1ZRRA 4IEOA 1NXMA 4FBFA 2OYZA 1XE7A 2PHDA 4R8HA 1O3TA 3SMHA 3H50A 1CAUB 5I0UA 1YFUA 3JZVA 4O9EA 1JUHA 3IDCB 4IEVA 4XETA 1EPZA 4Q0QA 4JTOA 1RL3A 4FT8A 1X82A 3H3ZA 2BYVE 2GC2A 3NJZA 1LB2A 4LULA 3H7YA 3LAGA 3HIFA 2B5HA 4EV0A 1X7NA 2ZKLA 2XL9A 2GC3A 2E9QA 4P9GA 2FMYA 2QDRA 4UBHA 5FQ0A 1X8MA 3IDBB 4XFCA 3FE5A 4E2SA 1PMIA 2FQPA 3H9AA 4XFFA 4NVPA 1CAXA 3PVBB 3NSTA 1FT9A 2ET7A 3RDIA 1NE4A 1UIKA 1YWKA 4PIXA 4N9IA 3ETQA 4ZU4A 2MHFA 2PAEA 2Q0AA 5BUVA 5D1IA 4J1XA 4ONUA 4HZFA 3IBMA 5KHKA 2EA7A 4QMAA 3NVCA 5F1RA 4XEZA 1ZRDA 3BU7A 1I5ZA 2ETEA 1ZZBA 4HSJA 4PIYA 4AVCA 3HQXA 1OFNA 3HT1A 4TLFA 5CADA 1NE6A 1RUNA 5I93A 4K8FA 3EQEA 4AVAA 3E5QA 3OF1A 4N9HA 5I0SA 1I6XA 1O7FA 2ZCWA 3OGJA 1VR3A 4MX3A 3UKVA 4ZU5A 5I0TA 5FLHA 1CAVB 3CO2A 3SCHA 3SCFA 4XF1A 1Y9QA 2H6CA 3S7IA 1CGPA 1YUDA 2K9ZA 1RUOA 1IPJA 4Q0SA 1LR5A 1ZZCA 1O3QA 3CL1A 2D5FA 3D0SA 3I7DA 3QOPA 5FPXA 1ZZ9A 2V09A 4IETA 2XLAA 5I0RA 5KHJA 4XFBA 3GBFA 2D40A 4KU8A 1OI6A 3FWEA 2XHKA 3IIAA 5CVRA 3D0JA 4Q0PA 3WW2A 3KGZA 4QX5A 5FLJA 1L3JA 2BGCA 4WBBA 2F4PA 2MPFA 4OLLA 3RYKA 2CAUA 2PTMA 2XL7A 4PJYA 4X6RB 1ZZ6A 4KL1A 3E5UA 1WLTA 5JAXA 3U11A 3CF6E 4JV4A 3FJSA 5FPZA 3NKTA 4L2NA 2N7GA 3CEWA 2PHLA 4MGZE 1RTVA 2P17A 1CAWB 4HSLA 5EFUA 1CAWA 2VPVA 3RPQA 4F7ZA 2CV6A 4I0BA 3N4MA 2PFWA 3ZDSA 3SCGA 1CAXB 2PA7A 1J58A 1LKNA 4QM9A 5LRRA 4OFGA 4MV2A 1YLLA 3DN7A 2QNKA 3UKTA 2MNGA 2QVSB 4LA2A 3WW4A 4DINB 1Q3EA 4O9GA 5JSOA 4IEXA 4B29A 4KWJA 5JR7B 5FLIA 2WFPA 4QM8A 3H1MA 3LA7A 3L2HA 2I45A 4KU7A 1ZREA 1QXJA 2EVXA 3U0ZA 4RD7A 1EY2A 2D93A 1CAUA 5T3NA 4H7LA 2Q30A 4META 4HVRA 2IC1A 1QWRA 4HLTA 2BNMA 2XGXA 1IPKA 5FCCA 4XFGA 4IERA 1ZZ7A 4HMZA 4Q0VA 5BPXA 5BV6A 4AQ6A 2HJIA 5E1RA 2IXIA 1YFWA 3BCWA 1CAVA 1YFYA 3MDPA 3NW4A 3QACA 4FAHA 3I59A 4QGLA 1Q5OA 3USSA 1TQ5A 1YFXA 2PAMA 3BALA 4EWEA 3MYXA 4BH9A 1O5UA 2BEOA 2OA2A 4MGIE 2WC2A 2GC0A 4PIZA 3SXWA 3ST7A 4LLOA 5FDBA 1UPIA 1ZRCA 4IEYA 3FZ3A 4EROA 2UY9A 1HW5A 4GULA 1J1LA 4LUKA 2KXLA 3ES1A 4ZU7A 1SEFA 5J3UA 2IXJA 3ACLA 4J1WA 1ZRFA 3EHKA 1DGRA 2XKOA 3S0MA 4XFHA 3E97A 2GZWA 3DV8A 4X6QB 3HT2A 4I0AA 4E2QA 5FQ0B 5I8SA 1OMIA 1RC6A 5JSPA 3CLPA 4IEZA 2DCTA 4AXOA 3RYRA 4HVQA 3E6DA 1J59A 4I02A 1XE8A 5KHHA 5JSRA 4YARA 1H1IA 3M70A 2OPKA 4JVAA 5HI0A 3C3VA 4WZCA 3I54A 3ROUA 4L11A 3E5XA 1FI2A 4D7SA 5LRSA 1G6NA 5EZWA 1UIJA 4EWDA 1O3SA 4IEWA 3WW3A 3KCCA 5LEKA 4WVZA 1FXZA 4YYOA 4XF0A 2VECA 1DZRA 4MH0E 3KMHA 5C6CA 5I91A 3E6CC 4QXKA 4MGKE 3ELNA 1UW8A 4Z07A 2UY8A 5KBFA 4EWAA 2CAVA 1XRUA 4I3PA 3G7DA 2GAUA 3H1WA 2XLGA 3DKWA 3LOIA 4HVOA 5I8YA 1NYWA 5BXXA 2VQAA 2UYAA 4D7TA 1RGSA 3BB6A 3OCPA 4AQ2A 4XF4A 4LTAA 1ZZ8A 3RZZA 3OTFA 1UCXA 4HBNA 1CX4A 2GU9A 3DL3A 4MZUA 2HKXA 1ZX5A 1EP0A 4XF3A 2IXKA 1J3QA 3E6BA 2O1QA 4I09A
chains in the Genus database with same CATH superfamily
3JBG1 3IAPA 4Q4V3 5J7MA 3PLQA 1DQ1A 1IGOA 2ZS6B 5T5JA 4ORFA 3WG3A 1PO21 2A3WA 4Y26A 4F3JA 1KJRA 2B8MA 2LUWA 4QU2A 4DXTA 4FAGA 5JMCA 4PBOA 4YG0A 3M3EA 1YIPA 4JTNA 3VBSB 3ZYIB 2DVDA 2QQOA 4AOCA 3GCWA 1VBE2 4B7EA 3QCWA 1OD5A 3HMYA 3H8UA 3TEZA 4RHV2 5C33A 4Q8KA 4YG3A 2R061 3PJQA 1W2OA 4RFT0 2A6ZA 2W92A 3N3HA 2C0ZA 4SLIA 1UZVA 3LCPA 3BPSA 4O61A 4DEQA 3MIDA 3GGLA 3TNPB 3W59A 1BBT2 2BVBA 3LDRA 4MUVA 4MHRA 3WUCA 4FPGA 1GZWA 2JICA 2PAKA 2AC1A 4W65A 4WVWA 4CPBA 2GDFA 4KMQA 2JX9A 4XFIA 3N9MA 2IXLA 2SBAA 4K6BA 3R4UA 3U37A 1JZ6A 1BBT3 2VZSA 2X5IB 1U5ZA 1VB4A 3PMSA 1VPHA 2Q1ZB 4XACA 2ZGKA 1Q43A 1AL22 1ENQA 1W6OA 2WLPA 2BWAA 3MICA 1AYM1 3QH6A 4PHZA 4I2OA 2HBTA 2L9LA 3O1PA 3ZFGB 1LU2A 5A6QA 5FP9A 4TYSA 2GNBA 3BTXA 2J22A 3K46A 3WP4A 3SNMA 3U14A 1CZSA 3ZYPA 4QHOA 1QGLA 1LCLA 5A7WA 4OMDA 5A3PA 3M2MA 3H8XA 3J7MA 3ZLIA 1AZDA 1VIWB 4DOUA 1X9TA 4AVVA 2Y0OA 2Z2SB 1E57A 2VQTA 3FX3A 2NP0A 3KB5A 1HJFA 1DGWX 3DXTA 1LRHA 1OUXA 1SHWB 1VAMA 2WT1A 3FMGA 4N43C 3V0AA 3GYDA 3BTZA 2J7MA 1X33A 1X50A 3DYMA 5GZDA 1JN2P 2RMU2 1H2KA 4A6OA 1QHDA 5DAVA 3VHOA 3RS6A 1O8PA 2WL1A 1ZNPA 1DHKB 2UYBA 4QPYA 1R1A3 2RJ2A 5KC5A 5FK8A 1CONA 4UOJA 5DDJ2 1O3RA 2BOIA 4X8NA 4HONA 3VD7A 3MIFA 2PQQA 1AR61 5FP4A 5FYVA 3IWZA 1H1MA 3OD4A 5FV3A 1V00A 3IPVA 3UGGA 2WFF1 4JGYC 4XUQA 3VBUA 5A7NA 1AL0G 4H2AA 4QPIC 1U5XA 1JOPA 2ZEZA 3FUOA 5HXMA 2GNMA 3ZPOA 5J37A 3NV1A 2HWC1 3T2QA 3B02A 2WQ4A 2JE9A 3CBNA 1YJLA 3AKQA 3NWKA 3OGVA 3WR0A 5J48A 3ACHA 1VE0A 1V6JA 2E31A 4PI0A 5BNNB 5LK5A 3T0DA 1DZTA 1WCQA 3RZKA 1SLIA 1MVEA 5LWBA 4XPVA 1QJX3 3PVEA 2WS91 4P9XA 2V5DA 4XXPA 4DMIA 2DTYA 4Z82A 5AVAA 4E2GA 4OZOA 1EYBA 2Y6LA 5IT6A 5JZGA 2ORZA 4BQWA 4BOWA 1YO8A 1OA4A 4AFMA 1REDA 2EAAA 3KCXA 5BY5A 1L7LA 1NZCA 2XMLA 2AYHA 3ITQA 1E5SA 3U75A 4AQSA 2D6LX 4BE3A 2J1RA 3NL1A 2ENRA 1LEDA 2VTFA 1PGSA 4J6GA 2W91A 1ASJ1 4E8CA 4QPGB 2DU1A 1JOJA 2RS13 3SMHA 4N8MA 5F3CA 2CNAA 2YYOA 1UX6A 2D98A 3PUHA 5FJKA 3K4AA 5CNAA 2JKXA 3WP3A 1SLAA 4LHLA 4U2AA 3I97A 3OB8A 4XDPA 4O9EA 4QPWA 1JUHA 4DY5A 1ENSA 3IDCB 3IN9A 5C3RA 2XJPA 4IEVA 4IV3B 5FMBA 5C4WB 1R092 2EXHA 1MS1A 3AZXA 2DVGA 2WNUB 1KQRA 1PNFA 1YQ6A 3H7YA 4LULA 3MLJA 3ZYFA 1HKDA 3MFCA 3J7HA 1NUKA 3M3QA 1X7NA 1U5YA 2ZKLA 2AH2A 2HWE3 4KH9A 4M0NA 2E9QA 5C9AB 2VZVA 1ULPA 1BK0A 4OZXA 4P9GA 4AI8A 4UBHA 2GN3A 1X8MA 2VW2A 5FQ0A 3IDBB 4E2SA 1RUH1 1E5RA 2FQPA 2GP5A 3NNFA 2W87A 4IGQA 5GALA 4HK8A 4DZGA 4WM8A 3CDZB 1J83A 1RUJ1 1UKRA 1XB9A 5EWSA 2YGLA 2CYFA 1GKBA 3LF7A 4O7XA 4PDWC 4QPGA 1XQNA 5FYUA 4D6RA 1NE4A 1ZBA2 3PIJA 4H14A 3ZFFB 4CA9A 1UIKA 4MSVA 1I5PA 4PIXA 4N9IA 1N3QA 1REEA 3ETQA 1NKGA 2MHFA 2Q0AA 5FZ9A 2WLQA 5C8CB 1VBC1 2VE1A 1W0PA 3UGFA 5C70A 1IOAA 1OH4A 2R1DA 1FATA 1G86A 4ONUA 2Q8EA 3POEA 2EIGA 3FUQA 2RV9A 4QMAA 1LEMA 3RWNA 4P9LA 5L7OA 1COV2 2YUEA 3OPZA 4YM0A 5FUPA 3GZAA 3KQ4B 4AFAA 2GALA 5FOBB 1OD3A 4IGPA 1PZ8A 1W8WA 3BU7A 5FO9B 2W9XA 4HSJA 3SH5A 3LFMA 2CGNA 4QQHA 4CEYB 4AVCA 3HQXA 3HT1A 3OYWB 4TLFA 3UL2A 1NE6A 2R0HA 2QQPA 4K8FA 4HT1T 1TVGA 1CZVA 3EQEA 1CIWA 1WA6X 3T0AA 2H0BA 2Q1MA 4AVAA 2X5IC 5IFTA 1HRV3 1I6XA 1EAH3 3GCXA 1GOHA 4Q4W3 4A42A 4AZZA 3WEZA 3J7LA 1VR3A 3C7GA 3FC0A 3A22A 1QJFA 3I2OA 1JODA 1FMD3 4IW3A 2Z4FA 5CKQA 5I0TA 3PJYA 3X29B 4NHLA 1J84A 4XW3A 3VBRA 2Y6GA 1Y9QA 1JI6A 1GICA 3F95A 4XQWA 1M06G 1CGPA 3PUQA 1QOSA 2GMMA 3AK0A 2ZEWA 5IAVA 3WD5A 3C8XA 2PN5A 4LO6B 5BNQA 3QOPA 4PBPA 4LXLA 5CYYA 2JWPA 4Q1RA 1NXD1 5L19A 2XLAA 2EAKA 2HEVF 1QJY2 4XFBA 5FKBA 3I2FA 1KS5A 1OURA 3K3OA 4ZZ5A 5GLWA 3O1VA 5A32A 3FWEA 5C4WC 2XOMA 1C8M1 5FY0A 3W21A 1C4RA 2EICA 1JTZX 1RUF1 1L3JA 3R05A 1G9FA 4MYEA 5FLJA 2A6YA 2C9KA 1H9PA 1TZOA 2BVVA 2XG3A 3KZ4C 3N7JA 4Y1UA 2RG4A 4DXSA 2MPFA 4OLLA 4FTBA 4A3ZA 3GBGA 4QXCA 1TE1B 2VMHA 4Q2FA 2D6NA 1PVC3 2QKDA 4PJYA 4COUA 2X10A 3OPTA 1ZZ6A 3P1IA 4WV8A 2J1VA 2P3JA 1OQ1A 3E5UA 3ABZA 2P5BA 2VNVA 4RR3A 4JKLA 2YDEA 1UYPA 4IXLA 2C1FA 4YW5A 1NA1C 2JJ6A 4AGRA 2VZ3A 1ND2A 4JV4A 2FCTA 3NKTA 5FPZA 1OLMA 5CKNA 3RSJA 1HRI1 4XBLA 3O1TA 1O6UA 3OUJA 1GBGA 1W9WA 4MGQA 4NAMA 1NA1B 1XBFA 1KJLA 5A7WB 3USUA 4Y20B 2W1SA 3ZXFA 4A7KA 2ZGLA 4F7ZA 1ND3A 1OOPB 4ISRA 1N1YA 3ZR5A 4RS5A 5C8CC 1OA3A 5DXDA 4Y1ZA 4YM1A 2PFWA 1V6MA 1NY72 3SCGA 3JCIA 4AG4A 4AFCA 1JYXA 5DDJ1 1J58A 2WA3A 3N35A 3I3QA 3C7FA 4J25A 2MNGA 2QVSB 4N90A 3VDDB 4BDVB 1AR92 5A1LA 3ZFEA 3MW3A 4LHSA 2WZPP 3BUCA 2RDSA 3WNMA 1Q3EA 1XNTA 4Y1VA 1QJY3 3H0OA 4IEXA 1W6NA 5JZGB 1QJU1 4YW1A 5EYXA 5T5LA 5JR7B 5HCFA 4GJZA 5CA6A 3TEYA 3L2HA 3MIEA 4GWJA 1JZ4A 2I45A 1TG7A 1TMF2 1QXJA 2VTXA 1H2LA 1R1A2 5JWPA 3WDWA 1CAUA 1UY3A 2TEPA 5FXXA 2Q30A 4C1WA 4CXWA 3O1RA 2ZMKA 1MQTA 2IC1A 2JE7A 4PT6A 3U4XA 4HLTA 1SMVA 2VUCA 2WNUC 1S2BA 1PVC1 5FCCA 5A3OA 1KDMA 1ZYBA 3WNXA 2WT0A 3L2YA 1K5MA 2MEV2 1KFXL 4AQ6A 1FMD1 1UY2A 1D0GA 4BCUA 4D6SA 1NG0A 1UOGA 3PTYA 5C9AC 5HCHA 1MS9A 2IXIA 4LK6A 4BQ5A 2YC0A 3RZHA 2TNFA 1VBD2 4Q1PA 1PK6A 4QX1A 3HWJA 2DUPA 3WCRA 1W8HA 2JB8A 4QQ2A 2B45X 3JD73 4PQQA 5DMYA 2WS93 3NW4A 4AI9A 3ZKYA 1PVC2 4FAHA 4ET7A 2FHRA 4S2FA 4QQLA 1CD3G 5A7SA 4EWEA 1EV11 1VBA2 3BN6A 3MYXA 1NZIA 2OX0A 2DYCA 4BJ0A 1W6QB 1RUD2 2D6PA 2PHUA 2R062 2ZBJA 3ZXKA 2A1XA 2JDHA 4ZKTB 4WM7A 3LD8A 2WC2A 2YBKA 1TMF1 4C1XA 1CJPA 3A4UA 2XVLA 3RI9A 4GXLA 4QKDA 1ND3C 5SV8A 3UT0A 4XVHA 4EROA 4COVA 3V0BB 1V6LA 1YQ2A 1PO22 4N53B 2JDNA 1QJU3 2JXAA 2V73A 4FQ4A 4ZU7A 3OGSA 3HQRA 4KG0A 4OHXA 2R16A 3ZXDA 1JU3A 5A6YA 3SH3A 1ZRFA 3VBOC 2UWAA 5BNOC 5FR3A 4CE8A 4XFHA 2A71A 2VCCA 2GZWA 2HWD1 3J8F1 3WY6A 3DV8A 4HFSA 5IK5A 5C3SA 4CEYA 4I0AA 5BNOB 3CQOA 4XILA 3OYWA 1LHNA 5FQ0B 3N7MA 5FZLA 4A41A 2GH8A 1JHJA 1F5JA 1MS5A 1OMIA 4PDWA 1WW5A 3AP9A 4QHBA 3ATGA 4JDOA 5JOZA 3CLPA 3HNYM 4LBQB 3AZZA 4JKKA 5FY8A 3HR9A 1AJOA 3ZN6A 3J9SA 4OQ9A 4EQVA 2C4XA 5JI9A 1W8OA 2Y26A 3N36A 2DDUA 1TNRA 5GLUA 3VB9A 2LM3A 4ZPIA 1UYXA 1XE8A 2QQJA 3ZO0B 4D7YA 5AC92 4NRMA 4CP1A 4YARA 3LSEA 4LE3A 3B5LB 1N1SA 4GMP3 5IK4A 1BMV1 5DAWA 2OPKA 3RQ0A 3IDEA 5C9AA 4N7IA 1DCSA 4K8RB 4RGAA 3RG0A 4JVAA 4DY3A 1RIRA 3WNNA 3C3VA 5C71A 1IS5A 1OPMA 1J1TA 1QIQA 5FK7A 4AEDA 2VXRA 1DBNA 3LEIA 4YVWA 1UU5A 1FI2A 4JHZA 1C8M2 3ZXGA 3BIEA 1G6NA 1YC61 3T4HB 2WUHA 3VD3A 3MEPA 1BK1A 2W52A 1YQ5A 1H30A 3M8LA 1C1FA 2YBPA 4QKNA 5EQUA 4XF0A 5FO7B 1DQ4A 2VZ1A 4YG6A 1VBB1 2QQMA 4Q26A 5A80A 4CU6A 3W5MA 2V72A 3GDBA 1BHGA 4AHZA 1OUSA 1N3OA 4Z07A 2UY8A 1I3HA 1F2NA 2E7AA 2JENA 4IV3A 3VBRB 4EWAA 4GA9A 2CAVA 3P3NA 1S0EA 1FPN1 4TSVA 2W2IA 2GAUA 4DB5A 3DKWA 3LOIA 1WW7A 1AJKA 1DU3D 2ZHLA 2FBEA 5BNOA 2OIIA 3DGTA 2EXKA 1XSRA 1GLHA 2VQAA 2ZX2A 1QNYA 3QD6A 1CPNA 5FIXA 1CN1A 4D7TA 2OQ6A 5DZEA 1RGSA 3KCYA 1JOBA 3PTRB 2RDRA 2YU2A 1XE0A 2P1BA 1SG3A 2BOJA 3PDQA 5DZGA 2YROA 5FZ4A 1BLZA 3ZSJA 5F2WA 3AYCA 4MZUA 1PZ7A 4FFHA 1T6GC 1UF2C 1UY4A 2WZ8A 3OEAA 2EXIA 3TYJA 5BNNA 1V0AA 5FMCA 5HPOA 3WT3A 5FYYA 1PO12 3CNAA 2X05A 5C3OA 4RGGA 4GB31 2UWCA 2W1UA 5GLVA 3CMGA 1HXS1 2WZEA 3SKJE 4RA0A 4YVSC 5JXJA 2QZ2A 5CKMA 3IMNA 1TME1 2D97A 3AVRA 4HK9A 4YZ4A 3AFKA 2EIDA 3K4DA 2RDQA 3EJKA 3O14A 1ZBA1 2R0FA 1SLLA 4B3NA 4CDUA 3MPBA 4RGKA 1X8EA 2ATFA 1SCSA 1MZ6A 3CJIC 4YNIA 5E16A 1SBFA 1VAKA 1Z7S1 1US2A 5KHIA 1JZ5A 4FQZA 4MGTA 4QKFA 4CU9A 3DYOA 2QJVA 1RUH2 3M3CA 3HQUA 4R9AA 2BFUL 3B9IA 4FVVA 1E5HA 1STMA 1YXWA 1UWWA 4P9IA 5ANNA 5JMOA 5FYCA 2BNOA 2OT7A 4XIOA 1YHFA 2RM23 3WLUA 2DUQA 3O1SA 1VBD1 4LO7A 4XFAA 3VZKA 1HRI3 1ULDA 4IL7A 3NJYA 1K45A 2RR12 3AMQA 2Y64A 3R6SA 2IXHA 3ES4A 2XVGA 2MEV1 3I8TA 3K77A 4QD2A 4YLZA 5FMDA 1W3XA 2VUAA 1NCQB 3UKNA 5A3UA 4HN0A 2PYTA 3EBRA 2K0GA 3RYPA 1OOPA 2J42A 3U10A 3WNLA 4BYYA 3OBZA 5DDJ3 2H6BA 1MACA 4M00A 3U78A 3S6PA 2G9FA 4A4AA 2XKPA 5CG8A 2ET1A 1ONAA 4YRDA 4BHPA 3AMNA 3OGGA 3VKLA 3VZNA 3KT1A 4PLOA 3O1MA 3GZEA 5IVBA 5A32B 5LEJA 1GQGA 3OSDA 1BZWA 2KR2A 2PHWA 3SITA 3D5OA 2HH9A 3NV3A 4A44A 1PK6C 3O12A 2NMOA 3M3IA 1G9BA 2DV9A 3H1YA 2V4AA 4HETA 5F7UA 1YI9A 3QLQA 5FXWA 5JCTA 5CIRA 4W6YA 5DAXA 1HQLA 2QQLA 2R6QA 3OEBA 1AYM3 3DECA 1OQDA 4AVBA 2CL2A 3BPZA 2D6KA 2JDAA 3KGLA 3Q8CA 3KVBA 2GC1A 4OQ8A 4BXSV 1LOBA 5FY5A 4QX8A 4OI2A 1WD3A 1FOD3 4NE9A 4ATEA 4QAWA 4QX7A 1OLRA 3CJIA 4RL7A 4QGNA 3WP6A 1WA4A 1A6CA 1IS3A 2WFF3 3TNQA 5F6KA 1FOD2 2ARCA 4QPIB 4LE4A 4IESA 3THPA 5A1AA 3DPRB 4Q29A 4QDSA 3W5NA 1EUTA 4B8EA 4BU2A 1ZA7A 3MW4A 3PNAA 1GWMA 3CJXA 3T2OA 5HV0A 5IHRA 5K8SA 5A7PA 1LENA 1AF9A 1ST8A 1X36A 4Q0UA 5F32A 3LGRA 5FXZA 2VL4A 1HIXA 1WLCA 2K2SA 3VDDA 3LZZA 5FREA 3NAPB 5L9BA 2OUHA 1SQ4A 2A6WA 1Q8QA 4RN5A 1V70A 4LMFA 2VOWA 3AJZA 2VXJA 1OHFA 4UBGA 3FBYA 3FHIB 1CPMA 2RR13 5A6ZA 1N1TA 5H9PA 5CU1A 1D4VB 1F4HA 2VU9A 1V6IA 3VDAA 1KITA 4ES8A 4P08A 4YGDA 2JIJA 2Y8KA 5FYHA 4R8HA 2VZRA 2LW8A 2LALA 2QE3A 1HB2A 2ZAAA 1JHNA 5APAA 2ORXA 3ILRA 3ZX7A 4LK7A 4DQAA 1YFUA 4Q0QA 1SZBA 1CVNA 1ZM1A 4XDQA 4EN9B 1AYM2 2ZHKA 4JTOA 1DLCA 1T6BX 4YM2A 2R49A 5T5OA 4NRQA 3NNLA 4A3XA 4N43B 1S0DA 1YRZA 4COWA 1LB2A 4CCLA 3LAGA 4I30A 3HIFA 2WIIB 1U5IA 5CZKA 1N3PA 3PU8A 3OBAA 4BXFA 1BBT1 4NWWA 4D0QA 2VW0A 3USUB 3IZOA 2WT2A 2ZZQA 2DVFA 2QDRA 2JIGA 3FFZA 4XURA 3S5QA 1DYPA 1C1LA 4XFCA 2GMEA 5FRAA 3KWVA 1DZQA 1PMIA 2ZGMA 4IUGA 2JECA 1C8NA 1QH6A 3H9AA 2C5DA 2WWJA 1RUC1 3LKJA 1Q8VA 1HN0A 2GNTA 4WM8B 4XCAA 4NIGA 4K40A 2P4EA 2WYFA 2ZGRA 4JGYB 3TAYA 4BMEA 4LBQD 5F5AA 1SDWA 4WM7B 3O0VA 4Y5Z0 4Q4X1 5DZFA 3AXDA 4CCOA 3R0RA 1R081 5D1IA 1QF3A 5F5IA 2ADDA 1ULFA 4LBJA 1ND2C 4Q4Y1 1PO23 4AE2A 1QMJA 3JBG3 3NAPA 4Q4V1 1PO11 5FJHA 4BPZA 2PLV3 1RUG3 3GZTB 5CG9A 5F1RA 2W68A 5ISLA 3VDDC 2E33A 4XEZA 5A3TA 2DUOA 2VBBA 1I5ZA 3MW2A 1V9U2 4XCBA 4PIYA 2PLV2 2DCJA 4LKEA 3DPRC 1GYKA 3ZYGA 1RUJ2 5AFEA 3VHNA 2D3PA 3VBOB 2AGSA 1H6YA 2JDUA 1WBFA 2RS52 3ZYRA 5ACA2 4XXAA 3LQCA 4C90A 3LIHA 1O4YA 2WA4A 3OUHA 4CCKA 3KVAA 1O7FA 4EN6B 4XTPA 4F83A 1FAYA 5KWRA 3F2ZA 3K4ZA 2VR4A 3UKVA 2SLIA 1GR3A 4FP2A 3ZN6B 4TZDA 2VNOA 3WG2A 2PQSA 3ACIA 3SCHA 2EXJA 1PX4A 4LJHA 1OLQA 3SCFA 2RS32 2XBO1 4XF1A 2H6CA 1G8WA 1DQ5A 1LGNA 1SLCA 3POFA 4XE9A 1R091 4LQRA 2LROA 1MS0A 3PVOA 1AR71 2CWSA 4CUCA 1NCQA 5G04L 4YZ5A 5T52A 1AR72 2FMDA 3D0SA 3I7DA 1ZZ9A 3GNEA 3VBHA 4KI5M 3VZMA 5EYYA 1S0GA 4XHBA 2BP6A 3WHTA 4A7ZA 5C5TA 3WZ1A 2RS31 4BM8A 1ASJ2 4KU8A 1W0NA 2YGMA 2RM22 4YVWB 4QQOA 4CDQB 3PIGA 4Z2AA 3IIAA 3O1OA 4SBVA 5FYMA 2RHPA 1WBLA 2XJUA 4FPYA 5A3LA 1K5MC 3POWA 3EMRA 1SBEA 4CCCA 5ACA1 3RYKA 4AK3A 1RUG2 2R041 2RS51 4AF9A 1GWKA 2XL7A 4UFJA 3VL9A 4HL0A 4DUWA 3PVNA 4P02B 2VD7A 4KL1A 1W8ZA 4AEJA 5JAXA 1HB3A 4XC9A 2A6VA 3FBMA 2R1BA 4GWIA 1JYIA 2TBVA 5BYNA 3FJSA 2DU0A 4L2NA 2N7GA 2OXBA 4JZRA 4ZY9A 2LTNA 1MS3A 1S1AA 4XJZA 1RTVA 1JXNA 4PDWB 4Q4V2 2CHHA 5E8AA 1PGL2 2CTVA 5EHDA 4P9JA 1CAWA 4I3GA 1AR63 1Z78A 5LB6A 4LO5B 2C6SA 1TEIA 2X29A 1F31A 4I0BA 1UMHA 5K0UC 3T30A 3ON7A 1BYHA 1LHVA 2OPWA 2NYYA 1YQ8A 1GNHA 5AFBA 3FLRA 3H42B 1F9KA 4M0HA 3J8F2 2HWD2 2E63A 3KM5A 4KBBA 4BQYA 1B35C 1XC6A 1D4M1 5LRRA 5EJZB 1GSLA 5LA2A 3UJQA 4NMIA 4CCJA 1RUC2 3DN7A 2VNGA 3KV5A 4INDA 3WHUA 1AR73 2VW1A 4FSJA 1W6OB 4P9WA 2UU8A 1YIFA 3ZVXA 4O9GA 2NPIA 1ODMA 5JSOA 2DCYA 3JB8A 4TWTA 4B29A 1S0JA 4ZXKA 3POIA 1XJAA 5FLIA 1MVQA 1GQPA 4RSUA 2RS33 3DYPA 3LA7A 4XMIA 1CWPA 1W2AX 5LCWL 4KU7A 1ZREA 3ASIA 5FY9A 4YM3A 1LOGA 3U0ZA 4RD7A 1EY2A 1SLBA 1FPN3 3B3QE 1RUD1 4META 4DS0A 4YZ3A 1WCSA 1DGRN 4HVRA 2WWSA 4BLIA 4ISQA 4EYUA 3RMYA 1MQTB 1JYWA 2JG9A 2R063 1IPKA 2XGXA 4JGZB 1W2TA 1JZ8A 2AREA 2GN7A 2PMWB 2HEWF 1WMEA 1UZWA 1UOJA 5FZ1A 5H9SA 5C3QA 4WVVA 3HEIA 4M4RA 4FPFA 2HJIA 3AX4A 2JB4A 5F8PA 4OI0A 1HQWA 2W1WA 4FOVA 4OI1A 4C0HA 1YFWA 3WV6A 1A78A 2W08A 3LDKA 2YMZA 1VMJA 3ME2A 4XJAA 3AMPA 1VBC3 4FOYA 3QACA 5FYIA 2ZZJA 3H8OA 4P9YA 4D8MA 1Q5OA 1G9DA 2RMU3 3PURA 4A7YA 3I49A 2WN2A 5HCAA 3ECQA 3VKOA 1HB4A 4AI1A 1DQ2A 3VD4A 4E4SA 1W8TA 5F3EA 1SDDB 2D7FA 1ZBA3 2OA2A 4MGIE 4RHV1 3ZXLA 1V9U3 5JI7A 5LASA 4CUAA 2ZGSA 4PIZA 1UZ0A 3TWIA 1GUIA 4YVSA 4D3WA 5FOJB 5FUNA 5IK7A 2HWC3 2XUEA 2B46X 2WZR1 5A7QA 5EXOA 1ZRCA 4EZHA 2UY9A 4AW7A 5LBCA 1Y4WA 2BW8A 1J1LA 3ZR6A 4LUKA 2BBVA 2HYKA 1HJGA 4BISA 1LULA 4URAA 5FP8A 1WLDA 1A34A 3EHKA 5KC6A 2QZ3A 5K9YA 2VCBA 4CUGA 4LKSA 1A3KA 5FY4A 1GOGA 4LBMA 4GJYA 4X6QB 3WG1A 2JDPA 3PUAA 4E4HA 1WD4A 4ZXEA 3THTA 3P6BA 4Y4RA 1SLTA 3TN92 4B4PA 3B01A 4R4ZA 1KXGA 3AYDA 4E4DX 4FO9A 4NWVA 5JPMB 3VKFC 4OMCA 2CU5A 2LRPA 4IEZA 3NV4A 4PI2A 2DCTA 2BJSA 5FPBA 4CEWA 1BKZA 4LBQA 4HVQA 1QDCA 4AGVA 5FY1A 2QTWB 4DPNA 5TSWA 2FZ1A 2D43A 4HANA 4M4PA 1W04A 5IVEA 2DVBA 1ZA4A 1U0AA 4DUXA 4OYUA 5JSRA 3ZFFA 5EJ3A 4OHZA 5LK7B 3AMHA 4UW5A 3M70A 5FXVA 2W39A 3N7KA 4XTMA 5JOXA 4QU1A 1RMU2 3LDBA 2QQKA 3OY8B 1EV13 3ROUA 3VBSA 5FWJA 1GANA 4D7SA 2A3YA 1CR7A 2VOTA 5DABA 1XNBA 2VBDA 4JQRA 1RUE1 2WZR3 4CDQA 1UIJA 4EWDA 3MIGA 3POSA 3VDCA 1AX0A 1O3SA 4IEWA 4BQXA 3A23A 1OFSA 3NNJA 4GH4A 1LOFA 4LPLA 1K5JA 3RZJA 3EB7A 2WRAA 3KMHA 4IDZA 5C6CA 2P2KA 5C5UA 1COV3 4MGKE 4XJ8A 5F2SA 3H3LA 4UW3A 1LTEA 2ZPXA 3AL6A 3G7DA 3VBUC 1PGW1 5F6LB 4HKWA 1RB8G 3K51A 4NR1A 1OOPC 1AX1A 3HD8B 1HB1A 2QQIA 3I2IA 1TME2 3C7OA 3URFA 1NYWA 3Q8EA 5DAQA 3POYA 2JDKA 1MEC3 2VCAA 4NHXA 1RUI2 3UNPA 3KQRA 5BXXA 2UYAA 3Q8AA 1XNAA 3RJ2X 5KXEA 2DF7A 4HXCA 1AYN3 5FZHA 4WZFA 4YPJA 1IQDC 1SACA 2WDBA 3LPGA 1IKQA 4UF0B 1D4M2 1UCXA 1W6QA 1H2MA 5JOWA 4BQ2A 4DNYA 1ZX5A 5IVCA 1EP0A 1POV0 4CEWC 5HV4A 2D3SA 1LOAA 3VBFC 2WSVA 3D6EA 3HAGA 1IKPA 2O1QA 4Z8BA 1Y9MA 4I09A 2NN8A 4Q4Y3 2D44A 3DKQA 4IEUA 3GXUA 5FZBA 2YFZA 4AGGA 4C0BA 2NMNA 4XMAA 5IFPA 3HBKA 4FPHA 2D6MA 4KG8A 1L7RA 2ARAA 3O0XA 3NRUA 2ES3A 4CP9A 4HPKA 5LW9A 3AFGA 2JD9A 4LT5A 2BRTA 2WKKA 1KDKA 3BTAA 4KNCA 4HN1A 4Y1XA 3LA3A 3VBSC 4LOTA 3ZPYA 1CESA 2VZQA 2R072 4IE5A 1K42A 2OW4A 5FZOB 3SQOA 2JG9B 1R1ZA 1VBB2 2FCUA 5FAXA 4KGGA 3FHQA 4IE0A 4NUBA 1ZVFA 1HV1A 4CU8A 1UZYA 3ZXEA 5I8TA 4OHVA 1U12A 2JD4A 2Y38A 2A6XA 2QQVA 4QGMA 4CDWC 1JZ3A 2H0VA 4U36A 4YW3A 2D6OX 3AL5A 3K75B 4AEMA 4CRQA 4DRRA 4EN7B 1QY4A 5FYSA 1OQEA 3SEEA 3FFQA 4B4QA 4FTEA 1HXS3 1H4GA 2XWJB 1GZTA 1VBA3 2YU1A 3PMEA 2OZJA 3AJYA 1GOFA 3IIIA 2IUWA 3H3UA 3HN1A 1RUH3 3S57A 3WQ7A 4FP3A 5CFCA 1C5IA 1VJ2A 2BWCA 4BIFA 4DO0A 2BBAA 4LEJA 1JYVA 2ADEA 3MLKA 4ZS2A 1H6XA 4RS5B 1RHI1 2BZDA 3N9OA 4CTEA 3VUOA 3N9NA 5H9RA 4MGYE 2WBKA 4TTGA 4V1PA 1PM7A 4N53A 2A70A 1BXHA 1DP0A 3WNKA 4K20A 2FDHA 1RVF2 1VRH2 2DWRA 2DFBA 4Q8LA 4YSFA 2Z69A 4IV1C 4UXAA 3VLBB 1UZZA 4Z1VA 1W8NA 1UY0A 2IWGB 4EN0A 5C4WA 1GZWB 2W95A 1RJ8A 1OA2A 1WGPA 3Q8FA 3TN91 3UK9A 5FP3A 4CVUA 1LHUA 1VRBA 2OQ7A 3AP6A 1UU4A 3VHRA 2JG8A 5C8WA 2A7AA 3GBWA 4RQPB 1UAIA 1POV3 1QXRA 1YCIA 4HPKB 4CDXB 1UN1A 2HYXA 4Q4Y2 4WVMB 3WXPA 4BIOA 1LOEA 2R32A 2CSGA 2HWC2 2XJTA 3EO6A 5FY7A 3RFRA 4LKDA 3T1MA 4RQPC 4KWLA 1GP5A 1Q8SA 2P3KA 1GWLA 3D82A 1APNA 2HWE2 3HBZA 4QQPA 4XUPA 5L73A 1AR62 5D21A 5BNPC 3AP4A 2ZGOA 3VV1A 2PHTA 2WZR2 2YC2A 4NHYA 4RHV3 1GP6A 1UD1A 5FBJA 5IW0A 4TN7A 1JZ2A 1J3RA 1IS4A 4ARXA 4GWNA 1GNYA 1REFA 1G9AA 5F5CA 4A2UA 4JX0A 4I01A 3NAPC 2AENA 3VBHC 4CDWA 3KSCA 3AP7A 3LA2A 5FPAA 3KLSA 4KWKA 3WNOA 2D5HA 4CEYC 3B93A 2W0XA 4IEPA 4NO4A 2W1QA 2E7TA 3B00A 4NPLA 1OXCA 2PELA 1F5FA 3ZFGC 1DGWA 4BA6A 4BZ4A 3T08A 2WQZC 1Y3TA 2B9UA 1ZRRA 1NXMA 2OYZA 1XE7A 1VB2A 1XPWA 2J1SA 2PHDA 4LBNA 4AR2A 1FMD2 5LATA 1HRV1 1O3TA 3H50A 3KV9A 2ARXA 3SKVA 2ILMA 2Z79A 5DUWA 1ENRA 4JC1A 5A7OA 4UFMA 2JKBA 4AAPA 4FOWA 4L8QA 3JZVA 4DIQA 1JUIA 1XOYA 4S2GA 1RUD3 1XNKA 4XETA 2ZX1A 4AFBA 2JDZA 1X82A 3UETA 3TEXA 2GC2A 4JDMA 5KXCA 3RZGA 2ZMLA 2HWF2 2ZHMA 1UOFA 5IWFA 4UAPA 2B5HA 5IAXA 1VLNA 2X53S 4KWUA 4K3UA 4JHTA 5FZIA 2XL9A 4FPEA 1QJU2 2GC3A 5SV5A 1UMZA 3NJXA 4CXXA 3W20A 2HWB2 2ZOEB 3JQWA 1AX2A 3JQXA 4GH4C 1DQ6A 3T1LA 2B42B 1LECA 1RUJ3 3TOJA 3A21A 4ITCA 2YC4A 4R9DA 1FT9A 1QQP2 2ET7A 3B7MA 1JZ7A 5IUQA 4CCEA 4CZSA 2V5YA 1YWKA 2XXZA 4NROA 4TLGA 3WVJA 4FI9A 5BNPA 1L7QA 3WF4A 1PIV3 3G6JB 1VAVA 2PAEA 1SBDA 2K46A 3I2JA 1UXXX 2VMGA 3ORJA 2ZKNA 5BUVA 4WM7C 4L97A 2WR9A 3OY8A 1NLQA 4J1XA 3N9QA 1DFQA 4XBQA 5LBBA 4YZ1A 1OVSA 1PGL1 1I9RA 2EA7A 3GJBA 5F39A 4YFWA 2WNVB 1LGCA 5FUIA 1UX7A 3KD4A 3NVCA 5GZEA 3T4VA 5FWEA 4BQ3A 1ND2B 4JAAA 1ZRDA 1JS9A 2O8OA 1YI7A 1POV1 1W99A 1ZZBA 2CDOA 3MFAA 2LS6A 4FFFA 4LO8A 5FZAA 1OFNA 2AEYA 1RUNA 4CCMA 1GU3A 5IVFA 3FL7A 4YW7A 5FZ8A 4ASKA 4LNVA 3E5QA 3KHBA 1RVF1 2RS11 3WP5A 1BEV1 1H9WA 1AR81 2NZ9A 4MX3A 3ZSKA 4OVEA 1WUVA 5D8AC 1W9YA 4ZU5A 2ZHNA 3MIHA 1CAVB 4QPIA 4E4ZA 1GMMA 4O65A 2B4KA 4EZ4A 1QJY1 3ZFEB 2WABA 1VBE3 1YUDA 2K9ZA 2Z42A 5A33B 1RUOA 2Y60A 2ZMNA 4CDUC 2W3JA 2ZA9A 5E6HA 5FPUA 2B39A 2CDPA 2G4IA 4W4ZA 4HKLA 3NV2A 1R093 4Q5OA 1URXA 4E9KA 2DVAA 4Y5SA 1D7PM 3BOPA 4TXWA 2B9VA 4CP9B 4IETA 4XBNA 5I0RA 5JXIA 4A45A 3GBFA 3I3EA 3JB4C 2D40A 1EPWA 1JH5A 4ZHNA 2RDNA 1EAH1 2OKXA 4CPBD 5CAZA 2AZ5A 1LESA 4QDQA 2R071 2F4PA 5FZDA 1IG0A 3APBA 2CAUA 1LJ7A 4X6RB 1VBB3 4XZPA 1W6NB 1GV9A 3BOWA 1PMJX 2QBXA 4V2WA 2DCKA 3RMXA 2VOVA 2XONA 2PLV1 2WAOA 3AP5A 1QOOA 1FNYA 1NCRA 3GALA 2A75A 3U11A 2JG8B 3I3MA 4GMP1 2WINB 4XUNA 2J1EA 3V56A 3ZSEA 2PHLA 5EV7A 2DURA 1NLSA 3NJVA 5IYYA 3GF6A 2P17A 5GLZA 1CAWB 4Q4W2 3BGAA 4HSLA 5EFUA 2HWE1 1HXS2 2VPVA 4GALA 2J1AA 4OUSA 5DUXA 3T2TA 5ERLA 3RPQA 3VBUB 1R082 1ODNA 2CV6A 1OC1A 5FZ6A 2F4LA 3WF3A 1RUI3 4K21A 3LB9A 2VVEA 4EN8B 4GWMA 3WF1A 4Q4X2 2W94A 4IQPA 2E53A 3ZDSA 4CUBA 4OI4A 5K0UB 4A6SA 1CAXB 1QEXA 4MV2A 3UKTA 1E5IA 1DGLA 4GIQA 2Q8DA 3MUY1 1G9CA 1IG3A 1UL9A 1XNDA 1ALYA 1KFUL 1SFPA 3ZSMA 2E6VA 3BKZA 2Y6JA 1K3IA 4PQ9A 1VRH1 2E51A 2VO5A 4NN0A 2WFPA 4UFLA 3H1MA 1NCRB 3LE0A 4L99A 4P5YA 2I2SA 2IVJA 5DAPA 4CDUB 2BPA2 2Q5TA 1S2KA 4JQTA 5T55A 2D93A 5JXHA 1H2NA 3KV4A 1F8VA 5GM0A 3D8CA 1C5HA 1W2NA 3PUIA 2EALA 4XUTA 2HWD3 3WQ1A 4JRLA 1FNZA 3HN3A 1TMF3 4YZ2A 1QWRA 4NRPA 1HX6A 1MZ5A 3KT4A 3LFIA 1W28A 1V6NA 4GD4A 3VHPA 4B7KA 2VAUA 5FZKA 3DF0A 3I4IA 2OS2A 4Z2WA 1ZRIA 1LOCA 2NLRA 4Q0VA 4QX2A 5BPXA 1NQDA 5BV6A 1JYTA 3DXUA 1XYOA 1GZCA 1PM4A 1S55A 3BCWA 4ZS3A 5F3GA 4RR3B 2JE8A 3WSOA 4E8DA 5ABJA 4QX3A 2YY1A 1WMDA 1YFYA 4QT6A 2BUKA 1XYNA 2DCZA 4NJ4A 4Q27A 1CZTA 3MDPA 3VKMA 4NIHA 4FTSA 4ES9A 2TUNA 1ULEA 4HG6B 2DFCA 3I59A 1RMU1 2ZJCA 3USSA 3LSDA 5CISA 3BALA 2PAMA 5DUVA 4NHMA 4P00B 1GZ9A 1CIYA 1OKQA 1NQJA 2DTWA 2KM2A 2WS92 3N7LA 1QJEA 4BH9A 5JDBA 4LKFA 3AKTA 2VBPA 2VUJA 1B09A 2GC0A 3SXWA 1LAJA 2FDIA 3ST7A 1DYOA 1BQPA 1S0IA 1MS4A 3KT7A 4XOGA 3HVDA 2YXSA 4C91A 1C8M3 5L7OB 1UPIA 3BVCA 2XJQA 5L7OC 3JU9A 1MZEA 2VOXA 3MIBA 4GULA 3WQBA 3LOBA 1HDKA 1S0FA 3C2UA 2KXLA 2VM9A 4Y24A 5DPNA 4QX0A 4KQ7A 3MF6A 3UESA 2HBUA 3PUSA 2WWUA 1MR5A 1VRH3 4XDOA 4GKYA 2VVFA 5J98B 1WMFA 5CEHA 5J3UA 3ACLA 4QDRA 4AEDB 1DGRA 2XKOA 4C8DA 3AVSA 4FPLA 2FDJA 2XH6A 3N9PA 3V64A 3E97A 1PK6B 3ENRA 3P5BA 2G19A 2P3IA 3AZYA 3HT2A 4MHUA 1QQP3 1O8SA 5JZGC 1UXZA 3S30A 4E2QA 1HQNA 3RVHA 1NLRA 3QH7A 4KBZA 1RC6A 4I0WB 3RI8A 3KHCA 2WSUA 1XU1A 4CEWB 5C7GA 5JPNB 2YG0A 2ZACA 3PL0A 4Q4W1 4AXOA 1RUI1 5FYTA 4CDXC 1YQCA 1C28A 2HWB3 4FPKA 1WLWA 3RYRA 5IVVA 1W39A 3WG4A 1VBD3 2ZGNA 1J59A 2I07B 3HJRA 4I02A 3K48A 4JGYA 1XXNA 5DQ0A 5DUUA 3E1F1 2AR6A 2YPJA 4PLMA 2W5FA 3A0KA 3OG2A 1RXFA 4AHXA 5M0TA 1T2XA 2QFEA 1OSGA 2FDGA 1IQAA 1LODA 3KS7A 1PO13 1FV3A 5LY2A 2I74A 3I54A 1GP4A 1JMUB 1H1AA 5A3NA 1EAH2 1P8JA 2Y0IA 4L11A 4IE7A 4JGZC 1UYZA 2RR11 3EYPA 1AL21 4OUEA 4Y22B 5LRSA 1NAEA 1RUE2 2VMCA 2E32A 5GJ6A 2ZX0A 3SEPA 2VGDA 2WNEA 3KCCA 4GQ7A 1K12A 1VMFA 1FXZA 4WVZA 1JBCA 1W06A 3AZVA 3POJA 1H8TA 4RR3C 1C57A 2VECA 1DZRA 1Q8OA 1Z7S3 2E7QA 2XJSA 4MH0E 1IHMA 4OUMA 2JG8C 2VTXJ 4NIIA 5I91A 1JYCA 2QDNA 2GMPA 4QXKA 1UOBA 3L9JT 4LLFA 1W03A 3TRSB 4EE2A 3ZMNA 2WO3A 2EIBA 3WDVA 4QWNA 1Q56A 5FO8B 4Y1YA 2QUOA 1XRUA 4I3PA 4RQPA 4W6XA 2Q8CA 3RWKX 5FPVA 5LY1A 4NHKA 1F4AA 3H1WA 4DEVA 3VD9A 4K9SA 4L9BA 1W8FA 1C3HA 5CFCC 2A5ZA 2BDRA 2GNDA 4YGEA 4NOTA 3PHMA 5IVYA 1W6PA 1QU0A 2F17A 4K1YA 1RJ7A 3LPFA 1D2QA 3ACGA 3BI3A 4IGOA 1AR91 1ZBE2 4AQ2A 3NMBA 1WZXA 2X8KA 4XJ9A 4XF4A 4Y22A 3RZZA 1ULGA 3OTFA 4HBNA 2R30A 1YJKA 1LHOA 1OVPA 2GU9A 3A0NA 3BIWE 1NY71 3DL3A 3GM8A 4IV1A 2ZGTA 2Y34A 2IXKA 4M3CA 3GHNA 4XZUG 5HCBA 1H8TB 3RZLA 4LBKA 3E6BA 1TNFA 1XU2A 3THDA 2ZX4A 1NCRC 2VZUA 4WM8C 1PMHX 5FZ0A 4RFRB 2G9GA 1O5LA 3MI8A 3VBFB 3OD0A 3ALQA 4LBOA 1W6MA 2BNNA 5AVPA 1RINA 1WMXA 1MEC2 1VP6A 5F37A 1AL23 2XLFA 5IATA 5ANQA 2Y6KA 3VBHB 4XHXA 3AKSA 2ZTNA 4MGSA 2PHXA 5LA9A 3VBOA 4JGZA 4XABA 4P5HA 2HEYF 4NIDA 5C3PA 4CYDA 3CJIB 1UY1A 3I2DA 1MPXA 1M4WA 5JUVA 1D0HA 4BMBA 2IXCA 2OZ6A 3BODA 5JR2A 3S5AA 4K1ZA 2ZGQA 4M3CE 4BK5A 2O8QA 1WKYA 4AI2A 3OGRA 2RM21 2KA3A 2HWF1 4QHZA 1IPSA 1JU4A 4Q4X3 4EJRA 5A3MA 5L36A 3W9AA 2O0OA 3BTYA 1YYNA 2Z5WA 4BWOA 3NNGA 1W9FA 3VD5A 3WDYA 5EIYB 1SFNA 2CWMA 4H3WA 2VMIA 3ZFGA 1BVVA 3POGA 1GQHA 2UWBA 2DBNA 3ETPA 4CSWA 3S7EA 5T54A 3Q9OA 3KV6A 2WAAA 4MVTA 1O59A 4MO3M 5HXVA 3LWCA 4GZ9A 4IV1B 4XF9A 4AVSA 1QH7A 3J7NA 1VMHA 1J3PA 2WO2A 4LUMA 5GZGA 4MOAA 3RGBA 2QQNA 2RJKA 1WCKA 2HLEA 3M4FA 4RS5C 5C8CA 1R64A 1LNSA 3UYJA 3JD72 3UGHA 5J09A 3OUIA 4LHNA 1I1EA 5JVVA 4BQ1A 4YFZA 2UURA 3VZLA 1F35A 2Q4SA 3D3AA 3DCQA 1H8VA 5JXGA 2YFUA 2P3YA 2CGOA 3MZHA 3MO4A 2MEV3 1UO9A 2ZX3A 1QJX2 5E88A 5EPAA 4AFDA 4OULA 4UYBA 1COV1 1HN1A 1S4CA 3D4KA 4JKMA 4QB6A 1DYKA 3SHRA 3I59B 3H7JA 4MXWB 2BFUS 3H8RA 5T50A 4NPMA 4DRVA 4F8AA 3TEWA 1OLME 1UYYA 2G1MA 2WNVC 3CZUA 3UJOA 4R4XA 3OBTA 3ZFFC 1AVBA 1NA1A 4COZA 3QBQA 4D6QA 2CGPA 1RVF3 1EUUA 2YPDA 5FMOS 4LA3A 5FYBA 2VZPA 1O4TA 2Y6HA 5KHGA 3WW1A 2VUDA 3MV01 4QB1A 1QJX1 4IEQA 4UF0A 5LBFA 4P14A 4V2VA 3ZMOA 2RJLA 3VKNA 3MLLA 2A73B 5A33A 1OKOA 3VN4A 2JEMA 2VZTA 3CKHA 4AYUA 3DUIA 1H4HA 3WDUA 3AMMA 2YB7A 2CY6A 3RNSA 3AKRA 5BNNC 3ILFA 4NAOA 2XHNA 3JD71 3BU0A 2QCSB 1B35A 5IVJA 1DIWA 5FP7A 3AZWA 2KD7A 1BCXA 4Y3OA 2GH2A 4CP2A 2GP3A 4XYXA 3ZFEC 4R52A 3IT8A 4UI9L 3MV11 2QQUA 2C24A 2XVKA 5FPLA 4BB3A 4IEOA 4FBFA 4MXVA 4MXWA 1DQ0A 5FYZA 3SISA 4AVTA 4R9CA 3AKPA 3NQHA 1NT0A 5D8AB 2X09A 4IV3C 3J4UH 3OOXA 1CAUB 3Q8BA 4M3CF 1UPSA 1ZBE3 4JDNA 5I0UA 4UT5A 4ASLA 4UFHA 1QNWA 1EPZA 5LA1A 5FTTC 5CFDC 1RL3A 4FT8A 1PZ9A 3WINE 3H3ZA 2BYVE 2IFWA 1MQTC 3RRDA 4OHYA 1Q8PA 1DG6A 3B69A 3NJZA 1K5MB 1G7YA 2XBO2 1CQ9A 1W90A 4XIKA 4XQ4A 4EV0A 4QXBA 5AC93 3INAA 5ABJB 3KF3A 4QKBA 2FCVA 2IVIB 2OUJA 2VQ0A 5FBZA 4CDQC 2FMYA 1BEV2 5L9VA 3OJBA 1PX3A 3WDTA 3FE5A 4CU7A 4GAZA 2W46A 2AACA 1H8TC 5JIUA 4XFFA 3ZIXA 4NVPA 2XJRA 5D2AA 1CAXA 3PVBB 1FX5A 3NSTA 3B94A 5B4NA 1UU6A 3RJRA 3RDIA 3ZN5A 4CCDA 2ERFA 2PHRA 1JW6A 3KF5A 5JIAA 2R043 2C26A 4ZU4A 2P6CA 1OH3A 4DXRA 3WOGA 3ZYHA 4W6WA 1YNAA 2PHFA 5LBEA 2WFF2 2VQUA 3PU3A 1D2SA 5A6XA 4CCNA 2VH9A 3V0BA 3WX5A 4HZFA 3A7QA 3IBMA 5KHKA 5JLVA 1B35B 1NX9A 5FZFA 1HV0A 3SC7X 1HRI2 5KXBA 4PF5A 4N43A 4BK4A 3P3PA 4UW4A 4XQDA 5DN2A 2VC9A 2XR4A 5A70A 2JG9C 1QQP1 1LGBA 4COYA 5F9TA 2ETEA 3AB0A 2DBIA 1SFYA 2RMU1 5CADA 2XJVA 3EXUA 3I3DA 3IKWA 4AEDC 1Y7BA 1ZBE1 5I93A 2BGOA 3BYWA 3OPWA 3OF1A 4N9HA 5I0SA 2HWB1 2XDVA 1PIV2 3IAQA 1RUF2 2ZCWA 3OGJA 2VG9A 4B4RA 3UV9A 1XNCA 5FLHA 3CO2A 3CZJA 4FXGB 2VJXA 4AI0A 2OVUA 2Y33A 1W9TA 4QB2A 1IZ3A 4AI3A 3S7IA 2FZ2A 3J8F3 1W9SA 2BV4A 1S0CA 1HLCA 1WW6A 3LIGA 5FZMA 1IPJA 4DXZA 4Q0SA 1LR5A 3O5SA 1ZZCA 1AYN2 1O3QA 2RE9A 3RZMA 1AYN1 4K7JA 2FDFA 3CL1A 2D5FA 2WO7A 3VZJA 5FPXA 2IZWA 3U1XA 2V09A 4ZONA 5LA0A 2XPJA 5KHJA 4PLNA 3K3NA 1HRV2 2VVDA 1RXGA 1N1VA 1OI6A 4H7MA 1UMIA 1AXKA 2XHKA 2V4VA 1S0BA 5CVRA 3V0AB 4X8PA 4LIVA 3D0JA 4Q0PA 1R083 3WW2A 1WCUA 1RUE3 3KGZA 4QX5A 3WUDA 4YVWC 2BGCA 1PIV1 4WBBA 4AL9A 1WCDJ 1F15A 1OT5A 2AUYA 3MBWA 4YW2A 5FZEA 3AM2A 5ABJC 5J36A 4ATFA 3FLPA 3FHAA 4XAEA 4YGBA 1Z7S2 2PTMA 4LR4A 5J1XA 4S2DA 4XAAA 4IE6A 4LITA 5FZ3A 4G9SB 3NKGA 1WLTA 4D69A 1LOFC 5B2GB 3CF6E 3AYAA 4XJUA 4W50A 1ULOA 4UFKA 1AHSA 5FZ7A 2VY0A 3CEWA 1XSQA 4MGZE 1FOD1 2R7EB 4D94A 1S2EA 5IK8A 2G9ZA 3AXEA 4FOQA 3JBG2 4FPCA 1NOVA 1OBNA 4PF1A 4R9BA 1ND3B 1Y43B 1XYPA 1VBC2 1OF3A 1GNZA 4FFIA 1WW4A 3HOBA 4Y20A 5K4LA 5H9QA 1A8DA 3N4MA 2WJSA 5FZOA 5CFCB 1RUC3 4KGQA 2FDKA 2O14A 2XUMA 3I2GA 4JRAA 3I3BA 1DLLA 1OPOA 2PA7A 1LKNA 3HNMA 3LEGA 4QM9A 3TB0A 4OFGA 4LIUA 1YLLA 4LBLA 3ACFA 2IFRA 5ACA3 2QNKA 4FPOB 4B1MA 2ZAHA 3NNMA 2ZGPA 2Y6FA 1O4ZA 2NQYA 4YWAA 5T5PA 4LA2A 3WW4A 4DINB 3THCA 1TME3 3MF9A 1W3VA 2BTVC 2Q1FA 3U07A 1PHMA 2ZXQA 4CP0A 1ASJ3 4KWJA 4NIAA 3VBFA 1FPN2 4QM8A 4MG2A 4YW6A 2ZABA 1W6MB 4FFGA 4H55A 1WWYA 3POBA 3TBDA 4Y33A 2P34A 2EVXA 4L92A 4XJWA 3U4SA 1RHI2 2ZEYA 5T3NA 3OBRA 4CDXA 3MGUA 4H7LA 4DFSA 4IE4A 4DUVA 1AUYA 5CFDB 2XB6C 1IS6A 5A3WA 3T2PA 3ZYJB 2WYSA 4W8JA 3M3OA 5CBLA 4HOOA 2BNMA 1FV2A 1FYUA 1JYNA 1W2UA 1AR93 1KEXA 3FN9A 4PCRA 3DPRA 3VDBA 1QXPA 4IERA 2ZEXA 4XFGA 1RITA 3O7OA 1ZZ7A 4HMZA 2HWF3 2ID4A 4BLJA 2QQWA 5I0DA 1UQXA 2VULA 5E1RA 3ZSLA 2FD8A 4G3YC 2X5IA 2YHJA 4OCTA 1OF4A 1CAVA 4GMP0 2BGPA 2P6HA 5DG2A 3V65A 5GZCA 5HBAA 1SPPA 4URTA 5GLTA 4Z92B 1PNGA 1Z0HA 1AXYA 4AAXA 4CDWB 1RYYA 1POQA 3NO8A 5KXDA 4QGLA 4UWDA 4WVMA 1GFF2 5IJRA 4AHWA 1DDLA 1BVP1 1TQ5A 3VBRC 1YFXA 2XWBB 4FCAA 5A1FA 3IPVB 1KD7A 3C7HA 1O5UA 1RMU3 3I2HA 4ASMB 2BEOA 4LHKA 2VMFA 1NCQC 3DEMA 4LO4B 2J1UA 3VZOA 1ULCA 3ZXAC 4UFIA 2GSYA 4LLOA 5FDBA 5CFDA 5LZ6A 1Y9GA 3AC0A 2WNOA 3IMMA 4IEYA 3FZ3A 3K2OA 5DG1A 1HW5A 3LEMA 3AYEA 4BQ4A 1VALA 4FXKB 2VCMA 3CU7A 4UW6A 3ES1A 2YV8A 1US3A 1W8UA 4Y4YA 1SEFA 2YZ4A 3IDAA 3FLTA 2IXJA 2RVAA 4GB32 4J1WA 1CJDA 4NPRA 3JXSA 3T3YA 4N53C 5GZFA 2JDYA 3S0MA 3TN93 4LOSA 2PXJA 4XUOA 3VGIA 5JOYA 1SPPB 5G05L 2WO1A 1MS8A 4LORA 1DF0A 4M01A 5FKCA 3CHXA 1BJQA 5D8AA 5I8SA 2F6BA 2Q8OA 3N9LA 5JSPA 1BEV3 4ZZ8A 1MZFA 3ZXJA 2A3XA 3E6DA 1RHI3 2EIEA 4E27A 4MADA 1ENXA 5CB7A 3ZIWA 4YVSB 2VZOA 3ZOIA 1PGW2 4B1LA 5K0UA 5KHHA 1W0OA 1D4M3 2VNRA 1KGYA 1H1IA 5EJ1B 5BNPB 3MHZA 3MPPG 1EV12 1VBA1 3WNPA 2J1TA 3HPNA 1RUG1 2R042 1QJZA 3ILNA 4G4FA 2ARBA 1W05A 3GJAA 5HI0A 2XQXA 4AHYA 1SCRA 4WZCA 4Y5TA 1UNBA 3WF0A 3B9CA 1QKQA 2C9AA 3E5XA 1RUF3 2EF6A 2P37A 3M7AA 5B4XA 3T0BA 5EZWA 1X9PA 3IM0A 5FZCA 2XQRA 4OHWA 5FZGA 3WW3A 5LEKA 1A8MA 5GKAC 2AEZA 4YYOA 3WDXA 2W47A 4FPJA 1PVXA 1QOTA 5J96B 5KR7A 3WF2A 2D3RA 3O1UA 1KRIA 4GB33 1AXZA 2WN3A 1N47A 2E26A 2RS53 2BQPA 2YBSA 4QPGC 4S2HA 3E6CC 4AQTA 3ZDVA 2R073 1CX1A 5EP9A 2NM1A 2VMDA 3VL8A 4AWDA 1BMV2 3ELNA 1UW8A 3T09A 3LEKA 1R1A1 3SLIA 5KBFA 1VBE1 2VMEA 2WNUA 2WNVA 4YW4A 3ZYBA 5AC91 3R4SA 3ZKUA 1LHWA 2XLGA 3GZUC 2XBO3 3O0WA 4HVOA 5F5QA 5I8YA 1AR82 4CXYA 2B7YA 3W58A 1MEC1 1O91A 3J26N 4ARYA 3IB3A 2VOKA 2RS12 2BU9A 4HKOA 3I2KA 5FFOC 5FMOL 4QXHA 1W6PB 5L9RA 3SH4A 1AR83 3BB6A 3OCPA 3ZN4A 4N7UA 1V6KA 4MLOA 5E89A 3WQ0A 4JCKA 4LTAA 1ZZ8A 1V9U1 2ZGUA 4L0PA 5K7PA 1H0BA 1UKGA 4GKXA 1CX4A 1QDOA 3ZM8A 1V6OA 1ACCA 2HKXA 3M1HA 3WCSA 3MUZ1 4M3CB 3JUUA 4XF3A 4AEKA 3HNBM 3CIHA 3R4DB 4GH4B 2BERA 1J3QA 3C7EA 1YEWA 4YGCA 3GHMA 5F3IA 1LU1A 1KS4A 2WQ8A 4RYDA 2JDMA
chains in the Genus database with same CATH topology
3JBG1 4Q4V3 5J7MA 3PLQA 1DQ1A 1IGOA 2ZS6B 5T5JA 4ORFA 3WG3A 1PO21 2A3WA 4Y26A 4F3JA 1KJRA 2B8MA 2LUWA 4QU2A 4FAGA 5JMCA 4PBOA 4YG0A 3M3EA 1YIPA 4JTNA 3VBSB 3ZYIB 2DVDA 4B7EA 1VBE2 3QCWA 1OD5A 3HMYA 3H8UA 4RHV2 5C33A 4Q8KA 4YG3A 2R061 3PJQA 4RFT0 2A6ZA 3N3HA 2C0ZA 4SLIA 3LCPA 3MIDA 3TNPB 3W59A 1BBT2 2BVBA 3WUCA 4MUVA 4FPGA 1GZWA 2JICA 2PAKA 4WVWA 4W65A 2GDFA 2JX9A 4XFIA 2IXLA 2SBAA 4K6BA 3R4UA 1BBT3 2X5IB 1U5ZA 1VB4A 3PMSA 2Q1ZB 2ZGKA 1Q43A 1AL22 1ENQA 1W6OA 2WLPA 2BWAA 3MICA 1AYM1 3QH6A 4I2OA 3ZFGB 1LU2A 4TYSA 2GNBA 3WP4A 3SNMA 3ZYPA 1QGLA 1LCLA 3M2MA 1AZDA 1VIWB 4DOUA 4AVVA 2Y0OA 2Z2SB 1E57A 3FX3A 2NP0A 3KB5A 1DGWX 1LRHA 1VAMA 2WT1A 3FMGA 4N43C 3V0AA 3GYDA 1X33A 1X50A 5GZDA 1JN2P 2RMU2 1H2KA 1QHDA 3VHOA 3RS6A 2WL1A 1ZNPA 1DHKB 2UYBA 4QPYA 1R1A3 5KC5A 1CONA 5DDJ2 1O3RA 4X8NA 3MIFA 2PQQA 1AR61 3IWZA 1H1MA 3OD4A 1V00A 3IPVA 2WFF1 4JGYC 3VBUA 1AL0G 4QPIC 1U5XA 3FUOA 2GNMA 5J37A 3NV1A 2HWC1 3B02A 2WQ4A 2JE9A 1YJLA 3AKQA 3NWKA 3WR0A 5J48A 1V6JA 5BNNB 5LK5A 1DZTA 1SLIA 1MVEA 4XPVA 1QJX3 3PVEA 2WS91 4P9XA 4DMIA 4XXPA 2DTYA 4Z82A 5AVAA 4E2GA 1EYBA 5IT6A 5JZGA 4BOWA 1YO8A 1OA4A 4AFMA 1REDA 2EAAA 3KCXA 5BY5A 1NZCA 2AYHA 4AQSA 2D6LX 4BE3A 3NL1A 2ENRA 1LEDA 1PGSA 4J6GA 1ASJ1 4QPGB 2DU1A 1JOJA 2RS13 3SMHA 2CNAA 2YYOA 1UX6A 2D98A 5CNAA 3WP3A 1SLAA 4LHLA 4U2AA 4O9EA 4DY5A 1JUHA 1ENSA 3IDCB 3IN9A 2XJPA 4IEVA 4IV3B 5C4WB 1R092 2EXHA 1MS1A 3AZXA 2DVGA 2WNUB 1KQRA 1PNFA 3H7YA 4LULA 3MLJA 1HKDA 3MFCA 3M3QA 1X7NA 1U5YA 2ZKLA 2AH2A 2HWE3 4KH9A 5C9AB 2E9QA 4P9GA 4AI8A 4OZXA 4UBHA 2GN3A 1X8MA 2VW2A 5FQ0A 3IDBB 4E2SA 1RUH1 2FQPA 5GALA 4HK8A 4DZGA 4WM8A 1RUJ1 1UKRA 5EWSA 2YGLA 2CYFA 1GKBA 4PDWC 4QPGA 1XQNA 1NE4A 1ZBA2 4H14A 3ZFFB 1UIKA 4MSVA 4PIXA 4N9IA 1N3QA 1REEA 3ETQA 2MHFA 2Q0AA 2WLQA 5C8CB 1VBC1 1W0PA 1IOAA 2R1DA 4ONUA 1FATA 1G86A 2EIGA 3FUQA 4QMAA 1LEMA 3RWNA 4P9LA 5L7OA 1COV2 2YUEA 3OPZA 4YM0A 3GZAA 4AFAA 5FOBB 2GALA 1PZ8A 3BU7A 5FO9B 4HSJA 3SH5A 4QQHA 2CGNA 4CEYB 4AVCA 3HQXA 3HT1A 3OYWB 4TLFA 3UL2A 1NE6A 2R0HA 2QQPA 4K8FA 4HT1T 3EQEA 1CIWA 2H0BA 2Q1MA 4AVAA 2X5IC 1HRV3 1I6XA 1EAH3 4Q4W3 1VR3A 3FC0A 1FMD3 5I0TA 3PJYA 3X29B 4NHLA 4XW3A 3VBRA 1M06G 1Y9QA 4XQWA 1GICA 1CGPA 1QOSA 2GMMA 3AK0A 3WD5A 2PN5A 4LO6B 5BNQA 3QOPA 4PBPA 4Q1RA 1NXD1 5L19A 2XLAA 2EAKA 2HEVF 1QJY2 4XFBA 1KS5A 5GLWA 5A32A 3FWEA 5C4WC 1C8M1 1C4RA 1JTZX 1RUF1 1L3JA 3R05A 1G9FA 4MYEA 5FLJA 2A6YA 1H9PA 2BVVA 2XG3A 3KZ4C 3N7JA 4Y1UA 2MPFA 4OLLA 4FTBA 3GBGA 1TE1B 2VMHA 4Q2FA 2D6NA 1PVC3 2QKDA 4PJYA 4COUA 1ZZ6A 4WV8A 2P3JA 1OQ1A 3E5UA 4RR3A 5L7OB 2YDEA 4IXLA 2C1FA 4YW5A 1NA1C 2JJ6A 4AGRA 1ND2A 4JV4A 5FPZA 3NKTA 3RSJA 1HRI1 4XBLA 1GBGA 1NA1B 1KJLA 3USUA 4Y20B 4A7KA 3ZXFA 4F7ZA 2ZGLA 1ND3A 1OOPB 4ISRA 1N1YA 4RS5A 5C8CC 1OA3A 5DXDA 4Y1ZA 4YM1A 2PFWA 1V6MA 1NY72 3SCGA 3JCIA 4AG4A 4AFCA 5DDJ1 1J58A 2WA3A 3N35A 2MNGA 2QVSB 4N90A 3VDDB 1AR92 3ZFEA 3MW3A 2WZPP 1Q3EA 4Y1VA 1QJY3 3H0OA 4IEXA 1W6NA 5JZGB 1QJU1 4YW1A 5EYXA 5T5LA 5JR7B 5HCFA 5CA6A 3L2HA 3MIEA 2I45A 1TMF2 1QXJA 5JWPA 1H2LA 1R1A2 3WDWA 1CAUA 2TEPA 2Q30A 4C1WA 2ZMKA 1MQTA 2IC1A 2JE7A 4HLTA 1SMVA 2WNUC 1S2BA 1PVC1 5FCCA 1KDMA 1ZYBA 3WNXA 2WT0A 3L2YA 1K5MA 2MEV2 1KFXL 4AQ6A 1FMD1 5C9AC 1D0GA 4BCUA 1NG0A 3PTYA 1MS9A 2IXIA 2YC0A 2TNFA 1VBD2 4Q1PA 1PK6A 3WCRA 3HWJA 2DUPA 4QQ2A 2B45X 3JD73 2WS93 3NW4A 1PVC2 4FAHA 2FHRA 4S2FA 4QQLA 1CD3G 4EWEA 1EV11 1VBA2 3MYXA 2DYCA 1W6QB 1RUD2 2D6PA 2PHUA 2R062 2ZBJA 3ZXKA 4ZKTB 4WM7A 2WC2A 1TMF1 4C1XA 1CJPA 3A4UA 2XVLA 3RI9A 4GXLA 1ND3C 5SV8A 4EROA 4COVA 3V0BB 1V6LA 1PO22 4N53B 1QJU3 2JXAA 2V73A 4FQ4A 4ZU7A 4OHXA 4KG0A 2R16A 3ZXDA 3SH3A 1ZRFA 3VBOC 2UWAA 5BNOC 4XFHA 2A71A 2GZWA 2HWD1 3J8F1 3WY6A 3DV8A 4HFSA 5IK5A 4CEYA 4I0AA 5BNOB 4XILA 3OYWA 1LHNA 5FQ0B 3N7MA 2GH8A 1F5JA 1MS5A 1OMIA 4PDWA 1WW5A 3AP9A 4QHBA 3ATGA 4JDOA 5JOZA 3CLPA 4LBQB 3AZZA 3ZN6A 3HR9A 1AJOA 3J9SA 5JI9A 2Y26A 3N36A 1TNRA 5GLUA 2LM3A 3ZO0B 5AC92 1XE8A 4D7YA 4CP1A 4YARA 3LSEA 4LE3A 3B5LB 1N1SA 4GMP3 5IK4A 1BMV1 2OPKA 3RQ0A 3IDEA 5C9AA 4N7IA 3RG0A 4RGAA 4DY3A 3U4XA 4JVAA 1RIRA 3C3VA 1IS5A 1OPMA 1J1TA 4AEDA 2VXRA 1DBNA 4YVWA 1UU5A 1FI2A 1C8M2 3ZXGA 1G6NA 3MEPA 1BK1A 2W52A 1H30A 3M8LA 1C1FA 5FO7B 4XF0A 1DQ4A 4YG6A 1VBB1 4Q26A 4AHZA 1N3OA 4Z07A 2UY8A 1I3HA 1F2NA 2E7AA 2JENA 4IV3A 3VBRB 4EWAA 4GA9A 2CAVA 3P3NA 1S0EA 1FPN1 4TSVA 2GAUA 4DB5A 3DKWA 3LOIA 1WW7A 1AJKA 2ZHLA 1DU3D 2FBEA 5BNOA 2OIIA 3DGTA 2EXKA 1GLHA 2VQAA 2ZX2A 1QNYA 3QD6A 1CPNA 1CN1A 4D7TA 5DZEA 1RGSA 3KCYA 5DZGA 2YROA 3ZSJA 3AYCA 4MZUA 1PZ7A 1T6GC 1UF2C 3TYJA 5BNNA 2EXIA 3WT3A 1PO12 3CNAA 4RGGA 4GB31 2UWCA 5GLVA 1HXS1 4RA0A 4YVSC 2QZ2A 3IMNA 1TME1 2D97A 4HK9A 4YZ4A 3AFKA 3EJKA 3O14A 4B3NA 1ZBA1 2R0FA 1SLLA 4CDUA 3MPBA 1X8EA 2ATFA 1SCSA 1MZ6A 3CJIC 4YNIA 5E16A 1SBFA 1VAKA 1Z7S1 5KHIA 4FQZA 3M3CA 2QJVA 1RUH2 4R9AA 2BFUL 3B9IA 4FVVA 4P9IA 1YXWA 2BNOA 4XIOA 1YHFA 2RM23 3WLUA 2DUQA 1VBD1 4LO7A 4XFAA 3VZKA 1HRI3 1ULDA 4IL7A 2RR12 3AMQA 3R6SA 2IXHA 3ES4A 2XVGA 2MEV1 3I8TA 4YLZA 4QD2A 2VUAA 1NCQB 3UKNA 4HN0A 2PYTA 3EBRA 2K0GA 3RYPA 1OOPA 3U10A 4BYYA 5DDJ3 2H6BA 1MACA 4M00A 3S6PA 2G9FA 2XKPA 5CG8A 2ET1A 1ONAA 4YRDA 4BHPA 3AMNA 3OGGA 3VKLA 3VZNA 3KT1A 4PLOA 5A32B 5LEJA 1GQGA 1BZWA 2PHWA 3SITA 3D5OA 3NV3A 1PK6C 3O12A 2NMOA 3M3IA 1G9BA 2DV9A 3H1YA 4HETA 1YI9A 3QLQA 5JCTA 5CIRA 4W6YA 1HQLA 2R6QA 1AYM3 1OQDA 4AVBA 2CL2A 3BPZA 2D6KA 3KGLA 2GC1A 1LOBA 4OI2A 1WD3A 1FOD3 4ATEA 1OLRA 3CJIA 4RL7A 4QGNA 3WP6A 1WA4A 1A6CA 1IS3A 2WFF3 3TNQA 5F6KA 1FOD2 4QPIB 4LE4A 4IESA 3THPA 3DPRB 4Q29A 4B8EA 3MW4A 3PNAA 3CJXA 5K8SA 1LENA 1AF9A 1X36A 4Q0UA 3LGRA 1HIXA 1WLCA 2K2SA 3VDDA 3LZZA 5FREA 3NAPB 2OUHA 1SQ4A 2A6WA 1Q8QA 1V70A 2VOWA 3AJZA 1OHFA 4UBGA 3FBYA 3FHIB 1CPMA 2RR13 1N1TA 5H9PA 5CU1A 1D4VB 2VU9A 1V6IA 1KITA 4ES8A 4YGDA 4R8HA 2LALA 2QE3A 2ZAAA 1JHNA 3ILRA 3ZX7A 4DQAA 1YFUA 4Q0QA 4XDQA 1CVNA 1ZM1A 4EN9B 1AYM2 2ZHKA 4JTOA 4YM2A 2R49A 5T5OA 4A3XA 4N43B 1S0DA 1YRZA 4COWA 1LB2A 3LAGA 4I30A 3HIFA 2WIIB 1U5IA 1N3PA 1BBT1 4NWWA 2VW0A 3USUB 2WT2A 2ZZQA 2DVFA 2QDRA 3FFZA 1DYPA 1C1LA 4XFCA 2GMEA 5FRAA 1DZQA 1PMIA 2ZGMA 2JECA 1C8NA 1QH6A 3H9AA 2C5DA 1RUC1 3LKJA 1Q8VA 2GNTA 4WM8B 4K40A 4BMEA 2ZGRA 4JGYB 3TAYA 4LBQD 1SDWA 4WM7B 3O0VA 4Y5Z0 4Q4X1 5DZFA 3AXDA 3R0RA 1R081 5D1IA 1QF3A 1ULFA 4LBJA 1ND2C 4Q4Y1 1PO23 4AE2A 1QMJA 3JBG3 3NAPA 4Q4V1 1PO11 4BPZA 2PLV3 1RUG3 3GZTB 5CG9A 5F1RA 2W68A 3VDDC 4XEZA 2DUOA 1I5ZA 3MW2A 1V9U2 4PIYA 2PLV2 2DCJA 3DPRC 1GYKA 3ZYGA 1RUJ2 5AFEA 3VHNA 2D3PA 3VBOB 2AGSA 1WBFA 2RS52 3ZYRA 5ACA2 4XXAA 4C90A 1O4YA 2WA4A 1O7FA 4EN6B 4XTPA 4F83A 1FAYA 5KWRA 3UKVA 4TZDA 2SLIA 1GR3A 4FP2A 3ZN6B 2VNOA 3WG2A 3SCHA 2EXJA 1OLQA 3SCFA 2RS32 2XBO1 4XF1A 2H6CA 1G8WA 1DQ5A 1LGNA 1SLCA 4XE9A 1R091 1MS0A 3PVOA 1AR71 2CWSA 1NCQA 4YZ5A 5T52A 1AR72 2FMDA 3D0SA 3I7DA 1ZZ9A 3GNEA 3VBHA 3VZMA 5EYYA 1S0GA 4XHBA 3WHTA 4A7ZA 3WZ1A 2RS31 4BM8A 1ASJ2 4KU8A 2YGMA 2RM22 4YVWB 4QQOA 4CDQB 3IIAA 4SBVA 2RHPA 1WBLA 2XJUA 4FPYA 5A3LA 1K5MC 3POWA 1SBEA 5ACA1 3RYKA 4AK3A 1RUG2 2R041 2RS51 4AF9A 2XL7A 3VL9A 4HL0A 3PVNA 4KL1A 4AEJA 5JAXA 2A6VA 3FBMA 2R1BA 1JYIA 2TBVA 5BYNA 3FJSA 2DU0A 4L2NA 2N7GA 2LTNA 1MS3A 1S1AA 4XJZA 1RTVA 1JXNA 4PDWB 4Q4V2 5E8AA 1PGL2 2CTVA 4P9JA 1CAWA 4I3GA 1AR63 1Z78A 4LO5B 1TEIA 2X29A 1F31A 4I0BA 5K0UC 1BYHA 1LHVA 2NYYA 1GNHA 5AFBA 3FLRA 1F9KA 4M0HA 3J8F2 2HWD2 2E63A 3KM5A 4KBBA 1B35C 1D4M1 5LRRA 3UJQA 1GSLA 1RUC2 3DN7A 2VNGA 4INDA 3WHUA 1AR73 2VW1A 4FSJA 1W6OB 4P9WA 2UU8A 1YIFA 3ZVXA 4O9GA 2NPIA 5JSOA 2DCYA 3JB8A 4TWTA 4B29A 1S0JA 4ZXKA 5FLIA 1MVQA 4RSUA 2RS33 3LA7A 4XMIA 4KU7A 1ZREA 3ASIA 4YM3A 1LOGA 3U0ZA 4RD7A 1EY2A 1SLBA 1FPN3 3B3QE 1RUD1 4META 4DS0A 4YZ3A 1WCSA 1DGRN 4HVRA 2WWSA 4BLIA 4ISQA 3RMYA 1MQTB 2JG9A 2XGXA 1IPKA 2R063 4JGZB 2AREA 2GN7A 2HEWF 1WMEA 5H9SA 4WVVA 4FPFA 2HJIA 3AX4A 1HQWA 4FOVA 4OI1A 4C0HA 1YFWA 3WV6A 1A78A 2W08A 2YMZA 3ME2A 4XJAA 3AMPA 1VBC3 4FOYA 3QACA 2ZZJA 4P9YA 1Q5OA 1G9DA 2RMU3 4A7YA 5HCAA 3ECQA 3VKOA 4AI1A 1DQ2A 4E4SA 2OA2A 2D7FA 1ZBA3 4MGIE 3ZXLA 4RHV1 1V9U3 5JI7A 2ZGSA 4PIZA 3TWIA 4YVSA 4D3WA 5FOJB 5IK7A 2HWC3 2B46X 2WZR1 5EXOA 1ZRCA 2UY9A 4AW7A 2BW8A 1J1LA 4LUKA 2BBVA 2HYKA 1LULA 1WLDA 3EHKA 5KC6A 2QZ3A 5K9YA 1A3KA 4LBMA 4X6QB 3WG1A 1WD4A 3THTA 3TN92 1SLTA 4B4PA 3B01A 4R4ZA 1KXGA 3AYDA 4E4DX 4FO9A 4NWVA 5JPMB 3VKFC 4IEZA 3NV4A 2DCTA 4CEWA 1BKZA 4LBQA 4HVQA 1QDCA 4AGVA 4DPNA 5TSWA 2FZ1A 2D43A 4HANA 2DVBA 1ZA4A 1U0AA 5JSRA 3ZFFA 5EJ3A 4OHZA 5LK7B 3AMHA 4UW5A 3M70A 2W39A 3N7KA 4XTMA 5JOXA 1RMU2 3OY8B 1EV13 3ROUA 3VBSA 1GANA 4D7SA 2A3YA 1CR7A 1XNBA 4JQRA 1RUE1 2WZR3 4CDQA 1UIJA 4EWDA 3MIGA 3POSA 1O3SA 1AX0A 4IEWA 1OFSA 4GH4A 1LOFA 3KMHA 5C6CA 2P2KA 1COV3 4MGKE 4XJ8A 4UW3A 1LTEA 2ZPXA 3G7DA 3VBUC 1PGW1 4HKWA 1RB8G 3K51A 4NR1A 1OOPC 1AX1A 3HD8B 1TME2 3URFA 1NYWA 3POYA 1MEC3 1RUI2 3KQRA 5BXXA 2UYAA 3RJ2X 5KXEA 2DF7A 1AYN3 4WZFA 1SACA 1IKQA 1D4M2 1UCXA 1W6QA 1H2MA 5JOWA 4DNYA 1ZX5A 1EP0A 1POV0 4CEWC 2D3SA 1LOAA 3VBFC 2WSVA 3D6EA 3HAGA 1IKPA 2O1QA 4Z8BA 4I09A 2NN8A 4Q4Y3 2D44A 4IEUA 4AGGA 4C0BA 2NMNA 4XMAA 4FPHA 2D6MA 4KG8A 3O0XA 2ES3A 4HPKA 3AFGA 4LT5A 2WKKA 1KDKA 3BTAA 4KNCA 4HN1A 4Y1XA 3LA3A 3VBSC 3ZPYA 1CESA 2R072 2OW4A 2JG9B 1R1ZA 1VBB2 5FAXA 4KGGA 1ZVFA 1HV1A 1UZYA 3ZXEA 5I8TA 4OHVA 1U12A 2JD4A 2Y38A 2A6XA 4QGMA 4CDWC 2H0VA 4YW3A 2D6OX 4AEMA 4CRQA 4DRRA 4EN7B 1QY4A 1OQEA 3FFQA 4B4QA 4FTEA 1HXS3 1H4GA 2XWJB 1VBA3 3PMEA 2OZJA 3AJYA 3H3UA 3HN1A 1RUH3 3WQ7A 4FP3A 5CFCA 1C5IA 1VJ2A 2BWCA 4BIFA 4LEJA 3MLKA 4RS5B 1RHI1 4CTEA 3VUOA 5H9RA 4MGYE 4V1PA 1PM7A 4N53A 2A70A 1BXHA 4K20A 1RVF2 1VRH2 2DWRA 2DFBA 4Q8LA 4YSFA 2Z69A 4IV1C 4UXAA 3VLBB 1UZZA 4Z1VA 2IWGB 4EN0A 5C4WA 1GZWB 1RJ8A 1OA2A 1WGPA 3TN91 3UK9A 1LHUA 3AP6A 1UU4A 3VHRA 2JG8A 5C8WA 2A7AA 3GBWA 4RQPB 1UAIA 1POV3 1QXRA 1YCIA 4HPKB 4CDXB 1UN1A 4Q4Y2 4WVMB 3WXPA 4BIOA 1LOEA 2R32A 2HWC2 2XJTA 3EO6A 3T1MA 4RQPC 4KWLA 1Q8SA 2P3KA 3HBZA 3D82A 4QQPA 1APNA 2HWE2 5L73A 1AR62 5BNPC 3AP4A 2ZGOA 3VV1A 2PHTA 2WZR2 4RHV3 1UD1A 1J3RA 1IS4A 4GWNA 1REFA 1G9AA 4A2UA 4I01A 3NAPC 2AENA 3VBHC 4CDWA 3KSCA 3AP7A 3LA2A 3KLSA 4KWKA 2D5HA 4CEYC 3B93A 2W0XA 4IEPA 4NO4A 3B00A 2E7TA 2PELA 1F5FA 3ZFGC 1DGWA 4BA6A 4BZ4A 2WQZC 1Y3TA 2B9UA 1ZRRA 1NXMA 2OYZA 1XE7A 1VB2A 4LBNA 2PHDA 1FMD2 1HRV1 1O3TA 3H50A 2ARXA 2ILMA 2Z79A 5DUWA