2VQCA

Structure of a dna binding winged-helix protein, f-112, from sulfolobus spindle-shaped virus 1.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
TLNSYKMAEIMYKILEKKGELTLEDILAQFEISVPSAYNIQRALKAICERHPDECEVQYKNRKTTFKWIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL 13.2 KDA PROTEIN
publication title Cysteine Usage in Sulfolobus Spindle-Shaped Virus 1 and Extension to Hyperthermophilic Viruses in General.
pubmed doi rcsb
source organism Sulfolobus virus-like particle ssv1
molecule tags Dna binding protein
total genus 19
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09645 F-112 F-112 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqcA00
2VQCA
chains in the Genus database with same CATH superfamily
3SZTA 4HEA2 3WTXC 2BXYA 1RC9A 3RDIA 3ZCOA 2ETHA 1ZR2A 4ZDPA 3B73A 3GFMA 5EGOB 1IXRC 2VKHA 4CXFA 3GTQJ 3B6CA 2KL4A 2W84A 3TOBA 5CVVA 3BCBA 3K4LA 4XSXF 2OV7A 2YS9A 4L0YB 2EK5A 2KIMA 2CW8A 5C4JJ 1YITI 1MKMA 3FWEA 2W48A 4MTDA 4XLCA 1OLTA 1RNLA 2JSPA 4MTEA 3EUAA 1FSEA 5EZHA 3C2GA 2JRMA 5D8KB 2R4GA 2P5KA 1UG2A 1MMAA 4IL6C 4LLGF 4MIMA 1DGWY 5ED4A 1MJ9A 3QP5A 2VT3A 4BXFA 4KIFA 4OOIA 3RZDJ 3MKYB 3CJQB 1WPKA 1OYIA 3CCEI 4AM3A 4I2OA 3LSKA 3FBNB 3OYKA 3C2HA 2K3FA 4MLOA 4AUXA 3CMMA 1IN8A 1NTCA 5JI6A 3Q0VA 2A69F 4A3DJ 1W0TA 1A6IA 4EJTA 1JE8A 2Q8KA 2XKOA 1FPQA 3QPHA 3LSGA 1I3QJ 1LUJB 2JSCA 5ERIA 3HTSB 3WTUC 3FX3A 4BNCA 3RYPA 4CUGA 4PJJA 4IHSA 1X1BA 1E0EA 1LVKA 4BL0B 3FBIB 2HOSA 1OJLA 4L9TA 2R7OA 1FT9A 3ZMZA 2Z3YA 5C4XJ 3G6EI 2XGXA 4HF1A 3I58A 2DYSH 1R1VA 3HHGA 5HS9A 2PMUA 1HQCA 3SXYA 1RKTA 3EPZA 3A0HC 3H35A 2A6HF 3F0CA 2HQAA 4I01A 3SEQA 1OCOH 2P0WA 2Y31A 4Y13A 1CQTA 3DPUA 4I98B 1EH8A 1TL8A 3M3YJ 4Q47A 1FOXA 3GMEA 1QVTA 4S0HB 1LE8B 3QU3A 1IRGA 1JT0A 3QRFF 4BE0A 1YW8A 2VC0A 1W7PB 1U3EM 2P6TA 3K1MA 2M3AA 1RETA 2VKDA 3CCVI 2X1DA 3FF5A 1T8IA 2VC1A 1BOBA 5D5WB 2COMA 1VQPI 3GFLA 2G9WA 3Q3SA 1B9MA 3BWGA 1K79A 2CV0A 2QQAA 3IAM2 1XCBA 2KLOA 1G3SA 3GFIA 1ZKGA 1HW5A 3OYLA 4ESJA 1IGNA 3DEWA 4N4NB 4GYIA 2GA2A 3LAPA 3OIPA 5E17F 3AG4H 1UAAA 4NQWA 2EIKH 4I0AA 3CMAI 1QHGA 3HRUA 2DMUA 3DTIA 4B48A 1H89C 2V1DA 5CVUA 2LBFA 1AOYA 2CO5A 1FLIA 3OIOA 1R9TJ 1IV6A 1T39A 2ZFWA 4G7OF 1ZGJA 1DUXC 1MDMA 4HV5A 2H8RA 1WZ2A 1IN4A 5CQEA 3JTGA 5IP6A 3KYLA 4OIPF 2MYSA 3OOPA 2E2IJ 1FP2A 2EV6A 3BQYA 5E3LA 1L3LA 4CHUA 3IAS2 1ETXA 4LMYA 3JREA 2OUMA 4BJ6C 4NC6A 4LG3A 2HS5A 1QHHD 1O57A 4U88A 4XLHA 5E1WA 3IRRA 2MFZA 2K9NA 3GLXA 3REOA 4DIQA 1ZLJA 4B44A 4YFNF 3OYNA 5IT9K 3SFZA 2CWEA 4E7IA 2W7NA 9ANTA 2ELJA 4E4HA 3RPUA 2FBHA 2EA4A 2W1OA 3FMQA 3L2WA 1WKMA 1YHQI 3K69A 1MBGA 1ON1A 1STZA 1YX5A 3U21A 5D6EA 3FZVA 4A3KJ 4AC0A 2E5NA 2NOJB 2R7FA 1X1AA 4MQ9F 2VPLA 1YO5C 1LNWA 1VZ0A 1KU3A 2ADUA 1X4OA 2PMZA 2MC3A 3LMMA 4PSXA 1PUFB 4NC7A 3W6KB 2RNJA 2R7ZJ 1OKRA 3D5SC 1OR7A 1KQ0A 1NH3A 5L3EA 2IP2A 1ERDA 3CJRB 3MFKA 4AD9A 3V8KA 2EINH 2VXDA 4BBSJ 1I1SA 3E5QA 3JRDA 5E8IA 3OYBA 1HW2A 2KJCA 1QA6A 2P5LC 3E1SA 3LOCA 2JWTA 3DFGA 4EM1A 2B9SA 1ETKA 1I3AA 4MFDA 3VSKA 1JJ6C 3O3KA 4KN4X 1K78B 4G7HF 4CYCB 1UELB 2H09A 4L5EA 2DA1A 3HOUJ 3JRFA 5DCMB 4E7HA 2A5YB 2QVOA 5E1XA 2YX4A 3VODA 4ZYHA 1VQ4I 1P6RA 1JKRC 3T1BA 4A3FJ 1YIOA 4M3DA 4OIRF 3VEPA 1ZGWA 4GO1A 4FX4A 2F5EA 2LKPA 4HLXA 1H8AC 5EEAA 4KMFA 2D5VA 3CC7I 4M71A 2Y0MA 2HKXA 3L2RA 4XOTA 4YELA 1DPUA 4KFCA 1R5GA 1EA3A 3TKYA 3AL0B 1VI0A 5E1ZB 1QBJA 4JYKA 3HOWJ 1WH7A 4A0XA 3BCAA 2M4KA 3OSGA 4XLNF 2R5ZB 3TQNA 1SANA 1FOKA 2EFQA 4JQFA 2OTJI 3WU0A 3M1CA 4LB6B 4BDZA 4UHTA 4WF2A 5B3SH 4KUMA 1BR2A 1TT5B 5M5XJ 1IJWC 4DYQA 1QU3A 2VONA 4PGGA 1MZBA 4HPQA 3HRTA 2WY8Q 2BE5F 2DFHA 2FNAA 4PGHA 4FHTA 5F0FA 3RQIA 2IA0A 2X85A 3JRBA 2ECCA 1X3WB 2FMLA 2K27A 5K7FA 2G0EA 2VJJA 2DOFA 4IO9F 1FC3A 3LWFA 2Q1ZB 1GUUA 2M8GX 2I5UA 4JOMA 5TGTA 4OAZA 1YW7A 4EATA 4M6VA 2VBZA 4M3EA 4PK4A 1QPIA 3EUHC 3K4CA 2BOLA 1SFOJ 2Y9YA 1MMNA 3W6JB 2ESHA 1LQ1A 1U5TA 4E7KA 2Z1DA 2VJ5A 3WGIA 2H94A 1CF7A 2JA8J 5LEKA 2LSOA 1Y0UA 4B3XA 5LRSA 2V26A 4IOAF 3CDIA 2BVLA 1WJFA 4CH7A 3QWLA 2JVGA 1QRYA 3I9V2 4M9ZA 4AU7A 3I4MJ 3ZR8X 3TDUC 4OWRB 2V1UA 2F4MB 2FBIA 2HYGD 3H9GA 4ENJA 4DGWB 3RCOA 1LPQA 2VQLA 1V4RA 1B72A 1WCMJ 2L4AA 2E2JJ 4BH9A 1MMDA 2QF7A 3QYFA 4B1RA 1Y1VJ 1JKQC 5IYBJ 1ZRFA 2X4HA 2DOAA 1SD5A 2FRHA 4U87A 1S8NA 5A2QZ 2QSHX 3PSIA 5BOXA 1YG2A 2CSOA 1W1WE 1ETVA 4XM3A 4ZYEA 2R92J 5EYRA 2KIFA 3GTPJ 2Y30A 3GBGA 5DEQA 3I4PA 3JSPA 3G1MA 1JT6A 4HG2A 2FE3A 2KT0A 3FKIJ 1DGRM 3F3XA 1XN7A 4PZJA 1IXCA 3WHBA 2RVCA 3L1PA 1OFCX 3E7LA 1R5ID 5F08A 2W24A 3R61A 1KGSA 4BHPA 3BT9A 3KP5A 4QSHA 3GZ5A 1Z3XA 4XRFA 4KNYA 1Z7UA 2K5CA 1ZQ3P 1ORKA 5FB2A 1V5EA 1DP3A 2HOTA 4Y17A 2L9RA 3A02A 1FYLA 2QLZA 3HXLA 2MC4A 3NQOA 3FMSA 4DBQA 4HV6A 5M5WJ 2R7RA 5LFAA 4G6DA 4B47A 1WH5A 3OV8A 2AXLA 4B3AA 1K4TA 2CUJA 1G59A 2DO7A 4KYWA 3BZKA 1TBXA 2FBKA 3RPQA 3TW7A 5F27A 3WODF 1BI1A 4QPOA 1B8IA 5FKOA 2ZXWH 3CUQB 1MD0A 4Y7NJ 4A0YA 4RAZA 1KU9A 2UUZA 3BTLA 2V4JC 1WRJA 2NVTJ 2F5CA 2CUEA 3MKLA 4U7BA 1QO0D 3N97A 3TO7A 2M0CA 3HKZA 4LLLA 1Z3YA 3EUKL 3UKGA 3JW4A 3W2WA 4I76A 4E70A 4E7ZA 2QM3A 1IRXA 4B43A 4NUBA 2BY1A 4CCNA 4PUSA 1WJEA 5ICCA 2Z2SB 1VQ8I 5J47A 1A5JA 3PIOF 3HIFA 5ICFA 4XMYA 3S3OA 2ZCWA 4I6ZA 1D8JA 5LRRA 5JHUA 1W5SA 3KP3A 2CQQA 4XLPF 2RN7A 5K1YA 1A31A 3S1QJ 5HNHA 2ZMEA 3DPTA 3VYRB 4LK1F 3MN2A 4BQOA 3L2VA 1FP1D 1PDNC 2GOXB 5H6QA 3E6DA 2KFDA 2ZB9A 5FLMJ 2XAQA 2KKOA 3TMOA 4F7ZA 5F6FA 3WTVC 3VYTB 2DAOA 2V9KA 1D0ZA 2Y9ZA 4OIOF 1N75A 2LY9A 3L09A 2MSYA 4J01A 4UXNA 2IA2A 2ACJA 1V5FA 5B1BH 1XD7A 3DCFA 4A3MJ 3FXRA 1WJ5A 4IQJA 2F5DA 1BJAA 3V8JA 2W82A 4BHBA 3FDYA 1MBHA 5D5UB 3IP4B 4EM2A 3SHFA 2EBIA 1U8RA 1H0MA 1WSUA 4PFOA 2MA3A 2R7UA 1QGPA 4DNCA 1X3UA 3GXOA 1O3SA 1T56A 1UHMA 2KIQA 2NOGA 3ZMDA 3OY9A 2XVCA 4PDKA 3RPUD 2ZSHB 1A04A 1ETQA 1XMAA 1MMSA 1OPCA 3S17J 1QQIA 3V8LA 2QZ8A 2HDDA 2AHQA 3WTZA 2KIUA 2P81A 4EV0A 5FFZA 5E20A 1GHCA 2VL8A 1VQLI 4D5CA 3CP2A 3G71I 3LSPA 2HOEA 3HGYA 4A0ZA 2JVHA 2Y69H 4H0EA 2GLOA 2JA5J 5FKKA 3HYIA 1V3FA 1K83J 4RM2A 2MH9A 5AONA 1BL0A 1FYKA 2IVMA 4U7DA 3KPHA 4IRGA 2QENA 1H88C 3A1YA 4M74A 2AQFA 4J19A 1HKTA 1OISA 3KYDB 3O2PE 3F23A 2HPMA 2JZYA 4QWQA 1OCRH 1S5LC 1USSA 4PCQA 4E7SA 3TDZC 3MWMA 3HOTA 1AWCA 2V9VA 4A3EJ 2RAEA 1IN7A 4UV9A 3JCUC 1LE8A 2W4SA 1DDNA 1EKEA 2NNNA 1F9NA 1W7PA 2DN0A 3NRVA 2ZJ2A 3KP6A 4WXCA 2HQRA 3S16J 1BR1A 3T8TA 3BZ6A 2E35A 3ZPLA 1E3PA 3FXLA 4UUSA 2PJRB 4YFKF 1P2FA 5CVIA 4UUVA 1W4MA 3HOZJ 2Z99A 1ZRCA 1YFHA 2KMUA 2EFNA 2Q2EB 4E7JA 3OYFA 4AIDA 2QYOA 2KP6A 2L7FP 2LFBA 4HOBA 4JP0A 3GZ6A 3K70C 2M8EA 2M9HA 2MABA 1AA7A 2E60A 1O7LA 4IQ4A 3ONQA 2DU9A 1JXSA 3F6OA 1YOVB 5FFXA 2QA4I 4UVCA 3LSJA 1X19A 2BY3A 2DT6A 3E0JB 5IT9Z 3HEFA 1HKSA 5GAGJ 5DS9A 1DPRA 1U8BA 4F55A 4ASNA 1S72I 4V19K 3IKVA 2OD5A 3ZQGA 3K6GA 1BR4A 3F8CA 5IYCJ 4BACA 4M9SA 2QBYB 2MLKA 1T6SA 3J7YJ 3MCZA 4HBLA 5HNFA 2NVYJ 1Y0NA 2V9PA 3LA2A 2KDZA 5HODA 3HSFA 3TP0A 1YRNB 4BUPA 5CVRA 1P9QC 1HSJA 2KPMA 3KEOA 1SD6A 1WGXA 1R1TA 1D1AA 2GOMA 3H9QA 1MJAA 4C2UA 2GXAA 4L9NA 2DFFA 3CC4I 4WCGA 4D7MA 4W97A 2VKVA 4S05A 1LEAA 2DODA 1OCPA 3MZ8A 1LDKB 2KDOA 1ZRDA 4XKCA 4NDLA 3OS2A 3P9IA 4XBFA 2M45A 4JX4A 3HGGA 3HRSA 3BR3A 4Y15A 4BJ5C 1F5TA 3ASOH 4CA0A 3V4GA 1PUFA 4A3JJ 4XOPA 3S15J 2L3DA 5EG0A 1S9HA 1NHAA 2NVQJ 4CICA 2XPVA 5DV5A 1I5ZA 2O0YA 3H5RA 3GEZA 2BBYA 3DV8A 3GF2A 3H1CA 2D2WA 3QPSA 1DU6A 4AIKA 5GP9A 3LL7A 4UB8C 5LBQA 2PMHA 2EPFA 4LG0B 3M4OJ 3SQNA 2HWVA 5CVJA 3WTWC 4HSRA 2F4OB 1ZGAA 5FLXZ 2X1EA 3HSEA 1MBEA 3DBLB 2HXIA 3S14J 2R7DA 1K78A 3BG6A 2XROA 1EH7A 1BOAA 3E5UA 1Z0XA 1Z91A 4BU2A 4L9VA 2NXNB 4UV8A 5DCMA 2BEOA 4BAYA 1FTZA 3S8PA 3I71A 2W57A 5CKTA 1WWXA 3PO3J 1Y8RB 3MZYA 2ME0A 2WAQN 3GVAA 3IH4A 3WGHA 1D1CA 2A07F 2LDUA 3P7NA 2H6BA 4QLCU 2XSJC 1TTYA 3N05A 2X9DA 4KMUX 5EEHA 5J8CA 4II3A 1SFKA 2F6CA 4Q5SF 2O8KA 3HUGA 5F64A 1MBJA 3ZP5A 1QZZA 2L01A 5HS7A 2A68F 2XF5A 1ETOA 2P4WA 3J80K 4FCYA 2LY1A 1FYMA 3ZRGA 5HVQC 4A3CJ 5K5QA 2R5ZA 1YIJI 4A6DA 1W36D 3K9TA 1ZG5A 2VUMJ 2KRFA 3WE3A 2R7SA 5JHFA 3OYDA 2M7AA 3J81K 1XSVA 3FMRA 2VE9A 3CLQA 1BJZA 3AG2H 1VQ9I 4LK0F 3WU2C 4RGUA 4HF2A 1LDJA 1WJCA 3IC7A 4ANJA 1SFUA 1LEBA 3HOSA 1LKXA 2RKHA 3FXJA 1UG0A 1I6XA 1REPC 1JKOC 3M7GA 1VQMI 3S3MA 1QZEA 1HCRA 1EJ9A 2VODA 2EJRA 3SDGA 1YS6A 4OIQF 2HTSA 3JAMK 1NG7A 3OYJA 1IV8A 3CO6C 1IRZA 2R7TA 1U9NA 1P4WA 2FEZA 4DBRA 2ZNZA 4CGZA 3K4BA 2IXSA 2QWWA 2MD5A 1Z9CA 3D5LA 2Y0SN 3ZN1A 5K7ZA 2KRCA 2X6OA 3ZQFA 3DU5A 2M34A 5CLSA 1T08B 3WE2A 3RKXA 4HX8A 3I54A 1K6OA 3CDHA 2ESNA 2ECBA 3NWSA 4S04A 2HEOA 3EYYA 1GLNA 2FMYA 4N0BA 2LF7A 4C3IJ 2IA1A 1JTXA 3H5NA 3H9JA 3H3UA 5H6RA 2JT1A 2XF7A 2XPUA 3HC7A 1K7AA 1TLHB 4JX6A 2GXBA 2XRLA 4A12A 2RV8A 3J7AO 4C2TA 3GO5A 2L7MP 2DTZA 4PJMA 2E1CA 2DFIA 2QCOA 3PFYA 2HKOA 1D0YA 2JRTA 3RKYA 4U0WA 3VDXA 4IX7A 1BI0A 2W25A 1Y8QB 1R1UA 3KZYA 1JGSA 2CYYA 1TNSA 2M30A 1G3YA 4R79A 3ZXSA 4YFXF 3BTCA 5J4VA 4L0ZB 2DOEA 2IGNA 1SFXA 3RSNA 5HDKA 1ZLKA 4DYRA 3JRHA 5BPDA 1FSHA 1AHDP 1TWAJ 2EIMH 5D8LB 1FBUA 3LA3A 4Y52J 2K86A 3ZQHA 5IOYA 3H0DA 5F04A 3CCYA 3H92A 3ZQQA 2JQ7A 2VE8A 4RLFA 1IN5A 3W6VA 4HF0A 4IKFA 2ICWG 3BG7A 2D1VA 3CCQI 4A6EA 1R6RA 4CDGA 4IEJA 3K2ZA 3P9CA 3WG9A 1P7JA 4A93J 1WVRA 1JUPA 2DDBA 1BBYA 1C0WA 3DKYA 3CUQA 3LFUA 2WAFA 4BS9A 2E71A 3DEUA 2NS8A 2OA4A 5FO5A 1HC8A 4ESBA 1OMIA 5ICEA 2XHKA 3G2BA 1QZYA 1RUOA 2GWRA 2HZTA 4CO8A 3L2CA 4RAGA 4D1QA 2ISYA 5J6XA 2O8XA 4ZDOA 1W5CC 2LKXA 2ID6A 2QUFA 1BN5A 4CCKA 1BC8C 1WJDA 4CCMA 1UB9A 5FROA 3WTTC 1TQMA 1IC8A 3MVPA 2DT5A 2E1MC 2A3SA 3ISPA 3TL4X 3L2UA 2LNBA 5J1YA 4DZPA 2EWNA 3KZZA 1ODDA 2XF6A 1Z05A 2E7XA 3FM3A 2XB0X 1GXPA 2DDAA 2JJ7A 1FIAA 1TZLA 1WJBA 5KVRA 4BDYA 1MSEC 3IUOA 4HRIA 3WG7H 2LG4A 2R93J 2DQRA 5J8FA 5FLXK 2JK3A 4DJAA 5LGUA 1SAUA 3CCUI 2QQ9A 3PIPF 4II2A 4BYYA 5LLQA 3M9AA 4O6JA 4A5NA 1X2MA 3AKZA 1JGGA 1SMYF 4JBAA 2J5OA 1VQOI 2CJJA 3QOPA 4BE1A 1S7AA 5FGMA 4LLNA 1W0UA 2IS6A 1BI3A 1YX3A 2K7LA 5LEJA 2QKLB 2CS3A 3PFIA 2EQRA 3HM5A 4HQEA 1E3HA 2EFOA 3K0LA 1GDTA 1FBSA 4MGRA 2XAGA 4WWCA 1FJLA 3OR2C 1XG1A 1BIBA 2ZXJA 2QSGX 1U0JA 1ZREA 3BR5A 3OSFA 2IT0A 2JMWA 5LD2C 4MNUA 1JUSA 3W2VA 2Y75A 3VOEA 4XNFA 3ZMUA 4HAMA 3LA7A 4RB2C 4EJVA 4DQ2A 3AG3H 3IWFA 1FOWA 1UCRA 3U2RA 3HDDA 2BVMA 4ZYDA 2JA6J 5BNGA 4PJNA 1CGPA 3A4CA 3N4MA 1HDDC 4RLQA 4ENMA 2E1NA 2BY2A 4HW0A 5EDNA 4HDUA 1JI8A 3ZQLA 4UB6C 3KYCB 1F43A 3E6BA 4A2UA 1G2HA 3T8RA 2NRAC 2M2EA 4D5FA 4WXDA 5FRNA 4I99C 3AG1H 5K7HA 3DKXA 3DWLE 2CGPA 2WV1A 2PBIA 4G7ZF 3ECOA 2CW7A 2GBYA 4UVAA 2M5WA 3GTLJ 4RBOA 3QPLA 4RAFA 1E3OC 2H6CA 1MNMC 2FSWA 2EFWA 4IHTA 2VBXA 3MKWB 1Z67A 1Z7LA 3G3ZA 2Q2EA 1S29A 4XKBA 1IUYA 1NK2P 4YG2F 2R5YB 4BJTA 2J5PA 5FD6A 1X1CA 5B1AH 4HSTA 1TP4A 1IW7F 2BGCA 3M8EA 2RC4A 2ZKZA 4L18B 3PUFA 5LHHA 2G7HA 3I3LA 2X6WA 4BEHB 1VNDA 1PP7U 4U0YA 3KP4A 2MBFA 2LOOA 3K10A 3WHCA 2DBBA 4MHGA 2CW0F 5E18F 1VFCA 3J7AY 3DEEA 4OU0A 5EZGA 1BI2A 2CRGA 3KLOA 3KP7A 2QBYA 3W2AA 4NC8A 2L9SA 5L3DA 5HS8A 3HTUA 2HDWA 2OQGA 1YRNA 4X1EA 4NQWB 2F5VA 5F1RA 3GLLA 3TBIA 2HVQA 2HYFA 4XIDA 2LBFB 2LC2A 2YSRA 4IRIA 2DMTA 4HNUA 3I55I 1HDPA 2UXNA 4XORA 3HOYJ 3GW2A 1L0OC 2VIXA 2JUGA 3JRIA 2HZDA 1D0XA 3F8NA 4I02A 4K2EA 5E79C 2KJBA 3HPHA 5BMZA 3OR1C 3ULQB 5FD5A 1XS9A 3V42A 1A6QA 2X6YA 2CQ7A 5D5VB 3F21A 1SVOA 2WTEA 1O4XA 1W5TA 2E34A 1KA8A 4C3HJ 5GPCA 3BDDA 3L00A 4I7HA 4GFBA 3FXQA 1MBFA 1WFXA 5D5XB 2YPRA 2E5ZA 3CF2A 3TGNA 3T0YA 4ETSA 5K5RA 1IDYA 2JPCA 3DXJF 3Q0UA 4M9XA 3OWTA 2TCTA 3DTKA 4ESFA 2JUCA 3WGGA 5BPIA 3HL2A 2YX7A 4IZZA 4YRVA 4V2FA 4EVIA 3BJOA 1LFPA 3UNGC 3CCLI 1ZN2A 5HDGA 4UNOA 2OZ6A 4RGRA 1AKHB 2R7QA 1PJRA 1FBQA 5C3EJ 3BG3A 1IXSB 3P9KA 5EGOA 2RDPA 3IV5A 4BQQA 2A6TA 4L5JA 2R3SA 1Y39A 1O3TA 1IRFA 3J80Z 2VBYA 2OJED 3K4NA 1RIOH 2K9LA 1Z77A 4XR6A 4IOCF 2WA0A 4M3BA 1VTNC 1ZTRA 2ZO4A 4RB3C 5KAFC 4EJOA 3QYEA 3ZQCA 3PNYA 3RJPA 4QTRA 1OR7C 3J81Z 4GXOA 1TQIA 1KU7A 3K7AJ 3RKWA 1RI7A 5HLGA 4EGYA 2A05A 5CPRB 1MBKA 1Q1HA 2JA7J 2CQKA 3PM1A 1ZAOA 1HA8A 1KQ8A 2FD5A 1MH4A 3PNVA 3BROA 5AIQA 3C1DA 1X1PA 3GFJA 4I09A 3I4NJ 2K4BA 1ETWA 2V1NA 1X2NA 4IXAA 3QODA 2DA4A 5IOZA 1X4PA 3JAMZ 5ILUA 4P9FA 5CYVA 3VFZA 3M8JA 3ZMTA 3DTEA 2B7EA 3F8FA 2OQRA 4JK1X 2EV5A 3BP8A 2YU9J 1MW7A 1FZPB 2HYJA 5JVGF 1J2XA 2OZUA 1IUFA 1UZCA 5M5YJ 1YI2I 1OCCH 4OMZA 2XSDC 1G4DA 5L3GA 1E17A 1P7IA 3SDBA 1JUMA 4ITVA 2ZNYA 1V55H 3D1NI 2DW4A 4MQVA 1J75A 1LVAA 5FJ8J 4D0PA 4M6XA 1XTAA 3F9KA 2VB6A 3KIOA 3BR0A 3RKQA 2Y0SA 4OINF 2LF8A 2E7WA 2OAZA 2VXZA 2ZBKA 5EF6A 1RKWA 3LSRA 1Z21A 3DLAA 3HPGA 4AYBN 3A2KA 1T0FA 4ZH4F 1A35A 3BG9A 4YIFA 1MH3A 3I59B 1JKPC 3D0SA 1XGMA 3R4KA 5TJJA 2IPQX 4IRHA 1OCTC 2BW3B 3LQRA 4RGXA 5CQGA 2BHZA 2Z33A 1U9OA 4UUTA 4YEJA 3V7SA 4L5IA 1XC5A 1E2XA 5DDGA 2IW5A 3ESWB 3OS0A 1UFMA 3RI4A 1CF7B 1RESA 2MW8A 1VQ7I 5C44J 2LREA 5D6FA 2V79A 3GTJJ 3GZNB 2VQCA 4BKXA 1FIPA 4QIWN 3ERED 1XSDA 1SMTA 4BXXJ 4ZDLA 1IZ1A 1TWHJ 3IWZA 4FETA 4MFEA 2M4GA 2A6EF 3K1NA 2L0KA 1GT0C 3C3WA 4BQAA 2VJ4A 2R0QC 1B72B 2B0LA 3JSOA 1T38A 1U5TC 2O6GE 1LB2A 2E2HJ 2NVUB 1ZARA 2FU4A 2BZTA 2ZC2A 3UR3C 4HYEA 2M87A 3SYTA 2DJIA 3FM5A 4RDUA 2D45A 4IHXA 3HHHA 2E36A 5J3LA 2L4MA 5BS6A 4G6TB 5L3BA 3T5XA 2HGCA 4EGZA 4IHWA 4RB1A 4WXHA 4XK4A 3K1PA 3SJMA 4F52A 2LK2A 5IT3A 1P4XA 2L2OA 5TISC 3KX2A 1JTYA 2K9MA 5IP7J 3QAHA 3G73A 2GQQA 5DYMA 5DD8A 3OYCA 4MO7A 5JR3A 2QSFX 4YIIA 2GM4A 4NBQA 3GWZA 2X48A 2ZXHA 3GUDA 2HPIA 2WBMA 2XV4S 3CZ6A 4Y33A 4KIGA 2DPDA 3NARA 1WQ2A 3CMYA 4XN0A 1G8XA 1PUEE 1MIJA 3B6AA 4LJZF 3ZQ7A 1J59A 3PNTA 1N25A 3FHZA 2RREA 4J00A 2DMPA 1IO2A 2L7KA 2DI3A 1Z1DA 2UXXA 2NYXA 1T2KA 1T33A 2AQEA 4P96A 3RQ4A 2KRHA 2TRTA 3BLYA 5TRDA 3HJEA 4XICA 2GXGA 2RGVA 1R4MB 2IBDA 2V1XA 3A01B 3LQQA 4DW6A 2XAJA 2JN6A 3DLLF 3ZGKA 1O3RA 1D5VA 5JVTA 2XKPA 5J4YA 1USTA 2M0MA 1W36C 3ABTA 2F5FA 3EYIA 4CYCA 5GAEJ 1DU0A 4Q4ZF 2PEXA 3RTRA 1VQ6I 5M3FJ 3HKZN 3BG5A 2X0LA 4XQFA 4P5OA 3DBRB 3DF8A 1RUNA 4EQQA 3A03A 2NS0A 3VSLA 3PQKA 5FLVA 2Q0OA 4FQGA 4D7NA 3Q9VA 1N77A 2WC2A 4C2MJ 2LMDA 1S3JA 2XGEA 1OYYA 1B59A 1EV7A 3F72A 3K4MA 3I5UA 2O3FA 2K40A 1FX7A 4XLAA 3S3NA 4Q48A 1LDDA 2NVXJ 1MMGA 3RIRA 2P5VA 4N9HA 5KHDA 1XGSA 4BBRJ 1OYWA 1SFEA 3ZQIA 5HLTA 4XSZF 3WTSC 1R71A 1U78A 2DK8A 4M3GA 1XMXA 4C3JJ 2XIGA 3HRMA 2DT7B 1MNDA 2RNGA 2ZMEC 3PJRA 2LVSA 3CTAA 3HG9A 3EUHA 2VOOA 3BJAA 1F36A 1UHSA 3H3VK 3HZJA 2CMPA 1DP7P 4HNVA 4A3BJ 2DA6A 2HNHA 2XAUA 2F4IA 4AVZA 2PG4A 1ZK8A 2QEXI 2O9LA 1B6AA 3CD6I 4M72A 2CV2A 3ML6A 3P5JA 1ETYA 3R6SA 2W85A 2VN2A 2VT2A 2WADA 5JLWA 4N4OB 2FA5A 1VF9A 4AIHA 5LHGA 2UZKA 1GV2A 2CFXA 1YJNI 1AU7A 5LHIA 2LP0A 3H5AA 2JTVA 4UY8I 4BHCA 4OMYA 5FRMA 1S7OA 2EZIA 1MGTA 1HKQA 4TV7A 5FKNA 3R0JA 1RPWA 3S1RJ 2XAHA 3WU1B 5KAIC 4EMSA 2LLKA 1K61A 2HQNA 4IVNA 3X2QH 5J40A 1FMVA 2VLAA 4B09A 3TP3A 1ZYRF 1B1BA 5KCMA 4N9IA 3FXOA 3CO7C 2O03A 1SD4A 1ULYA 2XAFA 4PFPA 1LFUP 2RQPA 4ZTJA 3IH2A 4XKWA 1R5HA 4PJ0C 3JRCA 3GCMA 1HW1A 2R5YA 5M3MJ 3Q5FA 4BY1J 4NB5A 4XN3A 3CCJI 4XLFA 3R60A 1KYZA 2D1HA 1T0FC 2F2EA 3GX4X 4UUSB 1PYVA 4IF4A 4PSWA 2PFBA 4ENNA 3MQ0A 4FASD 3CQZJ 4BEHA 1WHUA 1MNEA 2A5WA 2HI3A 1NK3P 1Y56A 5IYDJ 5F1JA 2L9NA 1FOYA 4XRSA 2BXZA 4XKVA 4V2GA 5HOOA 2DMQA 4RMNA 4L9JA 5H2FC 1R4NB 1RZ4A 3FXKA 1J5YA 2Z5UA 3Q0WA 1KU2A 4EJWA 5BQTA 3IRQA 4HQMA 3BJ6A 4HLYA 4KDPA 3BC8A 1TW3A 1YE9A 3EETA 3BY6A 6PAXA 2XGDA 5FKMA 2HVSA 1ONVA 3B02A 1TWCJ 3LFKA 2VOPA 2M1BA 3HOXJ 2K4JA 2VKEA 1P92A 1QVUA 3JTHA 2DXIA 4C9YA 1APLC 3ZMSA 1LFBA 4EM0B 4A69C 2CH0A 3H36A 1UHWA 3BTIA 2E1MB 2O7OA 3VB2A 2DMNA 2V7FA 3COAC 1ZELA 2FOKA 3DP7A 1W7PD 3LSTA 2GAUA 5DCFA 3LSHA 1GVDA 4EJUA 4X0GA 3FIWA 5F0CA 4CYDA 3OYGA 1BA5A 4XLEA 3L7WA 2CU7A 3BPVA 2FNPA 2K3PA 3TO9A 4ZZDA 4KN7X 3V7CA 2EIJH 2FQ4A 3VPRA 3K2AA 5GPAA 5F0HA 3ELKA 3KCCA 5KK1A 4FE4A 2VJIA 3OYAA 4KJZA 3L2QA 5EG0B 1SAXA 5IPAA 1AKHA 2PJPA 5HDNA 2LH9A 1V5GA 3CJNA 3QU6A 3DBHB 3CCRI 3BR2A 5EJCA 4OAYA 1BIAA 2CV1A 1GVJA 2MH2A 4G12A 2VBWA 1R58A 4B4CA 3OYIA 3S1MJ 2OC6A 2PN6A 1X58A 1RRJA 2WB1N 5K5OA 3KLNA 1XPXA 2IRFG 3SZPA 1XGOA 2L5QA 4MEYF 1EF4A 3ASNH 2P7VB 2P7CB 2WV0A 2PLYA 1XSXA 2N8GA 2DA7A 2ISZA 3QOEA 1M1EB 1YW9A 1PP8F 3DU6A 3RZOJ 2IEKA 4YIRX 3VYUB 3LSIA 3S2WA 3CMEI 2HQ5A 3CCSI 1R22A 4DYCA 1MJBA 4X6AJ 1I1GA 1YS7A 3LNQA 2FJ1A 3E5XA 5E3MA 2AS5F 4CCJA 3TEDA 4RB0A 3M07A 2R7WA 2KISA 3HOVJ 5E3NA 2B63J 3S1NJ 4LITA 3HUGB 2H8WA 3IH3A 1BW5A 1HLVA 4P1WA 1J09A 2HDCA 1ZR4A 4G8XA 2V6EA 1Y1WJ 3TW6A 1R00A 2WWYA 2XGCA 2MG4A 3NEUA 3L9FA 5EEGA 3I56I 3ABKH 3PQJA 2HR3A 4AYBA 5FKLA 4GDFA 2HFHA 2K9QA 5JLXA 4Y3OA 1T95A 1N78A 2IS2A 2ID3A 2LKSA 1ENHA 1YJWI 2CQXA 4ZC3A 3AL0C 2Z16A 1ZG3A 1J9IA 3I59A 3LAJA 1I27A 1XGNA 3JRGA 2BW3A 3OMYA 3AFHA 1UJ8A 1TW2A 3CDLA 5LGNA 3OYMA 3J7ZI 3CESA 1TWFJ 1FY7A 1UMQA 4RAYA 1TQPA 3FKJA 2PX9A 3F6VA 3GYHX 2EZLA 5DM6F 2EH3A 4ZYAA 2ZJRF 2PJRA 4KIBA 4G94A 1GV5A 4DOZA 4WK8F 4HX4A 3KE2A 3OOUA 1U2WA 2MGQA 5DUKA 4WX9A 2FF4A 3LSMA 1PVEA 3WTYC 5H20A 1V54H 3BPXA 5B5EC 1Y6IA 3KETA 4GYGA 4C30A 4H4KC 3S32A 1OQYA 4LIUA 1S7EA 2DFEA 3C7JA 2FXAA 2TDXA 3K4JA 4KT6A 4QPQA 4BGDA 3U9GA 5DTDA 4U0VA 1GXQA 2YU3A 1XB4A 2IGMA 1RR7A 1HSTA 4AIJA 3OIQA 4A3GJ 2UV1A 5DUIA 4RGSA 5IP9J 2FUG2 2EZKA 2GZWA 1T98A 1EH6A 1YJ9I 2RQQA 4BQNA 3PO2J 3OL4A 1D8KA 2L54A 3CUOA 4G9YA 2DTRA 2DA2A 3FHNA 2IAIA 3KEYA 4GCVA 1MDMB 4NNJA 4AWXB 2MD0A 4O5VA 3JRAA 1O3QA 5J1UA 2LR8A 3ABLH 3ZOBA 3DPLC 3NAUA 4HZFA 4F3QA 4CCOA 3JR9A 1Z6TA 4KA4A 1RR8C 4P55A 1TWGJ 2OCEA 1KQ9A 2JA2A 2STWA 1D1BA 2HXOA 4A3IJ 3RYRA 5AIPA 4G6QA 4AVPA 2ZXIA 2FQ3A 3KP2A 2LYCA 1G3WA 4LIVA 3CLOA 2G7UA 3M8FA 3GTKJ 2H1KA 2XC7A 3GTGJ 2W00A 1R49A 3FK6A 4XRMA 3ECHA 2NNYA 4LG0A 3A01A 2OTLI 3GTMJ 2IGOA 2HVRA 2E19A 3IL2A 3QP6A 3S93A 2R7VA 3O8HA 1SEUA 2KZGA 5D4RA 4HDVA 2X1CA 2WAQA 2PMZN 3E97A 2ZJPF 2V6CA 4D9JA 3F8MA 4ZZLA 2AO9A 2QQBA 1WI9A 4FTHA 3CUQC 1B4AA 5LGTA 3U1DA 4R8HA 2ELHA 1H9GA 1OCZH 1YLFA 3EQLF 3MKZA 5E3OA 1B9NA 3SZGA 2Z9OA 1G6NA 1J7KA 1D5YA 1YTYA 1HXDA 3VYSB 1YQAA 4XL9A 3ZMVA 1XCVA 1IDZA 2FOWA 4GGGA 4HA8A 4ON0A 1IG7A 2A61A 2P8TA 1FMWA 1POGA 2HOAA 2VQGA 1IN6A 4KITB 4FT8A 1Q1VA 4IPAA 3S2DJ 2XUBA 5JFRA 2KZVA 3MAJA 2STTA 5L3CA 1FWZA 2M7BA 3C2BA 2DA3A 1LJ9A 2JPBA 4XRSG 1JHHA 4KISA 2CQNA 1ZHFA 1SC7A 1ON2A 1XX5A 2I10A 3BTJA 2Y2ZA 2R7XA 5IY5H 3CP8A 2VI6A 4M3FA 5HLHA 2KHMA 2IS1A 3QQAA 2OF7A 3IHUA 1ACIA 2I8DA 3A0BC 5GAHJ 1R7JA 4GRIA 1XDSA 1ITYA 3PL8A 1H9TA 3EDPA 1HBXG 4F92B 5J1RA 3HBLA 3OS1A 1HF0A 4IHVA 2UWMA 4RS8A 2GIZA 3FXUA 1K6YA 2EFPA 4RA2A 2XPWA 5GTHC 5D4SA 1I50J 2OCCH 4FE7A 4ABZA 2EB7A 3BQZA 2E1OA 5GTIC 5ILVA 1KONA 3PSFA 3I64A 4CZZA 3SFIA 1J0RA 2EA2A 2IJLA 4ZJZA 2CFOA 3ABMH 5B66C 2XDVA 3BZCA 1KYWA 1I6HJ 2DK5A 2VPRA 2XB5A 3G1OA 1QNTA 2X51A 4BE2A 4NHJA 3G1LA 3M1EA 1TNTA 3KZIC 1U5TB 2OPTA 1YYVA 3CCMI 1O7FA 4A3LJ 2WY7Q 3NWTA 4EEFG 4IJAA 4KT5C 2EV0A 2IGKA 2VASA 4F91B 4B8XA 4E7LA 4P9UA 5ICGA 4A5MA 3H0GJ 2XASA 3V7RA 2NAZA 3ABUA 4XONA 3TOAA 2DYRH 1ZG1A 1TC3C 1IAWA 2MLGA 2L7ZA 4LGWA 2DLLA 1K4SA 2K02A 2EZHA 4JX5A 2EILH 5L3FA 3HB9A 5KNLA 1BW6A 2LD5A 2IS4A 1ZH5A 2YR2A 4MEXF 5CJ9A 2P6SA 1SVMA 2QKMB 1IF1A 4IHYA 3BR6A 1F4KA 3G4SI 3KFWX 4M73A 1Z6RA 1VQNI 5ILSA 4KICA 3O8GA 1FTTA 3BR1A 3U1KA 3Q9SA 3SEZA 4W1UA 2C6YA 1I39A 2CUFA 4ENKA 1SVLA 3W3CA 1BC7C 5E8GA 1R23A 3MZHA 2KQRA 1S6LA 2DCEA 1X1DA 3C18A 3MD2A 1XDUA 3D5RC 4CSWA 1X3ZB 4PJLA 2L02A 2CUZA 3O6BB 2H1LA 2QGUA 2YUSA 3HSRA 2QQ8A 4LOCA 2LY2A 3R0AA 1F1ZA 3FK7A 2XRNA 2ME6A 4CZCA 2LTPA 5A2QK 2AXTC 4HNTA 2PI0A 3VWBA 3I53A 1P4AA 1U6GA 1JHFA 4FISA 3OYEA 1VQ5I 4R1HA 3BOQA 1HOMA 3KEQA 5HLIA 4ZYGA 2LRDA 3CJTB 3I0TA 1WJAA 3E6CC 4BXUA 2FX0A 3FXMA 3E3VA 2L9VA 3CC2I 1VQKI 3MMYB 1QPMA 5DD4A 2F48A 1FNNA 2HTJA 2OU2A 4E6KG 4HX7A 2DQLA 3ZN0A 4BY7J 4Z2YA 3QYBA 2GIVA 2ZSIB 1MSFC 2OBPA 3K70D 4DZJA 2ZJQF 2WAEA 1B8IB 1TT0A 5DM7F 4RM3A 4F93B 2O61A 2CG4A 4LB5A 4I0BA 2ZFUA 3OL3A 3F8BA 2COBA 5GADJ 2BV6A 3FISA 2DA5A 1NG6A 2ELKA 3CF5F 1R36A 3OYHA 3IKTA 1DQUA 1FEXA 3F22A 3K4KA 3H3ZA 2H27A 1WI3A 4O3MA 4ZTFA 2WB1A 3TO6A 3AAFA 2BHYA 1D3YA 3ROUA 4LD5A 2X6XA 2Y48A 1XMKA 1KZHA 4Z6YA 2NS7A 3ERMA 3E6MA 2BY0A 2GA1A 3QPTA 4CCLA 2O5RA 1G3TA 1BM9A 1SD7A 3MEXA 4UVBA 4LFUA 4FX0A 4M6YA 2DPUA 2DJNA 2K9SA 4Y4RA 1JJ8C 3DKWA 2HU9A 2ZMEB 3DQVC 2K85A 3GTOJ 2BYVE 3PUBA 3S2HJ 1A36A 2PQ8A 2VQHA
chains in the Genus database with same CATH topology
4HEA2 2JVHA 3ZCOA 2CH0A 4ZDPA 4BJTA 2E1MB 1X1CA 2VKHA 4HSTA 2V7FA 4RM2A 1ZELA 2KL4A 3BCBA 3LSHA 3I3LA 2X6WA 4X0GA 3OYGA 3K4LA 4BEHB 2OV7A 3A1YA 4XLEA 2LOOA 2CW8A 3K10A 2K3PA 2AQFA 4XLCA 1OLTA 3J7AY 2JSPA 3DEEA 3EUAA 3W2AA 3C2GA 4NC8A 2HPMA 2R4GA 2L9SA 4E7SA 2VJIA 3OYAA 4KJZA 2HDWA 1MMAA 3L2QA 3HOTA 4NQWB 1DGWY 2F5VA 3TBIA 2HVQA 1V5GA 2LH9A 2W4SA 4BXFA 3MKYB 3CJQB 2LBFB 2LC2A 4OAYA 2CV1A 4HNUA 3LSKA 3FBNB 3OYKA 3C2HA 3OYIA 2OC6A 4MLOA 1BR1A 4XORA 3CMMA 2VIXA 2JUGA 2PJRB 2HZDA 2L5QA 1D0XA 3HPHA 3OR1C 3V42A 2KMUA 2X6YA 3QOEA 2Q2EB 3LSGA 4E7JA 3OYFA 3DU6A 2KP6A 3VYUB 3K70C 3LSIA 4PJJA 4CUGA 1X1BA 1WFXA 2MABA 1LVKA 1E0EA 4BL0B 3FBIB 2E5ZA 1AA7A 2E60A 3CF2A 4IQ4A 2R7OA 3ONQA 1X19A 2DT6A 3OWTA 3E0JB 4CCJA 4F55A 3DTKA 3EPZA 2R7WA 3H35A 3K6GA 1BR4A 3HL2A 4BACA 2HQAA 3SEQA 4IZZA 2P0WA 4YRVA 4LITA 3HUGB 3DPUA 3UNGC 1LFPA 5HNFA 4P1WA 1J09A 4BUPA 1P9QC 2R7QA 2V6EA 1PJRA 4BE0A 2KPMA 2M3AA 2VKDA 4BQQA 2A6TA 1D1AA 2GOMA 4AYBA 3H9QA 2X1DA 4C2UA 4Y3OA 3K4NA 1T95A 1N78A 2IS2A 1BOBA 2K9LA 4XR6A 2WA0A 4ZC3A 3AL0C 1LDKB 2KDOA 2Z16A 2CV0A 3QYEA 3PNYA 3IAM2 4XKCA 3OS2A 1OR7C 2KLOA 3OYLA 4BJ5C 4CA0A 4N4NB 2BW3A 3OMYA 3AFHA 4XOPA 3OIPA 5CPRB 1UAAA 1S9HA 3OYMA 1QHGA 3H5RA 1HA8A 3CESA 3DTIA 4B48A 2LBFA 3PNVA 3FKJA 3LL7A 4ZYAA 2V1NA 2PJRA 3QODA 4DOZA 1X4PA 4HSRA 5CQEA 3KYLA 3M8JA 2MYSA 3OOUA 2X1EA 3DTEA 3IAS2 2OUMA 1MW7A 4BJ6C 4LG3A 1QHHD 3BG6A 3LSMA 4XLHA 2MFZA 4DIQA 4BU2A 4B44A 3OYNA 1Y6IA 4E7IA 3SDBA 3S8PA 2W7NA 4ITVA 2ELJA 5CKTA 4H4KC 4C30A 4E4HA 3S32A 2W1OA 4LIUA 3L2WA 3F9KA 2VB6A 2Y0SA 3U21A 1YX5A 4QPQA 4KT6A 3K4JA 1D1CA 2VXZA 2E5NA 4BGDA 1Z21A 2NOJB 3DLAA 3HPGA 3A2KA 1X1AA 2XSJC 2VPLA 3N05A 1VZ0A 1SFKA 4II3A 1X4OA 2F6CA 2IGMA 2PMZA 2BW3B 3LMMA 3OIQA 4PSXA 2UV1A 2XF5A 4NC7A 5CQGA 3D5SC 2LY1A 2FUG2 3ZRGA 5HVQC 4YEJA 1W36D 2RQQA 4BQNA 1ERDA 3OL4A 3CJRB 3OS0A 2R7SA 5JHFA 3FHNA 3OYDA 3KEYA 2VXDA 2M7AA 4NNJA 2MD0A 3OYBA 4F3QA 3DPLC 2LREA 4CCOA 2VQCA 3E1SA 4ZDLA 3VSKA 1WJCA 4FETA 4ANJA 1UELB 2JA2A 3HOSA 2M4GA 1D1BA 1LKXA 4E7HA 1UG0A 2VJ4A 2ZXIA 3S3MA 2LYCA 4LIVA 1NG7A 3OYJA 2R7TA 2XC7A 4DBRA 3UR3C 2W00A 3SYTA 2DJIA 3K4BA 2IXSA 4G6TB 3D5LA 3L2RA 2KRCA 4XOTA 2IGOA 4YELA 2HVRA 3DU5A 1EA3A 3AL0B 3S93A 2R7VA 3BCAA 2M4KA 4F52A 2L2OA 3NWSA 2X1CA 2WAQA 3KX2A 1GLNA 4D9JA 2K9MA 4JQFA 3H5NA 3OYCA 3H9JA 3M1CA 4BDZA 2XF7A 3HC7A 1BR2A 3MKZA 1QU3A 3SZGA 4HPQA 2WY8Q 2ZXHA 4C2TA 2HPIA 2WBMA 2X85A 3CZ6A 4XL9A 3VYSB 4Y33A 4XN0A 1G8XA 4PJMA 1FMWA 2VJJA 3PFYA 2Q1ZB 1D0YA 2VQGA 3PNTA 3VDXA 4KITB 2RREA 4IX7A 4J00A 4JOMA 2L7KA 5TGTA 4OAZA 4EATA 2KZVA 4PK4A 2M7BA 3EUHC 3K4CA 2AQEA 2BOLA 3RQ4A 2KRHA 1MMNA 4R79A 3BLYA 3ZXSA 4KISA 4E7KA 2Z1DA 2VJ5A 2IGNA 3RSNA 4B3XA 2V26A 3ZGKA 4CH7A 2BVLA 1WJFA 2R7XA 3CP8A 2JVGA 2KHMA 3I9V2 4AU7A 2M0MA 1W36C 2IS1A 3ZR8X 4OWRB 2I8DA 3H0DA 3H9GA 3ZQQA 4GRIA 3PL8A 4RLFA 3RCOA 3RTRA 4DGWB 2VQLA 4IKFA 4F92B 3BG7A 2UWMA 3OS1A 4XQFA 1R6RA 1MMDA 3QYFA 4P5OA 1K6YA 3VSLA 2DOAA 4U87A 3DKYA 3LFUA 2WAFA 1KONA 4BS9A 1N77A 3PSFA 3PSIA 3K4MA 4XM3A 4ZJZA 2CFOA 3S3NA 4XLAA 1MMGA 3GBGA 2XDVA 3G2BA 4HG2A 5KHDA 5HLTA 2X51A 4BE2A 1DGRM 4D1QA 2DT7B 1MNDA 4ZDOA 2RNGA 3PJRA 2WY7Q 3HG9A 3NWTA 4CCKA 1WJDA 2IGKA 4CCMA 2VASA 4F91B 4E7LA 5FROA 1Z3XA 2K5CA 2CMPA 2E1MC 4XONA 1V5EA 1DP3A 3TL4X 3L2UA 2HNHA 2XAUA 2XF6A 2F4IA 3HXLA 4AVZA 2MC4A 4DBQA 2CV2A 2R7RA 5LFAA 4B47A 5KNLA 1TZLA 2WADA 2IS4A 1WJBA 4BDYA 4N4OB 2CUJA 3IUOA 1G59A 4HRIA 2LG4A 2QKMB 4DJAA 4QPOA 1SAUA 3H5AA 3SEZA 4II2A 5FRMA 3W3CA 2UUZA 2V4JC 3AKZA 2KQRA 2DCEA 4U7BA 1X1DA 4BE1A 3MD2A 3D5RC 3HKZA 4CSWA 1Z3YA 3EUKL 4PJLA 2CUZA 3W2WA 2IS6A 1YX3A 4E7ZA 1FMVA 2LY2A 2QKLB 2CS3A 1IRXA 4B43A 4CZCA 4NUBA 4CCNA 4HNTA 4PUSA 1WJEA 3VWBA 2VLAA 2Z2SB 5KCMA 3OYEA 4XMYA 3S3OA 3OR2C 5HNHA 3DPTA 2LRDA 3VYRB 1U0JA 4BQOA 1WJAA 4PFPA 3L2VA 4ZTJA 4XKWA 2GOXB 3MMYB 5LD2C 4XN3A 4XLFA 3W2VA 4E6KG 3TMOA 4XNFA 1T0FC 3QYBA 3VYTB 2V9KA 1D0ZA 2ZSIB 1N75A 1PYVA 4PSWA 3K70D 4FASD 4BEHA 2WAEA 1TT0A 4J01A 2BVMA 1V5FA 1MNEA 2A5WA 1WJ5A 4RM3A 4PJNA 4F93B 4IQJA 1Y56A 2W82A 2ZFUA 3A4CA 3FDYA 3OL3A 3IP4B 2L9NA 4RLQA 4XKVA 1NG6A 5HOOA 3OYHA 4PFOA 2R7UA 1DQUA 4RMNA 3K4KA 1JI8A 4ZTFA 2WB1A 5FRNA 3BC8A 2X6XA 1YE9A 3OY9A 3DKXA 3DWLE 3RPUD 2ZSHB 2HVSA 2CW7A 4CCLA 2O5RA 4Y4RA 2VL8A 2DXIA 2HU9A 3DQVC 4C9YA 3CP2A 1Z7LA 3PUBA 3MKWB 4XKBA 2VQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQC A; 
#chains in the Genus database with same CATH topology
 3SZT A;  4HEA 2;  3WTX C;  2BXY A;  1RC9 A;  3RDI A;  3ZCO A;  2ETH A;  1ZR2 A;  4ZDP A;  3B73 A;  3GFM A;  5EGO B;  1IXR C;  2VKH A;  4CXF A;  3GTQ J;  3B6C A;  2KL4 A;  2W84 A;  3TOB A;  5CVV A;  3BCB A;  3K4L A;  4XSX F;  2OV7 A;  2YS9 A;  4L0Y B;  2EK5 A;  2KIM A;  2CW8 A;  5C4J J;  1YIT I;  1MKM A;  3FWE A;  2W48 A;  4MTD A;  4XLC A;  1OLT A;  1RNL A;  2JSP A;  4MTE A;  3EUA A;  1FSE A;  5EZH A;  3C2G A;  2JRM A;  5D8K B;  2R4G A;  2P5K A;  1UG2 A;  1MMA A;  4IL6 C;  4LLG F;  4MIM A;  1DGW Y;  5ED4 A;  1MJ9 A;  3QP5 A;  2VT3 A;  4BXF A;  4KIF A;  4OOI A;  3RZD J;  3MKY B;  3CJQ B;  1WPK A;  1OYI A;  3CCE I;  4AM3 A;  4I2O A;  3LSK A;  3FBN B;  3OYK A;  3C2H A;  2K3F A;  4MLO A;  4AUX A;  3CMM A;  1IN8 A;  1NTC A;  5JI6 A;  3Q0V A;  2A69 F;  4A3D J;  1W0T A;  1A6I A;  4EJT A;  1JE8 A;  2Q8K A;  2XKO A;  1FPQ A;  3QPH A;  3LSG A;  1I3Q J;  1LUJ B;  2JSC A;  5ERI A;  3HTS B;  3WTU C;  3FX3 A;  4BNC A;  3RYP A;  4CUG A;  4PJJ A;  4IHS A;  1X1B A;  1E0E A;  1LVK A;  4BL0 B;  3FBI B;  2HOS A;  1OJL A;  4L9T A;  2R7O A;  1FT9 A;  3ZMZ A;  2Z3Y A;  5C4X J;  3G6E I;  2XGX A;  4HF1 A;  3I58 A;  2DYS H;  1R1V A;  3HHG A;  5HS9 A;  2PMU A;  1HQC A;  3SXY A;  1RKT A;  3EPZ A;  3A0H C;  3H35 A;  2A6H F;  3F0C A;  2HQA A;  4I01 A;  3SEQ A;  1OCO H;  2P0W A;  2Y31 A;  4Y13 A;  1CQT A;  3DPU A;  4I98 B;  1EH8 A;  1TL8 A;  3M3Y J;  4Q47 A;  1FOX A;  3GME A;  1QVT A;  4S0H B;  1LE8 B;  3QU3 A;  1IRG A;  1JT0 A;  3QRF F;  4BE0 A;  1YW8 A;  2VC0 A;  1W7P B;  1U3E M;  2P6T A;  3K1M A;  2M3A A;  1RET A;  2VKD A;  3CCV I;  2X1D A;  3FF5 A;  1T8I A;  2VC1 A;  1BOB A;  5D5W B;  2COM A;  1VQP I;  3GFL A;  2G9W A;  3Q3S A;  1B9M A;  3BWG A;  1K79 A;  2CV0 A;  2QQA A;  3IAM 2;  1XCB A;  2KLO A;  1G3S A;  3GFI A;  1ZKG A;  1HW5 A;  3OYL A;  4ESJ A;  1IGN A;  3DEW A;  4N4N B;  4GYI A;  2GA2 A;  3LAP A;  3OIP A;  5E17 F;  3AG4 H;  1UAA A;  4NQW A;  2EIK H;  4I0A A;  3CMA I;  1QHG A;  3HRU A;  2DMU A;  3DTI A;  4B48 A;  1H89 C;  2V1D A;  5CVU A;  2LBF A;  1AOY A;  2CO5 A;  1FLI A;  3OIO A;  1R9T J;  1IV6 A;  1T39 A;  2ZFW A;  4G7O F;  1ZGJ A;  1DUX C;  1MDM A;  4HV5 A;  2H8R A;  1WZ2 A;  1IN4 A;  5CQE A;  3JTG A;  5IP6 A;  3KYL A;  4OIP F;  2MYS A;  3OOP A;  2E2I J;  1FP2 A;  2EV6 A;  3BQY A;  5E3L A;  1L3L A;  4CHU A;  3IAS 2;  1ETX A;  4LMY A;  3JRE A;  2OUM A;  4BJ6 C;  4NC6 A;  4LG3 A;  2HS5 A;  1QHH D;  1O57 A;  4U88 A;  4XLH A;  5E1W A;  3IRR A;  2MFZ A;  2K9N A;  3GLX A;  3REO A;  4DIQ A;  1ZLJ A;  4B44 A;  4YFN F;  3OYN A;  5IT9 K;  3SFZ A;  2CWE A;  4E7I A;  2W7N A;  9ANT A;  2ELJ A;  4E4H A;  3RPU A;  2FBH A;  2EA4 A;  2W1O A;  3FMQ A;  3L2W A;  1WKM A;  1YHQ I;  3K69 A;  1MBG A;  1ON1 A;  1STZ A;  1YX5 A;  3U21 A;  5D6E A;  3FZV A;  4A3K J;  4AC0 A;  2E5N A;  2NOJ B;  2R7F A;  1X1A A;  4MQ9 F;  2VPL A;  1YO5 C;  1LNW A;  1VZ0 A;  1KU3 A;  2ADU A;  1X4O A;  2PMZ A;  2MC3 A;  3LMM A;  4PSX A;  1PUF B;  4NC7 A;  3W6K B;  2RNJ A;  2R7Z J;  1OKR A;  3D5S C;  1OR7 A;  1KQ0 A;  1NH3 A;  5L3E A;  2IP2 A;  1ERD A;  3CJR B;  3MFK A;  4AD9 A;  3V8K A;  2EIN H;  2VXD A;  4BBS J;  1I1S A;  3E5Q A;  3JRD A;  5E8I A;  3OYB A;  1HW2 A;  2KJC A;  1QA6 A;  2P5L C;  3E1S A;  3LOC A;  2JWT A;  3DFG A;  4EM1 A;  2B9S A;  1ETK A;  1I3A A;  4MFD A;  3VSK A;  1JJ6 C;  3O3K A;  4KN4 X;  1K78 B;  4G7H F;  4CYC B;  1UEL B;  2H09 A;  4L5E A;  2DA1 A;  3HOU J;  3JRF A;  5DCM B;  4E7H A;  2A5Y B;  2QVO A;  5E1X A;  2YX4 A;  3VOD A;  4ZYH A;  1VQ4 I;  1P6R A;  1JKR C;  3T1B A;  4A3F J;  1YIO A;  4M3D A;  4OIR F;  3VEP A;  1ZGW A;  4GO1 A;  4FX4 A;  2F5E A;  2LKP A;  4HLX A;  1H8A C;  5EEA A;  4KMF A;  2D5V A;  3CC7 I;  4M71 A;  2Y0M A;  2HKX A;  3L2R A;  4XOT A;  4YEL A;  1DPU A;  4KFC A;  1R5G A;  1EA3 A;  3TKY A;  3AL0 B;  1VI0 A;  5E1Z B;  1QBJ A;  4JYK A;  3HOW J;  1WH7 A;  4A0X A;  3BCA A;  2M4K A;  3OSG A;  4XLN F;  2R5Z B;  3TQN A;  1SAN A;  1FOK A;  2EFQ A;  4JQF A;  2OTJ I;  3WU0 A;  3M1C A;  4LB6 B;  4BDZ A;  4UHT A;  4WF2 A;  5B3S H;  4KUM A;  1BR2 A;  1TT5 B;  5M5X J;  1IJW C;  4DYQ A;  1QU3 A;  2VON A;  4PGG A;  1MZB A;  4HPQ A;  3HRT A;  2WY8 Q;  2BE5 F;  2DFH A;  2FNA A;  4PGH A;  4FHT A;  5F0F A;  3RQI A;  2IA0 A;  2X85 A;  3JRB A;  2ECC A;  1X3W B;  2FML A;  2K27 A;  5K7F A;  2G0E A;  2VJJ A;  2DOF A;  4IO9 F;  1FC3 A;  3LWF A;  2Q1Z B;  1GUU A;  2M8G X;  2I5U A;  4JOM A;  5TGT A;  4OAZ A;  1YW7 A;  4EAT A;  4M6V A;  2VBZ A;  4M3E A;  4PK4 A;  1QPI A;  3EUH C;  3K4C A;  2BOL A;  1SFO J;  2Y9Y A;  1MMN A;  3W6J B;  2ESH A;  1LQ1 A;  1U5T A;  4E7K A;  2Z1D A;  2VJ5 A;  3WGI A;  2H94 A;  1CF7 A;  2JA8 J;  5LEK A;  2LSO A;  1Y0U A;  4B3X A;  5LRS A;  2V26 A;  4IOA F;  3CDI A;  2BVL A;  1WJF A;  4CH7 A;  3QWL A;  2JVG A;  1QRY A;  3I9V 2;  4M9Z A;  4AU7 A;  3I4M J;  3ZR8 X;  3TDU C;  4OWR B;  2V1U A;  2F4M B;  2FBI A;  2HYG D;  3H9G A;  4ENJ A;  4DGW B;  3RCO A;  1LPQ A;  2VQL A;  1V4R A;  1B72 A;  1WCM J;  2L4A A;  2E2J J;  4BH9 A;  1MMD A;  2QF7 A;  3QYF A;  4B1R A;  1Y1V J;  1JKQ C;  5IYB J;  1ZRF A;  2X4H A;  2DOA A;  1SD5 A;  2FRH A;  4U87 A;  1S8N A;  5A2Q Z;  2QSH X;  3PSI A;  5BOX A;  1YG2 A;  2CSO A;  1W1W E;  1ETV A;  4XM3 A;  4ZYE A;  2R92 J;  5EYR A;  2KIF A;  3GTP J;  2Y30 A;  3GBG A;  5DEQ A;  3I4P A;  3JSP A;  3G1M A;  1JT6 A;  4HG2 A;  2FE3 A;  2KT0 A;  3FKI J;  1DGR M;  3F3X A;  1XN7 A;  4PZJ A;  1IXC A;  3WHB A;  2RVC A;  3L1P A;  1OFC X;  3E7L A;  1R5I D;  5F08 A;  2W24 A;  3R61 A;  1KGS A;  4BHP A;  3BT9 A;  3KP5 A;  4QSH A;  3GZ5 A;  1Z3X A;  4XRF A;  4KNY A;  1Z7U A;  2K5C A;  1ZQ3 P;  1ORK A;  5FB2 A;  1V5E A;  1DP3 A;  2HOT A;  4Y17 A;  2L9R A;  3A02 A;  1FYL A;  2QLZ A;  3HXL A;  2MC4 A;  3NQO A;  3FMS A;  4DBQ A;  4HV6 A;  5M5W J;  2R7R A;  5LFA A;  4G6D A;  4B47 A;  1WH5 A;  3OV8 A;  2AXL A;  4B3A A;  1K4T A;  2CUJ A;  1G59 A;  2DO7 A;  4KYW A;  3BZK A;  1TBX A;  2FBK A;  3RPQ A;  3TW7 A;  5F27 A;  3WOD F;  1BI1 A;  4QPO A;  1B8I A;  5FKO A;  2ZXW H;  3CUQ B;  1MD0 A;  4Y7N J;  4A0Y A;  4RAZ A;  1KU9 A;  2UUZ A;  3BTL A;  2V4J C;  1WRJ A;  2NVT J;  2F5C A;  2CUE A;  3MKL A;  4U7B A;  1QO0 D;  3N97 A;  3TO7 A;  2M0C A;  3HKZ A;  4LLL A;  1Z3Y A;  3EUK L;  3UKG A;  3JW4 A;  3W2W A;  4I76 A;  4E70 A;  4E7Z A;  2QM3 A;  1IRX A;  4B43 A;  4NUB A;  2BY1 A;  4CCN A;  4PUS A;  1WJE A;  5ICC A;  2Z2S B;  1VQ8 I;  5J47 A;  1A5J A;  3PIO F;  3HIF A;  5ICF A;  4XMY A;  3S3O A;  2ZCW A;  4I6Z A;  1D8J A;  5LRR A;  5JHU A;  1W5S A;  3KP3 A;  2CQQ A;  4XLP F;  2RN7 A;  5K1Y A;  1A31 A;  3S1Q J;  5HNH A;  2ZME A;  3DPT A;  3VYR B;  4LK1 F;  3MN2 A;  4BQO A;  3L2V A;  1FP1 D;  1PDN C;  2GOX B;  5H6Q A;  3E6D A;  2KFD A;  2ZB9 A;  5FLM J;  2XAQ A;  2KKO A;  3TMO A;  4F7Z A;  5F6F A;  3WTV C;  3VYT B;  2DAO A;  2V9K A;  1D0Z A;  2Y9Z A;  4OIO F;  1N75 A;  2LY9 A;  3L09 A;  2MSY A;  4J01 A;  4UXN A;  2IA2 A;  2ACJ A;  1V5F A;  5B1B H;  1XD7 A;  3DCF A;  4A3M J;  3FXR A;  1WJ5 A;  4IQJ A;  2F5D A;  1BJA A;  3V8J A;  2W82 A;  4BHB A;  3FDY A;  1MBH A;  5D5U B;  3IP4 B;  4EM2 A;  3SHF A;  2EBI A;  1U8R A;  1H0M A;  1WSU A;  4PFO A;  2MA3 A;  2R7U A;  1QGP A;  4DNC A;  1X3U A;  3GXO A;  1O3S A;  1T56 A;  1UHM A;  2KIQ A;  2NOG A;  3ZMD A;  3OY9 A;  2XVC A;  4PDK A;  3RPU D;  2ZSH B;  1A04 A;  1ETQ A;  1XMA A;  1MMS A;  1OPC A;  3S17 J;  1QQI A;  3V8L A;  2QZ8 A;  2HDD A;  2AHQ A;  3WTZ A;  2KIU A;  2P81 A;  4EV0 A;  5FFZ A;  5E20 A;  1GHC A;  2VL8 A;  1VQL I;  4D5C A;  3CP2 A;  3G71 I;  3LSP A;  2HOE A;  3HGY A;  4A0Z A;  2JVH A;  2Y69 H;  4H0E A;  2GLO A;  2JA5 J;  5FKK A;  3HYI A;  1V3F A;  1K83 J;  4RM2 A;  2MH9 A;  5AON A;  1BL0 A;  1FYK A;  2IVM A;  4U7D A;  3KPH A;  4IRG A;  2QEN A;  1H88 C;  3A1Y A;  4M74 A;  2AQF A;  4J19 A;  1HKT A;  1OIS A;  3KYD B;  3O2P E;  3F23 A;  2HPM A;  2JZY A;  4QWQ A;  1OCR H;  1S5L C;  1USS A;  4PCQ A;  4E7S A;  3TDZ C;  3MWM A;  3HOT A;  1AWC A;  2V9V A;  4A3E J;  2RAE A;  1IN7 A;  4UV9 A;  3JCU C;  1LE8 A;  2W4S A;  1DDN A;  1EKE A;  2NNN A;  1F9N A;  1W7P A;  2DN0 A;  3NRV A;  2ZJ2 A;  3KP6 A;  4WXC A;  2HQR A;  3S16 J;  1BR1 A;  3T8T A;  3BZ6 A;  2E35 A;  3ZPL A;  1E3P A;  3FXL A;  4UUS A;  2PJR B;  4YFK F;  1P2F A;  5CVI A;  4UUV A;  1W4M A;  3HOZ J;  2Z99 A;  1ZRC A;  1YFH A;  2KMU A;  2EFN A;  2Q2E B;  4E7J A;  3OYF A;  4AID A;  2QYO A;  2KP6 A;  2L7F P;  2LFB A;  4HOB A;  4JP0 A;  3GZ6 A;  3K70 C;  2M8E A;  2M9H A;  2MAB A;  1AA7 A;  2E60 A;  1O7L A;  4IQ4 A;  3ONQ A;  2DU9 A;  1JXS A;  3F6O A;  1YOV B;  5FFX A;  2QA4 I;  4UVC A;  3LSJ A;  1X19 A;  2BY3 A;  2DT6 A;  3E0J B;  5IT9 Z;  3HEF A;  1HKS A;  5GAG J;  5DS9 A;  1DPR A;  1U8B A;  4F55 A;  4ASN A;  1S72 I;  4V19 K;  3IKV A;  2OD5 A;  3ZQG A;  3K6G A;  1BR4 A;  3F8C A;  5IYC J;  4BAC A;  4M9S A;  2QBY B;  2MLK A;  1T6S A;  3J7Y J;  3MCZ A;  4HBL A;  5HNF A;  2NVY J;  1Y0N A;  2V9P A;  3LA2 A;  2KDZ A;  5HOD A;  3HSF A;  3TP0 A;  1YRN B;  4BUP A;  5CVR A;  1P9Q C;  1HSJ A;  2KPM A;  3KEO A;  1SD6 A;  1WGX A;  1R1T A;  1D1A A;  2GOM A;  3H9Q A;  1MJA A;  4C2U A;  2GXA A;  4L9N A;  2DFF A;  3CC4 I;  4WCG A;  4D7M A;  4W97 A;  2VKV A;  4S05 A;  1LEA A;  2DOD A;  1OCP A;  3MZ8 A;  1LDK B;  2KDO A;  1ZRD A;  4XKC A;  4NDL A;  3OS2 A;  3P9I A;  4XBF A;  2M45 A;  4JX4 A;  3HGG A;  3HRS A;  3BR3 A;  4Y15 A;  4BJ5 C;  1F5T A;  3ASO H;  4CA0 A;  3V4G A;  1PUF A;  4A3J J;  4XOP A;  3S15 J;  2L3D A;  5EG0 A;  1S9H A;  1NHA A;  2NVQ J;  4CIC A;  2XPV A;  5DV5 A;  1I5Z A;  2O0Y A;  3H5R A;  3GEZ A;  2BBY A;  3DV8 A;  3GF2 A;  3H1C A;  2D2W A;  3QPS A;  1DU6 A;  4AIK A;  5GP9 A;  3LL7 A;  4UB8 C;  5LBQ A;  2PMH A;  2EPF A;  4LG0 B;  3M4O J;  3SQN A;  2HWV A;  5CVJ A;  3WTW C;  4HSR A;  2F4O B;  1ZGA A;  5FLX Z;  2X1E A;  3HSE A;  1MBE A;  3DBL B;  2HXI A;  3S14 J;  2R7D A;  1K78 A;  3BG6 A;  2XRO A;  1EH7 A;  1BOA A;  3E5U A;  1Z0X A;  1Z91 A;  4BU2 A;  4L9V A;  2NXN B;  4UV8 A;  5DCM A;  2BEO A;  4BAY A;  1FTZ A;  3S8P A;  3I71 A;  2W57 A;  5CKT A;  1WWX A;  3PO3 J;  1Y8R B;  3MZY A;  2ME0 A;  2WAQ N;  3GVA A;  3IH4 A;  3WGH A;  1D1C A;  2A07 F;  2LDU A;  3P7N A;  2H6B A;  4QLC U;  2XSJ C;  1TTY A;  3N05 A;  2X9D A;  4KMU X;  5EEH A;  5J8C A;  4II3 A;  1SFK A;  2F6C A;  4Q5S F;  2O8K A;  3HUG A;  5F64 A;  1MBJ A;  3ZP5 A;  1QZZ A;  2L01 A;  5HS7 A;  2A68 F;  2XF5 A;  1ETO A;  2P4W A;  3J80 K;  4FCY A;  2LY1 A;  1FYM A;  3ZRG A;  5HVQ C;  4A3C J;  5K5Q A;  2R5Z A;  1YIJ I;  4A6D A;  1W36 D;  3K9T A;  1ZG5 A;  2VUM J;  2KRF A;  3WE3 A;  2R7S A;  5JHF A;  3OYD A;  2M7A A;  3J81 K;  1XSV A;  3FMR A;  2VE9 A;  3CLQ A;  1BJZ A;  3AG2 H;  1VQ9 I;  4LK0 F;  3WU2 C;  4RGU A;  4HF2 A;  1LDJ A;  1WJC A;  3IC7 A;  4ANJ A;  1SFU A;  1LEB A;  3HOS A;  1LKX A;  2RKH A;  3FXJ A;  1UG0 A;  1I6X A;  1REP C;  1JKO C;  3M7G A;  1VQM I;  3S3M A;  1QZE A;  1HCR A;  1EJ9 A;  2VOD A;  2EJR A;  3SDG A;  1YS6 A;  4OIQ F;  2HTS A;  3JAM K;  1NG7 A;  3OYJ A;  1IV8 A;  3CO6 C;  1IRZ A;  2R7T A;  1U9N A;  1P4W A;  2FEZ A;  4DBR A;  2ZNZ A;  4CGZ A;  3K4B A;  2IXS A;  2QWW A;  2MD5 A;  1Z9C A;  3D5L A;  2Y0S N;  3ZN1 A;  5K7Z A;  2KRC A;  2X6O A;  3ZQF A;  3DU5 A;  2M34 A;  5CLS A;  1T08 B;  3WE2 A;  3RKX A;  4HX8 A;  3I54 A;  1K6O A;  3CDH A;  2ESN A;  2ECB A;  3NWS A;  4S04 A;  2HEO A;  3EYY A;  1GLN A;  2FMY A;  4N0B A;  2LF7 A;  4C3I J;  2IA1 A;  1JTX A;  3H5N A;  3H9J A;  3H3U A;  5H6R A;  2JT1 A;  2XF7 A;  2XPU A;  3HC7 A;  1K7A A;  1TLH B;  4JX6 A;  2GXB A;  2XRL A;  4A12 A;  2RV8 A;  3J7A O;  4C2T A;  3GO5 A;  2L7M P;  2DTZ A;  4PJM A;  2E1C A;  2DFI A;  2QCO A;  3PFY A;  2HKO A;  1D0Y A;  2JRT A;  3RKY A;  4U0W A;  3VDX A;  4IX7 A;  1BI0 A;  2W25 A;  1Y8Q B;  1R1U A;  3KZY A;  1JGS A;  2CYY A;  1TNS A;  2M30 A;  1G3Y A;  4R79 A;  3ZXS A;  4YFX F;  3BTC A;  5J4V A;  4L0Z B;  2DOE A;  2IGN A;  1SFX A;  3RSN A;  5HDK A;  1ZLK A;  4DYR A;  3JRH A;  5BPD A;  1FSH A;  1AHD P;  1TWA J;  2EIM H;  5D8L B;  1FBU A;  3LA3 A;  4Y52 J;  2K86 A;  3ZQH A;  5IOY A;  3H0D A;  5F04 A;  3CCY A;  3H92 A;  3ZQQ A;  2JQ7 A;  2VE8 A;  4RLF A;  1IN5 A;  3W6V A;  4HF0 A;  4IKF A;  2ICW G;  3BG7 A;  2D1V A;  3CCQ I;  4A6E A;  1R6R A;  4CDG A;  4IEJ A;  3K2Z A;  3P9C A;  3WG9 A;  1P7J A;  4A93 J;  1WVR A;  1JUP A;  2DDB A;  1BBY A;  1C0W A;  3DKY A;  3CUQ A;  3LFU A;  2WAF A;  4BS9 A;  2E71 A;  3DEU A;  2NS8 A;  2OA4 A;  5FO5 A;  1HC8 A;  4ESB A;  1OMI A;  5ICE A;  2XHK A;  3G2B A;  1QZY A;  1RUO A;  2GWR A;  2HZT A;  4CO8 A;  3L2C A;  4RAG A;  4D1Q A;  2ISY A;  5J6X A;  2O8X A;  4ZDO A;  1W5C C;  2LKX A;  2ID6 A;  2QUF A;  1BN5 A;  4CCK A;  1BC8 C;  1WJD A;  4CCM A;  1UB9 A;  5FRO A;  3WTT C;  1TQM A;  1IC8 A;  3MVP A;  2DT5 A;  2E1M C;  2A3S A;  3ISP A;  3TL4 X;  3L2U A;  2LNB A;  5J1Y A;  4DZP A;  2EWN A;  3KZZ A;  1ODD A;  2XF6 A;  1Z05 A;  2E7X A;  3FM3 A;  2XB0 X;  1GXP A;  2DDA A;  2JJ7 A;  1FIA A;  1TZL A;  1WJB A;  5KVR A;  4BDY A;  1MSE C;  3IUO A;  4HRI A;  3WG7 H;  2LG4 A;  2R93 J;  2DQR A;  5J8F A;  5FLX K;  2JK3 A;  4DJA A;  5LGU A;  1SAU A;  3CCU I;  2QQ9 A;  3PIP F;  4II2 A;  4BYY A;  5LLQ A;  3M9A A;  4O6J A;  4A5N A;  1X2M A;  3AKZ A;  1JGG A;  1SMY F;  4JBA A;  2J5O A;  1VQO I;  2CJJ A;  3QOP A;  4BE1 A;  1S7A A;  5FGM A;  4LLN A;  1W0U A;  2IS6 A;  1BI3 A;  1YX3 A;  2K7L A;  5LEJ A;  2QKL B;  2CS3 A;  3PFI A;  2EQR A;  3HM5 A;  4HQE A;  1E3H A;  2EFO A;  3K0L A;  1GDT A;  1FBS A;  4MGR A;  2XAG A;  4WWC A;  1FJL A;  3OR2 C;  1XG1 A;  1BIB A;  2ZXJ A;  2QSG X;  1U0J A;  1ZRE A;  3BR5 A;  3OSF A;  2IT0 A;  2JMW A;  5LD2 C;  4MNU A;  1JUS A;  3W2V A;  2Y75 A;  3VOE A;  4XNF A;  3ZMU A;  4HAM A;  3LA7 A;  4RB2 C;  4EJV A;  4DQ2 A;  3AG3 H;  3IWF A;  1FOW A;  1UCR A;  3U2R A;  3HDD A;  2BVM A;  4ZYD A;  2JA6 J;  5BNG A;  4PJN A;  1CGP A;  3A4C A;  3N4M A;  1HDD C;  4RLQ A;  4ENM A;  2E1N A;  2BY2 A;  4HW0 A;  5EDN A;  4HDU A;  1JI8 A;  3ZQL A;  4UB6 C;  3KYC B;  1F43 A;  3E6B A;  4A2U A;  1G2H A;  3T8R A;  2NRA C;  2M2E A;  4D5F A;  4WXD A;  5FRN A;  4I99 C;  3AG1 H;  5K7H A;  3DKX A;  3DWL E;  2CGP A;  2WV1 A;  2PBI A;  4G7Z F;  3ECO A;  2CW7 A;  2GBY A;  4UVA A;  2M5W A;  3GTL J;  4RBO A;  3QPL A;  4RAF A;  1E3O C;  2H6C A;  1MNM C;  2FSW A;  2EFW A;  4IHT A;  2VBX A;  3MKW B;  1Z67 A;  1Z7L A;  3G3Z A;  2Q2E A;  1S29 A;  4XKB A;  1IUY A;  1NK2 P;  4YG2 F;  2R5Y B;  4BJT A;  2J5P A;  5FD6 A;  1X1C A;  5B1A H;  4HST A;  1TP4 A;  1IW7 F;  2BGC A;  3M8E A;  2RC4 A;  2ZKZ A;  4L18 B;  3PUF A;  5LHH A;  2G7H A;  3I3L A;  2X6W A;  4BEH B;  1VND A;  1PP7 U;  4U0Y A;  3KP4 A;  2MBF A;  2LOO A;  3K10 A;  3WHC A;  2DBB A;  4MHG A;  2CW0 F;  5E18 F;  1VFC A;  3J7A Y;  3DEE A;  4OU0 A;  5EZG A;  1BI2 A;  2CRG A;  3KLO A;  3KP7 A;  2QBY A;  3W2A A;  4NC8 A;  2L9S A;  5L3D A;  5HS8 A;  3HTU A;  2HDW A;  2OQG A;  1YRN A;  4X1E A;  4NQW B;  2F5V A;  5F1R A;  3GLL A;  3TBI A;  2HVQ A;  2HYF A;  4XID A;  2LBF B;  2LC2 A;  2YSR A;  4IRI A;  2DMT A;  4HNU A;  3I55 I;  1HDP A;  2UXN A;  4XOR A;  3HOY J;  3GW2 A;  1L0O C;  2VIX A;  2JUG A;  3JRI A;  2HZD A;  1D0X A;  3F8N A;  4I02 A;  4K2E A;  5E79 C;  2KJB A;  3HPH A;  5BMZ A;  3OR1 C;  3ULQ B;  5FD5 A;  1XS9 A;  3V42 A;  1A6Q A;  2X6Y A;  2CQ7 A;  5D5V B;  3F21 A;  1SVO A;  2WTE A;  1O4X A;  1W5T A;  2E34 A;  1KA8 A;  4C3H J;  5GPC A;  3BDD A;  3L00 A;  4I7H A;  4GFB A;  3FXQ A;  1MBF A;  1WFX A;  5D5X B;  2YPR A;  2E5Z A;  3CF2 A;  3TGN A;  3T0Y A;  4ETS A;  5K5R A;  1IDY A;  2JPC A;  3DXJ F;  3Q0U A;  4M9X A;  3OWT A;  2TCT A;  3DTK A;  4ESF A;  2JUC A;  3WGG A;  5BPI A;  3HL2 A;  2YX7 A;  4IZZ A;  4YRV A;  4V2F A;  4EVI A;  3BJO A;  1LFP A;  3UNG C;  3CCL I;  1ZN2 A;  5HDG A;  4UNO A;  2OZ6 A;  4RGR A;  1AKH B;  2R7Q A;  1PJR A;  1FBQ A;  5C3E J;  3BG3 A;  1IXS B;  3P9K A;  5EGO A;  2RDP A;  3IV5 A;  4BQQ A;  2A6T A;  4L5J A;  2R3S A;  1Y39 A;  1O3T A;  1IRF A;  3J80 Z;  2VBY A;  2OJE D;  3K4N A;  1RIO H;  2K9L A;  1Z77 A;  4XR6 A;  4IOC F;  2WA0 A;  4M3B A;  1VTN C;  1ZTR A;  2ZO4 A;  4RB3 C;  5KAF C;  4EJO A;  3QYE A;  3ZQC A;  3PNY A;  3RJP A;  4QTR A;  1OR7 C;  3J81 Z;  4GXO A;  1TQI A;  1KU7 A;  3K7A J;  3RKW A;  1RI7 A;  5HLG A;  4EGY A;  2A05 A;  5CPR B;  1MBK A;  1Q1H A;  2JA7 J;  2CQK A;  3PM1 A;  1ZAO A;  1HA8 A;  1KQ8 A;  2FD5 A;  1MH4 A;  3PNV A;  3BRO A;  5AIQ A;  3C1D A;  1X1P A;  3GFJ A;  4I09 A;  3I4N J;  2K4B A;  1ETW A;  2V1N A;  1X2N A;  4IXA A;  3QOD A;  2DA4 A;  5IOZ A;  1X4P A;  3JAM Z;  5ILU A;  4P9F A;  5CYV A;  3VFZ A;  3M8J A;  3ZMT A;  3DTE A;  2B7E A;  3F8F A;  2OQR A;  4JK1 X;  2EV5 A;  3BP8 A;  2YU9 J;  1MW7 A;  1FZP B;  2HYJ A;  5JVG F;  1J2X A;  2OZU A;  1IUF A;  1UZC A;  5M5Y J;  1YI2 I;  1OCC H;  4OMZ A;  2XSD C;  1G4D A;  5L3G A;  1E17 A;  1P7I A;  3SDB A;  1JUM A;  4ITV A;  2ZNY A;  1V55 H;  3D1N I;  2DW4 A;  4MQV A;  1J75 A;  1LVA A;  5FJ8 J;  4D0P A;  4M6X A;  1XTA A;  3F9K A;  2VB6 A;  3KIO A;  3BR0 A;  3RKQ A;  2Y0S A;  4OIN F;  2LF8 A;  2E7W A;  2OAZ A;  2VXZ A;  2ZBK A;  5EF6 A;  1RKW A;  3LSR A;  1Z21 A;  3DLA A;  3HPG A;  4AYB N;  3A2K A;  1T0F A;  4ZH4 F;  1A35 A;  3BG9 A;  4YIF A;  1MH3 A;  3I59 B;  1JKP C;  3D0S A;  1XGM A;  3R4K A;  5TJJ A;  2IPQ X;  4IRH A;  1OCT C;  2BW3 B;  3LQR A;  4RGX A;  5CQG A;  2BHZ A;  2Z33 A;  1U9O A;  4UUT A;  4YEJ A;  3V7S A;  4L5I A;  1XC5 A;  1E2X A;  5DDG A;  2IW5 A;  3ESW B;  3OS0 A;  1UFM A;  3RI4 A;  1CF7 B;  1RES A;  2MW8 A;  1VQ7 I;  5C44 J;  2LRE A;  5D6F A;  2V79 A;  3GTJ J;  3GZN B;  2VQC A;  4BKX A;  1FIP A;  4QIW N;  3ERE D;  1XSD A;  1SMT A;  4BXX J;  4ZDL A;  1IZ1 A;  1TWH J;  3IWZ A;  4FET A;  4MFE A;  2M4G A;  2A6E F;  3K1N A;  2L0K A;  1GT0 C;  3C3W A;  4BQA A;  2VJ4 A;  2R0Q C;  1B72 B;  2B0L A;  3JSO A;  1T38 A;  1U5T C;  2O6G E;  1LB2 A;  2E2H J;  2NVU B;  1ZAR A;  2FU4 A;  2BZT A;  2ZC2 A;  3UR3 C;  4HYE A;  2M87 A;  3SYT A;  2DJI A;  3FM5 A;  4RDU A;  2D45 A;  4IHX A;  3HHH A;  2E36 A;  5J3L A;  2L4M A;  5BS6 A;  4G6T B;  5L3B A;  3T5X A;  2HGC A;  4EGZ A;  4IHW A;  4RB1 A;  4WXH A;  4XK4 A;  3K1P A;  3SJM A;  4F52 A;  2LK2 A;  5IT3 A;  1P4X A;  2L2O A;  5TIS C;  3KX2 A;  1JTY A;  2K9M A;  5IP7 J;  3QAH A;  3G73 A;  2GQQ A;  5DYM A;  5DD8 A;  3OYC A;  4MO7 A;  5JR3 A;  2QSF X;  4YII A;  2GM4 A;  4NBQ A;  3GWZ A;  2X48 A;  2ZXH A;  3GUD A;  2HPI A;  2WBM A;  2XV4 S;  3CZ6 A;  4Y33 A;  4KIG A;  2DPD A;  3NAR A;  1WQ2 A;  3CMY A;  4XN0 A;  1G8X A;  1PUE E;  1MIJ A;  3B6A A;  4LJZ F;  3ZQ7 A;  1J59 A;  3PNT A;  1N25 A;  3FHZ A;  2RRE A;  4J00 A;  2DMP A;  1IO2 A;  2L7K A;  2DI3 A;  1Z1D A;  2UXX A;  2NYX A;  1T2K A;  1T33 A;  2AQE A;  4P96 A;  3RQ4 A;  2KRH A;  2TRT A;  3BLY A;  5TRD A;  3HJE A;  4XIC A;  2GXG A;  2RGV A;  1R4M B;  2IBD A;  2V1X A;  3A01 B;  3LQQ A;  4DW6 A;  2XAJ A;  2JN6 A;  3DLL F;  3ZGK A;  1O3R A;  1D5V A;  5JVT A;  2XKP A;  5J4Y A;  1UST A;  2M0M A;  1W36 C;  3ABT A;  2F5F A;  3EYI A;  4CYC A;  5GAE J;  1DU0 A;  4Q4Z F;  2PEX A;  3RTR A;  1VQ6 I;  5M3F J;  3HKZ N;  3BG5 A;  2X0L A;  4XQF A;  4P5O A;  3DBR B;  3DF8 A;  1RUN A;  4EQQ A;  3A03 A;  2NS0 A;  3VSL A;  3PQK A;  5FLV A;  2Q0O A;  4FQG A;  4D7N A;  3Q9V A;  1N77 A;  2WC2 A;  4C2M J;  2LMD A;  1S3J A;  2XGE A;  1OYY A;  1B59 A;  1EV7 A;  3F72 A;  3K4M A;  3I5U A;  2O3F A;  2K40 A;  1FX7 A;  4XLA A;  3S3N A;  4Q48 A;  1LDD A;  2NVX J;  1MMG A;  3RIR A;  2P5V A;  4N9H A;  5KHD A;  1XGS A;  4BBR J;  1OYW A;  1SFE A;  3ZQI A;  5HLT A;  4XSZ F;  3WTS C;  1R71 A;  1U78 A;  2DK8 A;  4M3G A;  1XMX A;  4C3J J;  2XIG A;  3HRM A;  2DT7 B;  1MND A;  2RNG A;  2ZME C;  3PJR A;  2LVS A;  3CTA A;  3HG9 A;  3EUH A;  2VOO A;  3BJA A;  1F36 A;  1UHS A;  3H3V K;  3HZJ A;  2CMP A;  1DP7 P;  4HNV A;  4A3B J;  2DA6 A;  2HNH A;  2XAU A;  2F4I A;  4AVZ A;  2PG4 A;  1ZK8 A;  2QEX I;  2O9L A;  1B6A A;  3CD6 I;  4M72 A;  2CV2 A;  3ML6 A;  3P5J A;  1ETY A;  3R6S A;  2W85 A;  2VN2 A;  2VT2 A;  2WAD A;  5JLW A;  4N4O B;  2FA5 A;  1VF9 A;  4AIH A;  5LHG A;  2UZK A;  1GV2 A;  2CFX A;  1YJN I;  1AU7 A;  5LHI A;  2LP0 A;  3H5A A;  2JTV A;  4UY8 I;  4BHC A;  4OMY A;  5FRM A;  1S7O A;  2EZI A;  1MGT A;  1HKQ A;  4TV7 A;  5FKN A;  3R0J A;  1RPW A;  3S1R J;  2XAH A;  3WU1 B;  5KAI C;  4EMS A;  2LLK A;  1K61 A;  2HQN A;  4IVN A;  3X2Q H;  5J40 A;  1FMV A;  2VLA A;  4B09 A;  3TP3 A;  1ZYR F;  1B1B A;  5KCM A;  4N9I A;  3FXO A;  3CO7 C;  2O03 A;  1SD4 A;  1ULY A;  2XAF A;  4PFP A;  1LFU P;  2RQP A;  4ZTJ A;  3IH2 A;  4XKW A;  1R5H A;  4PJ0 C;  3JRC A;  3GCM A;  1HW1 A;  2R5Y A;  5M3M J;  3Q5F A;  4BY1 J;  4NB5 A;  4XN3 A;  3CCJ I;  4XLF A;  3R60 A;  1KYZ A;  2D1H A;  1T0F C;  2F2E A;  3GX4 X;  4UUS B;  1PYV A;  4IF4 A;  4PSW A;  2PFB A;  4ENN A;  3MQ0 A;  4FAS D;  3CQZ J;  4BEH A;  1WHU A;  1MNE A;  2A5W A;  2HI3 A;  1NK3 P;  1Y56 A;  5IYD J;  5F1J A;  2L9N A;  1FOY A;  4XRS A;  2BXZ A;  4XKV A;  4V2G A;  5HOO A;  2DMQ A;  4RMN A;  4L9J A;  5H2F C;  1R4N B;  1RZ4 A;  3FXK A;  1J5Y A;  2Z5U A;  3Q0W A;  1KU2 A;  4EJW A;  5BQT A;  3IRQ A;  4HQM A;  3BJ6 A;  4HLY A;  4KDP A;  3BC8 A;  1TW3 A;  1YE9 A;  3EET A;  3BY6 A;  6PAX A;  2XGD A;  5FKM A;  2HVS A;  1ONV A;  3B02 A;  1TWC J;  3LFK A;  2VOP A;  2M1B A;  3HOX J;  2K4J A;  2VKE A;  1P92 A;  1QVU A;  3JTH A;  2DXI A;  4C9Y A;  1APL C;  3ZMS A;  1LFB A;  4EM0 B;  4A69 C;  2CH0 A;  3H36 A;  1UHW A;  3BTI A;  2E1M B;  2O7O A;  3VB2 A;  2DMN A;  2V7F A;  3COA C;  1ZEL A;  2FOK A;  3DP7 A;  1W7P D;  3LST A;  2GAU A;  5DCF A;  3LSH A;  1GVD A;  4EJU A;  4X0G A;  3FIW A;  5F0C A;  4CYD A;  3OYG A;  1BA5 A;  4XLE A;  3L7W A;  2CU7 A;  3BPV A;  2FNP A;  2K3P A;  3TO9 A;  4ZZD A;  4KN7 X;  3V7C A;  2EIJ H;  2FQ4 A;  3VPR A;  3K2A A;  5GPA A;  5F0H A;  3ELK A;  3KCC A;  5KK1 A;  4FE4 A;  2VJI A;  3OYA A;  4KJZ A;  3L2Q A;  5EG0 B;  1SAX A;  5IPA A;  1AKH A;  2PJP A;  5HDN A;  2LH9 A;  1V5G A;  3CJN A;  3QU6 A;  3DBH B;  3CCR I;  3BR2 A;  5EJC A;  4OAY A;  1BIA A;  2CV1 A;  1GVJ A;  2MH2 A;  4G12 A;  2VBW A;  1R58 A;  4B4C A;  3OYI A;  3S1M J;  2OC6 A;  2PN6 A;  1X58 A;  1RRJ A;  2WB1 N;  5K5O A;  3KLN A;  1XPX A;  2IRF G;  3SZP A;  1XGO A;  2L5Q A;  4MEY F;  1EF4 A;  3ASN H;  2P7V B;  2P7C B;  2WV0 A;  2PLY A;  1XSX A;  2N8G A;  2DA7 A;  2ISZ A;  3QOE A;  1M1E B;  1YW9 A;  1PP8 F;  3DU6 A;  3RZO J;  2IEK A;  4YIR X;  3VYU B;  3LSI A;  3S2W A;  3CME I;  2HQ5 A;  3CCS I;  1R22 A;  4DYC A;  1MJB A;  4X6A J;  1I1G A;  1YS7 A;  3LNQ A;  2FJ1 A;  3E5X A;  5E3M A;  2AS5 F;  4CCJ A;  3TED A;  4RB0 A;  3M07 A;  2R7W A;  2KIS A;  3HOV J;  5E3N A;  2B63 J;  3S1N J;  4LIT A;  3HUG B;  2H8W A;  3IH3 A;  1BW5 A;  1HLV A;  4P1W A;  1J09 A;  2HDC A;  1ZR4 A;  4G8X A;  2V6E A;  1Y1W J;  3TW6 A;  1R00 A;  2WWY A;  2XGC A;  2MG4 A;  3NEU A;  3L9F A;  5EEG A;  3I56 I;  3ABK H;  3PQJ A;  2HR3 A;  4AYB A;  5FKL A;  4GDF A;  2HFH A;  2K9Q A;  5JLX A;  4Y3O A;  1T95 A;  1N78 A;  2IS2 A;  2ID3 A;  2LKS A;  1ENH A;  1YJW I;  2CQX A;  4ZC3 A;  3AL0 C;  2Z16 A;  1ZG3 A;  1J9I A;  3I59 A;  3LAJ A;  1I27 A;  1XGN A;  3JRG A;  2BW3 A;  3OMY A;  3AFH A;  1UJ8 A;  1TW2 A;  3CDL A;  5LGN A;  3OYM A;  3J7Z I;  3CES A;  1TWF J;  1FY7 A;  1UMQ A;  4RAY A;  1TQP A;  3FKJ A;  2PX9 A;  3F6V A;  3GYH X;  2EZL A;  5DM6 F;  2EH3 A;  4ZYA A;  2ZJR F;  2PJR A;  4KIB A;  4G94 A;  1GV5 A;  4DOZ A;  4WK8 F;  4HX4 A;  3KE2 A;  3OOU A;  1U2W A;  2MGQ A;  5DUK A;  4WX9 A;  2FF4 A;  3LSM A;  1PVE A;  3WTY C;  5H20 A;  1V54 H;  3BPX A;  5B5E C;  1Y6I A;  3KET A;  4GYG A;  4C30 A;  4H4K C;  3S32 A;  1OQY A;  4LIU A;  1S7E A;  2DFE A;  3C7J A;  2FXA A;  2TDX A;  3K4J A;  4KT6 A;  4QPQ A;  4BGD A;  3U9G A;  5DTD A;  4U0V A;  1GXQ A;  2YU3 A;  1XB4 A;  2IGM A;  1RR7 A;  1HST A;  4AIJ A;  3OIQ A;  4A3G J;  2UV1 A;  5DUI A;  4RGS A;  5IP9 J;  2FUG 2;  2EZK A;  2GZW A;  1T98 A;  1EH6 A;  1YJ9 I;  2RQQ A;  4BQN A;  3PO2 J;  3OL4 A;  1D8K A;  2L54 A;  3CUO A;  4G9Y A;  2DTR A;  2DA2 A;  3FHN A;  2IAI A;  3KEY A;  4GCV A;  1MDM B;  4NNJ A;  4AWX B;  2MD0 A;  4O5V A;  3JRA A;  1O3Q A;  5J1U A;  2LR8 A;  3ABL H;  3ZOB A;  3DPL C;  3NAU A;  4HZF A;  4F3Q A;  4CCO A;  3JR9 A;  1Z6T A;  4KA4 A;  1RR8 C;  4P55 A;  1TWG J;  2OCE A;  1KQ9 A;  2JA2 A;  2STW A;  1D1B A;  2HXO A;  4A3I J;  3RYR A;  5AIP A;  4G6Q A;  4AVP A;  2ZXI A;  2FQ3 A;  3KP2 A;  2LYC A;  1G3W A;  4LIV A;  3CLO A;  2G7U A;  3M8F A;  3GTK J;  2H1K A;  2XC7 A;  3GTG J;  2W00 A;  1R49 A;  3FK6 A;  4XRM A;  3ECH A;  2NNY A;  4LG0 A;  3A01 A;  2OTL I;  3GTM J;  2IGO A;  2HVR A;  2E19 A;  3IL2 A;  3QP6 A;  3S93 A;  2R7V A;  3O8H A;  1SEU A;  2KZG A;  5D4R A;  4HDV A;  2X1C A;  2WAQ A;  2PMZ N;  3E97 A;  2ZJP F;  2V6C A;  4D9J A;  3F8M A;  4ZZL A;  2AO9 A;  2QQB A;  1WI9 A;  4FTH A;  3CUQ C;  1B4A A;  5LGT A;  3U1D A;  4R8H A;  2ELH A;  1H9G A;  1OCZ H;  1YLF A;  3EQL F;  3MKZ A;  5E3O A;  1B9N A;  3SZG A;  2Z9O A;  1G6N A;  1J7K A;  1D5Y A;  1YTY A;  1HXD A;  3VYS B;  1YQA A;  4XL9 A;  3ZMV A;  1XCV A;  1IDZ A;  2FOW A;  4GGG A;  4HA8 A;  4ON0 A;  1IG7 A;  2A61 A;  2P8T A;  1FMW A;  1POG A;  2HOA A;  2VQG A;  1IN6 A;  4KIT B;  4FT8 A;  1Q1V A;  4IPA A;  3S2D J;  2XUB A;  5JFR A;  2KZV A;  3MAJ A;  2STT A;  5L3C A;  1FWZ A;  2M7B A;  3C2B A;  2DA3 A;  1LJ9 A;  2JPB A;  4XRS G;  1JHH A;  4KIS A;  2CQN A;  1ZHF A;  1SC7 A;  1ON2 A;  1XX5 A;  2I10 A;  3BTJ A;  2Y2Z A;  2R7X A;  5IY5 H;  3CP8 A;  2VI6 A;  4M3F A;  5HLH A;  2KHM A;  2IS1 A;  3QQA A;  2OF7 A;  3IHU A;  1ACI A;  2I8D A;  3A0B C;  5GAH J;  1R7J A;  4GRI A;  1XDS A;  1ITY A;  3PL8 A;  1H9T A;  3EDP A;  1HBX G;  4F92 B;  5J1R A;  3HBL A;  3OS1 A;  1HF0 A;  4IHV A;  2UWM A;  4RS8 A;  2GIZ A;  3FXU A;  1K6Y A;  2EFP A;  4RA2 A;  2XPW A;  5GTH C;  5D4S A;  1I50 J;  2OCC H;  4FE7 A;  4ABZ A;  2EB7 A;  3BQZ A;  2E1O A;  5GTI C;  5ILV A;  1KON A;  3PSF A;  3I64 A;  4CZZ A;  3SFI A;  1J0R A;  2EA2 A;  2IJL A;  4ZJZ A;  2CFO A;  3ABM H;  5B66 C;  2XDV A;  3BZC A;  1KYW A;  1I6H J;  2DK5 A;  2VPR A;  2XB5 A;  3G1O A;  1QNT A;  2X51 A;  4BE2 A;  4NHJ A;  3G1L A;  3M1E A;  1TNT A;  3KZI C;  1U5T B;  2OPT A;  1YYV A;  3CCM I;  1O7F A;  4A3L J;  2WY7 Q;  3NWT A;  4EEF G;  4IJA A;  4KT5 C;  2EV0 A;  2IGK A;  2VAS A;  4F91 B;  4B8X A;  4E7L A;  4P9U A;  5ICG A;  4A5M A;  3H0G J;  2XAS A;  3V7R A;  2NAZ A;  3ABU A;  4XON A;  3TOA A;  2DYR H;  1ZG1 A;  1TC3 C;  1IAW A;  2MLG A;  2L7Z A;  4LGW A;  2DLL A;  1K4S A;  2K02 A;  2EZH A;  4JX5 A;  2EIL H;  5L3F A;  3HB9 A;  5KNL A;  1BW6 A;  2LD5 A;  2IS4 A;  1ZH5 A;  2YR2 A;  4MEX F;  5CJ9 A;  2P6S A;  1SVM A;  2QKM B;  1IF1 A;  4IHY A;  3BR6 A;  1F4K A;  3G4S I;  3KFW X;  4M73 A;  1Z6R A;  1VQN I;  5ILS A;  4KIC A;  3O8G A;  1FTT A;  3BR1 A;  3U1K A;  3Q9S A;  3SEZ A;  4W1U A;  2C6Y A;  1I39 A;  2CUF A;  4ENK A;  1SVL A;  3W3C A;  1BC7 C;  5E8G A;  1R23 A;  3MZH A;  2KQR A;  1S6L A;  2DCE A;  1X1D A;  3C18 A;  3MD2 A;  1XDU A;  3D5R C;  4CSW A;  1X3Z B;  4PJL A;  2L02 A;  2CUZ A;  3O6B B;  2H1L A;  2QGU A;  2YUS A;  3HSR A;  2QQ8 A;  4LOC A;  2LY2 A;  3R0A A;  1F1Z A;  3FK7 A;  2XRN A;  2ME6 A;  4CZC A;  2LTP A;  5A2Q K;  2AXT C;  4HNT A;  2PI0 A;  3VWB A;  3I53 A;  1P4A A;  1U6G A;  1JHF A;  4FIS A;  3OYE A;  1VQ5 I;  4R1H A;  3BOQ A;  1HOM A;  3KEQ A;  5HLI A;  4ZYG A;  2LRD A;  3CJT B;  3I0T A;  1WJA A;  3E6C C;  4BXU A;  2FX0 A;  3FXM A;  3E3V A;  2L9V A;  3CC2 I;  1VQK I;  3MMY B;  1QPM A;  5DD4 A;  2F48 A;  1FNN A;  2HTJ A;  2OU2 A;  4E6K G;  4HX7 A;  2DQL A;  3ZN0 A;  4BY7 J;  4Z2Y A;  3QYB A;  2GIV A;  2ZSI B;  1MSF C;  2OBP A;  3K70 D;  4DZJ A;  2ZJQ F;  2WAE A;  1B8I B;  1TT0 A;  5DM7 F;  4RM3 A;  4F93 B;  2O61 A;  2CG4 A;  4LB5 A;  4I0B A;  2ZFU A;  3OL3 A;  3F8B A;  2COB A;  5GAD J;  2BV6 A;  3FIS A;  2DA5 A;  1NG6 A;  2ELK A;  3CF5 F;  1R36 A;  3OYH A;  3IKT A;  1DQU A;  1FEX A;  3F22 A;  3K4K A;  3H3Z A;  2H27 A;  1WI3 A;  4O3M A;  4ZTF A;  2WB1 A;  3TO6 A;  3AAF A;  2BHY A;  1D3Y A;  3ROU A;  4LD5 A;  2X6X A;  2Y48 A;  1XMK A;  1KZH A;  4Z6Y A;  2NS7 A;  3ERM A;  3E6M A;  2BY0 A;  2GA1 A;  3QPT A;  4CCL A;  2O5R A;  1G3T A;  1BM9 A;  1SD7 A;  3MEX A;  4UVB A;  4LFU A;  4FX0 A;  4M6Y A;  2DPU A;  2DJN A;  2K9S A;  4Y4R A;  1JJ8 C;  3DKW A;  2HU9 A;  2ZME B;  3DQV C;  2K85 A;  3GTO J;  2BYV E;  3PUB A;  3S2H J;  1A36 A;  2PQ8 A;  2VQH A; 
#chains in the Genus database with same CATH homology
 4HEA 2;  2JVH A;  3ZCO A;  2CH0 A;  4ZDP A;  4BJT A;  2E1M B;  1X1C A;  2VKH A;  4HST A;  2V7F A;  4RM2 A;  1ZEL A;  2KL4 A;  3BCB A;  3LSH A;  3I3L A;  2X6W A;  4X0G A;  3OYG A;  3K4L A;  4BEH B;  2OV7 A;  3A1Y A;  4XLE A;  2LOO A;  2CW8 A;  3K10 A;  2K3P A;  2AQF A;  4XLC A;  1OLT A;  3J7A Y;  2JSP A;  3DEE A;  3EUA A;  3W2A A;  3C2G A;  4NC8 A;  2HPM A;  2R4G A;  2L9S A;  4E7S A;  2VJI A;  3OYA A;  4KJZ A;  2HDW A;  1MMA A;  3L2Q A;  3HOT A;  4NQW B;  1DGW Y;  2F5V A;  3TBI A;  2HVQ A;  1V5G A;  2LH9 A;  2W4S A;  4BXF A;  3MKY B;  3CJQ B;  2LBF B;  2LC2 A;  4OAY A;  2CV1 A;  4HNU A;  3LSK A;  3FBN B;  3OYK A;  3C2H A;  3OYI A;  2OC6 A;  4MLO A;  1BR1 A;  4XOR A;  3CMM A;  2VIX A;  2JUG A;  2PJR B;  2HZD A;  2L5Q A;  1D0X A;  3HPH A;  3OR1 C;  3V42 A;  2KMU A;  2X6Y A;  3QOE A;  2Q2E B;  3LSG A;  4E7J A;  3OYF A;  3DU6 A;  2KP6 A;  3VYU B;  3K70 C;  3LSI A;  4PJJ A;  4CUG A;  1X1B A;  1WFX A;  2MAB A;  1LVK A;  1E0E A;  4BL0 B;  3FBI B;  2E5Z A;  1AA7 A;  2E60 A;  3CF2 A;  4IQ4 A;  2R7O A;  3ONQ A;  1X19 A;  2DT6 A;  3OWT A;  3E0J B;  4CCJ A;  4F55 A;  3DTK A;  3EPZ A;  2R7W A;  3H35 A;  3K6G A;  1BR4 A;  3HL2 A;  4BAC A;  2HQA A;  3SEQ A;  4IZZ A;  2P0W A;  4YRV A;  4LIT A;  3HUG B;  3DPU A;  3UNG C;  1LFP A;  5HNF A;  4P1W A;  1J09 A;  4BUP A;  1P9Q C;  2R7Q A;  2V6E A;  1PJR A;  4BE0 A;  2KPM A;  2M3A A;  2VKD A;  4BQQ A;  2A6T A;  1D1A A;  2GOM A;  4AYB A;  3H9Q A;  2X1D A;  4C2U A;  4Y3O A;  3K4N A;  1T95 A;  1N78 A;  2IS2 A;  1BOB A;  2K9L A;  4XR6 A;  2WA0 A;  4ZC3 A;  3AL0 C;  1LDK B;  2KDO A;  2Z16 A;  2CV0 A;  3QYE A;  3PNY A;  3IAM 2;  4XKC A;  3OS2 A;  1OR7 C;  2KLO A;  3OYL A;  4BJ5 C;  4CA0 A;  4N4N B;  2BW3 A;  3OMY A;  3AFH A;  4XOP A;  3OIP A;  5CPR B;  1UAA A;  1S9H A;  3OYM A;  1QHG A;  3H5R A;  1HA8 A;  3CES A;  3DTI A;  4B48 A;  2LBF A;  3PNV A;  3FKJ A;  3LL7 A;  4ZYA A;  2V1N A;  2PJR A;  3QOD A;  4DOZ A;  1X4P A;  4HSR A;  5CQE A;  3KYL A;  3M8J A;  2MYS A;  3OOU A;  2X1E A;  3DTE A;  3IAS 2;  2OUM A;  1MW7 A;  4BJ6 C;  4LG3 A;  1QHH D;  3BG6 A;  3LSM A;  4XLH A;  2MFZ A;  4DIQ A;  4BU2 A;  4B44 A;  3OYN A;  1Y6I A;  4E7I A;  3SDB A;  3S8P A;  2W7N A;  4ITV A;  2ELJ A;  5CKT A;  4H4K C;  4C30 A;  4E4H A;  3S32 A;  2W1O A;  4LIU A;  3L2W A;  3F9K A;  2VB6 A;  2Y0S A;  3U21 A;  1YX5 A;  4QPQ A;  4KT6 A;  3K4J A;  1D1C A;  2VXZ A;  2E5N A;  4BGD A;  1Z21 A;  2NOJ B;  3DLA A;  3HPG A;  3A2K A;  1X1A A;  2XSJ C;  2VPL A;  3N05 A;  1VZ0 A;  1SFK A;  4II3 A;  1X4O A;  2F6C A;  2IGM A;  2PMZ A;  2BW3 B;  3LMM A;  3OIQ A;  4PSX A;  2UV1 A;  2XF5 A;  4NC7 A;  5CQG A;  3D5S C;  2LY1 A;  2FUG 2;  3ZRG A;  5HVQ C;  4YEJ A;  1W36 D;  2RQQ A;  4BQN A;  1ERD A;  3OL4 A;  3CJR B;  3OS0 A;  2R7S A;  5JHF A;  3FHN A;  3OYD A;  3KEY A;  2VXD A;  2M7A A;  4NNJ A;  2MD0 A;  3OYB A;  4F3Q A;  3DPL C;  2LRE A;  4CCO A;  2VQC A;  3E1S A;  4ZDL A;  3VSK A;  1WJC A;  4FET A;  4ANJ A;  1UEL B;  2JA2 A;  3HOS A;  2M4G A;  1D1B A;  1LKX A;  4E7H A;  1UG0 A;  2VJ4 A;  2ZXI A;  3S3M A;  2LYC A;  4LIV A;  1NG7 A;  3OYJ A;  2R7T A;  2XC7 A;  4DBR A;  3UR3 C;  2W00 A;  3SYT A;  2DJI A;  3K4B A;  2IXS A;  4G6T B;  3D5L A;  3L2R A;  2KRC A;  4XOT A;  2IGO A;  4YEL A;  2HVR A;  3DU5 A;  1EA3 A;  3AL0 B;  3S93 A;  2R7V A;  3BCA A;  2M4K A;  4F52 A;  2L2O A;  3NWS A;  2X1C A;  2WAQ A;  3KX2 A;  1GLN A;  4D9J A;  2K9M A;  4JQF A;  3H5N A;  3OYC A;  3H9J A;  3M1C A;  4BDZ A;  2XF7 A;  3HC7 A;  1BR2 A;  3MKZ A;  1QU3 A;  3SZG A;  4HPQ A;  2WY8 Q;  2ZXH A;  4C2T A;  2HPI A;  2WBM A;  2X85 A;  3CZ6 A;  4XL9 A;  3VYS B;  4Y33 A;  4XN0 A;  1G8X A;  4PJM A;  1FMW A;  2VJJ A;  3PFY A;  2Q1Z B;  1D0Y A;  2VQG A;  3PNT A;  3VDX A;  4KIT B;  2RRE A;  4IX7 A;  4J00 A;  4JOM A;  2L7K A;  5TGT A;  4OAZ A;  4EAT A;  2KZV A;  4PK4 A;  2M7B A;  3EUH C;  3K4C A;  2AQE A;  2BOL A;  3RQ4 A;  2KRH A;  1MMN A;  4R79 A;  3BLY A;  3ZXS A;  4KIS A;  4E7K A;  2Z1D A;  2VJ5 A;  2IGN A;  3RSN A;  4B3X A;  2V26 A;  3ZGK A;  4CH7 A;  2BVL A;  1WJF A;  2R7X A;  3CP8 A;  2JVG A;  2KHM A;  3I9V 2;  4AU7 A;  2M0M A;  1W36 C;  2IS1 A;  3ZR8 X;  4OWR B;  2I8D A;  3H0D A;  3H9G A;  3ZQQ A;  4GRI A;  3PL8 A;  4RLF A;  3RCO A;  3RTR A;  4DGW B;  2VQL A;  4IKF A;  4F92 B;  3BG7 A;  2UWM A;  3OS1 A;  4XQF A;  1R6R A;  1MMD A;  3QYF A;  4P5O A;  1K6Y A;  3VSL A;  2DOA A;  4U87 A;  3DKY A;  3LFU A;  2WAF A;  1KON A;  4BS9 A;  1N77 A;  3PSF A;  3PSI A;  3K4M A;  4XM3 A;  4ZJZ A;  2CFO A;  3S3N A;  4XLA A;  1MMG A;  3GBG A;  2XDV A;  3G2B A;  4HG2 A;  5KHD A;  5HLT A;  2X51 A;  4BE2 A;  1DGR M;  4D1Q A;  2DT7 B;  1MND A;  4ZDO A;  2RNG A;  3PJR A;  2WY7 Q;  3HG9 A;  3NWT A;  4CCK A;  1WJD A;  2IGK A;  4CCM A;  2VAS A;  4F91 B;  4E7L A;  5FRO A;  1Z3X A;  2K5C A;  2CMP A;  2E1M C;  4XON A;  1V5E A;  1DP3 A;  3TL4 X;  3L2U A;  2HNH A;  2XAU A;  2XF6 A;  2F4I A;  3HXL A;  4AVZ A;  2MC4 A;  4DBQ A;  2CV2 A;  2R7R A;  5LFA A;  4B47 A;  5KNL A;  1TZL A;  2WAD A;  2IS4 A;  1WJB A;  4BDY A;  4N4O B;  2CUJ A;  3IUO A;  1G59 A;  4HRI A;  2LG4 A;  2QKM B;  4DJA A;  4QPO A;  1SAU A;  3H5A A;  3SEZ A;  4II2 A;  5FRM A;  3W3C A;  2UUZ A;  2V4J C;  3AKZ A;  2KQR A;  2DCE A;  4U7B A;  1X1D A;  4BE1 A;  3MD2 A;  3D5R C;  3HKZ A;  4CSW A;  1Z3Y A;  3EUK L;  4PJL A;  2CUZ A;  3W2W A;  2IS6 A;  1YX3 A;  4E7Z A;  1FMV A;  2LY2 A;  2QKL B;  2CS3 A;  1IRX A;  4B43 A;  4CZC A;  4NUB A;  4CCN A;  4HNT A;  4PUS A;  1WJE A;  3VWB A;  2VLA A;  2Z2S B;  5KCM A;  3OYE A;  4XMY A;  3S3O A;  3OR2 C;  5HNH A;  3DPT A;  2LRD A;  3VYR B;  1U0J A;  4BQO A;  1WJA A;  4PFP A;  3L2V A;  4ZTJ A;  4XKW A;  2GOX B;  3MMY B;  5LD2 C;  4XN3 A;  4XLF A;  3W2V A;  4E6K G;  3TMO A;  4XNF A;  1T0F C;  3QYB A;  3VYT B;  2V9K A;  1D0Z A;  2ZSI B;  1N75 A;  1PYV A;  4PSW A;  3K70 D;  4FAS D;  4BEH A;  2WAE A;  1TT0 A;  4J01 A;  2BVM A;  1V5F A;  1MNE A;  2A5W A;  1WJ5 A;  4RM3 A;  4PJN A;  4F93 B;  4IQJ A;  1Y56 A;  2W82 A;  2ZFU A;  3A4C A;  3FDY A;  3OL3 A;  3IP4 B;  2L9N A;  4RLQ A;  4XKV A;  1NG6 A;  5HOO A;  3OYH A;  4PFO A;  2R7U A;  1DQU A;  4RMN A;  3K4K A;  1JI8 A;  4ZTF A;  2WB1 A;  5FRN A;  3BC8 A;  2X6X A;  1YE9 A;  3OY9 A;  3DKX A;  3DWL E;  3RPU D;  2ZSH B;  2HVS A;  2CW7 A;  4CCL A;  2O5R A;  4Y4R A;  2VL8 A;  2DXI A;  2HU9 A;  3DQV C;  4C9Y A;  3CP2 A;  1Z7L A;  3PUB A;  3MKW B;  4XKB A;  2VQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...