2VQCA

Structure of a dna binding winged-helix protein, f-112, from sulfolobus spindle-shaped virus 1.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
b'TLNSYKMAEIMYKILEKKGELTLEDILAQFEISVPSAYNIQRALKAICERHPDECEVQYKNRKTTFKWIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL 13.2 KDA PROTEIN
publication title Cysteine Usage in Sulfolobus Spindle-Shaped Virus 1 and Extension to Hyperthermophilic Viruses in General.
pubmed doi rcsb
source organism Sulfolobus virus-like particle ssv1
molecule tags Dna binding protein
total genus 19
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09645 F-112 F-112 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqcA00
2VQCA
chains in the Genus database with same CATH superfamily
3IP4B 1FBUA 3CDLA 4NUBA 5J8FA 3GTGJ 1P6RA 1UHSA 2DTZA 2L9VA 4G7ZF 5HODA 3PQKA 4XONA 3HKZA 3S16J 2XAUA 3ZQLA 1TW3A 2CFXA 4C3JJ 3JRIA 1JT0A 3ESWB 3Q0VA 4XOTA 1SFXA 3K70C 2F5EA 1YHQI 1H0MA 5HOOA 3EYIA 3LNQA 5J4VA 4L5IA 2NS8A 3LSKA 1KYWA 3CF5F 4DOZA 4XM3A 3K69A 1G6NA 2ICWG 5F6FA 3JRGA 1OR7A 2H94A 1Y56A 1YLFA 3GTJJ 3BC8A 1KGSA 4BQAA 2ZXWH 4CCMA 4A3DJ 2J5PA 4G6TB 4UUVA 2Z3YA 1IF1A 4L5JA 1X1BA 3BTJA 1LDKB 3H0GJ 4HV5A 1NK2P 2Z5UA 4FT8A 3BT9A 4AD9A 2K9MA 1GXQA 2H6CA 4XLPF 2CW0F 2HKXA 3QAHA 2FXAA 4AM3A 2LRDA 4U7DA 1RZ4A 1F9NA 4UB8C 3A4CA 2LMDA 5EEGA 4IJAA 2EWNA 2VQHA 4G6DA 4GYGA 1PP7U 2CGPA 4XOPA 4BHPA 1LVAA 2ZO4A 1XDSA 2DJIA 4N9IA 2GXAA 1TNTA 5IY5H 4HNTA 5EZGA 5B66C 3Q9SA 4M3BA 2FBIA 1OCPA 4KT5C 3V4GA 1R5GA 3BDDA 5J4YA 4KIFA 1R4NB 3PSFA 1HW1A 4I98B 4LGWA 4YFKF 2WV0A 4LK0F 4PJMA 3DTIA 5M3FJ 2KRHA 4BQOA 1Y0UA 2X9DA 3KEOA 2KFDA 3SJMA 2DT7B 4DIQA 3ZMTA 3OYAA 4RLQA 3QOPA 1D0XA 2IAIA 5M5WJ 4L0ZB 4J19A 1U5TB 3KZZA 5J1RA 4ZZLA 4ANJA 2VJ4A 3OYDA 1GT0C 4BE1A 2EIMH 1VQ8I 4A3MJ 4JX6A 3V7RA 1IUYA 3E97A 4FISA 1SFKA 2AXTC 1JUSA 1BC7C 1P4WA 3H1CA 5AIPA 1OCRH 5D5WB 3RYRA 1LNWA 1OKRA 1R00A 3SZPA 2TRTA 4CSWA 3CJRB 3IWZA 1EKEA 4MHGA 4AC0A 1X3UA 2CQQA 4D0PA 1DU0A 3AKZA 4NBQA 2RDPA 2EIKH 2RVCA 3MMYB 2W25A 5J47A 1QRYA 2XHKA 1TLHB 3TW7A 2M0MA 2XB0X 2JSCA 4HX8A 1K61A 2OTJI 5HLGA 4GRIA 3IRQA 4L9JA 3E5UA 3HGYA 3ABMH 1OFCX 3CP2A 5FFZA 4LLNA 2YR2A 2GXBA 4WXDA 4XSZF 3I71A 5ILSA 1L3LA 1TT0A 4F52A 2MD5A 2DW4A 3KLOA 3ZCOA 2QUFA 1K4TA 1HXDA 4DW6A 1AA7A 1FP2A 3W2AA 4BHCA 2OC6A 3G1MA 4Q48A 4E7SA 4G6QA 2HQ5A 3ABTA 2RC4A 3RTRA 4NB5A 4F92B 5KCMA 1R58A 1W1WE 4BBSJ 2O9LA 2X85A 2CFOA 2B0LA 3IUOA 1TNSA 4KN4X 2Y69H 2HEOA 2L7MP 3O6BB 3CO7C 2D1VA 3HUGB 3AG2H 1XGSA 1HOMA 4P55A 3ZQHA 2CW8A 4NNJA 4UV9A 5FO5A 2B9SA 2DOAA 3CCVI 2KRFA 2XSJC 3GFLA 2STTA 3WGIA 2NYXA 1VQKI 2W00A 5LBQA 3BR5A 3FXKA 3BQYA 1U5TA 2PG4A 2G9WA 2EZLA 1OCZH 3BROA 2R93J 3CUOA 4HOBA 2JPCA 4LD5A 4N4NB 4C9YA 3BG5A 4M73A 4QLCU 1KQ0A 1U3EM 2L0KA 2M9HA 1FIAA 5KAIC 2W84A 4CCOA 2H8RA 1S3JA 3TOBA 5JHUA 2AQEA 2KIUA 3OL3A 1E0EA 5DDGA 2PMHA 3SFIA 3GZ5A 1O7LA 2FJ1A 1SD7A 1MBGA 1MDMB 3TMOA 5EDNA 3BG6A 3MZ8A 3RPUD 4C30A 2W7NA 3BR1A 1ODDA 4HDUA 4N0BA 2A6TA 1YIJI 3ASNH 1VF9A 3KZYA 2EV0A 1JUPA 1ZRFA 5FROA 1QZYA 4PJNA 2GLOA 1RUOA 4R79A 2FRHA 4IPAA 3QPHA 2V9KA 2K27A 3TW6A 5E3OA 3CDHA 4IHWA 5J1UA 4Z2YA 1Z7UA 1EA3A 2HR3A 2PFBA 2WAFA 4CH7A 3GTKJ 3Q5FA 3FXJA 1XPXA 2IGKA 2W48A 1ZYRF 1IJWC 1ETYA 2WC2A 5FKLA 1A6IA 1D8KA 1SVOA 2WAQA 2QSFX 2K9LA 1JKQC 2E36A 3ZRGA 1GVDA 2AQFA 4RAYA 3CJNA 3DBRB 3RDIA 2F5VA 1YJWI 3K7AJ 2HXIA 3OYFA 2FMLA 1ZKGA 3L2UA 1IRGA 1QZEA 1MKMA 2WY7Q 5BS6A 1Z3YA 1TQPA 2YSRA 3HUGA 4UVAA 1OR7C 3KYLA 2P0WA 2KQRA 1SD4A 5CVRA 4ABZA 2VKDA 2XAJA 2IS6A 5TISC 5FKMA 4DBQA 3FF5A 1JT6A 1ZREA 4C2UA 1JTYA 4O5VA 1VQ6I 3GZNB 2V79A 4YRVA 2IEKA 4HLYA 2X6XA 5B5EC 1PVEA 1WJDA 5D5UB 2R7FA 2HYGD 3TOAA 5C4XJ 4ZYDA 1O3TA 2Y30A 2ZMEA 1X2MA 4YIFA 2A69F 1ZG1A 4KA4A 2X6WA 1I27A 1VQ9I 1LVKA 1LDJA 1R22A 1O57A 2LP0A 3F8CA 4CCNA 3TEDA 5E3MA 1HCRA 2NVTJ 2JMWA 1UG2A 3ZOBA 3J80K 2F4OB 1NH3A 1DU6A 1XMAA 3E3VA 2M7AA 5K7ZA 5ICEA 4R1HA 1VQ7I 3BOQA 3ASOH 2G7UA 4BHBA 5F27A 4A5MA 1MDMA 4HF2A 2L7ZA 3AL0C 1HA8A 1QPIA 2DA6A 5ILVA 1P7JA 2K9NA 3KP3A 1ZGAA 1Z21A 2DA4A 2CRGA 2MFZA 3OYIA 1FZPB 3TQNA 1MBHA 1ITYA 3E5QA 2LY2A 4L18B 1S7EA 4OAYA 2MLGA 1BR4A 3LQQA 4W97A 3VEPA 1FC3A 1A36A 1TT5B 4MNUA 4YIRX 3FXRA 4DQ2A 2O6GE 2R0QC 4BACA 4H0EA 2WWYA 1T95A 1AWCA 2PJPA 3OS2A 3LOCA 4RGRA 3R0AA 1PUEE 2DMUA 2R7VA 4IQ4A 3ZN0A 1FTZA 1YIOA 1HKQA 1MSEC 3W6JB 2JWTA 4LOCA 1ZH5A 1SEUA 1SFOJ 4B4CA 4IEJA 3VYUB 3G3ZA 4BEHB 2BBYA 2JK3A 4EJVA 1D1AA 4ESFA 1W36C 1JKOC 2A6HF 1Z6RA 4Q4ZF 2GBYA 2R7TA 2F4IA 3EUHC 2V1DA 2OF7A 2JZYA 1N75A 1IW7F 3OIQA 3LSHA 2BOLA 3K4MA 4OMZA 4WWCA 3CP8A 4ZYEA 1FYLA 4JX4A 2R4GA 4KITB 3NWSA 5GADJ 2CV1A 2EH3A 4XK4A 5LLQA 3TO9A 3RQIA 4BJTA 1SAXA 3K2AA 4II2A 3M8JA 2UXNA 2ZKZA 2EFWA 4CO8A 1OLTA 3P9KA 4O3MA 4G7OF 4XBFA 2E7WA 2W4SA 5L3EA 3WHCA 1ZK8A 2KIFA 4A69C 5IP6A 2CH0A 4ZTFA 4M9SA 4A3BJ 2K3FA 4P1WA 1WJFA 2XIGA 3BZKA 3JTHA 3UKGA 3ZQ7A 3WTSC 3VODA 3DKWA 1SVLA 2LKPA 3LA3A 2QCOA 1S29A 4WK8F 4PSXA 1D5YA 3LFKA 1GLNA 2EPFA 4BKXA 2ZJPF 4F91B 3DCFA 5E8GA 5LEKA 1VI0A 2P7CB 3M8FA 5LD2C 2GZWA 3MAJA 2DT5A 3WG9A 3I54A 3DKYA 2L7KA 3M1CA 1TTYA 3BG9A 3OYCA 4BE2A 3WG7H 2IJLA 5IT9K 3GEZA 2EFPA 3M8EA 3JRDA 1LDDA 1QHHD 4TV7A 4P5OA 4NHJA 1G2HA 4YFXF 1SMTA 4G9YA 5CQEA 2HZTA 2VB6A 3JAMK 5DS9A 2MLKA 4IRGA 5C3EJ 5DUKA 3ISPA 4I0AA 4UUSB 3K2ZA 4ZJZA 4PZJA 4G8XA 2QA4I 4I09A 2DA7A 2X48A 4U0YA 1U8BA 1IG7A 4BEHA 2D1HA 3R0JA 2QZ8A 3PIOF 4DGWB 1H8AC 3MQ0A 2PI0A 1YX5A 3CJTB 3WTVC 2G7HA 4EVIA 4IOAF 1S7OA 5CQGA 5H6RA 3GLLA 3DBHB 2EFNA 3S14J 1ETXA 3IWFA 3BG7A 1BJAA 5ICCA 3JR9A 3HC7A 1BIAA 1SAUA 2OV7A 5CVIA 4EM1A 1IXRC 1IV6A 4A3GJ 3K10A 5BPDA 1NTCA 2EA4A 1Z9CA 2Y48A 2FD5A 4PCQA 2CS3A 4BUPA 4EJUA 2H8WA 2P8TA 2JTVA 2LBFB 1PUFB 2WAEA 3ELKA 3OSGA 1BI2A 3A0BC 3HSRA 1T33A 1ZN2A 4B1RA 1GVJA 4NQWB 3L2RA 1YQAA 3PJRA 3CCYA 2LF8A 3OIOA 2KZGA 1BA5A 1JGSA 3J81K 2CV2A 2MYSA 2D5VA 2EK5A 1X1PA 4MTDA 3HTUA 2L9NA 3IRRA 3EUAA 3S17J 5E3NA 2VE9A 1MJAA 2JPBA 2QQ9A 4EGYA 3GFIA 4J00A 2L9RA 3ZN1A 2L9SA 4UNOA 1Z3XA 3BJ6A 3CCJI 2FSWA 2OZUA 4HDVA 3BJOA 1R5HA 4QTRA 1VQOI 4AIJA 2R7OA 5C44J 5JR3A 4BDYA 1LQ1A 2KJBA 3H3ZA 3AG4H 4LG3A 4XRSA 4HZFA 3LSRA 2HDCA 5IT9Z 3S1RJ 1FNNA 3T8TA 4K2EA 4II3A 4M3EA 4A3JJ 2RNJA 5FFXA 3G1OA 1LE8B 1TP4A 2HGCA 1RR8C 4I02A 3C2GA 2DBBA 4CZCA 3JAMZ 5DYMA 3GVAA 3SDBA 4ESBA 4LJZF 2ZMEC 3DWLE 4UUSA 3IH2A 2LD5A 3TKYA 3SDGA 3VPRA 5F1JA 4PDKA 1FOYA 1FY7A 3DP7A 3UNGC 2DOFA 1OYYA 1FP1D 5H20A 2CMPA 1WJBA 2VLAA 3BR0A 2OUMA 1OCCH 4ZC3A 2UWMA 4RAGA 1FT9A 2HOEA 3WE3A 5FLXK 3B6CA 4ENKA 2MW8A 9ANTA 5DUIA 3HTSB 4OIOF 2HTJA 3BPVA 1YOVB 1IUFA 1O4XA 1ZR4A 1UZCA 2DMPA 4E7ZA 4LFUA 1R1VA 4M9ZA 4HEA2 4BY1J 3CC7I 1E2XA 3CQZJ 2IPQX 4FX4A 3HYIA 3QU3A 1PUFA 2LBFA 3NWTA 5E1WA 1MBJA 1JGGA 1Y1WJ 1HSTA 2ZNYA 2Y75A 4NQWA 4XN3A 3VDXA 2DXIA 4M6VA 1R9TJ 2G0EA 3E0JB 1BI3A 1R36A 3J81Z 1VQ5I 2DDBA 2VOOA 3OL4A 1X1DA 2DA2A 2NVYJ 3WTZA 1T38A 4KDPA 4IL6C 1UB9A 1RIOH 3SHFA 2E35A 3MZHA 4A3EJ 3K1NA 2FBKA 3OYEA 3DPUA 3JTGA 1BIBA 1I3QJ 2P6TA 1OISA 5IYCJ 3MKZA 1Y8QB 4B47A 1QGPA 3ERMA 2VODA 4N9HA 3Q3SA 5F0CA 4EQQA 2FNAA 2ME6A 2E1MC 3HRSA 3OIPA 1ETQA 2X1CA 1REPC 4CGZA 4XMYA 1DPUA 4GO1A 1B1BA 1ZGWA 3FM5A 3MKYB 2O7OA 4UB6C 1IRXA 4BXFA 1CGPA 3BG3A 1BW5A 5EF6A 2FNPA 2BVLA 4MFDA 4N4OB 1XTAA 2FU4A 2Q8KA 2XC7A 3JRAA 1F5TA 2E2HJ 3DU6A 5KK1A 3R60A 4A0XA 2HS5A 2OA4A 3DTKA 1N77A 2E71A 1I6HJ 1XGMA 3VWBA 2ESNA 1FLIA 3CCLI 1IRZA 3BZ6A 3MEXA 3OR2C 4OIRF 3B02A 3HBLA 5FLXZ 2V4JC 4HSTA 3HEFA 5EYRA 1KU7A 2V1UA 3IV5A 3R6SA 1RNLA 1MBKA 3TP3A 4BS9A 3Q9VA 1H89C 3FX3A 2Z33A 3NEUA 4AVPA 4IOCF 4XLHA 2V1XA 4G94A 3H5NA 2E60A 2ADUA 2IP2A 4RB2C 3TBIA 2ZXJA 4GXOA 2PX9A 2ESHA 4FASD 1RETA 2FQ4A 2V9PA 3WE2A 1RUNA 1R23A 1XB4A 1GV5A 2EZIA 3H92A 2L3DA 2AO9A 4PGHA 5A2QK 2JA6J 4KT6A 4EATA 2L02A 1XCBA 1W7PD 3KFWX 3U1KA 2QQ8A 3CMEI 4I99C 3RJPA 2CQ7A 2K7LA 4PJLA 4U7BA 1YTYA 2RN7A 4B44A 4XQFA 2DMQA 1ZG5A 2KT0A 3NQOA 2HOSA 2P5KA 3GX4X 1WQ2A 5FLMJ 2MC3A 2WADA 4MIMA 4I2OA 3ZQFA 3WTWC 3ZQGA 4P9FA 3M3YJ 1VFCA 4BNCA 2KIQA 1D1CA 2NS0A 4PK4A 3OSFA 5DD8A 3GCMA 1WWXA 4A3FJ 4UHTA 1SC7A 4Y15A 3F8MA 3A0HC 2O5RA 4OIPF 3HSFA 5CPRB 3FM3A 3S3NA 1OQYA 4B8XA 1XMXA 1GXPA 4BXUA 4XLNF 5E8IA 1JXSA 3QOEA 2VXZA 2XAHA 3DTEA 2DDAA 2UZKA 1USSA 2QEXI 3D0SA 1WCMJ 2QGUA 2GIVA 4X6AJ 1FOXA 1FJLA 1IN8A 3HIFA 2WB1N 1J59A 4QIWN 3LMMA 4U88A 2K9QA 5M5YJ 3JRCA 4HQEA 3FMQA 5BPIA 2ZNZA 3F6OA 3FXLA 2LREA 1EJ9A 1X1AA 3A03A 4ZDPA 2X0LA 4D1QA 3N05A 1YE9A 2R7RA 5IP9J 4DBRA 1R5ID 1E3OC 2M8EA 1I50J 4ZTJA 4WXHA 3BR6A 3FKIJ 3M07A 1B72B 2E1CA 2X6YA 1W7PB 4R8HA 5A2QZ 2N8GA 1ENHA 5DTDA 2R7ZJ 3O8HA 3SZTA 1X4OA 2YU3A 3CMYA 2DTRA 5IOZA 4GFBA 1G3YA 3QQAA 3IHUA 1J75A 2DI3A 3F22A 1UAAA 3FBNB 1U9OA 4LLGF 2HQAA 2WTEA 4FX0A 4A93J 3A2KA 3E6DA 1FYKA 2VOPA 4HW0A 4KNYA 5IYBJ 2GA1A 2QYOA 1SANA 2RGVA 2JSPA 1T6SA 4XKCA 4F7ZA 3ZXSA 4AVZA 2F48A 3T0YA 4E7JA 1MJ9A 2VASA 2ZCWA 1AOYA 2H1LA 1UHMA 3K4CA 2GOMA 3KP2A 2IS4A 1F1ZA 1X19A 1Z7LA 2KDZA 4RM3A 2LSOA 5HNFA 2IRFG 2DMNA 1KU9A 1USTA 4L9NA 3ULQB 4XLFA 2E5ZA 3P7NA 1ZGJA 4J01A 2ZXHA 3QPLA 1SD6A 4F3QA 3H5AA 2QWWA 3V7CA 3L2WA 4AWXB 2X6OA 5AONA 2K85A 2K9SA 3D5LA 1PP8F 4OMYA 1RESA 2RQQA 3PNVA 4O6JA 2DA1A 5BOXA 1TWGJ 2A6EF 3CESA 1BI0A 1MBFA 2DT6A 3G2BA 1TZLA 2P4WA 5L3GA 2HPIA 5TJJA 2QSGX 3D5SC 3F23A 3FXUA 4DZJA 1U8RA 3IH3A 2IT0A 4BAYA 5HS8A 5J1YA 3F6VA 4RB3C 4Q5SF 1IN5A 3MKLA 3FHNA 2UXXA 5M3MJ 3JSOA 1JHFA 4WF2A 4E7IA 2BVMA 3CUQB 3S15J 4MO7A 2MABA 2BV6A 3CMMA 4EGZA 3PUFA 3CZ6A 5C4JJ 1OCTC 2XF7A 3K70D 1MMDA 1B72A 2OD5A 2RAEA 1W7PA 1BR2A 3R61A 3H35A 4ZDLA 4S0HB 3EPZA 3GW2A 1YS7A 3O2PE 4M3FA 3RKYA 3QODA 4OOIA 3ERED 1T08B 3C1DA 3PNTA 4PUSA 2YUSA 4XR6A 3G6EI 5GP9A 2HQNA 4L9TA 4YIIA 2L54A 2HVSA 3E6MA 4DJAA 2HTSA 1QVUA 3P9IA 5J8CA 4C2TA 4X1EA 4IHTA 5J3LA 4LB6B 3QWLA 2GM4A 4HBLA 2R7SA 3KEQA 4LB5A 3KE2A 1V4RA 4XORA 4HX7A 5B1AH 4ZDOA 2PQ8A 1MW7A 5TGTA 1P4AA 2BY3A 3LA2A 2LOOA 1MMGA 3X2QH 1ZR2A 2DPUA 1I3AA 4KICA 4HQMA 1IN6A 3HOYJ 1MMAA 2UV1A 4Y17A 5KNLA 3JRFA 3MCZA 2OAZA 1FBSA 5EEHA 3I5UA 2DQLA 4QPOA 5FRMA 2TDXA 1ZHFA 2L01A 3DEWA 2KLOA 5FD6A 3QYEA 3G71I 1B8IB 3HHHA 2Y0MA 1P4XA 2OPTA 3HB9A 1LFBA 3F3XA 4LG0B 5EZHA 2OBPA 3LSTA 4KUMA 1HW5A 1VQLI 2BHZA 2OU2A 1R1TA 5K5RA 1J5YA 3E5XA 3FHZA 4EJWA 1VQ4I 3O3KA 1FSHA 4YEJA 1IC8A 4EJTA 3GWZA 3I9V2 3FIWA 3IAS2 5FB2A 1R71A 5E20A 5F0FA 4FETA 3SQNA 1RI7A 2O3FA 1ETKA 1IO2A 2KPMA 5L3BA 3HOZJ 4DNCA 4F55A 1G8XA 3GFMA 1NHAA 1ZQ3P 4ON0A 1K4SA 3HOUJ 1W0TA 3QYFA 3L09A 3EDPA 4FE7A 4EM0B 3QPTA 1QA6A 1I39A 3CUQA 3HM5A 3S1MJ 1SFUA 3N4MA 2A5WA 3N97A 3DLAA 4M6XA 4XRMA 1FBQA 2C6YA 5IPAA 2V6EA 1K78B 3CDIA 1D1BA 6PAXA 3FMSA 4RGSA 5F0HA 4V2FA 3ECOA 1S8NA 5E79C 2JQ7A 2DAOA 4A6EA 5HLHA 4A6DA 2XGDA 4P9UA 1QO0D 1K7AA 3T5XA 1WVRA 2L4AA 3WHBA 1IN4A 1C0WA 3K0LA 2HDDA 2DLLA 2EIJH 2HI3A 2VN2A 5HS7A 3OYGA 2YX4A 2V9VA 3KETA 2E5NA 4QPQA 1PJRA 2EZKA 2MC4A 2DA5A 3GLXA 3S8PA 4C3HJ 3KLNA 3I56I 4A3LJ 1X58A 2OJED 3FK7A 3V8LA 5JFRA 2DYRH 2EZHA 1T0FA 4OU0A 4ZYGA 2KMUA 1I5ZA 1XN7A 2HFHA 1MNMC 2PMZN 3I3LA 2COBA 1OPCA 2F5CA 3DV8A 3ZPLA 5GAGJ 3PO2J 2OCEA 1UJ8A 4JQFA 1ETVA 2OQRA 3KEYA 2CQKA 1VTNC 1QBJA 3HRTA 2W24A 1O3QA 2DU9A 2XF6A 4M71A 5DM6F 5DCMB 1B8IA 3K9TA 4IHYA 4ASNA 3CC2I 1AKHB 4LG0A 2FUG2 4HLXA 5DEQA 2B7EA 2Y31A 4CYCB 4OINF 4UY8I 4MEYF 2OQGA 3LSMA 2R5ZB 2NS7A 1HC8A 3ECHA 4KISA 1RPWA 3KZIC 5HLTA 1HBXG 1KA8A 2UUZA 1E17A 2A3SA 3RPUA 1GDTA 3EUKL 4XNFA 3WU0A 2WB1A 5CVJA 3HRMA 5CJ9A 4E6KG 5M5XJ 2W82A 3L2CA 4DYRA 2IW5A 5LGUA 3L00A 4DZPA 5E3LA 2XDVA 4IVNA 1RR7A 4M3GA 2GWRA 3GBGA 2QLZA 2F6CA 4JP0A 4B3AA 1ZELA 5AIQA 2AHQA 2OCCH 4AUXA 1K78A 2DFHA 1U5TC 2LG4A 1FMWA 2IXSA 2BZTA 3U1DA 3HSEA 4CCKA 3TGNA 3SFZA 5FKNA 3T8RA 5ERIA 3WGGA 3M1EA 3NAUA 2VPLA 4E70A 1S5LC 3WTTC 1K83J 2KKOA 3U2RA 2CQXA 1TQMA 2XKPA 3DEUA 1IXSB 1B9NA 3HJEA 3V8JA 1APLC 3Q0WA 3CD6I 2VKVA 1I1GA 2QM3A 2CUJA 2IA1A 3JREA 3FBIB 2LK2A 5LHGA 1STZA 3NARA 3VYSB 1I1SA 1WFXA 3GTQJ 4IHVA 1B59A 1WSUA 2DOEA 2Y2ZA 3IKVA 2F2EA 3FXOA 2ACJA 2QBYB 1QPMA 3KYDB 5DV5A 1WJ5A 1PYVA 3LWFA 4P96A 2EQRA 3GYHX 4ZH4F 3H5RA 2K5CA 2M45A 1T56A 4UVBA 1XS9A 2HKOA 2QF7A 5JLXA 1LEBA 2XASA 3I53A 3HOTA 1ZLKA 1T2KA 2Y9YA 1HW2A 2LVSA 4FHTA 3I4NJ 3JRBA 2HDWA 1E3HA 3ZMZA 2JVGA 4PGGA 4HA8A 3PNYA 1QZZA 4RBOA 1MBEA 3IH4A 2CW7A 3HZJA 4NC6A 2F5DA 4OAZA 3BTCA 1TWFJ 2CSOA 4XLEA 1L0OC 5DCMA 3I4PA 3SZGA 4V19K 2EJRA 2VBZA 1AKHA 4CYCA 2R5ZA 4V2GA 2Q0OA 4M72A 3EETA 5LEJA 1ZTRA 4I01A 2BY1A 1Q1VA 1D3YA 4KMFA 3MWMA 2IA0A 2X1EA 1ON2A 3BJAA 2ZC2A 1R6RA 3SYTA 3VOEA 3TDUC 2GAUA 4IX7A 1O3SA 2HQRA 3LL7A 3AAFA 2DODA 4CDGA 4IZZA 3FK6A 3U21A 1XDUA 2O8KA 1J09A 2ZXIA 3GTLJ 3HL2A 2VJ5A 4A2UA 2IGMA 3RIRA 1DDNA 2STWA 1MJBA 3H9QA 4HSRA 2ZJRF 3DEEA 3E7LA 1VQPI 5K5OA 1D5VA 4AIKA 3DBLB 1P7IA 2MG4A 5J6XA 1WKMA 4U87A 2ELKA 4ETSA 3HXLA 4D5CA 4Y52J 4KJZA 3W2VA 3K4BA 3ABUA 3C7JA 1EH6A 3PFYA 1MH4A 3CCEI 4B09A 5K7FA 2XB5A 4I6ZA 1D0YA 1HSJA 4BE0A 1Y6IA 3VSLA 1TW2A 5E1XA 4BY7J 1MNEA 3LAPA 3KP4A 1KZHA 2O61A 4CYDA 4EMSA 2BEOA 1UHWA 2QBYA 4RA2A 1SFEA 4A3KJ 1G3SA 1LUJB 2GOXB 3J7YJ 1ULYA 1IZ1A 4CZZA 3ZQCA 2BYVE 2JT1A 2FF4A 2X51A 3ML6A 2Z16A 4KYWA 1TWHJ 1IDZA 2P6SA 3F9KA 1OCOH 3I58A 2KHMA 3H9JA 5L3DA 1W36D 4B48A 3S3OA 4G12A 1WH5A 3ZMDA 1TWCJ 3CLOA 3LFUA 3JRHA 2XSDC 2V7FA 2QVOA 3OMYA 1V5FA 3CC4I 5LHHA 2E2IJ 2L2OA 4BJ5C 4ENMA 1YW9A 4PJ0C 1XGOA 1BJZA 3G4SI 1F43A 4BH9A 5GPCA 3DU5A 4F93B 3HOVJ 3LA7A 2JA7J 5HDGA 2DPDA 1YYVA 1UG0A 3CCUI 2M30A 4RGXA 3LSGA 4JX5A 1J9IA 1Y1VJ 2BXYA 4AIHA 2ID6A 5B3SH 1BW6A 5GTHC 2LTPA 3S32A 1OMIA 4I7HA 1IDYA 2FBHA 3MVPA 5E17F 1ZRDA 1LPQA 2KDOA 4I76A 1LE8A 5ICGA 3COAC 2O03A 4MTEA 1RKWA 3CJQB 1BOBA 3RZDJ 3BPXA 3FMRA 4E4HA 2NNYA 4B3XA 1IGNA 5KHDA 1FPQA 4BJ6C 3B6AA 3WTXC 2HVQA 3AL0B 1H9GA 3FWEA 3GXOA 3ZMVA 1QQIA 2LC2A 4HF0A 1SD5A 4LITA 3QU6A 1G4DA 4IF4A 2XGEA 4A12A 5K1YA 5D4RA 3IL2A 1KYZA 1S9HA 2NVUB 2XGXA 1RRJA 3LSPA 5IP7J 3BP8A 2P7VB 2V26A 2QKLB 3PQJA 2M87A 2E34A 2EFOA 1QU3A 3CMAI 4C3IJ 3J7ZI 1M1EB 2ELHA 2MH2A 3HRUA 3ONQA 2PMZA 1XG1A 1OJLA 2FE3A 1ZAOA 4LIVA 2CYYA 4HNUA 1Z6TA 4BGDA 2VQLA 2MA3A 2XKOA 4E7KA 5F64A 1WJCA 4KN7X 2JA5J 2M34A 3CTAA 3TP0A 3HPHA 1BM9A 1Z67A 4RLFA 2LY9A 3A02A 1WRJA 4AYBN 3PL8A 3S3MA 3MZYA 2RKHA 3GUDA 3HG9A 3REOA 5ILUA 2BGCA 4A0ZA 4A0YA 4IQJA 1Y0NA 3BY6A 1XGNA 5LFAA 5LGTA 4UXNA 3F8FA 1J2XA 1XSXA 1SMYF 2E2JJ 4ZYHA 2NOGA 2R5YB 3TDZC 2ZFUA 1Z05A 2M4KA 1OYWA 2ZBKA 3LSJA 4MFEA 2R3SA 1A04A 1Z91A 2VC1A 5GTIC 1G59A 1XCVA 5J40A 1BOAA 2Y0SN 2PN6A 2ZSHB 3RCOA 2DJNA 5FRNA 1LEAA 2HOAA 3M7GA 2EV6A 2VONA 3ZMSA 1WH7A 4LLLA 1U9NA 2M7BA 4RMNA 1R4MB 2P5LC 2E7XA 3C2HA 3B73A 4OWRB 1KQ9A 2ISZA 1MNDA 3MD2A 1G3WA 4KMUX 1HF0A 3S2DJ 1O3RA 3HGGA 5F1RA 2IVMA 2XV4S 3BR2A 3I59B 4CCLA 4M6YA 1R7JA 1PDNC 1AU7A 1FYMA 2DFEA 4CHUA 1X2NA 2M3AA 2XROA 2DCEA 3C18A 4XSXF 5FD5A 4MQVA 2VC0A 2Z1DA 1EH7A 4OIQF 3C2BA 2ZB9A 1WHUA 1MZBA 3S93A 5LHIA 3WU1B 2Q2EB 2PJRB 3H3UA 4RGUA 3PIPF 5HDKA 2JRMA 3TO6A 4EV0A 1LB2A 1MD0A 1YFHA 1NK3P 3FDYA 1FIPA 2J5OA 4ITVA 3LQRA 2DQRA 2KIMA 3AG1H 3EUHA 5FJ8J 4IRIA 1KQ8A 4XKVA 4BQNA 3V7SA 4D5FA 1QHGA 1K6YA 2VPRA 3PM1A 2NVXJ 2WV1A 3OR1C 2WA0A 1U0JA 3V42A 3MN2A 1ZG3A 3K1PA 2AXLA 3E6CC 1W5CC 2DK5A 1JHHA 3DFGA 1U2WA 2M0CA 2OTLI 1HKTA 1XX5A 2IBDA 4BQQA 1UCRA 2VQGA 2R5YA 1B6AA 3GTPJ 3OS1A 2DK8A 1Y8RB 2VXDA 4Q47A 2IGNA 3QYBA 3CCRI 3OOUA 1FTTA 4MGRA 2WBMA 5CKTA 5HVQC 2NXNB 5K5QA 2IA2A 1W0UA 3H9GA 2M4GA 1JE8A 2DFFA 2HYFA 4E7HA 3F0CA 3DKXA 1K79A 2TCTA 2H27A 1VQNI 1OYIA 3KCCA 1JJ8C 1A35A 3JW4A 2HU9A 3FXMA 3RPQA 1WJAA 2FOWA 3PO3J 2M1BA 5HDNA 3RKQA 2L4MA 2A05A 3AG3H 3IAM2 4YELA 4ESJA 2D2WA 4I0BA 3I4MJ 1GHCA 5DCFA 3A1YA 1CF7B 4PJJA 1YJ9I 5EJCA 4KIBA 3DQVC 3OYMA 3G73A 2FA5A 1UMQA 1N78A 4HAMA 1HDPA 5EGOB 3I59A 2VT2A 3OYKA 3QRFF 1B9MA 2VE8A 5IOYA 1R1UA 2LKSA 1BR1A 1XD7A 2BY2A 3HHGA 2B63J 2ZMEB 1T8IA 2L7FP 2PJRA 2Q2EA 2YPRA 4X0GA 3L2VA 1XC5A 4EJOA 4YG2F 4E7LA 3WTYC 2K86A 2YX7A 3R4KA 4QSHA 1MGTA 1N25A 3MFKA 2A61A 3D5RC 3KP7A 2XRLA 5E18F 2I8DA 5CYVA 2CQNA 4LIUA 1G3TA 3QPSA 2QQBA 3W3CA 4IO9F 4PFOA 4IKFA 2H1KA 2VBXA 1W5TA 5E1ZB 1ERDA 3F8BA 1Y39A 5IT3A 3ROUA 1BI1A 4L5EA 3T1BA 2PLYA 2RREA 1V5EA 4IHXA 5H2FC 3SEQA 4CICA 1ONVA 3RKWA 1WJEA 3C3WA 3OV8A 4D9JA 2GQQA 1VNDA 1GUUA 2CJJA 1F4KA 4UVCA 2QENA 2V6CA 1BN5A 2EILH 3KP5A 4IHSA 2EV5A 4L9VA 4KIGA 4XN0A 1DPRA 4CA0A 2DMTA 3MKWB 2E1OA 1U78A 3S1NJ 3ZGKA 4FTHA 1IAWA 4Z6YA 1KU2A 4H4KC 1HQCA 3ZQQA 2A5YB 5BNGA 5KAFC 1K6OA 5JVGF 2BY0A 2DN0A 1FOKA 4XLAA 2VKEA 3RKXA 4M74A 3OS0A 3A01B 1QNTA 5EG0B 3OYHA 4XL9A 3W2WA 1EV7A 2F5FA 1ZRCA 1RC9A 3TO7A 2XRNA 3Q0UA 5D6EA 1YW7A 1WZ2A 2KISA 3E6BA 3BLYA 1YRNB 2VJIA 1P9QC 1V54H 2E1MB 2JA8J 1O7FA 2XPWA 1DGRM 4D7MA 1CF7A 1WI3A 1YW8A 4GCVA 1IV8A 1YJNI 4AIDA 3I0TA 3P9CA 3EYYA 2LNBA 3GMEA 5EGOA 3D1NI 4JBAA 4MEXF 1YX3A 2JRTA 1IN7A 2FEZA 5D8KB 1A5JA 5CVVA 3W6VA 1W4MA 3BCBA 3GF2A 5GAEJ 2Q1ZB 1V3FA 2BHYA 2LH9A 2W85A 3S1QJ 2CO5A 3I55I 1V55H 4U0WA 5D5XB 4JK1X 5H6QA 1ZARA 1NG6A 3F72A 1S7AA 3K4JA 4BBRJ 3CO6C 2CU7A 3RZOJ 5F08A 4PFPA 1H9TA 2MGQA 3WODF 1TC3C 4B43A 4ENNA 2EINH 3S2WA 3OYLA 4HF1A 4XKBA 4GDFA 3WTUC 1X3WB 5D6FA 2BW3B 2E19A 2FQ3A 1FMVA 2OZ6A 3VYTB 1UELB 2IS1A 2CUZA 2ME0A 3W6KB 5CVUA 4HYEA 3BQZA 1MIJA 3OYJA 3GTMJ 2R7DA 3GO5A 1AHDP 4D7NA 2ID3A 5ICFA 4UUTA 1HDDC 5FLVA 1TL8A 2F4MB 3PFIA 4GYIA 2HXOA 4AYBA 2LKXA 2HPMA 2MD0A 1U6GA 4HX4A 2LY1A 5D4SA 3HKZN 2JJ7A 3BCAA 5CLSA 5JLWA 1EF4A 3CCQI 2D45A 1ETOA 2I5UA 4EM2A 2HVRA 2CG4A 3DPTA 1ZLJA 1ETWA 4L0YB 4AU7A 2EA2A 2QQAA 1FOWA 2ECBA 3OOPA 2HYJA 3A01A 5EG0A 2FOKA 2IGOA 3BTLA 2I10A 4BL0B 1FEXA 4DYQA 1YS6A 2Y0SA 3H0DA 2H6BA 4HPQA 3FZVA 3BZCA 2R7QA 2MH9A 1JUMA 3CCSI 2R92J 1YI2I 1YRNA 2XAQA 4JYKA 3WGHA 3KIOA 2RNGA 4IRHA 2NOJB 4Y3OA 3KYCB 2DO7A 2JVHA 3ABLH 4W1UA 3U9GA 1JKPC 5HLIA 3J7AO 1VZ0A 3NRVA 4GGGA 4A3IJ 2VJJA 3DLLF 3ZMUA 5L3FA 3HDDA 1Z1DA 2NVQJ 2GXGA 2LR8A 2NRAC 4M9XA 3KPHA 1MMSA 2LFBA 1H88C 1IRFA 2FMYA 2CV0A 2K3PA 3GZ6A 2RQPA 3BTIA 2M5WA 2JA2A 5D5VB 2ZJQF 2VBWA 1LFUP 3J80Z 2M2EA 2YS9A 1A6QA 1J7KA 3IKTA 3PUBA 2IS2A 2WY8Q 3AFHA 2HNHA 1SVMA 5KVRA 3CCMI 5B1BH 2BW3A 3M9AA 2Y9ZA 3SEZA 3PSIA 4Y13A 2VIXA 1MH3A 4RB0A 4A3CJ 2NAZA 3S2HJ 4HRIA 4S05A 5ED4A 4RDUA 5FGMA 3RYPA 4A5NA 1P92A 2X1DA 3LSIA 3KP6A 3RSNA 1FWZA 3K4NA 2EB7A 4M3DA 2Z9OA 2PMUA 2KRCA 3L9FA 4QWQA 3J7AY 4RAZA 3G1LA 3OWTA 3OYNA 1Q1HA 1Z77A 5LRRA 2COMA 1XSDA 1JTXA 2JUGA 4Y4RA 2EFQA 3GTOJ 2R7XA 2CUFA 1VQMI 1CQTA 3L2QA 3HPGA 2VBYA 2DA3A 3OYBA 3K4LA 2ECCA 4ZZDA 5BQTA 2YU9J 4BU2A 4KFCA 2P81A 4MLOA 1A31A 4FE4A 1JI8A 2GA2A 2XAGA 3HOSA 1D8JA 2NNNA 1S6LA 2PEXA 3ZQIA 1LKXA 1WPKA 4MQ9F 2KP6A 2GIZA 1DGWY 2JN6A 3VFZA 5LGNA 5DD4A 4XRSG 4S04A 4RAFA 2ETHA 2KZVA 3KX2A 2VKHA 2K4JA 3H36A 2ZJ2A 4XICA 1IXCA 1BC8C 2X4HA 5IYDJ 1DQUA 1F36A 1DP7P 3L7WA 5EEAA 2A07F 1KU3A 4ZYAA 1JKRC 1ACIA 1I6XA 4XIDA 4ENJA 4JOMA 2DFIA 2DYSH 1BBYA 2P5VA 3F8NA 4RM2A 1XSVA 3SXYA 5L3CA 1GV2A 3O8GA 3RI4A 1S72I 2LYCA 4CXFA 3GFJA 3HOXJ 2XF5A 3ZP5A 1TWAJ 4CUGA 1JJ6C 1J0RA 4IXAA 4HNVA 4RS8A 3V8KA 1W5SA 3K4KA 3M4OJ 4YFNF 5LRSA 4DYCA 1WGXA 4CCJA 5D8LB 2ISYA 2W1OA 3K1MA 2E1NA 3QP5A 3ZR8X 3WU2C 2VI6A 5K7HA 1FSEA 2VL8A 3IC7A 3RQ4A 4EEFG 1DP3A 3VB2A 2K40A 4WX9A 3BR3A 4XLCA 3DF8A 3HOWJ 1TQIA 4Y7NJ 2R7WA 4UV8A 2VUMJ 2VT3A 4XRFA 5GPAA 1XMKA 4G7HF 5TRDA 4U0VA 3ABKH 2XAFA 2PBIA 5JHFA 1FX7A 1T39A 2CWEA 4WXCA 3CUQC 3VSKA 2W57A 5JVTA 3CLQA 2A68F 2JUCA 1YITI 5JI6A 2HOTA 2HZDA 2ELJA 3CF2A 5GAHJ 1X1CA 2Z99A 2CUEA 3E1SA 1V5GA 2AS5F 4RB1A 2K02A 1TBXA 2O0YA 3F21A 3JSPA 2EBIA 4LMYA 1YO5C 4BXXJ 2KJCA 1HKSA 2VQCA 3DXJF 4LK1F 2O8XA 5DM7F 4C2MJ 2LF7A 2V1NA 1MMNA 2BXZA 3DPLC 4PSWA 2R7UA 2KL4A 2LDUA 1YG2A 5FKKA 2MBFA 1LJ9A 1X3ZB 1P2FA 1UFMA 2LLKA 3OY9A 3H3VK 2XGCA 1POGA 2ZSIB 4BDZA 2Z2SB 4BYYA 3FXQA 4Y33A 2QKMB 1X4PA 2HWVA 3LAJA 2WAQN 2XUBA 1MSFC 4FQGA 1T0FC 5HS9A 5HNHA 3P5JA 3VYRB 3K6GA 3UR3C 2H09A 4NC8A 3JCUC 5BMZA 4HG2A 3EQLF 3BWGA 1BL0A 3TL4X 3L1PA 1WI9A 2FX0A 4FCYA 1ORKA 1EH8A 1HLVA 2RV8A 3QP6A 4XKWA 5FKOA 1NG7A 3FKJA 1Z0XA 2MSYA 4WCGA 2XPUA 4NDLA 2ZFWA 1D0ZA 1LFPA 2QSHX 1B4AA 2M8GX 1R49A 2L5QA 4NC7A 2XVCA 3FISA 5F04A 3I64A 2BE5F 1QVTA 1DUXC 1T98A 4HV6A 1ON1A 2K4BA 1KONA 2XPVA 1E3PA 1RKTA
chains in the Genus database with same CATH topology
3OOUA 3IP4B 4NUBA 2WBMA 5CKTA 5HVQC 2A5WA 3DLAA 4NQWB 3L2RA 3PJRA 3H9GA 2M4GA 2V6EA 1D1BA 4XONA 3HKZA 2XAUA 2CV2A 4E7HA 2MYSA 3DKXA 4XOTA 3K70C 5HOOA 2L9NA 2HU9A 3EUAA 1WJAA 3LSKA 4J00A 4DOZA 3IAM2 2L9SA 4YELA 1Z3XA 4XM3A 3OYGA 3A1YA 4PJJA 2E5NA 1Y56A 3DQVC 4QPQA 3OYMA 1PJRA 2MC4A 3BC8A 3S8PA 1N78A 4CCMA 4G6TB 2R7OA 3OYKA 4BDYA 4LG3A 1X1BA 1BR1A 1LDKB 2KMUA 4II3A 2K9MA 3I3LA 3C2GA 2PJRA 2LRDA 4X0GA 3L2VA 4JQFA 4E7LA 4CZCA 3SDBA 3KEYA 3DWLE 3A4CA 3D5RC 2XF6A 2VQHA 2I8DA 4LIUA 3UNGC 4XOPA 3W3CA 2CMPA 1WJBA 4PFOA 2DJIA 4IKFA 2VLAA 2OUMA 4HNTA 1ERDA 4ZC3A 2FUG2 2UWMA 3LSMA 2RREA 1V5EA 3SEQA 4KISA 3PSFA 1WJEA 5HLTA 4PJMA 3DTIA 2KRHA 2UUZA 4BQOA 4D9JA 4E7ZA 2DT7B 3EUKL 4XNFA 4DIQA 3OYAA 4HEA2 2WB1A 4RLQA 1D0XA 4E6KG 2W82A 3MKWB 4XN0A 4CA0A 2LBFA 3NWTA 3ZGKA 4ANJA 2VJ4A 2XDVA 3OYDA 4H4KC 3ZQQA 4BE1A 3GBGA 2F6CA 1ZELA 4XN3A 3VDXA 2DXIA 4XLAA 3E0JB 2LG4A 1SFKA 1FMWA 3OS0A 2IXSA 3OL4A 1X1DA 4XL9A 3OYHA 3W2WA 4CCKA 2VPLA 4CSWA 3BLYA 3CJRB 2VJIA 1P9QC 2E1MB 3OYEA 3DPUA 3AKZA 1DGRM 3MKZA 4B47A 3MMYB 2CUJA 2M0MA 3FBIB 3VYSB 4GRIA 2E1MC 1WFXA 1YX3A 3OIPA 2X1CA 4XMYA 3CP2A 3BCBA 1WJ5A 2Q1ZB 1PYVA 2LH9A 3MKYB 3H5RA 2K5CA 1TT0A 4F52A 1IRXA 4BXFA 3ZCOA 1NG6A 3K4JA 3HOTA 2BVLA 2HDWA 4N4OB 1AA7A 2JVGA 4PFPA 2XC7A 3PNYA 3DU6A 3W2AA 1N77A 3DTKA 4B43A 2OC6A 2CW7A 4OAZA 3OYLA 3VWBA 4E7SA 4XKBA 4XLEA 3SZGA 3RTRA 4F92B 2BW3B 1FMVA 5KCMA 3VYTB 1UELB 2IS1A 2CUZA 3OR2C 2X85A 2V4JC 4HSTA 2CFOA 3IUOA 3OYJA 3HUGB 4BS9A 2CW8A 4NNJA 2DOAA 2X1EA 2XSJC 1R6RA 3SYTA 4AYBA 4XLHA 3H5NA 2E60A 2MD0A 2HPMA 4IX7A 2W00A 2LY1A 3TBIA 3LL7A 3BCAA 4IZZA 3U21A 4FASD 1J09A 2ZXIA 3HL2A 2VJ5A 2HVRA 2IGMA 3DPTA 4N4NB 3H9QA 4HSRA 3DEEA 4AU7A 4C9YA 4KT6A 4EATA 2IGOA 4BL0B 4CCOA 3H0DA 2Y0SA 4U87A 4HPQA 4PJLA 2AQEA 2R7QA 3HXLA 4U7BA 3OL3A 1E0EA 4KJZA 3W2VA 3K4BA 4B44A 4XQFA 3PFYA 2RNGA 2NOJB 4Y3OA 3TMOA 2JVHA 3BG6A 1D0YA 3RPUD 4BE0A 4C30A 2W7NA 2WADA 1Y6IA 3VSLA 2A6TA 1MNEA 1VZ0A 2VJJA 5FROA 4PJNA 1D1CA 4PK4A 4R79A 2V9KA 2GOXB 2CV0A 2O5RA 1EA3A 2X51A 5CPRB 2Z16A 2WAFA 2K3PA 4CH7A 3S3NA 3F9KA 2JA2A 2IGKA 2KHMA 3H9JA 1W36D 3QOEA 4B48A 3S3OA 2VXZA 3DTEA 2WAQA 3PUBA 2K9LA 2IS2A 3LFUA 2WY8Q 2V7FA 2HNHA 3AFHA 2AQFA 1V5FA 3OMYA 3ZRGA 2L2OA 4BJ5C 2BW3A 3SEZA 3PSIA 2F5VA 2VIXA 3OYFA 3DU5A 4F93B 3L2UA 4HRIA 2WY7Q 1Z3YA 3LMMA 3KYLA 1OR7C 2P0WA 2KQRA 2VKDA 2X1DA 1UG0A 3LSIA 3RSNA 2IS6A 4DBQA 3K4NA 3LSGA 2LREA 4C2UA 1X1AA 4ZDPA 4D1QA 2KRCA 3J7AY 3N05A 1YE9A 4YRVA 2R7RA 3OWTA 2X6XA 3OYNA 4DBRA 1WJDA 3S32A 2JUGA 4Y4RA 4ZTJA 2R7XA 3L2QA 2KDOA 3HPGA 2X6YA 3OYBA 2X6WA 3K4LA 3CJQB 1LVKA 1BOBA 4CCNA 1X4OA 4BU2A 4E4HA 4MLOA 4B3XA 2M7AA 5KHDA 4BJ6C 2HVQA 3AL0B 1JI8A 1UAAA 3FBNB 3HOSA 2HQAA 2LC2A 3A2KA 4LITA 1LKXA 2KP6A 3AL0C 1DGWY 1HA8A 1Z21A 2KZVA 3KX2A 1S9HA 2MFZA 2VKHA 3OYIA 2JSPA 4XKCA 2LY2A 3ZXSA 4AVZA 2V26A 4OAYA 1BR4A 1DQUA 2QKLB 4E7JA 2VASA 2IS4A 3K4CA 4ZYAA 2GOMA 1QU3A 4BACA 1X19A 1Z7LA 1T95A 4JOMA 3QYBA 4RM3A 5HNFA 4RM2A 3OS2A 2LYCA 3ONQA 4IQ4A 2R7VA 4XLFA 2PMZA 2E5ZA 2XF5A 4LIVA 4J01A 4CUGA 4HNUA 2ZXHA 3VYUB 4F3QA 4BGDA 2VQLA 4BEHB 4E7KA 1WJCA 1D1AA 3H5AA 3L2WA 1W36C 3D5LA 3K4KA 2RQQA 3PNVA 2R7TA 4CCJA 3HPHA 2F4IA 3EUHC 4RLFA 1N75A 2W1OA 3CESA 3OIQA 2DT6A 2BOLA 3G2BA 3K4MA 1TZLA 3LSHA 3PL8A 3S3MA 3ZR8X 3CP8A 2HPIA 3D5SC 3HG9A 2VL8A 4IQJA 3RQ4A 2R4GA 4KITB 1DP3A 3NWSA 5LFAA 2CV1A 4XLCA 4BJTA 2R7WA 3FHNA 2ZFUA 2M4KA 4II2A 3M8JA 4E7IA 2BVMA 1OLTA 2MABA 2W4SA 3CMMA 3CZ6A 1G59A 2XF7A 5JHFA 2CH0A 3K70D 1MMDA 2ZSHB 3RCOA 4ZTFA 3VSKA 4P1WA 1WJFA 5FRNA 1BR2A 3H35A 4ZDLA 3EPZA 2HZDA 2ELJA 3CF2A 1X1CA 3QODA 2M7BA 4PSXA 4RMNA 1GLNA 3E1SA 1V5GA 3PNTA 4PUSA 4XR6A 3C2HA 4F91B 4OWRB 5LD2C 1MNDA 4DJAA 2HVSA 3MD2A 2VQCA 4C2TA 3DKYA 2L7KA 2V1NA 3DPLC 1MMNA 3M1CA 4PSWA 4CCLA 2R7SA 2KL4A 3OYCA 4BE2A 2R7UA 4XORA 4ZDOA 1MW7A 2M3AA 5TGTA 3OY9A 2DCEA 1QHHD 4P5OA 2ZSIB 2Z1DA 4BDZA 2Z2SB 2LOOA 1MMGA 4Y33A 2QKMB 3S93A 1X4PA 5CQEA 2PJRB 2Q2EB 1MMAA 2UV1A 2VB6A 5KNLA 1T0FC 5HNHA 3VYRB 3K6GA 3UR3C 4ZJZA 4QPOA 4NC8A 5FRMA 3FDYA 4HG2A 4ITVA 2KLOA 3QYEA 4XKVA 3TL4X 4BEHA 4BQNA 4DGWB 1YX5A 1QHGA 1K6YA 3OR1C 4XKWA 1NG7A 2WA0A 3FKJA 1U0JA 3V42A 5CQGA 2IGNA 4YEJA 1D0ZA 1LFPA 3I9V2 3IAS2 3BG7A 2L5QA 3HC7A 4FETA 1SAUA 2OV7A 4NC7A 3K10A 2KPMA 4BQQA 4F55A 1G8XA 2VQGA 2CS3A 4BUPA 3QYFA 3OS1A 2VXDA 1KONA 2LBFB 2WAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQC A; 
#chains in the Genus database with same CATH topology
 3IP4 B;  1FBU A;  3CDL A;  4NUB A;  5J8F A;  3GTG J;  1P6R A;  1UHS A;  2DTZ A;  2L9V A;  4G7Z F;  5HOD A;  3PQK A;  4XON A;  3HKZ A;  3S16 J;  2XAU A;  3ZQL A;  1TW3 A;  2CFX A;  4C3J J;  3JRI A;  1JT0 A;  3ESW B;  3Q0V A;  4XOT A;  1SFX A;  3K70 C;  2F5E A;  1YHQ I;  1H0M A;  5HOO A;  3EYI A;  3LNQ A;  5J4V A;  4L5I A;  2NS8 A;  3LSK A;  1KYW A;  3CF5 F;  4DOZ A;  4XM3 A;  3K69 A;  1G6N A;  2ICW G;  5F6F A;  3JRG A;  1OR7 A;  2H94 A;  1Y56 A;  1YLF A;  3GTJ J;  3BC8 A;  1KGS A;  4BQA A;  2ZXW H;  4CCM A;  4A3D J;  2J5P A;  4G6T B;  4UUV A;  2Z3Y A;  1IF1 A;  4L5J A;  1X1B A;  3BTJ A;  1LDK B;  3H0G J;  4HV5 A;  1NK2 P;  2Z5U A;  4FT8 A;  3BT9 A;  4AD9 A;  2K9M A;  1GXQ A;  2H6C A;  4XLP F;  2CW0 F;  2HKX A;  3QAH A;  2FXA A;  4AM3 A;  2LRD A;  4U7D A;  1RZ4 A;  1F9N A;  4UB8 C;  3A4C A;  2LMD A;  5EEG A;  4IJA A;  2EWN A;  2VQH A;  4G6D A;  4GYG A;  1PP7 U;  2CGP A;  4XOP A;  4BHP A;  1LVA A;  2ZO4 A;  1XDS A;  2DJI A;  4N9I A;  2GXA A;  1TNT A;  5IY5 H;  4HNT A;  5EZG A;  5B66 C;  3Q9S A;  4M3B A;  2FBI A;  1OCP A;  4KT5 C;  3V4G A;  1R5G A;  3BDD A;  5J4Y A;  4KIF A;  1R4N B;  3PSF A;  1HW1 A;  4I98 B;  4LGW A;  4YFK F;  2WV0 A;  4LK0 F;  4PJM A;  3DTI A;  5M3F J;  2KRH A;  4BQO A;  1Y0U A;  2X9D A;  3KEO A;  2KFD A;  3SJM A;  2DT7 B;  4DIQ A;  3ZMT A;  3OYA A;  4RLQ A;  3QOP A;  1D0X A;  2IAI A;  5M5W J;  4L0Z B;  4J19 A;  1U5T B;  3KZZ A;  5J1R A;  4ZZL A;  4ANJ A;  2VJ4 A;  3OYD A;  1GT0 C;  4BE1 A;  2EIM H;  1VQ8 I;  4A3M J;  4JX6 A;  3V7R A;  1IUY A;  3E97 A;  4FIS A;  1SFK A;  2AXT C;  1JUS A;  1BC7 C;  1P4W A;  3H1C A;  5AIP A;  1OCR H;  5D5W B;  3RYR A;  1LNW A;  1OKR A;  1R00 A;  3SZP A;  2TRT A;  4CSW A;  3CJR B;  3IWZ A;  1EKE A;  4MHG A;  4AC0 A;  1X3U A;  2CQQ A;  4D0P A;  1DU0 A;  3AKZ A;  4NBQ A;  2RDP A;  2EIK H;  2RVC A;  3MMY B;  2W25 A;  5J47 A;  1QRY A;  2XHK A;  1TLH B;  3TW7 A;  2M0M A;  2XB0 X;  2JSC A;  4HX8 A;  1K61 A;  2OTJ I;  5HLG A;  4GRI A;  3IRQ A;  4L9J A;  3E5U A;  3HGY A;  3ABM H;  1OFC X;  3CP2 A;  5FFZ A;  4LLN A;  2YR2 A;  2GXB A;  4WXD A;  4XSZ F;  3I71 A;  5ILS A;  1L3L A;  1TT0 A;  4F52 A;  2MD5 A;  2DW4 A;  3KLO A;  3ZCO A;  2QUF A;  1K4T A;  1HXD A;  4DW6 A;  1AA7 A;  1FP2 A;  3W2A A;  4BHC A;  2OC6 A;  3G1M A;  4Q48 A;  4E7S A;  4G6Q A;  2HQ5 A;  3ABT A;  2RC4 A;  3RTR A;  4NB5 A;  4F92 B;  5KCM A;  1R58 A;  1W1W E;  4BBS J;  2O9L A;  2X85 A;  2CFO A;  2B0L A;  3IUO A;  1TNS A;  4KN4 X;  2Y69 H;  2HEO A;  2L7M P;  3O6B B;  3CO7 C;  2D1V A;  3HUG B;  3AG2 H;  1XGS A;  1HOM A;  4P55 A;  3ZQH A;  2CW8 A;  4NNJ A;  4UV9 A;  5FO5 A;  2B9S A;  2DOA A;  3CCV I;  2KRF A;  2XSJ C;  3GFL A;  2STT A;  3WGI A;  2NYX A;  1VQK I;  2W00 A;  5LBQ A;  3BR5 A;  3FXK A;  3BQY A;  1U5T A;  2PG4 A;  2G9W A;  2EZL A;  1OCZ H;  3BRO A;  2R93 J;  3CUO A;  4HOB A;  2JPC A;  4LD5 A;  4N4N B;  4C9Y A;  3BG5 A;  4M73 A;  4QLC U;  1KQ0 A;  1U3E M;  2L0K A;  2M9H A;  1FIA A;  5KAI C;  2W84 A;  4CCO A;  2H8R A;  1S3J A;  3TOB A;  5JHU A;  2AQE A;  2KIU A;  3OL3 A;  1E0E A;  5DDG A;  2PMH A;  3SFI A;  3GZ5 A;  1O7L A;  2FJ1 A;  1SD7 A;  1MBG A;  1MDM B;  3TMO A;  5EDN A;  3BG6 A;  3MZ8 A;  3RPU D;  4C30 A;  2W7N A;  3BR1 A;  1ODD A;  4HDU A;  4N0B A;  2A6T A;  1YIJ I;  3ASN H;  1VF9 A;  3KZY A;  2EV0 A;  1JUP A;  1ZRF A;  5FRO A;  1QZY A;  4PJN A;  2GLO A;  1RUO A;  4R79 A;  2FRH A;  4IPA A;  3QPH A;  2V9K A;  2K27 A;  3TW6 A;  5E3O A;  3CDH A;  4IHW A;  5J1U A;  4Z2Y A;  1Z7U A;  1EA3 A;  2HR3 A;  2PFB A;  2WAF A;  4CH7 A;  3GTK J;  3Q5F A;  3FXJ A;  1XPX A;  2IGK A;  2W48 A;  1ZYR F;  1IJW C;  1ETY A;  2WC2 A;  5FKL A;  1A6I A;  1D8K A;  1SVO A;  2WAQ A;  2QSF X;  2K9L A;  1JKQ C;  2E36 A;  3ZRG A;  1GVD A;  2AQF A;  4RAY A;  3CJN A;  3DBR B;  3RDI A;  2F5V A;  1YJW I;  3K7A J;  2HXI A;  3OYF A;  2FML A;  1ZKG A;  3L2U A;  1IRG A;  1QZE A;  1MKM A;  2WY7 Q;  5BS6 A;  1Z3Y A;  1TQP A;  2YSR A;  3HUG A;  4UVA A;  1OR7 C;  3KYL A;  2P0W A;  2KQR A;  1SD4 A;  5CVR A;  4ABZ A;  2VKD A;  2XAJ A;  2IS6 A;  5TIS C;  5FKM A;  4DBQ A;  3FF5 A;  1JT6 A;  1ZRE A;  4C2U A;  1JTY A;  4O5V A;  1VQ6 I;  3GZN B;  2V79 A;  4YRV A;  2IEK A;  4HLY A;  2X6X A;  5B5E C;  1PVE A;  1WJD A;  5D5U B;  2R7F A;  2HYG D;  3TOA A;  5C4X J;  4ZYD A;  1O3T A;  2Y30 A;  2ZME A;  1X2M A;  4YIF A;  2A69 F;  1ZG1 A;  4KA4 A;  2X6W A;  1I27 A;  1VQ9 I;  1LVK A;  1LDJ A;  1R22 A;  1O57 A;  2LP0 A;  3F8C A;  4CCN A;  3TED A;  5E3M A;  1HCR A;  2NVT J;  2JMW A;  1UG2 A;  3ZOB A;  3J80 K;  2F4O B;  1NH3 A;  1DU6 A;  1XMA A;  3E3V A;  2M7A A;  5K7Z A;  5ICE A;  4R1H A;  1VQ7 I;  3BOQ A;  3ASO H;  2G7U A;  4BHB A;  5F27 A;  4A5M A;  1MDM A;  4HF2 A;  2L7Z A;  3AL0 C;  1HA8 A;  1QPI A;  2DA6 A;  5ILV A;  1P7J A;  2K9N A;  3KP3 A;  1ZGA A;  1Z21 A;  2DA4 A;  2CRG A;  2MFZ A;  3OYI A;  1FZP B;  3TQN A;  1MBH A;  1ITY A;  3E5Q A;  2LY2 A;  4L18 B;  1S7E A;  4OAY A;  2MLG A;  1BR4 A;  3LQQ A;  4W97 A;  3VEP A;  1FC3 A;  1A36 A;  1TT5 B;  4MNU A;  4YIR X;  3FXR A;  4DQ2 A;  2O6G E;  2R0Q C;  4BAC A;  4H0E A;  2WWY A;  1T95 A;  1AWC A;  2PJP A;  3OS2 A;  3LOC A;  4RGR A;  3R0A A;  1PUE E;  2DMU A;  2R7V A;  4IQ4 A;  3ZN0 A;  1FTZ A;  1YIO A;  1HKQ A;  1MSE C;  3W6J B;  2JWT A;  4LOC A;  1ZH5 A;  1SEU A;  1SFO J;  4B4C A;  4IEJ A;  3VYU B;  3G3Z A;  4BEH B;  2BBY A;  2JK3 A;  4EJV A;  1D1A A;  4ESF A;  1W36 C;  1JKO C;  2A6H F;  1Z6R A;  4Q4Z F;  2GBY A;  2R7T A;  2F4I A;  3EUH C;  2V1D A;  2OF7 A;  2JZY A;  1N75 A;  1IW7 F;  3OIQ A;  3LSH A;  2BOL A;  3K4M A;  4OMZ A;  4WWC A;  3CP8 A;  4ZYE A;  1FYL A;  4JX4 A;  2R4G A;  4KIT B;  3NWS A;  5GAD J;  2CV1 A;  2EH3 A;  4XK4 A;  5LLQ A;  3TO9 A;  3RQI A;  4BJT A;  1SAX A;  3K2A A;  4II2 A;  3M8J A;  2UXN A;  2ZKZ A;  2EFW A;  4CO8 A;  1OLT A;  3P9K A;  4O3M A;  4G7O F;  4XBF A;  2E7W A;  2W4S A;  5L3E A;  3WHC A;  1ZK8 A;  2KIF A;  4A69 C;  5IP6 A;  2CH0 A;  4ZTF A;  4M9S A;  4A3B J;  2K3F A;  4P1W A;  1WJF A;  2XIG A;  3BZK A;  3JTH A;  3UKG A;  3ZQ7 A;  3WTS C;  3VOD A;  3DKW A;  1SVL A;  2LKP A;  3LA3 A;  2QCO A;  1S29 A;  4WK8 F;  4PSX A;  1D5Y A;  3LFK A;  1GLN A;  2EPF A;  4BKX A;  2ZJP F;  4F91 B;  3DCF A;  5E8G A;  5LEK A;  1VI0 A;  2P7C B;  3M8F A;  5LD2 C;  2GZW A;  3MAJ A;  2DT5 A;  3WG9 A;  3I54 A;  3DKY A;  2L7K A;  3M1C A;  1TTY A;  3BG9 A;  3OYC A;  4BE2 A;  3WG7 H;  2IJL A;  5IT9 K;  3GEZ A;  2EFP A;  3M8E A;  3JRD A;  1LDD A;  1QHH D;  4TV7 A;  4P5O A;  4NHJ A;  1G2H A;  4YFX F;  1SMT A;  4G9Y A;  5CQE A;  2HZT A;  2VB6 A;  3JAM K;  5DS9 A;  2MLK A;  4IRG A;  5C3E J;  5DUK A;  3ISP A;  4I0A A;  4UUS B;  3K2Z A;  4ZJZ A;  4PZJ A;  4G8X A;  2QA4 I;  4I09 A;  2DA7 A;  2X48 A;  4U0Y A;  1U8B A;  1IG7 A;  4BEH A;  2D1H A;  3R0J A;  2QZ8 A;  3PIO F;  4DGW B;  1H8A C;  3MQ0 A;  2PI0 A;  1YX5 A;  3CJT B;  3WTV C;  2G7H A;  4EVI A;  4IOA F;  1S7O A;  5CQG A;  5H6R A;  3GLL A;  3DBH B;  2EFN A;  3S14 J;  1ETX A;  3IWF A;  3BG7 A;  1BJA A;  5ICC A;  3JR9 A;  3HC7 A;  1BIA A;  1SAU A;  2OV7 A;  5CVI A;  4EM1 A;  1IXR C;  1IV6 A;  4A3G J;  3K10 A;  5BPD A;  1NTC A;  2EA4 A;  1Z9C A;  2Y48 A;  2FD5 A;  4PCQ A;  2CS3 A;  4BUP A;  4EJU A;  2H8W A;  2P8T A;  2JTV A;  2LBF B;  1PUF B;  2WAE A;  3ELK A;  3OSG A;  1BI2 A;  3A0B C;  3HSR A;  1T33 A;  1ZN2 A;  4B1R A;  1GVJ A;  4NQW B;  3L2R A;  1YQA A;  3PJR A;  3CCY A;  2LF8 A;  3OIO A;  2KZG A;  1BA5 A;  1JGS A;  3J81 K;  2CV2 A;  2MYS A;  2D5V A;  2EK5 A;  1X1P A;  4MTD A;  3HTU A;  2L9N A;  3IRR A;  3EUA A;  3S17 J;  5E3N A;  2VE9 A;  1MJA A;  2JPB A;  2QQ9 A;  4EGY A;  3GFI A;  4J00 A;  2L9R A;  3ZN1 A;  2L9S A;  4UNO A;  1Z3X A;  3BJ6 A;  3CCJ I;  2FSW A;  2OZU A;  4HDV A;  3BJO A;  1R5H A;  4QTR A;  1VQO I;  4AIJ A;  2R7O A;  5C44 J;  5JR3 A;  4BDY A;  1LQ1 A;  2KJB A;  3H3Z A;  3AG4 H;  4LG3 A;  4XRS A;  4HZF A;  3LSR A;  2HDC A;  5IT9 Z;  3S1R J;  1FNN A;  3T8T A;  4K2E A;  4II3 A;  4M3E A;  4A3J J;  2RNJ A;  5FFX A;  3G1O A;  1LE8 B;  1TP4 A;  2HGC A;  1RR8 C;  4I02 A;  3C2G A;  2DBB A;  4CZC A;  3JAM Z;  5DYM A;  3GVA A;  3SDB A;  4ESB A;  4LJZ F;  2ZME C;  3DWL E;  4UUS A;  3IH2 A;  2LD5 A;  3TKY A;  3SDG A;  3VPR A;  5F1J A;  4PDK A;  1FOY A;  1FY7 A;  3DP7 A;  3UNG C;  2DOF A;  1OYY A;  1FP1 D;  5H20 A;  2CMP A;  1WJB A;  2VLA A;  3BR0 A;  2OUM A;  1OCC H;  4ZC3 A;  2UWM A;  4RAG A;  1FT9 A;  2HOE A;  3WE3 A;  5FLX K;  3B6C A;  4ENK A;  2MW8 A;  9ANT A;  5DUI A;  3HTS B;  4OIO F;  2HTJ A;  3BPV A;  1YOV B;  1IUF A;  1O4X A;  1ZR4 A;  1UZC A;  2DMP A;  4E7Z A;  4LFU A;  1R1V A;  4M9Z A;  4HEA 2;  4BY1 J;  3CC7 I;  1E2X A;  3CQZ J;  2IPQ X;  4FX4 A;  3HYI A;  3QU3 A;  1PUF A;  2LBF A;  3NWT A;  5E1W A;  1MBJ A;  1JGG A;  1Y1W J;  1HST A;  2ZNY A;  2Y75 A;  4NQW A;  4XN3 A;  3VDX A;  2DXI A;  4M6V A;  1R9T J;  2G0E A;  3E0J B;  1BI3 A;  1R36 A;  3J81 Z;  1VQ5 I;  2DDB A;  2VOO A;  3OL4 A;  1X1D A;  2DA2 A;  2NVY J;  3WTZ A;  1T38 A;  4KDP A;  4IL6 C;  1UB9 A;  1RIO H;  3SHF A;  2E35 A;  3MZH A;  4A3E J;  3K1N A;  2FBK A;  3OYE A;  3DPU A;  3JTG A;  1BIB A;  1I3Q J;  2P6T A;  1OIS A;  5IYC J;  3MKZ A;  1Y8Q B;  4B47 A;  1QGP A;  3ERM A;  2VOD A;  4N9H A;  3Q3S A;  5F0C A;  4EQQ A;  2FNA A;  2ME6 A;  2E1M C;  3HRS A;  3OIP A;  1ETQ A;  2X1C A;  1REP C;  4CGZ A;  4XMY A;  1DPU A;  4GO1 A;  1B1B A;  1ZGW A;  3FM5 A;  3MKY B;  2O7O A;  4UB6 C;  1IRX A;  4BXF A;  1CGP A;  3BG3 A;  1BW5 A;  5EF6 A;  2FNP A;  2BVL A;  4MFD A;  4N4O B;  1XTA A;  2FU4 A;  2Q8K A;  2XC7 A;  3JRA A;  1F5T A;  2E2H J;  3DU6 A;  5KK1 A;  3R60 A;  4A0X A;  2HS5 A;  2OA4 A;  3DTK A;  1N77 A;  2E71 A;  1I6H J;  1XGM A;  3VWB A;  2ESN A;  1FLI A;  3CCL I;  1IRZ A;  3BZ6 A;  3MEX A;  3OR2 C;  4OIR F;  3B02 A;  3HBL A;  5FLX Z;  2V4J C;  4HST A;  3HEF A;  5EYR A;  1KU7 A;  2V1U A;  3IV5 A;  3R6S A;  1RNL A;  1MBK A;  3TP3 A;  4BS9 A;  3Q9V A;  1H89 C;  3FX3 A;  2Z33 A;  3NEU A;  4AVP A;  4IOC F;  4XLH A;  2V1X A;  4G94 A;  3H5N A;  2E60 A;  2ADU A;  2IP2 A;  4RB2 C;  3TBI A;  2ZXJ A;  4GXO A;  2PX9 A;  2ESH A;  4FAS D;  1RET A;  2FQ4 A;  2V9P A;  3WE2 A;  1RUN A;  1R23 A;  1XB4 A;  1GV5 A;  2EZI A;  3H92 A;  2L3D A;  2AO9 A;  4PGH A;  5A2Q K;  2JA6 J;  4KT6 A;  4EAT A;  2L02 A;  1XCB A;  1W7P D;  3KFW X;  3U1K A;  2QQ8 A;  3CME I;  4I99 C;  3RJP A;  2CQ7 A;  2K7L A;  4PJL A;  4U7B A;  1YTY A;  2RN7 A;  4B44 A;  4XQF A;  2DMQ A;  1ZG5 A;  2KT0 A;  3NQO A;  2HOS A;  2P5K A;  3GX4 X;  1WQ2 A;  5FLM J;  2MC3 A;  2WAD A;  4MIM A;  4I2O A;  3ZQF A;  3WTW C;  3ZQG A;  4P9F A;  3M3Y J;  1VFC A;  4BNC A;  2KIQ A;  1D1C A;  2NS0 A;  4PK4 A;  3OSF A;  5DD8 A;  3GCM A;  1WWX A;  4A3F J;  4UHT A;  1SC7 A;  4Y15 A;  3F8M A;  3A0H C;  2O5R A;  4OIP F;  3HSF A;  5CPR B;  3FM3 A;  3S3N A;  1OQY A;  4B8X A;  1XMX A;  1GXP A;  4BXU A;  4XLN F;  5E8I A;  1JXS A;  3QOE A;  2VXZ A;  2XAH A;  3DTE A;  2DDA A;  2UZK A;  1USS A;  2QEX I;  3D0S A;  1WCM J;  2QGU A;  2GIV A;  4X6A J;  1FOX A;  1FJL A;  1IN8 A;  3HIF A;  2WB1 N;  1J59 A;  4QIW N;  3LMM A;  4U88 A;  2K9Q A;  5M5Y J;  3JRC A;  4HQE A;  3FMQ A;  5BPI A;  2ZNZ A;  3F6O A;  3FXL A;  2LRE A;  1EJ9 A;  1X1A A;  3A03 A;  4ZDP A;  2X0L A;  4D1Q A;  3N05 A;  1YE9 A;  2R7R A;  5IP9 J;  4DBR A;  1R5I D;  1E3O C;  2M8E A;  1I50 J;  4ZTJ A;  4WXH A;  3BR6 A;  3FKI J;  3M07 A;  1B72 B;  2E1C A;  2X6Y A;  1W7P B;  4R8H A;  5A2Q Z;  2N8G A;  1ENH A;  5DTD A;  2R7Z J;  3O8H A;  3SZT A;  1X4O A;  2YU3 A;  3CMY A;  2DTR A;  5IOZ A;  4GFB A;  1G3Y A;  3QQA A;  3IHU A;  1J75 A;  2DI3 A;  3F22 A;  1UAA A;  3FBN B;  1U9O A;  4LLG F;  2HQA A;  2WTE A;  4FX0 A;  4A93 J;  3A2K A;  3E6D A;  1FYK A;  2VOP A;  4HW0 A;  4KNY A;  5IYB J;  2GA1 A;  2QYO A;  1SAN A;  2RGV A;  2JSP A;  1T6S A;  4XKC A;  4F7Z A;  3ZXS A;  4AVZ A;  2F48 A;  3T0Y A;  4E7J A;  1MJ9 A;  2VAS A;  2ZCW A;  1AOY A;  2H1L A;  1UHM A;  3K4C A;  2GOM A;  3KP2 A;  2IS4 A;  1F1Z A;  1X19 A;  1Z7L A;  2KDZ A;  4RM3 A;  2LSO A;  5HNF A;  2IRF G;  2DMN A;  1KU9 A;  1UST A;  4L9N A;  3ULQ B;  4XLF A;  2E5Z A;  3P7N A;  1ZGJ A;  4J01 A;  2ZXH A;  3QPL A;  1SD6 A;  4F3Q A;  3H5A A;  2QWW A;  3V7C A;  3L2W A;  4AWX B;  2X6O A;  5AON A;  2K85 A;  2K9S A;  3D5L A;  1PP8 F;  4OMY A;  1RES A;  2RQQ A;  3PNV A;  4O6J A;  2DA1 A;  5BOX A;  1TWG J;  2A6E F;  3CES A;  1BI0 A;  1MBF A;  2DT6 A;  3G2B A;  1TZL A;  2P4W A;  5L3G A;  2HPI A;  5TJJ A;  2QSG X;  3D5S C;  3F23 A;  3FXU A;  4DZJ A;  1U8R A;  3IH3 A;  2IT0 A;  4BAY A;  5HS8 A;  5J1Y A;  3F6V A;  4RB3 C;  4Q5S F;  1IN5 A;  3MKL A;  3FHN A;  2UXX A;  5M3M J;  3JSO A;  1JHF A;  4WF2 A;  4E7I A;  2BVM A;  3CUQ B;  3S15 J;  4MO7 A;  2MAB A;  2BV6 A;  3CMM A;  4EGZ A;  3PUF A;  3CZ6 A;  5C4J J;  1OCT C;  2XF7 A;  3K70 D;  1MMD A;  1B72 A;  2OD5 A;  2RAE A;  1W7P A;  1BR2 A;  3R61 A;  3H35 A;  4ZDL A;  4S0H B;  3EPZ A;  3GW2 A;  1YS7 A;  3O2P E;  4M3F A;  3RKY A;  3QOD A;  4OOI A;  3ERE D;  1T08 B;  3C1D A;  3PNT A;  4PUS A;  2YUS A;  4XR6 A;  3G6E I;  5GP9 A;  2HQN A;  4L9T A;  4YII A;  2L54 A;  2HVS A;  3E6M A;  4DJA A;  2HTS A;  1QVU A;  3P9I A;  5J8C A;  4C2T A;  4X1E A;  4IHT A;  5J3L A;  4LB6 B;  3QWL A;  2GM4 A;  4HBL A;  2R7S A;  3KEQ A;  4LB5 A;  3KE2 A;  1V4R A;  4XOR A;  4HX7 A;  5B1A H;  4ZDO A;  2PQ8 A;  1MW7 A;  5TGT A;  1P4A A;  2BY3 A;  3LA2 A;  2LOO A;  1MMG A;  3X2Q H;  1ZR2 A;  2DPU A;  1I3A A;  4KIC A;  4HQM A;  1IN6 A;  3HOY J;  1MMA A;  2UV1 A;  4Y17 A;  5KNL A;  3JRF A;  3MCZ A;  2OAZ A;  1FBS A;  5EEH A;  3I5U A;  2DQL A;  4QPO A;  5FRM A;  2TDX A;  1ZHF A;  2L01 A;  3DEW A;  2KLO A;  5FD6 A;  3QYE A;  3G71 I;  1B8I B;  3HHH A;  2Y0M A;  1P4X A;  2OPT A;  3HB9 A;  1LFB A;  3F3X A;  4LG0 B;  5EZH A;  2OBP A;  3LST A;  4KUM A;  1HW5 A;  1VQL I;  2BHZ A;  2OU2 A;  1R1T A;  5K5R A;  1J5Y A;  3E5X A;  3FHZ A;  4EJW A;  1VQ4 I;  3O3K A;  1FSH A;  4YEJ A;  1IC8 A;  4EJT A;  3GWZ A;  3I9V 2;  3FIW A;  3IAS 2;  5FB2 A;  1R71 A;  5E20 A;  5F0F A;  4FET A;  3SQN A;  1RI7 A;  2O3F A;  1ETK A;  1IO2 A;  2KPM A;  5L3B A;  3HOZ J;  4DNC A;  4F55 A;  1G8X A;  3GFM A;  1NHA A;  1ZQ3 P;  4ON0 A;  1K4S A;  3HOU J;  1W0T A;  3QYF A;  3L09 A;  3EDP A;  4FE7 A;  4EM0 B;  3QPT A;  1QA6 A;  1I39 A;  3CUQ A;  3HM5 A;  3S1M J;  1SFU A;  3N4M A;  2A5W A;  3N97 A;  3DLA A;  4M6X A;  4XRM A;  1FBQ A;  2C6Y A;  5IPA A;  2V6E A;  1K78 B;  3CDI A;  1D1B A;  6PAX A;  3FMS A;  4RGS A;  5F0H A;  4V2F A;  3ECO A;  1S8N A;  5E79 C;  2JQ7 A;  2DAO A;  4A6E A;  5HLH A;  4A6D A;  2XGD A;  4P9U A;  1QO0 D;  1K7A A;  3T5X A;  1WVR A;  2L4A A;  3WHB A;  1IN4 A;  1C0W A;  3K0L A;  2HDD A;  2DLL A;  2EIJ H;  2HI3 A;  2VN2 A;  5HS7 A;  3OYG A;  2YX4 A;  2V9V A;  3KET A;  2E5N A;  4QPQ A;  1PJR A;  2EZK A;  2MC4 A;  2DA5 A;  3GLX A;  3S8P A;  4C3H J;  3KLN A;  3I56 I;  4A3L J;  1X58 A;  2OJE D;  3FK7 A;  3V8L A;  5JFR A;  2DYR H;  2EZH A;  1T0F A;  4OU0 A;  4ZYG A;  2KMU A;  1I5Z A;  1XN7 A;  2HFH A;  1MNM C;  2PMZ N;  3I3L A;  2COB A;  1OPC A;  2F5C A;  3DV8 A;  3ZPL A;  5GAG J;  3PO2 J;  2OCE A;  1UJ8 A;  4JQF A;  1ETV A;  2OQR A;  3KEY A;  2CQK A;  1VTN C;  1QBJ A;  3HRT A;  2W24 A;  1O3Q A;  2DU9 A;  2XF6 A;  4M71 A;  5DM6 F;  5DCM B;  1B8I A;  3K9T A;  4IHY A;  4ASN A;  3CC2 I;  1AKH B;  4LG0 A;  2FUG 2;  4HLX A;  5DEQ A;  2B7E A;  2Y31 A;  4CYC B;  4OIN F;  4UY8 I;  4MEY F;  2OQG A;  3LSM A;  2R5Z B;  2NS7 A;  1HC8 A;  3ECH A;  4KIS A;  1RPW A;  3KZI C;  5HLT A;  1HBX G;  1KA8 A;  2UUZ A;  1E17 A;  2A3S A;  3RPU A;  1GDT A;  3EUK L;  4XNF A;  3WU0 A;  2WB1 A;  5CVJ A;  3HRM A;  5CJ9 A;  4E6K G;  5M5X J;  2W82 A;  3L2C A;  4DYR A;  2IW5 A;  5LGU A;  3L00 A;  4DZP A;  5E3L A;  2XDV A;  4IVN A;  1RR7 A;  4M3G A;  2GWR A;  3GBG A;  2QLZ A;  2F6C A;  4JP0 A;  4B3A A;  1ZEL A;  5AIQ A;  2AHQ A;  2OCC H;  4AUX A;  1K78 A;  2DFH A;  1U5T C;  2LG4 A;  1FMW A;  2IXS A;  2BZT A;  3U1D A;  3HSE A;  4CCK A;  3TGN A;  3SFZ A;  5FKN A;  3T8R A;  5ERI A;  3WGG A;  3M1E A;  3NAU A;  2VPL A;  4E70 A;  1S5L C;  3WTT C;  1K83 J;  2KKO A;  3U2R A;  2CQX A;  1TQM A;  2XKP A;  3DEU A;  1IXS B;  1B9N A;  3HJE A;  3V8J A;  1APL C;  3Q0W A;  3CD6 I;  2VKV A;  1I1G A;  2QM3 A;  2CUJ A;  2IA1 A;  3JRE A;  3FBI B;  2LK2 A;  5LHG A;  1STZ A;  3NAR A;  3VYS B;  1I1S A;  1WFX A;  3GTQ J;  4IHV A;  1B59 A;  1WSU A;  2DOE A;  2Y2Z A;  3IKV A;  2F2E A;  3FXO A;  2ACJ A;  2QBY B;  1QPM A;  3KYD B;  5DV5 A;  1WJ5 A;  1PYV A;  3LWF A;  4P96 A;  2EQR A;  3GYH X;  4ZH4 F;  3H5R A;  2K5C A;  2M45 A;  1T56 A;  4UVB A;  1XS9 A;  2HKO A;  2QF7 A;  5JLX A;  1LEB A;  2XAS A;  3I53 A;  3HOT A;  1ZLK A;  1T2K A;  2Y9Y A;  1HW2 A;  2LVS A;  4FHT A;  3I4N J;  3JRB A;  2HDW A;  1E3H A;  3ZMZ A;  2JVG A;  4PGG A;  4HA8 A;  3PNY A;  1QZZ A;  4RBO A;  1MBE A;  3IH4 A;  2CW7 A;  3HZJ A;  4NC6 A;  2F5D A;  4OAZ A;  3BTC A;  1TWF J;  2CSO A;  4XLE A;  1L0O C;  5DCM A;  3I4P A;  3SZG A;  4V19 K;  2EJR A;  2VBZ A;  1AKH A;  4CYC A;  2R5Z A;  4V2G A;  2Q0O A;  4M72 A;  3EET A;  5LEJ A;  1ZTR A;  4I01 A;  2BY1 A;  1Q1V A;  1D3Y A;  4KMF A;  3MWM A;  2IA0 A;  2X1E A;  1ON2 A;  3BJA A;  2ZC2 A;  1R6R A;  3SYT A;  3VOE A;  3TDU C;  2GAU A;  4IX7 A;  1O3S A;  2HQR A;  3LL7 A;  3AAF A;  2DOD A;  4CDG A;  4IZZ A;  3FK6 A;  3U21 A;  1XDU A;  2O8K A;  1J09 A;  2ZXI A;  3GTL J;  3HL2 A;  2VJ5 A;  4A2U A;  2IGM A;  3RIR A;  1DDN A;  2STW A;  1MJB A;  3H9Q A;  4HSR A;  2ZJR F;  3DEE A;  3E7L A;  1VQP I;  5K5O A;  1D5V A;  4AIK A;  3DBL B;  1P7I A;  2MG4 A;  5J6X A;  1WKM A;  4U87 A;  2ELK A;  4ETS A;  3HXL A;  4D5C A;  4Y52 J;  4KJZ A;  3W2V A;  3K4B A;  3ABU A;  3C7J A;  1EH6 A;  3PFY A;  1MH4 A;  3CCE I;  4B09 A;  5K7F A;  2XB5 A;  4I6Z A;  1D0Y A;  1HSJ A;  4BE0 A;  1Y6I A;  3VSL A;  1TW2 A;  5E1X A;  4BY7 J;  1MNE A;  3LAP A;  3KP4 A;  1KZH A;  2O61 A;  4CYD A;  4EMS A;  2BEO A;  1UHW A;  2QBY A;  4RA2 A;  1SFE A;  4A3K J;  1G3S A;  1LUJ B;  2GOX B;  3J7Y J;  1ULY A;  1IZ1 A;  4CZZ A;  3ZQC A;  2BYV E;  2JT1 A;  2FF4 A;  2X51 A;  3ML6 A;  2Z16 A;  4KYW A;  1TWH J;  1IDZ A;  2P6S A;  3F9K A;  1OCO H;  3I58 A;  2KHM A;  3H9J A;  5L3D A;  1W36 D;  4B48 A;  3S3O A;  4G12 A;  1WH5 A;  3ZMD A;  1TWC J;  3CLO A;  3LFU A;  3JRH A;  2XSD C;  2V7F A;  2QVO A;  3OMY A;  1V5F A;  3CC4 I;  5LHH A;  2E2I J;  2L2O A;  4BJ5 C;  4ENM A;  1YW9 A;  4PJ0 C;  1XGO A;  1BJZ A;  3G4S I;  1F43 A;  4BH9 A;  5GPC A;  3DU5 A;  4F93 B;  3HOV J;  3LA7 A;  2JA7 J;  5HDG A;  2DPD A;  1YYV A;  1UG0 A;  3CCU I;  2M30 A;  4RGX A;  3LSG A;  4JX5 A;  1J9I A;  1Y1V J;  2BXY A;  4AIH A;  2ID6 A;  5B3S H;  1BW6 A;  5GTH C;  2LTP A;  3S32 A;  1OMI A;  4I7H A;  1IDY A;  2FBH A;  3MVP A;  5E17 F;  1ZRD A;  1LPQ A;  2KDO A;  4I76 A;  1LE8 A;  5ICG A;  3COA C;  2O03 A;  4MTE A;  1RKW A;  3CJQ B;  1BOB A;  3RZD J;  3BPX A;  3FMR A;  4E4H A;  2NNY A;  4B3X A;  1IGN A;  5KHD A;  1FPQ A;  4BJ6 C;  3B6A A;  3WTX C;  2HVQ A;  3AL0 B;  1H9G A;  3FWE A;  3GXO A;  3ZMV A;  1QQI A;  2LC2 A;  4HF0 A;  1SD5 A;  4LIT A;  3QU6 A;  1G4D A;  4IF4 A;  2XGE A;  4A12 A;  5K1Y A;  5D4R A;  3IL2 A;  1KYZ A;  1S9H A;  2NVU B;  2XGX A;  1RRJ A;  3LSP A;  5IP7 J;  3BP8 A;  2P7V B;  2V26 A;  2QKL B;  3PQJ A;  2M87 A;  2E34 A;  2EFO A;  1QU3 A;  3CMA I;  4C3I J;  3J7Z I;  1M1E B;  2ELH A;  2MH2 A;  3HRU A;  3ONQ A;  2PMZ A;  1XG1 A;  1OJL A;  2FE3 A;  1ZAO A;  4LIV A;  2CYY A;  4HNU A;  1Z6T A;  4BGD A;  2VQL A;  2MA3 A;  2XKO A;  4E7K A;  5F64 A;  1WJC A;  4KN7 X;  2JA5 J;  2M34 A;  3CTA A;  3TP0 A;  3HPH A;  1BM9 A;  1Z67 A;  4RLF A;  2LY9 A;  3A02 A;  1WRJ A;  4AYB N;  3PL8 A;  3S3M A;  3MZY A;  2RKH A;  3GUD A;  3HG9 A;  3REO A;  5ILU A;  2BGC A;  4A0Z A;  4A0Y A;  4IQJ A;  1Y0N A;  3BY6 A;  1XGN A;  5LFA A;  5LGT A;  4UXN A;  3F8F A;  1J2X A;  1XSX A;  1SMY F;  2E2J J;  4ZYH A;  2NOG A;  2R5Y B;  3TDZ C;  2ZFU A;  1Z05 A;  2M4K A;  1OYW A;  2ZBK A;  3LSJ A;  4MFE A;  2R3S A;  1A04 A;  1Z91 A;  2VC1 A;  5GTI C;  1G59 A;  1XCV A;  5J40 A;  1BOA A;  2Y0S N;  2PN6 A;  2ZSH B;  3RCO A;  2DJN A;  5FRN A;  1LEA A;  2HOA A;  3M7G A;  2EV6 A;  2VON A;  3ZMS A;  1WH7 A;  4LLL A;  1U9N A;  2M7B A;  4RMN A;  1R4M B;  2P5L C;  2E7X A;  3C2H A;  3B73 A;  4OWR B;  1KQ9 A;  2ISZ A;  1MND A;  3MD2 A;  1G3W A;  4KMU X;  1HF0 A;  3S2D J;  1O3R A;  3HGG A;  5F1R A;  2IVM A;  2XV4 S;  3BR2 A;  3I59 B;  4CCL A;  4M6Y A;  1R7J A;  1PDN C;  1AU7 A;  1FYM A;  2DFE A;  4CHU A;  1X2N A;  2M3A A;  2XRO A;  2DCE A;  3C18 A;  4XSX F;  5FD5 A;  4MQV A;  2VC0 A;  2Z1D A;  1EH7 A;  4OIQ F;  3C2B A;  2ZB9 A;  1WHU A;  1MZB A;  3S93 A;  5LHI A;  3WU1 B;  2Q2E B;  2PJR B;  3H3U A;  4RGU A;  3PIP F;  5HDK A;  2JRM A;  3TO6 A;  4EV0 A;  1LB2 A;  1MD0 A;  1YFH A;  1NK3 P;  3FDY A;  1FIP A;  2J5O A;  4ITV A;  3LQR A;  2DQR A;  2KIM A;  3AG1 H;  3EUH A;  5FJ8 J;  4IRI A;  1KQ8 A;  4XKV A;  4BQN A;  3V7S A;  4D5F A;  1QHG A;  1K6Y A;  2VPR A;  3PM1 A;  2NVX J;  2WV1 A;  3OR1 C;  2WA0 A;  1U0J A;  3V42 A;  3MN2 A;  1ZG3 A;  3K1P A;  2AXL A;  3E6C C;  1W5C C;  2DK5 A;  1JHH A;  3DFG A;  1U2W A;  2M0C A;  2OTL I;  1HKT A;  1XX5 A;  2IBD A;  4BQQ A;  1UCR A;  2VQG A;  2R5Y A;  1B6A A;  3GTP J;  3OS1 A;  2DK8 A;  1Y8R B;  2VXD A;  4Q47 A;  2IGN A;  3QYB A;  3CCR I;  3OOU A;  1FTT A;  4MGR A;  2WBM A;  5CKT A;  5HVQ C;  2NXN B;  5K5Q A;  2IA2 A;  1W0U A;  3H9G A;  2M4G A;  1JE8 A;  2DFF A;  2HYF A;  4E7H A;  3F0C A;  3DKX A;  1K79 A;  2TCT A;  2H27 A;  1VQN I;  1OYI A;  3KCC A;  1JJ8 C;  1A35 A;  3JW4 A;  2HU9 A;  3FXM A;  3RPQ A;  1WJA A;  2FOW A;  3PO3 J;  2M1B A;  5HDN A;  3RKQ A;  2L4M A;  2A05 A;  3AG3 H;  3IAM 2;  4YEL A;  4ESJ A;  2D2W A;  4I0B A;  3I4M J;  1GHC A;  5DCF A;  3A1Y A;  1CF7 B;  4PJJ A;  1YJ9 I;  5EJC A;  4KIB A;  3DQV C;  3OYM A;  3G73 A;  2FA5 A;  1UMQ A;  1N78 A;  4HAM A;  1HDP A;  5EGO B;  3I59 A;  2VT2 A;  3OYK A;  3QRF F;  1B9M A;  2VE8 A;  5IOY A;  1R1U A;  2LKS A;  1BR1 A;  1XD7 A;  2BY2 A;  3HHG A;  2B63 J;  2ZME B;  1T8I A;  2L7F P;  2PJR A;  2Q2E A;  2YPR A;  4X0G A;  3L2V A;  1XC5 A;  4EJO A;  4YG2 F;  4E7L A;  3WTY C;  2K86 A;  2YX7 A;  3R4K A;  4QSH A;  1MGT A;  1N25 A;  3MFK A;  2A61 A;  3D5R C;  3KP7 A;  2XRL A;  5E18 F;  2I8D A;  5CYV A;  2CQN A;  4LIU A;  1G3T A;  3QPS A;  2QQB A;  3W3C A;  4IO9 F;  4PFO A;  4IKF A;  2H1K A;  2VBX A;  1W5T A;  5E1Z B;  1ERD A;  3F8B A;  1Y39 A;  5IT3 A;  3ROU A;  1BI1 A;  4L5E A;  3T1B A;  2PLY A;  2RRE A;  1V5E A;  4IHX A;  5H2F C;  3SEQ A;  4CIC A;  1ONV A;  3RKW A;  1WJE A;  3C3W A;  3OV8 A;  4D9J A;  2GQQ A;  1VND A;  1GUU A;  2CJJ A;  1F4K A;  4UVC A;  2QEN A;  2V6C A;  1BN5 A;  2EIL H;  3KP5 A;  4IHS A;  2EV5 A;  4L9V A;  4KIG A;  4XN0 A;  1DPR A;  4CA0 A;  2DMT A;  3MKW B;  2E1O A;  1U78 A;  3S1N J;  3ZGK A;  4FTH A;  1IAW A;  4Z6Y A;  1KU2 A;  4H4K C;  1HQC A;  3ZQQ A;  2A5Y B;  5BNG A;  5KAF C;  1K6O A;  5JVG F;  2BY0 A;  2DN0 A;  1FOK A;  4XLA A;  2VKE A;  3RKX A;  4M74 A;  3OS0 A;  3A01 B;  1QNT A;  5EG0 B;  3OYH A;  4XL9 A;  3W2W A;  1EV7 A;  2F5F A;  1ZRC A;  1RC9 A;  3TO7 A;  2XRN A;  3Q0U A;  5D6E A;  1YW7 A;  1WZ2 A;  2KIS A;  3E6B A;  3BLY A;  1YRN B;  2VJI A;  1P9Q C;  1V54 H;  2E1M B;  2JA8 J;  1O7F A;  2XPW A;  1DGR M;  4D7M A;  1CF7 A;  1WI3 A;  1YW8 A;  4GCV A;  1IV8 A;  1YJN I;  4AID A;  3I0T A;  3P9C A;  3EYY A;  2LNB A;  3GME A;  5EGO A;  3D1N I;  4JBA A;  4MEX F;  1YX3 A;  2JRT A;  1IN7 A;  2FEZ A;  5D8K B;  1A5J A;  5CVV A;  3W6V A;  1W4M A;  3BCB A;  3GF2 A;  5GAE J;  2Q1Z B;  1V3F A;  2BHY A;  2LH9 A;  2W85 A;  3S1Q J;  2CO5 A;  3I55 I;  1V55 H;  4U0W A;  5D5X B;  4JK1 X;  5H6Q A;  1ZAR A;  1NG6 A;  3F72 A;  1S7A A;  3K4J A;  4BBR J;  3CO6 C;  2CU7 A;  3RZO J;  5F08 A;  4PFP A;  1H9T A;  2MGQ A;  3WOD F;  1TC3 C;  4B43 A;  4ENN A;  2EIN H;  3S2W A;  3OYL A;  4HF1 A;  4XKB A;  4GDF A;  3WTU C;  1X3W B;  5D6F A;  2BW3 B;  2E19 A;  2FQ3 A;  1FMV A;  2OZ6 A;  3VYT B;  1UEL B;  2IS1 A;  2CUZ A;  2ME0 A;  3W6K B;  5CVU A;  4HYE A;  3BQZ A;  1MIJ A;  3OYJ A;  3GTM J;  2R7D A;  3GO5 A;  1AHD P;  4D7N A;  2ID3 A;  5ICF A;  4UUT A;  1HDD C;  5FLV A;  1TL8 A;  2F4M B;  3PFI A;  4GYI A;  2HXO A;  4AYB A;  2LKX A;  2HPM A;  2MD0 A;  1U6G A;  4HX4 A;  2LY1 A;  5D4S A;  3HKZ N;  2JJ7 A;  3BCA A;  5CLS A;  5JLW A;  1EF4 A;  3CCQ I;  2D45 A;  1ETO A;  2I5U A;  4EM2 A;  2HVR A;  2CG4 A;  3DPT A;  1ZLJ A;  1ETW A;  4L0Y B;  4AU7 A;  2EA2 A;  2QQA A;  1FOW A;  2ECB A;  3OOP A;  2HYJ A;  3A01 A;  5EG0 A;  2FOK A;  2IGO A;  3BTL A;  2I10 A;  4BL0 B;  1FEX A;  4DYQ A;  1YS6 A;  2Y0S A;  3H0D A;  2H6B A;  4HPQ A;  3FZV A;  3BZC A;  2R7Q A;  2MH9 A;  1JUM A;  3CCS I;  2R92 J;  1YI2 I;  1YRN A;  2XAQ A;  4JYK A;  3WGH A;  3KIO A;  2RNG A;  4IRH A;  2NOJ B;  4Y3O A;  3KYC B;  2DO7 A;  2JVH A;  3ABL H;  4W1U A;  3U9G A;  1JKP C;  5HLI A;  3J7A O;  1VZ0 A;  3NRV A;  4GGG A;  4A3I J;  2VJJ A;  3DLL F;  3ZMU A;  5L3F A;  3HDD A;  1Z1D A;  2NVQ J;  2GXG A;  2LR8 A;  2NRA C;  4M9X A;  3KPH A;  1MMS A;  2LFB A;  1H88 C;  1IRF A;  2FMY A;  2CV0 A;  2K3P A;  3GZ6 A;  2RQP A;  3BTI A;  2M5W A;  2JA2 A;  5D5V B;  2ZJQ F;  2VBW A;  1LFU P;  3J80 Z;  2M2E A;  2YS9 A;  1A6Q A;  1J7K A;  3IKT A;  3PUB A;  2IS2 A;  2WY8 Q;  3AFH A;  2HNH A;  1SVM A;  5KVR A;  3CCM I;  5B1B H;  2BW3 A;  3M9A A;  2Y9Z A;  3SEZ A;  3PSI A;  4Y13 A;  2VIX A;  1MH3 A;  4RB0 A;  4A3C J;  2NAZ A;  3S2H J;  4HRI A;  4S05 A;  5ED4 A;  4RDU A;  5FGM A;  3RYP A;  4A5N A;  1P92 A;  2X1D A;  3LSI A;  3KP6 A;  3RSN A;  1FWZ A;  3K4N A;  2EB7 A;  4M3D A;  2Z9O A;  2PMU A;  2KRC A;  3L9F A;  4QWQ A;  3J7A Y;  4RAZ A;  3G1L A;  3OWT A;  3OYN A;  1Q1H A;  1Z77 A;  5LRR A;  2COM A;  1XSD A;  1JTX A;  2JUG A;  4Y4R A;  2EFQ A;  3GTO J;  2R7X A;  2CUF A;  1VQM I;  1CQT A;  3L2Q A;  3HPG A;  2VBY A;  2DA3 A;  3OYB A;  3K4L A;  2ECC A;  4ZZD A;  5BQT A;  2YU9 J;  4BU2 A;  4KFC A;  2P81 A;  4MLO A;  1A31 A;  4FE4 A;  1JI8 A;  2GA2 A;  2XAG A;  3HOS A;  1D8J A;  2NNN A;  1S6L A;  2PEX A;  3ZQI A;  1LKX A;  1WPK A;  4MQ9 F;  2KP6 A;  2GIZ A;  1DGW Y;  2JN6 A;  3VFZ A;  5LGN A;  5DD4 A;  4XRS G;  4S04 A;  4RAF A;  2ETH A;  2KZV A;  3KX2 A;  2VKH A;  2K4J A;  3H36 A;  2ZJ2 A;  4XIC A;  1IXC A;  1BC8 C;  2X4H A;  5IYD J;  1DQU A;  1F36 A;  1DP7 P;  3L7W A;  5EEA A;  2A07 F;  1KU3 A;  4ZYA A;  1JKR C;  1ACI A;  1I6X A;  4XID A;  4ENJ A;  4JOM A;  2DFI A;  2DYS H;  1BBY A;  2P5V A;  3F8N A;  4RM2 A;  1XSV A;  3SXY A;  5L3C A;  1GV2 A;  3O8G A;  3RI4 A;  1S72 I;  2LYC A;  4CXF A;  3GFJ A;  3HOX J;  2XF5 A;  3ZP5 A;  1TWA J;  4CUG A;  1JJ6 C;  1J0R A;  4IXA A;  4HNV A;  4RS8 A;  3V8K A;  1W5S A;  3K4K A;  3M4O J;  4YFN F;  5LRS A;  4DYC A;  1WGX A;  4CCJ A;  5D8L B;  2ISY A;  2W1O A;  3K1M A;  2E1N A;  3QP5 A;  3ZR8 X;  3WU2 C;  2VI6 A;  5K7H A;  1FSE A;  2VL8 A;  3IC7 A;  3RQ4 A;  4EEF G;  1DP3 A;  3VB2 A;  2K40 A;  4WX9 A;  3BR3 A;  4XLC A;  3DF8 A;  3HOW J;  1TQI A;  4Y7N J;  2R7W A;  4UV8 A;  2VUM J;  2VT3 A;  4XRF A;  5GPA A;  1XMK A;  4G7H F;  5TRD A;  4U0V A;  3ABK H;  2XAF A;  2PBI A;  5JHF A;  1FX7 A;  1T39 A;  2CWE A;  4WXC A;  3CUQ C;  3VSK A;  2W57 A;  5JVT A;  3CLQ A;  2A68 F;  2JUC A;  1YIT I;  5JI6 A;  2HOT A;  2HZD A;  2ELJ A;  3CF2 A;  5GAH J;  1X1C A;  2Z99 A;  2CUE A;  3E1S A;  1V5G A;  2AS5 F;  4RB1 A;  2K02 A;  1TBX A;  2O0Y A;  3F21 A;  3JSP A;  2EBI A;  4LMY A;  1YO5 C;  4BXX J;  2KJC A;  1HKS A;  2VQC A;  3DXJ F;  4LK1 F;  2O8X A;  5DM7 F;  4C2M J;  2LF7 A;  2V1N A;  1MMN A;  2BXZ A;  3DPL C;  4PSW A;  2R7U A;  2KL4 A;  2LDU A;  1YG2 A;  5FKK A;  2MBF A;  1LJ9 A;  1X3Z B;  1P2F A;  1UFM A;  2LLK A;  3OY9 A;  3H3V K;  2XGC A;  1POG A;  2ZSI B;  4BDZ A;  2Z2S B;  4BYY A;  3FXQ A;  4Y33 A;  2QKM B;  1X4P A;  2HWV A;  3LAJ A;  2WAQ N;  2XUB A;  1MSF C;  4FQG A;  1T0F C;  5HS9 A;  5HNH A;  3P5J A;  3VYR B;  3K6G A;  3UR3 C;  2H09 A;  4NC8 A;  3JCU C;  5BMZ A;  4HG2 A;  3EQL F;  3BWG A;  1BL0 A;  3TL4 X;  3L1P A;  1WI9 A;  2FX0 A;  4FCY A;  1ORK A;  1EH8 A;  1HLV A;  2RV8 A;  3QP6 A;  4XKW A;  5FKO A;  1NG7 A;  3FKJ A;  1Z0X A;  2MSY A;  4WCG A;  2XPU A;  4NDL A;  2ZFW A;  1D0Z A;  1LFP A;  2QSH X;  1B4A A;  2M8G X;  1R49 A;  2L5Q A;  4NC7 A;  2XVC A;  3FIS A;  5F04 A;  3I64 A;  2BE5 F;  1QVT A;  1DUX C;  1T98 A;  4HV6 A;  1ON1 A;  2K4B A;  1KON A;  2XPV A;  1E3P A;  1RKT A; 
#chains in the Genus database with same CATH homology
 3OOU A;  3IP4 B;  4NUB A;  2WBM A;  5CKT A;  5HVQ C;  2A5W A;  3DLA A;  4NQW B;  3L2R A;  3PJR A;  3H9G A;  2M4G A;  2V6E A;  1D1B A;  4XON A;  3HKZ A;  2XAU A;  2CV2 A;  4E7H A;  2MYS A;  3DKX A;  4XOT A;  3K70 C;  5HOO A;  2L9N A;  2HU9 A;  3EUA A;  1WJA A;  3LSK A;  4J00 A;  4DOZ A;  3IAM 2;  2L9S A;  4YEL A;  1Z3X A;  4XM3 A;  3OYG A;  3A1Y A;  4PJJ A;  2E5N A;  1Y56 A;  3DQV C;  4QPQ A;  3OYM A;  1PJR A;  2MC4 A;  3BC8 A;  3S8P A;  1N78 A;  4CCM A;  4G6T B;  2R7O A;  3OYK A;  4BDY A;  4LG3 A;  1X1B A;  1BR1 A;  1LDK B;  2KMU A;  4II3 A;  2K9M A;  3I3L A;  3C2G A;  2PJR A;  2LRD A;  4X0G A;  3L2V A;  4JQF A;  4E7L A;  4CZC A;  3SDB A;  3KEY A;  3DWL E;  3A4C A;  3D5R C;  2XF6 A;  2VQH A;  2I8D A;  4LIU A;  3UNG C;  4XOP A;  3W3C A;  2CMP A;  1WJB A;  4PFO A;  2DJI A;  4IKF A;  2VLA A;  2OUM A;  4HNT A;  1ERD A;  4ZC3 A;  2FUG 2;  2UWM A;  3LSM A;  2RRE A;  1V5E A;  3SEQ A;  4KIS A;  3PSF A;  1WJE A;  5HLT A;  4PJM A;  3DTI A;  2KRH A;  2UUZ A;  4BQO A;  4D9J A;  4E7Z A;  2DT7 B;  3EUK L;  4XNF A;  4DIQ A;  3OYA A;  4HEA 2;  2WB1 A;  4RLQ A;  1D0X A;  4E6K G;  2W82 A;  3MKW B;  4XN0 A;  4CA0 A;  2LBF A;  3NWT A;  3ZGK A;  4ANJ A;  2VJ4 A;  2XDV A;  3OYD A;  4H4K C;  3ZQQ A;  4BE1 A;  3GBG A;  2F6C A;  1ZEL A;  4XN3 A;  3VDX A;  2DXI A;  4XLA A;  3E0J B;  2LG4 A;  1SFK A;  1FMW A;  3OS0 A;  2IXS A;  3OL4 A;  1X1D A;  4XL9 A;  3OYH A;  3W2W A;  4CCK A;  2VPL A;  4CSW A;  3BLY A;  3CJR B;  2VJI A;  1P9Q C;  2E1M B;  3OYE A;  3DPU A;  3AKZ A;  1DGR M;  3MKZ A;  4B47 A;  3MMY B;  2CUJ A;  2M0M A;  3FBI B;  3VYS B;  4GRI A;  2E1M C;  1WFX A;  1YX3 A;  3OIP A;  2X1C A;  4XMY A;  3CP2 A;  3BCB A;  1WJ5 A;  2Q1Z B;  1PYV A;  2LH9 A;  3MKY B;  3H5R A;  2K5C A;  1TT0 A;  4F52 A;  1IRX A;  4BXF A;  3ZCO A;  1NG6 A;  3K4J A;  3HOT A;  2BVL A;  2HDW A;  4N4O B;  1AA7 A;  2JVG A;  4PFP A;  2XC7 A;  3PNY A;  3DU6 A;  3W2A A;  1N77 A;  3DTK A;  4B43 A;  2OC6 A;  2CW7 A;  4OAZ A;  3OYL A;  3VWB A;  4E7S A;  4XKB A;  4XLE A;  3SZG A;  3RTR A;  4F92 B;  2BW3 B;  1FMV A;  5KCM A;  3VYT B;  1UEL B;  2IS1 A;  2CUZ A;  3OR2 C;  2X85 A;  2V4J C;  4HST A;  2CFO A;  3IUO A;  3OYJ A;  3HUG B;  4BS9 A;  2CW8 A;  4NNJ A;  2DOA A;  2X1E A;  2XSJ C;  1R6R A;  3SYT A;  4AYB A;  4XLH A;  3H5N A;  2E60 A;  2MD0 A;  2HPM A;  4IX7 A;  2W00 A;  2LY1 A;  3TBI A;  3LL7 A;  3BCA A;  4IZZ A;  3U21 A;  4FAS D;  1J09 A;  2ZXI A;  3HL2 A;  2VJ5 A;  2HVR A;  2IGM A;  3DPT A;  4N4N B;  3H9Q A;  4HSR A;  3DEE A;  4AU7 A;  4C9Y A;  4KT6 A;  4EAT A;  2IGO A;  4BL0 B;  4CCO A;  3H0D A;  2Y0S A;  4U87 A;  4HPQ A;  4PJL A;  2AQE A;  2R7Q A;  3HXL A;  4U7B A;  3OL3 A;  1E0E A;  4KJZ A;  3W2V A;  3K4B A;  4B44 A;  4XQF A;  3PFY A;  2RNG A;  2NOJ B;  4Y3O A;  3TMO A;  2JVH A;  3BG6 A;  1D0Y A;  3RPU D;  4BE0 A;  4C30 A;  2W7N A;  2WAD A;  1Y6I A;  3VSL A;  2A6T A;  1MNE A;  1VZ0 A;  2VJJ A;  5FRO A;  4PJN A;  1D1C A;  4PK4 A;  4R79 A;  2V9K A;  2GOX B;  2CV0 A;  2O5R A;  1EA3 A;  2X51 A;  5CPR B;  2Z16 A;  2WAF A;  2K3P A;  4CH7 A;  3S3N A;  3F9K A;  2JA2 A;  2IGK A;  2KHM A;  3H9J A;  1W36 D;  3QOE A;  4B48 A;  3S3O A;  2VXZ A;  3DTE A;  2WAQ A;  3PUB A;  2K9L A;  2IS2 A;  3LFU A;  2WY8 Q;  2V7F A;  2HNH A;  3AFH A;  2AQF A;  1V5F A;  3OMY A;  3ZRG A;  2L2O A;  4BJ5 C;  2BW3 A;  3SEZ A;  3PSI A;  2F5V A;  2VIX A;  3OYF A;  3DU5 A;  4F93 B;  3L2U A;  4HRI A;  2WY7 Q;  1Z3Y A;  3LMM A;  3KYL A;  1OR7 C;  2P0W A;  2KQR A;  2VKD A;  2X1D A;  1UG0 A;  3LSI A;  3RSN A;  2IS6 A;  4DBQ A;  3K4N A;  3LSG A;  2LRE A;  4C2U A;  1X1A A;  4ZDP A;  4D1Q A;  2KRC A;  3J7A Y;  3N05 A;  1YE9 A;  4YRV A;  2R7R A;  3OWT A;  2X6X A;  3OYN A;  4DBR A;  1WJD A;  3S32 A;  2JUG A;  4Y4R A;  4ZTJ A;  2R7X A;  3L2Q A;  2KDO A;  3HPG A;  2X6Y A;  3OYB A;  2X6W A;  3K4L A;  3CJQ B;  1LVK A;  1BOB A;  4CCN A;  1X4O A;  4BU2 A;  4E4H A;  4MLO A;  4B3X A;  2M7A A;  5KHD A;  4BJ6 C;  2HVQ A;  3AL0 B;  1JI8 A;  1UAA A;  3FBN B;  3HOS A;  2HQA A;  2LC2 A;  3A2K A;  4LIT A;  1LKX A;  2KP6 A;  3AL0 C;  1DGW Y;  1HA8 A;  1Z21 A;  2KZV A;  3KX2 A;  1S9H A;  2MFZ A;  2VKH A;  3OYI A;  2JSP A;  4XKC A;  2LY2 A;  3ZXS A;  4AVZ A;  2V26 A;  4OAY A;  1BR4 A;  1DQU A;  2QKL B;  4E7J A;  2VAS A;  2IS4 A;  3K4C A;  4ZYA A;  2GOM A;  1QU3 A;  4BAC A;  1X19 A;  1Z7L A;  1T95 A;  4JOM A;  3QYB A;  4RM3 A;  5HNF A;  4RM2 A;  3OS2 A;  2LYC A;  3ONQ A;  4IQ4 A;  2R7V A;  4XLF A;  2PMZ A;  2E5Z A;  2XF5 A;  4LIV A;  4J01 A;  4CUG A;  4HNU A;  2ZXH A;  3VYU B;  4F3Q A;  4BGD A;  2VQL A;  4BEH B;  4E7K A;  1WJC A;  1D1A A;  3H5A A;  3L2W A;  1W36 C;  3D5L A;  3K4K A;  2RQQ A;  3PNV A;  2R7T A;  4CCJ A;  3HPH A;  2F4I A;  3EUH C;  4RLF A;  1N75 A;  2W1O A;  3CES A;  3OIQ A;  2DT6 A;  2BOL A;  3G2B A;  3K4M A;  1TZL A;  3LSH A;  3PL8 A;  3S3M A;  3ZR8 X;  3CP8 A;  2HPI A;  3D5S C;  3HG9 A;  2VL8 A;  4IQJ A;  3RQ4 A;  2R4G A;  4KIT B;  1DP3 A;  3NWS A;  5LFA A;  2CV1 A;  4XLC A;  4BJT A;  2R7W A;  3FHN A;  2ZFU A;  2M4K A;  4II2 A;  3M8J A;  4E7I A;  2BVM A;  1OLT A;  2MAB A;  2W4S A;  3CMM A;  3CZ6 A;  1G59 A;  2XF7 A;  5JHF A;  2CH0 A;  3K70 D;  1MMD A;  2ZSH B;  3RCO A;  4ZTF A;  3VSK A;  4P1W A;  1WJF A;  5FRN A;  1BR2 A;  3H35 A;  4ZDL A;  3EPZ A;  2HZD A;  2ELJ A;  3CF2 A;  1X1C A;  3QOD A;  2M7B A;  4PSX A;  4RMN A;  1GLN A;  3E1S A;  1V5G A;  3PNT A;  4PUS A;  4XR6 A;  3C2H A;  4F91 B;  4OWR B;  5LD2 C;  1MND A;  4DJA A;  2HVS A;  3MD2 A;  2VQC A;  4C2T A;  3DKY A;  2L7K A;  2V1N A;  3DPL C;  1MMN A;  3M1C A;  4PSW A;  4CCL A;  2R7S A;  2KL4 A;  3OYC A;  4BE2 A;  2R7U A;  4XOR A;  4ZDO A;  1MW7 A;  2M3A A;  5TGT A;  3OY9 A;  2DCE A;  1QHH D;  4P5O A;  2ZSI B;  2Z1D A;  4BDZ A;  2Z2S B;  2LOO A;  1MMG A;  4Y33 A;  2QKM B;  3S93 A;  1X4P A;  5CQE A;  2PJR B;  2Q2E B;  1MMA A;  2UV1 A;  2VB6 A;  5KNL A;  1T0F C;  5HNH A;  3VYR B;  3K6G A;  3UR3 C;  4ZJZ A;  4QPO A;  4NC8 A;  5FRM A;  3FDY A;  4HG2 A;  4ITV A;  2KLO A;  3QYE A;  4XKV A;  3TL4 X;  4BEH A;  4BQN A;  4DGW B;  1YX5 A;  1QHG A;  1K6Y A;  3OR1 C;  4XKW A;  1NG7 A;  2WA0 A;  3FKJ A;  1U0J A;  3V42 A;  5CQG A;  2IGN A;  4YEJ A;  1D0Z A;  1LFP A;  3I9V 2;  3IAS 2;  3BG7 A;  2L5Q A;  3HC7 A;  4FET A;  1SAU A;  2OV7 A;  4NC7 A;  3K10 A;  2KPM A;  4BQQ A;  4F55 A;  1G8X A;  2VQG A;  2CS3 A;  4BUP A;  3QYF A;  3OS1 A;  2VXD A;  1KON A;  2LBF B;  2WAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...