2VQCA

Structure of a dna binding winged-helix protein, f-112, from sulfolobus spindle-shaped virus 1.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
TLNSYKMAEIMYKILEKKGELTLEDILAQFEISVPSAYNIQRALKAICERHPDECEVQYKNRKTTFKWIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL 13.2 KDA PROTEIN
publication title Cysteine Usage in Sulfolobus Spindle-Shaped Virus 1 and Extension to Hyperthermophilic Viruses in General.
pubmed doi rcsb
source organism Sulfolobus virus-like particle ssv1
molecule tags Dna binding protein
total genus 19
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09645 F-112 F-112 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqcA00
2VQCA
chains in the Genus database with same CATH superfamily
2K86A 3E5UA 3DU5A 2GA2A 4MFDA 5ICFA 3TW6A 2NOGA 1FBQA 2WV0A 5J47A 4ENMA 1IXRC 2A6HF 2FE3A 3RQ4A 2A3SA 2M0CA 4C3IJ 1IW7F 2BOLA 2P81A 3A1YA 1DPUA 3CDHA 1BR2A 3FMQA 9ANTA 1JKQC 1A31A 3FXKA 2XB0X 4OAYA 3JAMZ 3PM1A 2Y0SA 3K2AA 1FYMA 3MMYB 3E7LA 2DN0A 1BI1A 2WADA 1ZK8A 3GFJA 3JSOA 4B8XA 1EJ9A 1ETXA 2FOWA 2COMA 3C2GA 3FZVA 3L1PA 3AG3H 1X3UA 4CCKA 1JUSA 5GTHC 1UMQA 4AYBN 1OR7C 4L5EA 4N9IA 4DJAA 3QYFA 1ULYA 2XAGA 3HKZN 3H5NA 3AG1H 4HPQA 3OR2C 4FE4A 4LB6B 2BXZA 5L3GA 4ENKA 1YX3A 3TEDA 5DS9A 1LNWA 5FD6A 4X0GA 4A3DJ 4D0PA 3EPZA 4DGWB 4L9VA 4ZTFA 1VQKI 1QU3A 1A04A 3HHHA 2VONA 3MAJA 5GPAA 3FM5A 4KMFA 1YQAA 4HDUA 4XN0A 2DJIA 1G3SA 3BOQA 3E97A 4S0HB 2XSJC 3CQZJ 3HTSB 5K7HA 4A69C 4RGXA 2KZGA 3L09A 3PUBA 2NOJB 3DF8A 1SD7A 2BV6A 3ULQB 2M0MA 3BDDA 3KP2A 2KDOA 1HKTA 2LK2A 3HRSA 2AXTC 2A07F 3K9TA 4AUXA 4NC8A 2R7VA 1UG2A 5GAEJ 1W36D 4DYCA 2E5NA 2RDPA 1WFXA 4XQFA 3J7AY 3WHCA 2CQQA 2ETHA 3JRBA 2DMTA 2QVOA 1IZ1A 3IAS2 4AYBA 4GYIA 3CCEI 1I50J 3O2PE 2KRFA 4ZDOA 2GOMA 1T6SA 3HKZA 2VJIA 4GDFA 3T5XA 3HSEA 3F8CA 4UV8A 5LGNA 3ZRGA 3KZIC 3BPVA 3C18A 3TO9A 4RDUA 1IXCA 2Z5UA 5IYCJ 4ON0A 2PJRB 2MD0A 2Z9OA 1LB2A 3ZMSA 2DA5A 4DQ2A 4LGWA 1AHDP 3O8HA 4E7JA 5LHGA 3LSKA 4XL9A 4RB1A 2X0LA 1N77A 3WU1B 1WJDA 5FFXA 4HV5A 2Z1DA 2WY7Q 4BAYA 4IVNA 3DKXA 5CYVA 3ZQCA 1ZH5A 4BKXA 2DI3A 1D1BA 4M71A 1R58A 4LIUA 3L2WA 1X1BA 1ETWA 3NARA 4D1QA 2JA6J 1IAWA 1V5EA 3KIOA 4BE0A 2RN7A 2NNYA 4IX7A 2DPUA 3HOYJ 4FISA 2DFFA 3HIFA 2R7QA 4M6YA 2MC3A 2QUFA 1ZG3A 2CUJA 2OCEA 5EDNA 2OV7A 4ZYHA 1IGNA 1OCRH 4RM3A 3BR1A 2GA1A 2KIQA 2RGVA 6PAXA 4PSXA 1S29A 1VQMI 2RVCA 5LFAA 1MNEA 2GWRA 2D1VA 1I3QJ 2VOPA 1UJ8A 3DXJF 1WPKA 3BQZA 2CU7A 3LSPA 3FXJA 4UB6C 3HOZJ 2CYYA 1ZYRF 4HA8A 1S5LC 3IP4B 3FKJA 4XLFA 3QP6A 3JREA 5C4XJ 1TWCJ 3HEFA 5FKLA 1D0XA 4BQOA 2CV0A 2V7FA 3F21A 2EIKH 2WC2A 3S32A 2MABA 1LEBA 4RAFA 2NRAC 2XRLA 3NRVA 2Z33A 1I27A 5L3DA 5EEGA 3FMRA 3M1CA 3G4SI 4IO9F 3KX2A 2M34A 4GRIA 2K4BA 2YPRA 1B1BA 2RAEA 2PLYA 4C3HJ 4RAGA 3S2WA 1O3QA 1FTZA 5M3MJ 3KFWX 1XGMA 3Q0VA 3GYHX 1LQ1A 1EH6A 4AVPA 2JZYA 1LJ9A 1LVAA 4LK1F 2R7WA 3PO2J 4ZDPA 1PP7U 1L3LA 1TZLA 5GPCA 3VYSB 2EZKA 3OYFA 1R49A 2CFXA 2V9VA 3ECHA 4N9HA 2COBA 3BY6A 1STZA 2XSDC 1YFHA 4BBRJ 1GVJA 2BY3A 1R9TJ 3CJQB 3U9GA 1BM9A 1F36A 4G7HF 2YR2A 3V8JA 3TDUC 4FTHA 3IHUA 3ML6A 5F6FA 5LD2C 3CCSI 1OMIA 2ESHA 1X4PA 2VE8A 4CHUA 1R5ID 2GM4A 3IRRA 1CF7B 4P96A 5E79C 1GLNA 2LBFB 5AIQA 1ZG1A 1RUOA 4A5MA 1VQPI 2GXAA 4IOAF 3LFUA 3BR5A 1YRNB 2XPWA 1MMNA 3J80Z 3OYKA 4CZCA 4IHXA 2AS5F 3B02A 2QM3A 2EPFA 2JA5J 4C9YA 3CCRI 1SAXA 3FHZA 2M8EA 1X58A 1WRJA 4W1UA 2ADUA 2EQRA 3A0BC 1XSVA 3PNYA 2VODA 3CO7C 1QPIA 4EVIA 2HQRA 3FBNB 1PUFB 1OQYA 2GQQA 2LY1A 2BY0A 1R7JA 3K4JA 2KZVA 5ILSA 2I10A 1LPQA 3SDGA 4XBFA 2FSWA 3EETA 3G1OA 4E7ZA 2F5CA 3R4KA 1B59A 1YRNA 3EUAA 2JVGA 4ABZA 4KIBA 5ILUA 2EJRA 1ZRFA 5BS6A 3H9GA 1QGPA 2M4KA 4I76A 2ZMEA 5LRSA 5J4YA 3OWTA 4F92B 1UHSA 2D5VA 4P55A 3KP6A 3ABTA 2HXIA 1UELB 1HSJA 2XUBA 2DFHA 4QLCU 2PBIA 1S9HA 2JTVA 3I0TA 5F1RA 1PUFA 2CS3A 4HRIA 2QF7A 1POGA 2AO9A 3LSIA 4UVAA 1MNDA 1WGXA 4UUTA 2KKOA 3OSFA 2LF7A 2DQRA 2V6CA 3K10A 2VB6A 1FLIA 1FOXA 1W7PB 4I09A 2GOXB 2VKVA 3MKLA 3GFLA 4ZYEA 4CSWA 2QBYB 1HQCA 5IOZA 3ISPA 2BXYA 1G4DA 3OL4A 1JHHA 4BJ5C 4XLNF 4CCLA 1UHWA 2R7TA 2QQAA 3HGGA 4ZYAA 1IRXA 2RNGA 4Z2YA 3V7SA 4YEJA 1ZRDA 4XR6A 4BS9A 2HVSA 3WU0A 1P6RA 3LQRA 2PEXA 3X2QH 1IUYA 1WKMA 3VFZA 2KIFA 2CQXA 1G6NA 4B4CA 4A6DA 3H9JA 1YW8A 3MD2A 2FMYA 3M8EA 1R5GA 5E1WA 1G3YA 3GTKJ 1SEUA 2LNBA 3WE3A 2CGPA 3TQNA 2KISA 1BL0A 3Q9SA 4KT6A 5JHFA 4BU2A 4HSRA 3K4NA 2HPIA 4MQ9F 2DQLA 2MA3A 2NYXA 3GZ6A 2PMUA 2X85A 3ZMVA 3SXYA 2O8XA 4HX7A 2E34A 2CUFA 4XM3A 2ZFWA 4Y17A 1C0WA 1X3WB 2BY1A 2D2WA 2ECBA 3OYLA 2R7DA 2P4WA 1MZBA 3H5AA 1D0YA 1TC3C 3QPSA 3ZN0A 1QQIA 2E35A 2ZXWH 4AIKA 1S72I 1K4TA 1T98A 4OMZA 3I71A 3RQIA 4FCYA 2VL8A 3DBLB 5GTIC 2KL4A 2WV1A 4G6TB 2UWMA 3I3LA 4LLLA 1USTA 3GMEA 1QZYA 1FNNA 2KJCA 4C2MJ 4UY8I 2DO7A 3S1MJ 1IV8A 1J59A 3HDDA 4A6EA 4IOCF 2CV1A 1IRFA 3I4PA 3L2VA 2A68F 2H09A 1CQTA 2HDCA 1VQ8I 4RA2A 1MSFC 1J09A 1BI3A 5J40A 3OYGA 3FKIJ 2JA8J 1Y0NA 5KHDA 3RYPA 3GTQJ 5A2QZ 4MEYF 4FHTA 4IRHA 1SVOA 1YE9A 3E5XA 1USSA 4B09A 3LWFA 3A01A 3NWTA 4ZYDA 4IRGA 3WTUC 2CMPA 5IYDJ 2E2IJ 1W4MA 1RNLA 2DA1A 4CDGA 2XAJA 3BR6A 4HSTA 5EJCA 4P5OA 3ROUA 3LA3A 3WGHA 4A3EJ 3OSGA 1TNSA 4BNCA 3E3VA 3WU2C 2A05A 1VQOI 3M07A 4G6QA 1FYKA 2M8GX 2IJLA 3L7WA 3HPHA 3MVPA 1W5CC 3OYCA 3COAC 2IS4A 4B48A 1E2XA 5B66C 3I5UA 3KP5A 1OLTA 4UV9A 3J81K 2K9SA 3OIOA 5JLXA 2IGKA 3BT9A 3DTIA 1Z7UA 3JRGA 5FLXK 1SAUA 1VTNC 4NBQA 3QWLA 2QSFX 2F2EA 3OYNA 2DPDA 3PO3J 1R1VA 2NVQJ 1R23A 1ZG5A 4XONA 4PGHA 3BZCA 2XB5A 2IBDA 1ZREA 5E8IA 1B4AA 2QQ8A 3WODF 1SD5A 4EATA 4EGYA 2ZJ2A 2BHYA 3I58A 5J6XA 3RIRA 1MBFA 1X1PA 4ASNA 3S1NJ 1TT0A 4XOPA 4EM0B 1K78B 2LKXA 4IJAA 1K6OA 4DZPA 1ERDA 2MH9A 3NWSA 5ED4A 3CMEI 3GTLJ 3KE2A 1KU7A 1I1GA 1W5TA 4EJTA 1VFCA 1LUJB 2AQFA 1FSHA 4ANJA 3LAJA 1Z21A 2L5QA 1R6RA 3JAMK 1V54H 5DYMA 4IQJA 2WAQN 2XF5A 4DYRA 5FJ8J 1OR7A 1Z1DA 3J7YJ 5E3LA 3LNQA 5B3SH 1J75A 2V1DA 3F3XA 4G7ZF 1DGRM 3GVAA 4BEHB 1PUEE 5DUIA 3CP8A 3KEYA 3OIQA 1JKPC 2Y48A 3S2HJ 3I56I 3DFGA 5E3OA 4WF2A 3FBIB 3U1KA 3DCFA 4NC7A 4WX9A 5H20A 2YX7A 3BG9A 4OINF 3SQNA 3FXMA 1VQ5I 2VJ4A 4G7OF 3EUKL 4BL0B 3RZDJ 3SYTA 2L7KA 1WI9A 2OD5A 3WTXC 3BG3A 4JQFA 4BEHA 1HW5A 3QODA 2RQQA 1WCMJ 4RLFA 4E7HA 3FK6A 5K5RA 1F9NA 4AC0A 4I99C 3ELKA 1UHMA 5HOOA 2PJPA 2WAQA 3HB9A 3AKZA 3TOBA 2E7WA 1B9MA 1O3RA 1ETKA 3K4BA 3GUDA 4S05A 3QPLA 4XMYA 1R71A 4RB0A 2QZ8A 3A0HC 2B63J 3EQLF 2H6CA 3WTYC 3GF2A 2DDAA 2XHKA 3VODA 4IQ4A 3MEXA 4D9JA 2XV4S 5FGMA 5F0HA 1P92A 1HCRA 2JK3A 4UUSA 1OJLA 4LLNA 2HEOA 2R3SA 1BW6A 4EJVA 4L9JA 1IG7A 1XX5A 4AU7A 2ME6A 2Z3YA 3DU6A 1FC3A 1BOBA 3S3OA 3OMYA 3A2KA 1U6GA 2NVUB 2L54A 3RSNA 1U8BA 2K9MA 3F22A 3IH4A 2B7EA 3RI4A 3Q0UA 4R1HA 1ZELA 2CQ7A 2Y31A 4NUBA 1TQIA 4KDPA 4ESBA 2OAZA 2X1CA 4L5JA 5FRMA 2HOTA 1MH3A 2WBMA 3OV8A 1E3PA 2WA0A 1HA8A 3JRDA 1GT0C 2X4HA 4BY1J 2RNJA 2DCEA 3RPUA 1KU2A 3WE2A 2XROA 5EG0B 3REOA 4PUSA 4UUVA 1QO0D 1F5TA 1O4XA 1B72A 2ZB9A 1MMDA 2JN6A 4DIQA 2Z16A 1Z67A 3BJAA 4PGGA 1B9NA 1YYVA 5HLIA 4XRSA 3L2QA 4XICA 2XAUA 3CMMA 1K61A 4XKCA 1DUXC 2JT1A 2OU2A 2RC4A 3QP5A 1V5FA 3OYBA 5B1BH 2OQRA 3HM5A 4YFNF 2VT2A 4I01A 4CA0A 3UKGA 3F8BA 2VJJA 2CUZA 1FSEA 1SD6A 5GAGJ 4RGSA 4IEJA 3H36A 4CCMA 2QCOA 1YS6A 1BJZA 5C3EJ 2JMWA 2DOAA 5DM7F 2BGCA 3V4GA 2VJ5A 1H0MA 3K6GA 4ZJZA 1OCPA 2W82A 1RZ4A 1N78A 4Y7NJ 2HWVA 3ZQHA 4A3FJ 2LOOA 2D1HA 1SMTA 3ECOA 4LJZF 4CYCA 1J5YA 2Z2SB 3LSMA 4LITA 2VIXA 1X19A 2QEXI 5KCMA 3J7ZI 1T08B 1FMVA 2LTPA 2X6XA 5GAHJ 3ZR8X 4F7ZA 4EM1A 4TV7A 2FQ3A 2GBYA 2R7ZJ 3MCZA 2ZJPF 1RUNA 1W36C 4RGUA 3K1MA 1AWCA 1ZN2A 2ZC2A 4ZZLA 1A6IA 3G73A 5BNGA 2DFEA 3BTJA 3CCQI 5IT3A 2GXBA 3RZOJ 4XN3A 2LLKA 3PNTA 4IF4A 5CVVA 2BYVE 2O61A 1LEAA 3IRQA 1R4NB 1FX7A 4JBAA 1T56A 2K02A 1YJWI 2IS6A 3CC2I 1I39A 4E7SA 2M9HA 2CWEA 2NS0A 3FDYA 4PSWA 3CCMI 1V55H 3BG7A 3E1SA 4FX0A 2HFHA 1T33A 2XAHA 3I9V2 2M2EA 5E1ZB 1S7AA 2L9SA 1H9GA 2KP6A 4QPOA 5AONA 3D0SA 4I6ZA 2F5DA 2M87A 5D5XB 2NVXJ 2PQ8A 2M4GA 2GXGA 3J80K 2JWTA 3O6BB 1E3HA 3QOEA 3VOEA 3RTRA 2QENA 3L2RA 3QU3A 2WWYA 2OF7A 4LK0F 1WJBA 4XOTA 2G7HA 5BPIA 5ICEA 1N25A 1SANA 1UB9A 3EYYA 3PIOF 3Q0WA 3RKQA 5K5QA 1VQ9I 3T8RA 5IPAA 2DMUA 3SFZA 1PVEA 1Z91A 2EFNA 3D1NI 2W48A 1ZARA 5L3EA 4IZZA 4G9YA 4BHCA 2MC4A 4Y33A 3SZTA 3I64A 2KMUA 5HLHA 1S8NA 4ENNA 5D5UB 3JRAA 4A12A 1REPC 1IRGA 1DP7P 3LFKA 3SJMA 5HVQC 1MNMC 4V19K 2YS9A 2F48A 1JI8A 1NTCA 3C2HA 4OOIA 1IDZA 1RIOH 2XKOA 1TQMA 1FJLA 4C2UA 3K1NA 2CSOA 1RETA 5TRDA 2O6GE 1BR4A 1PJRA 1RR8C 4IHSA 1IRZA 4P1WA 1QHHD 5L3BA 1KQ8A 4M9XA 2H6BA 3TGNA 2LRDA 1I5ZA 2M45A 3L9FA 2PJRA 4BHBA 1IO2A 4V2GA 2ICWG 4ZTJA 1DU0A 3F8NA 1M1EB 2XGDA 4JX6A 2VQHA 1ORKA 4D7NA 2KRCA 4PJNA 4XKWA 5LRRA 3I55I 3RCOA 1YIJI 1KU9A 2PX9A 1VQ6I 3ERED 5KVRA 3MFKA 2A61A 4BH9A 2AHQA 4EJWA 2L4MA 4O6JA 3MZHA 5FROA 4XRMA 1OCZH 4G8XA 1ON2A 1SVMA 1QNTA 3QPHA 4KA4A 5JFRA 1FBUA 1ZR4A 2E1CA 2TRTA 3OYAA 2X1EA 3Q5FA 2EZIA 1G3WA 3BWGA 1XD7A 3KLNA 4XSZF 1VF9A 2L7MP 4HX4A 1MDMB 1K79A 1Y0UA 2W57A 2VPRA 3QYEA 2NNNA 2XPVA 4ESJA 3KEOA 2WY8Q 1DPRA 3IWFA 4CUGA 3OS2A 3GZNB 4MLOA 3GTGJ 1YX5A 4HV6A 2HOSA 4YELA 5M5WJ 2GIZA 2CW0F 1ZLKA 1GDTA 2QKMB 4C2TA 3JRFA 5D8LB 2K9NA 1YJ9I 2C6YA 4AVZA 1D5VA 2L7ZA 1TWGJ 2M7BA 1XSDA 4RS8A 2F5VA 3W6JB 1QBJA 3DPUA 2ISZA 4GO1A 1BJAA 3JRIA 4GFBA 2OTJI 2W24A 2Q2EB 3CJNA 3NAUA 4EM2A 2LR8A 1RKWA 5EZHA 2DFIA 3QRFF 2E1MC 1XN7A 1FZPB 2HU9A 2D45A 3GFMA 4M3EA 2Y9ZA 2HDDA 2E71A 2ZXHA 3TDZC 5E17F 2VXDA 2XVCA 3OS1A 4KN7X 3QU6A 3TP0A 3LAPA 4ITVA 3N4MA 2JA2A 4KFCA 2CJJA 3MZ8A 4YIFA 5FKMA 2LY9A 2Y2ZA 4LIVA 4KIFA 2R7RA 2AQEA 2QSHX 1X1CA 2X48A 3WHBA 3AG4H 3BP8A 3CF2A 1Y8QB 2L3DA 3T0YA 2EFPA 5A2QK 5FRNA 4M3FA 5CQGA 3DTEA 1D8KA 1Y1VJ 2V9KA 2CQNA 4KT5C 5DD8A 3MWMA 5IP9J 3MKYB 1EH7A 4I2OA 1JKRC 1CF7A 3F8MA 4WXCA 3M4OJ 5HNFA 2LBFA 2R5YB 4WCGA 5H6RA 1IJWC 1TW2A 1VZ0A 2B0LA 2W84A 3KPHA 3EYIA 3K1PA 5FLVA 1JUMA 3WG9A 4B44A 3GXOA 2K9QA 5J1YA 1R1UA 3DP7A 1A36A 4DW6A 3CLQA 3ONQA 2OTLI 1DP3A 3FIWA 1CGPA 4LD5A 1Z05A 3M8JA 4BXFA 1AA7A 2P5LC 4XLEA 1EV7A 2JJ7A 2BHZA 4X6AJ 4FE7A 3BROA 1BC7C 2QA4I 3E6CC 2KT0A 3CUOA 3TO7A 4HNTA 4BGDA 2R92J 4A3LJ 1FP2A 1LFUP 2R5YA 2X6WA 2K7LA 2O0YA 4NQWB 3HBLA 2O3FA 1X3ZB 1T95A 4D5CA 2LKSA 1G3TA 2OQGA 1W0UA 5CVRA 4QPQA 4NHJA 2JUCA 1HXDA 2Y75A 3PJRA 1YW7A 2ECCA 4YFKF 4MIMA 1U3EM 2LY2A 4I7HA 1SFOJ 4S04A 2E1NA 5IT9Z 4N0BA 3S3NA 3W6KB 5K1YA 1R1TA 2NS7A 1APLC 3BC8A 4YFXF 3ZQGA 3F9KA 2W4SA 3ZMDA 2BE5F 3SZPA 1Z0XA 1DDNA 2DW4A 4BXUA 2ISYA 1R4MB 5DCFA 5HS9A 4OIOF 4BHPA 3F8FA 2Q0OA 4MEXF 2K4JA 4NQWA 2FD5A 2L2OA 4MQVA 1W7PA 2YX4A 3U2RA 2QBYA 1IN6A 1XSXA 2X6YA 2YSRA 3B6CA 1YW9A 2A5YB 3E0JB 4Q48A 4B43A 4J19A 2R7FA 1ENHA 4XORA 1ETQA 2XDVA 2H27A 2DYSH 3E6MA 2W7NA 3IWZA 2V1NA 1XMXA 1HKQA 1ZQ3P 4M6XA 5DV5A 4AM3A 1X2NA 1JT6A 3F23A 3TMOA 2QYOA 5L3CA 3K70D 4Y4RA 1P4XA 1R00A 2W00A 2P0WA 4FQGA 2IVMA 1HW2A 4Y3OA 3BTLA 5HDKA 1IUFA 3MKWB 2ELJA 1JT0A 3SFIA 1RI7A 2L9NA 4EQQA 2MLGA 3HOSA 4BXXJ 3MZYA 2CV2A 2EIJH 4CZZA 1WQ2A 3L2CA 5HS7A 3TP3A 2HOEA 5AIPA 1F43A 2JSPA 3CDLA 3IC7A 3QOPA 4U7DA 1UZCA 2DA2A 1PYVA 1ETOA 4LFUA 4IRIA 1E0EA 4HQMA 1K7AA 2L9VA 3KYCB 3ABLH 4U88A 1MKMA 1JE8A 3EUHC 3V7RA 5EEHA 1QVTA 2CO5A 1R5HA 4MTEA 1R22A 3V8LA 1HKSA 3OOPA 4OIQF 3FF5A 1Z9CA 2L01A 1KYWA 4PZJA 3TOAA 5E3MA 4H0EA 1XG1A 2V1XA 2E5ZA 2DXIA 4O3MA 2YU3A 2Q8KA 4B3AA 1SFUA 1MJBA 2KLOA 5CJ9A 3A4CA 3ZXSA 3JTGA 1T8IA 3PIPF 1TQPA 2OBPA 2W1OA 4ZH4F 4E70A 2PI0A 2DMQA 2KJBA 5HDNA 1QHGA 1D0ZA 2O7OA 5LEJA 2IEKA 3OY9A 1VNDA 3WTTC 4ZDLA 3K4MA 2OZ6A 2M1BA 4YIIA 4AD9A 1LDDA 1JJ8C 4FASD 4YRVA 4DBRA 2QSGX 4ZC3A 3GW2A 2VI6A 3T8TA 3AAFA 3OOUA 3BPXA 2ZFUA 4FETA 1HW1A 2P7VB 3DLAA 2Q1ZB 5LBQA 4JOMA 1I6XA 3QYBA 1P7JA 2H1KA 1L0OC 2EFOA 5KAIC 3WG7H 1IC8A 2AXLA 4BYYA 2X1DA 2VC1A 5B1AH 3I54A 1T0FC 3MQ0A 1PDNC 3LMMA 4QWQA 2BW3B 2XF6A 4UVBA 5HLTA 3JTHA 4B3XA 3KZYA 2BVLA 5CQEA 3ZQ7A 1RC9A 2A6TA 2HYJA 3VYRB 4HLXA 5D5VB 2FXAA 4ZYGA 1P4WA 3LQQA 2O9LA 1ETYA 2RQPA 2CQKA 5IY5H 4KYWA 3GTPJ 3BR2A 3RDIA 5FKNA 3D5RC 2F6CA 2QLZA 2FNPA 3IH3A 1DU6A 4H4KC 2K3PA 4IPAA 2R7OA 4Z6YA 2XAFA 2MFZA 2E36A 5B5EC 4CICA 2ZMEC 3K4KA 2HR3A 3CUQC 2QQBA 4LB5A 1O7LA 2BW3A 2IGOA 3J7AO 4BQQA 2EA2A 1TW3A 1WI3A 1YS7A 3ASOH 3G2BA 2K27A 5F04A 4CYDA 1P7IA 3ZQFA 4RBOA 3GLLA 3JW4A 3HOVJ 2MD5A 2CW7A 4HF0A 3OYHA 3W2VA 2FRHA 1DQUA 5M5XJ 2ZJQF 4DZJA 2FEZA 3ZGKA 2JPCA 4II2A 3WTVC 1VQ4I 1OYYA 3BG6A 4HNVA 1G59A 4A5NA 1K78A 1XB4A 5GP9A 2H8RA 3HPGA 4P9FA 1I3AA 1LKXA 3PFYA 2IAIA 2G0EA 3CZ6A 3ESWB 1BI0A 2KQRA 2CRGA 3CTAA 3SHFA 1MJAA 1WSUA 3GX4X 1ETVA 5FLMJ 1NG6A 2XGEA 3KLOA 4MTDA 2LMDA 3BTIA 4BBSJ 2EBIA 2VPLA 2I5UA 1F4KA 2Y0MA 2V79A 1WJFA 1Z3XA 2EFWA 4AIJA 3DEUA 5HDGA 1AKHB 4IHWA 5ICGA 2JUGA 1X2MA 2OPTA 1HDDC 2R5ZB 2PFBA 1V4RA 2IS2A 3LSHA 1ZGJA 3HHGA 1FIAA 2P6SA 2IGMA 5C44J 3M9AA 3LL7A 5C4JJ 4M73A 4E4HA 4ZZDA 2DTRA 4L9TA 4HF1A 4R79A 3A02A 4GXOA 4IHVA 1S3JA 4CCNA 4DYQA 1KA8A 1VQ7I 1XMAA 5KK1A 3AFHA 1MGTA 1ZTRA 4PDKA 1UFMA 2M5WA 2V26A 5DUKA 4BY7J 3PNVA 3CCLI 4A3CJ 1FT9A 2EK5A 2DK8A 1J0RA 1D1AA 4E6KG 1Y39A 2LG4A 1PP8F 1O7FA 5DM6F 2STWA 4WK8F 5LGTA 4A2UA 1JTYA 1WH7A 1RRJA 3LSJA 5DDGA 2V4JC 2L9RA 3QAHA 4U7BA 3I59B 3IL2A 4A3MJ 3CLOA 4N4OB 2VQCA 4EMSA 4OIRF 4IKFA 2VE9A 1WH5A 1GV2A 5D4RA 3OYMA 4WXHA 1SFKA 3JR9A 1HLVA 5FKOA 2JPBA 3HRUA 1XC5A 3E6DA 1LE8B 4DNCA 1TWAJ 2OJED 2EIMH 2F4IA 1IN7A 2FF4A 2VKEA 1S7OA 3IH2A 1H88C 3CJTB 3BJOA 4UB8C 4J01A 1JUPA 3I59A 1ZAOA 3ZQIA 1U2WA 5F0FA 3C1DA 4ESFA 3ABUA 3DPLC 5K7FA 1JGSA 2ID6A 2N8GA 2Y69H 2CUEA 1BC8C 1W0TA 1SFXA 1W5SA 1U8RA 1LVKA 1FP1D 1U5TC 1YIOA 2Y30A 2XGXA 4I0BA 4HZFA 5HLGA 4BDZA 2E2HJ 3AL0B 4F91B 2EB7A 1LE8A 4BE1A 1UCRA 2LH9A 3OYIA 3OR1C 5FLXZ 2M30A 4XLAA 1MBHA 1S6LA 2DA6A 3Q9VA 1B8IB 2BVMA 1Z7LA 3CC4I 2LREA 4JX5A 3D5SC 2HGCA 2GIVA 5EG0A 1KYZA 2G7UA 4CGZA 3KYLA 3I4MJ 3LA2A 5HODA 2OCCH 3GCMA 3R0JA 1TTYA 4F93B 3WTZA 4L5IA 2E1MB 4EV0A 2XIGA 1G8XA 3QPTA 2OZUA 4EJUA 1QZEA 2HKXA 5D5WB 2ID3A 3DPTA 4RLQA 2RV8A 4IXAA 1X1AA 1BW5A 1B8IA 2VBZA 1HC8A 3BG5A 3P9IA 2ZSHB 1JGGA 3K4CA 4R8HA 3M3YJ 3N05A 4RB3C 4HLYA 1XMKA 5IP6A 1RESA 2EV0A 4HEA2 3NEUA 2H1LA 3ZQLA 4KUMA 4RAZA 4EEFG 4EGZA 4A3JJ 3GTMJ 1ITYA 2FBKA 2VKHA 5FB2A 2DODA 4HDVA 1XTAA 1HDPA 5BOXA 5CPRB 4PJMA 2XPUA 1QPMA 1TP4A 3F6OA 5F27A 3PQKA 2F5FA 4LG0B 5J3LA 2P8TA 1JTXA 3V8KA 4XIDA 1J9IA 2PN6A 4G6DA 4GGGA 5L3FA 3S14J 4EJOA 5LLQA 2ZBKA 2L0KA 4Y52J 2DOEA 3ZMUA 1LDKB 1OYWA 3I53A 4MHGA 5D4SA 3HG9A 4FX4A 1O3SA 5BPDA 1BIAA 5IYBJ 5E1XA 3F72A 3VB2A 4FT8A 1YITI 2EILH 1Z77A 1YHQI 3CC7I 3IUOA 2HNHA 2V1UA 4HQEA 1YTYA 1JJ6C 3ABKH 4KMUX 5HS8A 4A3GJ 3CESA 3FISA 4A3KJ 3IV5A 4LG0A 3SEZA 2A6EF 3HGYA 2MBFA 1NHAA 3VSKA 2DT7B 2MSYA 3E5QA 2ZKZA 1TWFJ 5E20A 4LOCA 5FFZA 1ZLJA 2M3AA 3ABMH 3M7GA 3AG2H 2V6EA 1Q1HA 2HVQA 1BN5A 3L00A 4M9ZA 2EINH 4KITB 3TW7A 3H1CA 3LSTA 1FYLA 1MMGA 2DU9A 2HYGD 4CXFA 2DA4A 4PJ0C 2FX0A 2X51A 3LSGA 5EF6A 2UZKA 4RAYA 2FA5A 2VQLA 2LDUA 2PMZN 5J8FA 4QTRA 2DTZA 5LHHA 3S2DJ 5CVUA 5KAFC 3CDIA 4ENJA 5EEAA 3FHNA 2HYFA 2XAQA 2FUG2 1T39A 3V42A 3KP3A 3HOUJ 1J7KA 2UV1A 3IKVA 1D8JA 2PMHA 1D3YA 5IT9K 2IA0A 3N97A 4BE2A 4HOBA 3DQVC 1Y56A 2MW8A 2PG4A 2QKLB 3FMSA 1MBGA 2UUZA 1ZGAA 1P2FA 3WTSC 4BJTA 1ZR2A 1T2KA 2EA4A 2YU9J 1GV5A 1Y6IA 3DKYA 1KONA 4WXDA 1P9QC 1NK2P 1T38A 1OYIA 3FXOA 3BLYA 5CKTA 3DLLF 5EZGA 5DD4A 1P4AA 5KNLA 2ELHA 2Z99A 5F64A 2E19A 4XRSG 2XRNA 2P5KA 1KQ9A 2F4OB 3T1BA 2BEOA 1MBKA 4Y15A 3H35A 1BBYA 4W97A 3H3UA 3HUGB 1VQNI 3JRHA 1OCCH 2PMZA 3HJEA 3VPRA 1WJ5A 2HQNA 4QSHA 2O5RA 3BR3A 3DBRB 4XKVA 1Z6TA 3HSRA 3AL0C 3VDXA 2EV5A 1ON1A 2XKPA 3M8FA 4AIDA 3G3ZA 1X1DA 3DEWA 4A3BJ 3BZ6A 2DOFA 3BQYA 2KDZA 1X4OA 4PK4A 2M7AA 3G1LA 3ZCOA 3V7CA 3GWZA 1WWXA 3EUHA 5JLWA 1ZRCA 2IW5A 1EH8A 1MDMA 3HZJA 3MKZA 2EV6A 3JCUC 3CMYA 1GHCA 3HUGA 4A0YA 4UVCA 1MSEC 3RPUD 3GEZA 5ILVA 2Y9YA 1WHUA 1XGNA 4HF2A 4YG2F 3GTJJ 2IA2A 3VYTB 3CF5F 2KFDA 3DTKA 2R93J 3HOXJ 2ESNA 2KPMA 3C2BA 2DMPA 1IN5A 5IP7J 4I02A 1XPXA 3CCJI 4NB5A 3BCAA 1K83J 4PCQA 3CJRB 4E7KA 1FEXA 3BR0A 3OL3A 1TL8A 1E3OC 2MYSA 3PUFA 4LLGF 3H9QA 3PL8A 3LOCA 1MBJA 5ERIA 1U78A 3VWBA 2R7UA 1BI2A 5E8GA 2ZXIA 3WTWC 4NDLA 5GADJ 2VT3A 4D5FA 2FU4A 2Q2EA 2JQ7A 2P6TA 3HOWJ 5F1JA 2CG4A 2ZXJA 2ELKA 1IDYA 3L2UA 3TL4X 5JVTA 1ZKGA 1OISA 2ZMEB 3HTUA 5JR3A 3HXLA 2GAUA 4P9UA 5LEKA 3P9CA 4IHTA 3CUQB 1K4SA 1SD4A 1T0FA 1J2XA 4AWXB 1FOWA 2J5PA 4E7IA 1HSTA 1YO5C 3TO6A 1QVUA 2EZLA 3S17J 1F1ZA 1D5YA 2H8WA 1HOMA 5F0CA 1K6YA 1TNTA 1WVRA 4LMYA 4A93J 2FBIA 2OA4A 2F4MB 2FNAA 1MH4A 2W85A 2FQ4A 3P5JA 4DBQA 3FX3A 2A5WA 2VUMJ 2P5VA 2E7XA 2LYCA 3CUQA 5FD5A 2GLOA 4KN4X 3C3WA 4GCVA 3K70C 3K0LA 3VSLA 5EGOB 2ZCWA 4MO7A 3R61A 4XRFA 3U21A 2OUMA 3S93A 5D6FA 1FOYA 1I6HJ 2HVRA 2E60A 2NVYJ 3DEEA 2K9LA 3O3KA 2VBXA 2L4AA 5H6QA 2R4GA 3HRTA 4XLCA 3U1DA 4RM2A 4L18B 3ZP5A 2UXXA 1Z3YA 3P7NA 1TBXA 4M3BA 3S1QJ 3P9KA 3WGIA 3JSPA 1GVDA 2VBWA 1KZHA 1JHFA 5DCMB 4A3IJ 3GBGA 1S7EA 4UNOA 4MGRA 1JXSA 3FXRA 3PSIA 2MH2A 3BJ6A 3BCBA 5EGOA 2NXNB 2IPQX 3GZ5A 1A6QA 4IL6C 4U0VA 1IXSB 5F08A 2LKPA 4RGRA 2DT5A 2VKDA 4KIGA 2BBYA 1KQ0A 4F52A 4IHYA 3LA7A 1IN8A 2G9WA 2LF8A 4D7MA 1TWHJ 4RMNA 4HX8A 4MFEA 2QWWA 3CCYA 3RPQA 4BJ6C 4BDYA 4U87A 2JA7J 2VASA 1YLFA 3GO5A 1YOVB 2EZHA 5J8CA 4I0AA 4A0XA 3H5RA 5DCMA 1MJ9A 3DKWA 2HXOA 1H8AC 4ETSA 2GZWA 3G1MA 5M3FJ 4BQNA 4NNJA 2VC0A 5ICCA 3OYJA 1KU3A 3S8PA 4HNUA 3RKWA 2X6OA 1H89C 1OFCX 4CH7A 1EA3A 3K4LA 1YG2A 2R0QC 1LFPA 2DA7A 3FXQA 3W2AA 4PJJA 3H0GJ 4JP0A 5K7ZA 4M6VA 4HAMA 5E3NA 1OPCA 3UNGC 1A5JA 2DJNA 3FWEA 1UG0A 2K85A 3A01B 4CCOA 1MW7A 5J4VA 3RKYA 3HOTA 4Q47A 5H2FC 2NVTJ 2JRMA 3CO6C 3ZMZA 1BOAA 1KGSA 3DWLE 4N4NB 1FMWA 3R6SA 1U5TB 1GXQA 1XCVA 2BZTA 1NK3P 1XS9A 2ZNYA 1AOYA 4A0ZA 2FBHA 3H3ZA 2HQAA 2HS5A 4OWRB 3BTCA 1V3FA 4OAZA 1OCTC 3W6VA 3IKTA 2STTA 1FPQA 4JX4A 5TGTA 4CO8A 4C3JJ 3ERMA 2KIMA 4HYEA 3OYDA 1IF1A 2E2JJ 1DGWY 3S16J 5HNHA 4KJZA 3ZN1A 2HZDA 4C30A 3ZMTA 2XASA 4OMYA 4B47A 2WB1N 2H94A 4LG3A 4U0WA 3KP4A 5DEQA 2EH3A 3JRCA 2RREA 4UHTA 2CFOA 1LDJA 1U5TA 3S3MA 3B6AA 1AU7A 3W3CA 3S15J 2DA3A 3FXUA 1MIJA 3GFIA 2IXSA 1ZGWA 2DMNA 1MBEA 2XGCA 2YUSA 4AIHA 4Q4ZF 1FWZA 2K5CA 4UXNA 2LVSA 3DV8A 1Y8RB 2RKHA 2CW8A 1MMSA 4M9SA 2MGQA 4M72A 2O03A 1HF0A 1XGSA 1BIBA 1QZZA 3F0CA 2HDWA 3H3VK 4Q5SF 3W2WA 4XKBA 2HI3A 4G94A 4K2EA 4CCJA 4OIPF 2DK5A 1A35A 2A69F 4M74A 3GTOJ 2L02A 4M3DA 1GUUA 3FXLA 4Y13A 3CCVI 3O8GA 3OYEA 5M5YJ 2DYRH 2IRFG 4J00A 2DAOA 3D5LA 3HL2A 3ZPLA 5CVJA 2IA1A 3NQOA 2F5EA 4YIRX 1YI2I 5FO5A 1Y1WJ 1TT5B 2LP0A 5CLSA 1OCOH 3G6EI 2WB1A 1ODDA 3K2ZA 4XK4A 4BQAA 4L0ZB 4B1RA 2DBBA 1FTTA 4G12A 1RR7A 4KISA 3A03A 2L7FP 1SC7A 3FM3A 2VN2A 2V9PA 3HSFA 3KETA 1U0JA 5TJJA 2TCTA 4WWCA 2ACJA 1V5GA 3C7JA 1RPWA 1E17A 1EF4A 2R7SA 5CVIA 1XDSA 2HOAA 3RJPA 4L9NA 3HRMA 3SZGA 1SFEA 2DLLA 2HPMA 5EYRA 3Q3SA 2LD5A 1ACIA 1I1SA 3S1RJ 3RYRA 3M1EA 4JK1X 3PFIA 5JHUA 4V2FA 1EKEA 3K69A 1R36A 5D8KB 3RKXA 3IAM2 2QGUA 5D6EA 3ZOBA 1FOKA 1OKRA 2VOOA 3KYDB 1FIPA 1O3TA 3CCUI 2UXNA 2ZNZA 3ZQQA 3H0DA 4KNYA 3KEQA 2FJ1A 3R60A 1U9NA 2XF7A 2FMLA 2IGNA 4NC6A 3KP7A 3SEQA 1B6AA 4MNUA 1XCBA 2NS8A 3UR3C 1BA5A 1ZHFA 3CMAI 4QIWN 3R0AA 4RB2C 1FBSA 4UUSB 3HC7A 5BMZA 2JSCA 1XGOA 1WJEA 2O8KA 1D1CA 2E1OA 1RKTA 4O5VA 4U0YA 2I8DA 4PJLA 2VLAA 1W7PD 3K7AJ 1AKHA 3WGGA 3I4NJ 1WJCA 4F3QA 1IN4A 2R5ZA 4BACA 1YJNI 3FK7A 2KRHA 2JRTA 2OC6A 2X9DA 4PFPA 2W25A 4XLPF 4OU0A 1ONVA 4KICA 3G71I 3MN2A 1QA6A 3DBHB 1SMYF 4X1EA 1Q1VA 5LHIA 2IS1A 3B73A 1GXPA 1IV6A 1XDUA 1HBXG 5TISC 1VQLI 2IT0A 4HW0A 3E6BA 2LC2A 3HYIA 5DTDA 2KHMA 5JI6A 5JVGF 1BR1A 3VEPA 2HKOA 3PQJA 2MLKA 3PSFA 1O57A 2WTEA 5E18F 5BQTA 1WZ2A 1UAAA 1W1WE 5LGUA 2KIUA 3SDBA 3TKYA 3LSRA 2MG4A 4HG2A 1B72B 1H9TA 2HQ5A 1WJAA 1N75A 1FY7A 1QRYA 4XLHA 3VYUB 2ZJRF 2K40A 4JYKA 2CH0A 2DT6A 3F6VA 4II3A 5J1RA 2EFQA 2LSOA 4BUPA 2BY2A 4XNFA 2WAEA 4HBLA 5K5OA 3ASNH 3CD6I 2HZTA 4E7LA 3TBIA 2Y0SN 4GYGA 2FOKA 4XSXF 2DDBA 2R7XA 1SVLA 3KCCA 2IP2A 4M3GA 2WAFA 3J81Z 2ZSIB 1JKOC 1MMAA 3H92A 2EWNA 1LFBA 3QQAA 2LFBA 5IOYA 1U9OA 2QQ9A 3OS0A 2B9SA 4F55A 1Z6RA 3OIPA 5J1UA 2J5OA 3KZZA 1MD0A 2VQGA 3CP2A 5FKKA 2P7CB 2VXZA 1NH3A 2K3FA 2HTSA 2VBYA 2TDXA 4PFOA 2JVHA 4I98B 4DOZA 2ZO4A 3EDPA 4CYCB 1G2HA 2HTJA 3GLXA 2ME0A 1TLHB 2NAZA 1NG7A 3BZKA 1VI0A 2XC7A 4L0YB
chains in the Genus database with same CATH topology
2X6YA 3DU5A 3H35A 3E0JB 3HUGB 4B43A 2PMZA 4XORA 2XDVA 3RQ4A 2AQFA 4ANJA 2BOLA 1Z21A 2L5QA 2W7NA 2V1NA 1R6RA 1WJ5A 3A1YA 4IQJA 1BR2A 2XF5A 2O5RA 4XKVA 4OAYA 3TMOA 3AL0C 2Y0SA 3VDXA 3K70D 4Y4RA 3MMYB 2W00A 2P0WA 2WADA 1X1DA 1DGRM 4BEHB 4Y3OA 1X4OA 3CP8A 2M7AA 4PK4A 3KEYA 3OIQA 3MKWB 3ZCOA 2ELJA 3C2GA 2L9NA 3HOSA 2CV2A 4CCKA 3FBIB 3MKZA 1OR7C 4NC7A 3RPUD 4DJAA 3QYFA 2JSPA 3H5NA 1PYVA 4HPQA 3OR2C 3VYTB 1YX3A 1E0EA 2VJ4A 3DTKA 2KPMA 4X0GA 3EUKL 3EPZA 4BL0B 4DGWB 1QU3A 4ZTFA 3SYTA 2L7KA 3EUHC 3BCAA 4JQFA 4BEHA 3CJRB 3QODA 4E7KA 2RQQA 3OL3A 4RLFA 4E7HA 2MYSA 4XN0A 2DJIA 3H9QA 3PL8A 2XSJC 2E5ZA 2DXIA 3VWBA 5HOOA 2R7UA 2WAQA 2ZXIA 3AKZA 3PUBA 2KLOA 3A4CA 2NOJB 3ZXSA 2M0MA 3K4BA 2KDOA 4XMYA 2W1OA 4NC8A 2R7VA 3L2UA 1W36D 1QHGA 4IQ4A 4D9JA 1D0ZA 3TL4X 2E5NA 3OY9A 4ZDLA 3K4MA 1WFXA 4XQFA 3J7AY 3HXLA 3IAS2 4AYBA 4FASD 4AU7A 4YRVA 4ZDOA 2GOMA 3HKZA 2VJIA 4DBRA 3DU6A 1BOBA 4E7IA 3S3OA 3OMYA 3A2KA 4ZC3A 3OOUA 3RSNA 3ZRGA 2K9MA 2ZFUA 4FETA 3DLAA 2Q1ZB 1K6YA 4JOMA 2PJRB 3QYBA 2MD0A 1ZELA 4NUBA 2X1DA 2X1CA 1T0FC 4E7JA 3LMMA 3LSKA 4XL9A 5FRMA 1N77A 2BW3B 2WBMA 1WJDA 2XF6A 5HLTA 2Z1DA 2WY7Q 4B3XA 5CQEA 2BVLA 4DBQA 3DKXA 2WA0A 2A6TA 2A5WA 1HA8A 2LYCA 3VYRB 1D1BA 2DCEA 3K70C 4LIUA 3VSLA 1X1BA 3L2WA 4PUSA 4D1QA 1V5EA 4BE0A 3U21A 2OUMA 4IX7A 3D5RC 2F6CA 3S93A 1MMDA 2R7QA 4DIQA 2CUJA 2Z16A 2K3PA 4H4KC 2HVRA 2OV7A 2E60A 2R7OA 2K9LA 3DEEA 2MFZA 4RM3A 2R4GA 4XLCA 3L2QA 4RM2A 2XAUA 3K4KA 3CMMA 4XKCA 4PSXA 1V5FA 3OYBA 5LFAA 2BW3A 2IGOA 1Z3YA 4BQQA 1MNEA 3G2BA 4CA0A 3GBGA 2VJJA 3IP4B 2CUZA 3FKJA 3PSIA 4XLFA 3BCBA 4CCMA 1D0XA 2CW7A 2DOAA 4BQOA 2V7FA 3W2VA 3OYHA 2CV0A 2VJ5A 3S32A 2MABA 2VKDA 3K6GA 4ZJZA 4F52A 2W82A 1DQUA 1N78A 4RMNA 3ZGKA 4II2A 2LOOA 3M1CA 2Z2SB 3BG6A 3LSMA 4LITA 4BJ6C 2VIXA 3KX2A 4BDYA 1G59A 4GRIA 1X19A 4U87A 5KCMA 2VASA 1FMVA 2X6XA 3ZR8X 3H5RA 3HPGA 3PFYA 1LKXA 1W36C 3CZ6A 2KQRA 4BQNA 4NNJA 3OYJA 1NG6A 2R7WA 3S8PA 4ZDPA 4HNUA 1TZLA 2VPLA 3VYSB 4XN3A 3PNTA 4CH7A 3OYFA 1WJFA 1Z3XA 1EA3A 3K4LA 1LFPA 2JUGA 2IS6A 3W2AA 4PJJA 2IS2A 4E7SA 3CJQB 3FDYA 3LSHA 4PSWA 3BG7A 2IGMA 3E1SA 3I9V2 5LD2C 3UNGC 3LL7A 2L9SA 4E4HA 1X4PA 1UG0A 2KP6A 4R79A 4QPOA 4CCNA 4CCOA 1MW7A 1GLNA 2LBFB 2M4GA 3AFHA 3HOTA 3QOEA 2V26A 3RTRA 3PNVA 3L2RA 3LFUA 1MMNA 3OYKA 3DWLE 1D1AA 1WJBA 4N4NB 4XOTA 4CZCA 1FMWA 4E6KG 2LG4A 4C9YA 2HQAA 4OWRB 2V4JC 3PNYA 4U7BA 4OAZA 4N4OB 2VQCA 3FBNB 4IKFA 2LY1A 4IZZA 5TGTA 3K4JA 3OYDA 2MC4A 2KZVA 3OYMA 4Y33A 1DGWY 5HNHA 2KMUA 1SFKA 4KJZA 2HZDA 4C30A 4B47A 4E7ZA 4LG3A 3EUAA 2JVGA 2RREA 2CFOA 5HVQC 2F4IA 3H9GA 3S3MA 2M4KA 1JI8A 3C2HA 3W3CA 3OWTA 4F92B 4C2UA 2IXSA 4J01A 2K5CA 1UELB 1BR4A 1PJRA 2CW8A 1S9HA 3DPLC 4P1WA 1QHHD 2CS3A 4HRIA 3LSIA 1MNDA 2HDWA 1LVKA 2LRDA 3W2WA 4XKBA 2PJRA 3K10A 2VB6A 4CCJA 4BDZA 2GOXB 3AL0B 4F91B 4CSWA 4BE1A 4ZTJA 2LH9A 3OYIA 3OR1C 3OYEA 3OL4A 4BJ5C 4XLAA 2VQHA 4CCLA 4J00A 3D5LA 3HL2A 2KRCA 4PJNA 4XKWA 2BVMA 3RCOA 1Z7LA 2R7TA 2LREA 3D5SC 4ZYAA 1IRXA 2RNGA 4YEJA 4XR6A 4BS9A 3KYLA 2WB1A 5FROA 2HVSA 4F93B 2E1MB 1G8XA 4KISA 3OYAA 2X1EA 3H9JA 3MD2A 1U0JA 3QYEA 3DPTA 4RLQA 1V5GA 1X1AA 2R7SA 4KT6A 5JHFA 3SZGA 2ZSHB 2WY8Q 4BU2A 3K4CA 4CUGA 2HPMA 4HSRA 3OS2A 3K4NA 2HPIA 4MLOA 1YX5A 3N05A 4YELA 2X85A 3IAM2 2QKMB 4HEA2 4XM3A 4C2TA 4AVZA 3OYLA 2VKHA 3ZQQA 2M7BA 3H5AA 1D0YA 3H0DA 5CPRB 2F5VA 4PJMA 2XF7A 3DPUA 2IGNA 3SEQA 2Q2EB 2VL8A 2E1MC 3UR3C 2HU9A 2KL4A 4G6TB 2UWMA 3I3LA 2ZXHA 2VXDA 3OS1A 3HC7A 1LDKB 1WJEA 1D1CA 3HG9A 4ITVA 2JA2A 2I8DA 2CV1A 4PJLA 2VLAA 3L2VA 4LIVA 1WJCA 4F3QA 2R7RA 2AQEA 3IUOA 4BACA 2HNHA 1J09A 1X1CA 2KRHA 5FRNA 2OC6A 3CF2A 4PFPA 5CQGA 3OYGA 3DTEA 2V9KA 3CESA 5KHDA 3MKYB 3SEZA 1YE9A 3VSKA 2DT7B 3NWTA 2IS1A 5HNFA 2LBFA 2CMPA 2LC2A 2M3AA 2KHMA 1VZ0A 2V6EA 1BR1A 2HVQA 4HSTA 3PSFA 4KITB 4P5OA 4B44A 1UAAA 1MMGA 1DP3A 3ONQA 3SDBA 4HG2A 3M8JA 3LSGA 2X51A 1AA7A 4BXFA 1WJAA 1N75A 4XLEA 2VQLA 4XLHA 3VYUB 2CH0A 2DT6A 4II3A 3OYCA 3HPHA 4HNTA 4BGDA 4BUPA 2IS4A 4XNFA 4B48A 2WAEA 3FHNA 2X6WA 1OLTA 4NQWB 4E7LA 2FUG2 3TBIA 2IGKA 1T95A 3DTIA 3V42A 2R7XA 1SAUA 2WAFA 2UV1A 2ZSIB 4QPQA 1MMAA 3PJRA 3OYNA 4BE2A 3DQVC 1Y56A 2LY2A 2QKLB 2UUZA 4XONA 3OS0A 3S3NA 4BJTA 4F55A 3OIPA 3BC8A 4EATA 3CP2A 2VQGA 1Y6IA 2W4SA 3F9KA 2VXZA 3DKYA 1KONA 1P9QC 2JVHA 4DOZA 3BLYA 5CKTA 1TT0A 2L2OA 4XOPA 1ERDA 1NG7A 5KNLA 2XC7A 4PFOA 3NWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQC A; 
#chains in the Genus database with same CATH topology
 2K86 A;  3E5U A;  3DU5 A;  2GA2 A;  4MFD A;  5ICF A;  3TW6 A;  2NOG A;  1FBQ A;  2WV0 A;  5J47 A;  4ENM A;  1IXR C;  2A6H F;  2FE3 A;  3RQ4 A;  2A3S A;  2M0C A;  4C3I J;  1IW7 F;  2BOL A;  2P81 A;  3A1Y A;  1DPU A;  3CDH A;  1BR2 A;  3FMQ A;  9ANT A;  1JKQ C;  1A31 A;  3FXK A;  2XB0 X;  4OAY A;  3JAM Z;  3PM1 A;  2Y0S A;  3K2A A;  1FYM A;  3MMY B;  3E7L A;  2DN0 A;  1BI1 A;  2WAD A;  1ZK8 A;  3GFJ A;  3JSO A;  4B8X A;  1EJ9 A;  1ETX A;  2FOW A;  2COM A;  3C2G A;  3FZV A;  3L1P A;  3AG3 H;  1X3U A;  4CCK A;  1JUS A;  5GTH C;  1UMQ A;  4AYB N;  1OR7 C;  4L5E A;  4N9I A;  4DJA A;  3QYF A;  1ULY A;  2XAG A;  3HKZ N;  3H5N A;  3AG1 H;  4HPQ A;  3OR2 C;  4FE4 A;  4LB6 B;  2BXZ A;  5L3G A;  4ENK A;  1YX3 A;  3TED A;  5DS9 A;  1LNW A;  5FD6 A;  4X0G A;  4A3D J;  4D0P A;  3EPZ A;  4DGW B;  4L9V A;  4ZTF A;  1VQK I;  1QU3 A;  1A04 A;  3HHH A;  2VON A;  3MAJ A;  5GPA A;  3FM5 A;  4KMF A;  1YQA A;  4HDU A;  4XN0 A;  2DJI A;  1G3S A;  3BOQ A;  3E97 A;  4S0H B;  2XSJ C;  3CQZ J;  3HTS B;  5K7H A;  4A69 C;  4RGX A;  2KZG A;  3L09 A;  3PUB A;  2NOJ B;  3DF8 A;  1SD7 A;  2BV6 A;  3ULQ B;  2M0M A;  3BDD A;  3KP2 A;  2KDO A;  1HKT A;  2LK2 A;  3HRS A;  2AXT C;  2A07 F;  3K9T A;  4AUX A;  4NC8 A;  2R7V A;  1UG2 A;  5GAE J;  1W36 D;  4DYC A;  2E5N A;  2RDP A;  1WFX A;  4XQF A;  3J7A Y;  3WHC A;  2CQQ A;  2ETH A;  3JRB A;  2DMT A;  2QVO A;  1IZ1 A;  3IAS 2;  4AYB A;  4GYI A;  3CCE I;  1I50 J;  3O2P E;  2KRF A;  4ZDO A;  2GOM A;  1T6S A;  3HKZ A;  2VJI A;  4GDF A;  3T5X A;  3HSE A;  3F8C A;  4UV8 A;  5LGN A;  3ZRG A;  3KZI C;  3BPV A;  3C18 A;  3TO9 A;  4RDU A;  1IXC A;  2Z5U A;  5IYC J;  4ON0 A;  2PJR B;  2MD0 A;  2Z9O A;  1LB2 A;  3ZMS A;  2DA5 A;  4DQ2 A;  4LGW A;  1AHD P;  3O8H A;  4E7J A;  5LHG A;  3LSK A;  4XL9 A;  4RB1 A;  2X0L A;  1N77 A;  3WU1 B;  1WJD A;  5FFX A;  4HV5 A;  2Z1D A;  2WY7 Q;  4BAY A;  4IVN A;  3DKX A;  5CYV A;  3ZQC A;  1ZH5 A;  4BKX A;  2DI3 A;  1D1B A;  4M71 A;  1R58 A;  4LIU A;  3L2W A;  1X1B A;  1ETW A;  3NAR A;  4D1Q A;  2JA6 J;  1IAW A;  1V5E A;  3KIO A;  4BE0 A;  2RN7 A;  2NNY A;  4IX7 A;  2DPU A;  3HOY J;  4FIS A;  2DFF A;  3HIF A;  2R7Q A;  4M6Y A;  2MC3 A;  2QUF A;  1ZG3 A;  2CUJ A;  2OCE A;  5EDN A;  2OV7 A;  4ZYH A;  1IGN A;  1OCR H;  4RM3 A;  3BR1 A;  2GA1 A;  2KIQ A;  2RGV A;  6PAX A;  4PSX A;  1S29 A;  1VQM I;  2RVC A;  5LFA A;  1MNE A;  2GWR A;  2D1V A;  1I3Q J;  2VOP A;  1UJ8 A;  3DXJ F;  1WPK A;  3BQZ A;  2CU7 A;  3LSP A;  3FXJ A;  4UB6 C;  3HOZ J;  2CYY A;  1ZYR F;  4HA8 A;  1S5L C;  3IP4 B;  3FKJ A;  4XLF A;  3QP6 A;  3JRE A;  5C4X J;  1TWC J;  3HEF A;  5FKL A;  1D0X A;  4BQO A;  2CV0 A;  2V7F A;  3F21 A;  2EIK H;  2WC2 A;  3S32 A;  2MAB A;  1LEB A;  4RAF A;  2NRA C;  2XRL A;  3NRV A;  2Z33 A;  1I27 A;  5L3D A;  5EEG A;  3FMR A;  3M1C A;  3G4S I;  4IO9 F;  3KX2 A;  2M34 A;  4GRI A;  2K4B A;  2YPR A;  1B1B A;  2RAE A;  2PLY A;  4C3H J;  4RAG A;  3S2W A;  1O3Q A;  1FTZ A;  5M3M J;  3KFW X;  1XGM A;  3Q0V A;  3GYH X;  1LQ1 A;  1EH6 A;  4AVP A;  2JZY A;  1LJ9 A;  1LVA A;  4LK1 F;  2R7W A;  3PO2 J;  4ZDP A;  1PP7 U;  1L3L A;  1TZL A;  5GPC A;  3VYS B;  2EZK A;  3OYF A;  1R49 A;  2CFX A;  2V9V A;  3ECH A;  4N9H A;  2COB A;  3BY6 A;  1STZ A;  2XSD C;  1YFH A;  4BBR J;  1GVJ A;  2BY3 A;  1R9T J;  3CJQ B;  3U9G A;  1BM9 A;  1F36 A;  4G7H F;  2YR2 A;  3V8J A;  3TDU C;  4FTH A;  3IHU A;  3ML6 A;  5F6F A;  5LD2 C;  3CCS I;  1OMI A;  2ESH A;  1X4P A;  2VE8 A;  4CHU A;  1R5I D;  2GM4 A;  3IRR A;  1CF7 B;  4P96 A;  5E79 C;  1GLN A;  2LBF B;  5AIQ A;  1ZG1 A;  1RUO A;  4A5M A;  1VQP I;  2GXA A;  4IOA F;  3LFU A;  3BR5 A;  1YRN B;  2XPW A;  1MMN A;  3J80 Z;  3OYK A;  4CZC A;  4IHX A;  2AS5 F;  3B02 A;  2QM3 A;  2EPF A;  2JA5 J;  4C9Y A;  3CCR I;  1SAX A;  3FHZ A;  2M8E A;  1X58 A;  1WRJ A;  4W1U A;  2ADU A;  2EQR A;  3A0B C;  1XSV A;  3PNY A;  2VOD A;  3CO7 C;  1QPI A;  4EVI A;  2HQR A;  3FBN B;  1PUF B;  1OQY A;  2GQQ A;  2LY1 A;  2BY0 A;  1R7J A;  3K4J A;  2KZV A;  5ILS A;  2I10 A;  1LPQ A;  3SDG A;  4XBF A;  2FSW A;  3EET A;  3G1O A;  4E7Z A;  2F5C A;  3R4K A;  1B59 A;  1YRN A;  3EUA A;  2JVG A;  4ABZ A;  4KIB A;  5ILU A;  2EJR A;  1ZRF A;  5BS6 A;  3H9G A;  1QGP A;  2M4K A;  4I76 A;  2ZME A;  5LRS A;  5J4Y A;  3OWT A;  4F92 B;  1UHS A;  2D5V A;  4P55 A;  3KP6 A;  3ABT A;  2HXI A;  1UEL B;  1HSJ A;  2XUB A;  2DFH A;  4QLC U;  2PBI A;  1S9H A;  2JTV A;  3I0T A;  5F1R A;  1PUF A;  2CS3 A;  4HRI A;  2QF7 A;  1POG A;  2AO9 A;  3LSI A;  4UVA A;  1MND A;  1WGX A;  4UUT A;  2KKO A;  3OSF A;  2LF7 A;  2DQR A;  2V6C A;  3K10 A;  2VB6 A;  1FLI A;  1FOX A;  1W7P B;  4I09 A;  2GOX B;  2VKV A;  3MKL A;  3GFL A;  4ZYE A;  4CSW A;  2QBY B;  1HQC A;  5IOZ A;  3ISP A;  2BXY A;  1G4D A;  3OL4 A;  1JHH A;  4BJ5 C;  4XLN F;  4CCL A;  1UHW A;  2R7T A;  2QQA A;  3HGG A;  4ZYA A;  1IRX A;  2RNG A;  4Z2Y A;  3V7S A;  4YEJ A;  1ZRD A;  4XR6 A;  4BS9 A;  2HVS A;  3WU0 A;  1P6R A;  3LQR A;  2PEX A;  3X2Q H;  1IUY A;  1WKM A;  3VFZ A;  2KIF A;  2CQX A;  1G6N A;  4B4C A;  4A6D A;  3H9J A;  1YW8 A;  3MD2 A;  2FMY A;  3M8E A;  1R5G A;  5E1W A;  1G3Y A;  3GTK J;  1SEU A;  2LNB A;  3WE3 A;  2CGP A;  3TQN A;  2KIS A;  1BL0 A;  3Q9S A;  4KT6 A;  5JHF A;  4BU2 A;  4HSR A;  3K4N A;  2HPI A;  4MQ9 F;  2DQL A;  2MA3 A;  2NYX A;  3GZ6 A;  2PMU A;  2X85 A;  3ZMV A;  3SXY A;  2O8X A;  4HX7 A;  2E34 A;  2CUF A;  4XM3 A;  2ZFW A;  4Y17 A;  1C0W A;  1X3W B;  2BY1 A;  2D2W A;  2ECB A;  3OYL A;  2R7D A;  2P4W A;  1MZB A;  3H5A A;  1D0Y A;  1TC3 C;  3QPS A;  3ZN0 A;  1QQI A;  2E35 A;  2ZXW H;  4AIK A;  1S72 I;  1K4T A;  1T98 A;  4OMZ A;  3I71 A;  3RQI A;  4FCY A;  2VL8 A;  3DBL B;  5GTI C;  2KL4 A;  2WV1 A;  4G6T B;  2UWM A;  3I3L A;  4LLL A;  1UST A;  3GME A;  1QZY A;  1FNN A;  2KJC A;  4C2M J;  4UY8 I;  2DO7 A;  3S1M J;  1IV8 A;  1J59 A;  3HDD A;  4A6E A;  4IOC F;  2CV1 A;  1IRF A;  3I4P A;  3L2V A;  2A68 F;  2H09 A;  1CQT A;  2HDC A;  1VQ8 I;  4RA2 A;  1MSF C;  1J09 A;  1BI3 A;  5J40 A;  3OYG A;  3FKI J;  2JA8 J;  1Y0N A;  5KHD A;  3RYP A;  3GTQ J;  5A2Q Z;  4MEY F;  4FHT A;  4IRH A;  1SVO A;  1YE9 A;  3E5X A;  1USS A;  4B09 A;  3LWF A;  3A01 A;  3NWT A;  4ZYD A;  4IRG A;  3WTU C;  2CMP A;  5IYD J;  2E2I J;  1W4M A;  1RNL A;  2DA1 A;  4CDG A;  2XAJ A;  3BR6 A;  4HST A;  5EJC A;  4P5O A;  3ROU A;  3LA3 A;  3WGH A;  4A3E J;  3OSG A;  1TNS A;  4BNC A;  3E3V A;  3WU2 C;  2A05 A;  1VQO I;  3M07 A;  4G6Q A;  1FYK A;  2M8G X;  2IJL A;  3L7W A;  3HPH A;  3MVP A;  1W5C C;  3OYC A;  3COA C;  2IS4 A;  4B48 A;  1E2X A;  5B66 C;  3I5U A;  3KP5 A;  1OLT A;  4UV9 A;  3J81 K;  2K9S A;  3OIO A;  5JLX A;  2IGK A;  3BT9 A;  3DTI A;  1Z7U A;  3JRG A;  5FLX K;  1SAU A;  1VTN C;  4NBQ A;  3QWL A;  2QSF X;  2F2E A;  3OYN A;  2DPD A;  3PO3 J;  1R1V A;  2NVQ J;  1R23 A;  1ZG5 A;  4XON A;  4PGH A;  3BZC A;  2XB5 A;  2IBD A;  1ZRE A;  5E8I A;  1B4A A;  2QQ8 A;  3WOD F;  1SD5 A;  4EAT A;  4EGY A;  2ZJ2 A;  2BHY A;  3I58 A;  5J6X A;  3RIR A;  1MBF A;  1X1P A;  4ASN A;  3S1N J;  1TT0 A;  4XOP A;  4EM0 B;  1K78 B;  2LKX A;  4IJA A;  1K6O A;  4DZP A;  1ERD A;  2MH9 A;  3NWS A;  5ED4 A;  3CME I;  3GTL J;  3KE2 A;  1KU7 A;  1I1G A;  1W5T A;  4EJT A;  1VFC A;  1LUJ B;  2AQF A;  1FSH A;  4ANJ A;  3LAJ A;  1Z21 A;  2L5Q A;  1R6R A;  3JAM K;  1V54 H;  5DYM A;  4IQJ A;  2WAQ N;  2XF5 A;  4DYR A;  5FJ8 J;  1OR7 A;  1Z1D A;  3J7Y J;  5E3L A;  3LNQ A;  5B3S H;  1J75 A;  2V1D A;  3F3X A;  4G7Z F;  1DGR M;  3GVA A;  4BEH B;  1PUE E;  5DUI A;  3CP8 A;  3KEY A;  3OIQ A;  1JKP C;  2Y48 A;  3S2H J;  3I56 I;  3DFG A;  5E3O A;  4WF2 A;  3FBI B;  3U1K A;  3DCF A;  4NC7 A;  4WX9 A;  5H20 A;  2YX7 A;  3BG9 A;  4OIN F;  3SQN A;  3FXM A;  1VQ5 I;  2VJ4 A;  4G7O F;  3EUK L;  4BL0 B;  3RZD J;  3SYT A;  2L7K A;  1WI9 A;  2OD5 A;  3WTX C;  3BG3 A;  4JQF A;  4BEH A;  1HW5 A;  3QOD A;  2RQQ A;  1WCM J;  4RLF A;  4E7H A;  3FK6 A;  5K5R A;  1F9N A;  4AC0 A;  4I99 C;  3ELK A;  1UHM A;  5HOO A;  2PJP A;  2WAQ A;  3HB9 A;  3AKZ A;  3TOB A;  2E7W A;  1B9M A;  1O3R A;  1ETK A;  3K4B A;  3GUD A;  4S05 A;  3QPL A;  4XMY A;  1R71 A;  4RB0 A;  2QZ8 A;  3A0H C;  2B63 J;  3EQL F;  2H6C A;  3WTY C;  3GF2 A;  2DDA A;  2XHK A;  3VOD A;  4IQ4 A;  3MEX A;  4D9J A;  2XV4 S;  5FGM A;  5F0H A;  1P92 A;  1HCR A;  2JK3 A;  4UUS A;  1OJL A;  4LLN A;  2HEO A;  2R3S A;  1BW6 A;  4EJV A;  4L9J A;  1IG7 A;  1XX5 A;  4AU7 A;  2ME6 A;  2Z3Y A;  3DU6 A;  1FC3 A;  1BOB A;  3S3O A;  3OMY A;  3A2K A;  1U6G A;  2NVU B;  2L54 A;  3RSN A;  1U8B A;  2K9M A;  3F22 A;  3IH4 A;  2B7E A;  3RI4 A;  3Q0U A;  4R1H A;  1ZEL A;  2CQ7 A;  2Y31 A;  4NUB A;  1TQI A;  4KDP A;  4ESB A;  2OAZ A;  2X1C A;  4L5J A;  5FRM A;  2HOT A;  1MH3 A;  2WBM A;  3OV8 A;  1E3P A;  2WA0 A;  1HA8 A;  3JRD A;  1GT0 C;  2X4H A;  4BY1 J;  2RNJ A;  2DCE A;  3RPU A;  1KU2 A;  3WE2 A;  2XRO A;  5EG0 B;  3REO A;  4PUS A;  4UUV A;  1QO0 D;  1F5T A;  1O4X A;  1B72 A;  2ZB9 A;  1MMD A;  2JN6 A;  4DIQ A;  2Z16 A;  1Z67 A;  3BJA A;  4PGG A;  1B9N A;  1YYV A;  5HLI A;  4XRS A;  3L2Q A;  4XIC A;  2XAU A;  3CMM A;  1K61 A;  4XKC A;  1DUX C;  2JT1 A;  2OU2 A;  2RC4 A;  3QP5 A;  1V5F A;  3OYB A;  5B1B H;  2OQR A;  3HM5 A;  4YFN F;  2VT2 A;  4I01 A;  4CA0 A;  3UKG A;  3F8B A;  2VJJ A;  2CUZ A;  1FSE A;  1SD6 A;  5GAG J;  4RGS A;  4IEJ A;  3H36 A;  4CCM A;  2QCO A;  1YS6 A;  1BJZ A;  5C3E J;  2JMW A;  2DOA A;  5DM7 F;  2BGC A;  3V4G A;  2VJ5 A;  1H0M A;  3K6G A;  4ZJZ A;  1OCP A;  2W82 A;  1RZ4 A;  1N78 A;  4Y7N J;  2HWV A;  3ZQH A;  4A3F J;  2LOO A;  2D1H A;  1SMT A;  3ECO A;  4LJZ F;  4CYC A;  1J5Y A;  2Z2S B;  3LSM A;  4LIT A;  2VIX A;  1X19 A;  2QEX I;  5KCM A;  3J7Z I;  1T08 B;  1FMV A;  2LTP A;  2X6X A;  5GAH J;  3ZR8 X;  4F7Z A;  4EM1 A;  4TV7 A;  2FQ3 A;  2GBY A;  2R7Z J;  3MCZ A;  2ZJP F;  1RUN A;  1W36 C;  4RGU A;  3K1M A;  1AWC A;  1ZN2 A;  2ZC2 A;  4ZZL A;  1A6I A;  3G73 A;  5BNG A;  2DFE A;  3BTJ A;  3CCQ I;  5IT3 A;  2GXB A;  3RZO J;  4XN3 A;  2LLK A;  3PNT A;  4IF4 A;  5CVV A;  2BYV E;  2O61 A;  1LEA A;  3IRQ A;  1R4N B;  1FX7 A;  4JBA A;  1T56 A;  2K02 A;  1YJW I;  2IS6 A;  3CC2 I;  1I39 A;  4E7S A;  2M9H A;  2CWE A;  2NS0 A;  3FDY A;  4PSW A;  3CCM I;  1V55 H;  3BG7 A;  3E1S A;  4FX0 A;  2HFH A;  1T33 A;  2XAH A;  3I9V 2;  2M2E A;  5E1Z B;  1S7A A;  2L9S A;  1H9G A;  2KP6 A;  4QPO A;  5AON A;  3D0S A;  4I6Z A;  2F5D A;  2M87 A;  5D5X B;  2NVX J;  2PQ8 A;  2M4G A;  2GXG A;  3J80 K;  2JWT A;  3O6B B;  1E3H A;  3QOE A;  3VOE A;  3RTR A;  2QEN A;  3L2R A;  3QU3 A;  2WWY A;  2OF7 A;  4LK0 F;  1WJB A;  4XOT A;  2G7H A;  5BPI A;  5ICE A;  1N25 A;  1SAN A;  1UB9 A;  3EYY A;  3PIO F;  3Q0W A;  3RKQ A;  5K5Q A;  1VQ9 I;  3T8R A;  5IPA A;  2DMU A;  3SFZ A;  1PVE A;  1Z91 A;  2EFN A;  3D1N I;  2W48 A;  1ZAR A;  5L3E A;  4IZZ A;  4G9Y A;  4BHC A;  2MC4 A;  4Y33 A;  3SZT A;  3I64 A;  2KMU A;  5HLH A;  1S8N A;  4ENN A;  5D5U B;  3JRA A;  4A12 A;  1REP C;  1IRG A;  1DP7 P;  3LFK A;  3SJM A;  5HVQ C;  1MNM C;  4V19 K;  2YS9 A;  2F48 A;  1JI8 A;  1NTC A;  3C2H A;  4OOI A;  1IDZ A;  1RIO H;  2XKO A;  1TQM A;  1FJL A;  4C2U A;  3K1N A;  2CSO A;  1RET A;  5TRD A;  2O6G E;  1BR4 A;  1PJR A;  1RR8 C;  4IHS A;  1IRZ A;  4P1W A;  1QHH D;  5L3B A;  1KQ8 A;  4M9X A;  2H6B A;  3TGN A;  2LRD A;  1I5Z A;  2M45 A;  3L9F A;  2PJR A;  4BHB A;  1IO2 A;  4V2G A;  2ICW G;  4ZTJ A;  1DU0 A;  3F8N A;  1M1E B;  2XGD A;  4JX6 A;  2VQH A;  1ORK A;  4D7N A;  2KRC A;  4PJN A;  4XKW A;  5LRR A;  3I55 I;  3RCO A;  1YIJ I;  1KU9 A;  2PX9 A;  1VQ6 I;  3ERE D;  5KVR A;  3MFK A;  2A61 A;  4BH9 A;  2AHQ A;  4EJW A;  2L4M A;  4O6J A;  3MZH A;  5FRO A;  4XRM A;  1OCZ H;  4G8X A;  1ON2 A;  1SVM A;  1QNT A;  3QPH A;  4KA4 A;  5JFR A;  1FBU A;  1ZR4 A;  2E1C A;  2TRT A;  3OYA A;  2X1E A;  3Q5F A;  2EZI A;  1G3W A;  3BWG A;  1XD7 A;  3KLN A;  4XSZ F;  1VF9 A;  2L7M P;  4HX4 A;  1MDM B;  1K79 A;  1Y0U A;  2W57 A;  2VPR A;  3QYE A;  2NNN A;  2XPV A;  4ESJ A;  3KEO A;  2WY8 Q;  1DPR A;  3IWF A;  4CUG A;  3OS2 A;  3GZN B;  4MLO A;  3GTG J;  1YX5 A;  4HV6 A;  2HOS A;  4YEL A;  5M5W J;  2GIZ A;  2CW0 F;  1ZLK A;  1GDT A;  2QKM B;  4C2T A;  3JRF A;  5D8L B;  2K9N A;  1YJ9 I;  2C6Y A;  4AVZ A;  1D5V A;  2L7Z A;  1TWG J;  2M7B A;  1XSD A;  4RS8 A;  2F5V A;  3W6J B;  1QBJ A;  3DPU A;  2ISZ A;  4GO1 A;  1BJA A;  3JRI A;  4GFB A;  2OTJ I;  2W24 A;  2Q2E B;  3CJN A;  3NAU A;  4EM2 A;  2LR8 A;  1RKW A;  5EZH A;  2DFI A;  3QRF F;  2E1M C;  1XN7 A;  1FZP B;  2HU9 A;  2D45 A;  3GFM A;  4M3E A;  2Y9Z A;  2HDD A;  2E71 A;  2ZXH A;  3TDZ C;  5E17 F;  2VXD A;  2XVC A;  3OS1 A;  4KN7 X;  3QU6 A;  3TP0 A;  3LAP A;  4ITV A;  3N4M A;  2JA2 A;  4KFC A;  2CJJ A;  3MZ8 A;  4YIF A;  5FKM A;  2LY9 A;  2Y2Z A;  4LIV A;  4KIF A;  2R7R A;  2AQE A;  2QSH X;  1X1C A;  2X48 A;  3WHB A;  3AG4 H;  3BP8 A;  3CF2 A;  1Y8Q B;  2L3D A;  3T0Y A;  2EFP A;  5A2Q K;  5FRN A;  4M3F A;  5CQG A;  3DTE A;  1D8K A;  1Y1V J;  2V9K A;  2CQN A;  4KT5 C;  5DD8 A;  3MWM A;  5IP9 J;  3MKY B;  1EH7 A;  4I2O A;  1JKR C;  1CF7 A;  3F8M A;  4WXC A;  3M4O J;  5HNF A;  2LBF A;  2R5Y B;  4WCG A;  5H6R A;  1IJW C;  1TW2 A;  1VZ0 A;  2B0L A;  2W84 A;  3KPH A;  3EYI A;  3K1P A;  5FLV A;  1JUM A;  3WG9 A;  4B44 A;  3GXO A;  2K9Q A;  5J1Y A;  1R1U A;  3DP7 A;  1A36 A;  4DW6 A;  3CLQ A;  3ONQ A;  2OTL I;  1DP3 A;  3FIW A;  1CGP A;  4LD5 A;  1Z05 A;  3M8J A;  4BXF A;  1AA7 A;  2P5L C;  4XLE A;  1EV7 A;  2JJ7 A;  2BHZ A;  4X6A J;  4FE7 A;  3BRO A;  1BC7 C;  2QA4 I;  3E6C C;  2KT0 A;  3CUO A;  3TO7 A;  4HNT A;  4BGD A;  2R92 J;  4A3L J;  1FP2 A;  1LFU P;  2R5Y A;  2X6W A;  2K7L A;  2O0Y A;  4NQW B;  3HBL A;  2O3F A;  1X3Z B;  1T95 A;  4D5C A;  2LKS A;  1G3T A;  2OQG A;  1W0U A;  5CVR A;  4QPQ A;  4NHJ A;  2JUC A;  1HXD A;  2Y75 A;  3PJR A;  1YW7 A;  2ECC A;  4YFK F;  4MIM A;  1U3E M;  2LY2 A;  4I7H A;  1SFO J;  4S04 A;  2E1N A;  5IT9 Z;  4N0B A;  3S3N A;  3W6K B;  5K1Y A;  1R1T A;  2NS7 A;  1APL C;  3BC8 A;  4YFX F;  3ZQG A;  3F9K A;  2W4S A;  3ZMD A;  2BE5 F;  3SZP A;  1Z0X A;  1DDN A;  2DW4 A;  4BXU A;  2ISY A;  1R4M B;  5DCF A;  5HS9 A;  4OIO F;  4BHP A;  3F8F A;  2Q0O A;  4MEX F;  2K4J A;  4NQW A;  2FD5 A;  2L2O A;  4MQV A;  1W7P A;  2YX4 A;  3U2R A;  2QBY A;  1IN6 A;  1XSX A;  2X6Y A;  2YSR A;  3B6C A;  1YW9 A;  2A5Y B;  3E0J B;  4Q48 A;  4B43 A;  4J19 A;  2R7F A;  1ENH A;  4XOR A;  1ETQ A;  2XDV A;  2H27 A;  2DYS H;  3E6M A;  2W7N A;  3IWZ A;  2V1N A;  1XMX A;  1HKQ A;  1ZQ3 P;  4M6X A;  5DV5 A;  4AM3 A;  1X2N A;  1JT6 A;  3F23 A;  3TMO A;  2QYO A;  5L3C A;  3K70 D;  4Y4R A;  1P4X A;  1R00 A;  2W00 A;  2P0W A;  4FQG A;  2IVM A;  1HW2 A;  4Y3O A;  3BTL A;  5HDK A;  1IUF A;  3MKW B;  2ELJ A;  1JT0 A;  3SFI A;  1RI7 A;  2L9N A;  4EQQ A;  2MLG A;  3HOS A;  4BXX J;  3MZY A;  2CV2 A;  2EIJ H;  4CZZ A;  1WQ2 A;  3L2C A;  5HS7 A;  3TP3 A;  2HOE A;  5AIP A;  1F43 A;  2JSP A;  3CDL A;  3IC7 A;  3QOP A;  4U7D A;  1UZC A;  2DA2 A;  1PYV A;  1ETO A;  4LFU A;  4IRI A;  1E0E A;  4HQM A;  1K7A A;  2L9V A;  3KYC B;  3ABL H;  4U88 A;  1MKM A;  1JE8 A;  3EUH C;  3V7R A;  5EEH A;  1QVT A;  2CO5 A;  1R5H A;  4MTE A;  1R22 A;  3V8L A;  1HKS A;  3OOP A;  4OIQ F;  3FF5 A;  1Z9C A;  2L01 A;  1KYW A;  4PZJ A;  3TOA A;  5E3M A;  4H0E A;  1XG1 A;  2V1X A;  2E5Z A;  2DXI A;  4O3M A;  2YU3 A;  2Q8K A;  4B3A A;  1SFU A;  1MJB A;  2KLO A;  5CJ9 A;  3A4C A;  3ZXS A;  3JTG A;  1T8I A;  3PIP F;  1TQP A;  2OBP A;  2W1O A;  4ZH4 F;  4E70 A;  2PI0 A;  2DMQ A;  2KJB A;  5HDN A;  1QHG A;  1D0Z A;  2O7O A;  5LEJ A;  2IEK A;  3OY9 A;  1VND A;  3WTT C;  4ZDL A;  3K4M A;  2OZ6 A;  2M1B A;  4YII A;  4AD9 A;  1LDD A;  1JJ8 C;  4FAS D;  4YRV A;  4DBR A;  2QSG X;  4ZC3 A;  3GW2 A;  2VI6 A;  3T8T A;  3AAF A;  3OOU A;  3BPX A;  2ZFU A;  4FET A;  1HW1 A;  2P7V B;  3DLA A;  2Q1Z B;  5LBQ A;  4JOM A;  1I6X A;  3QYB A;  1P7J A;  2H1K A;  1L0O C;  2EFO A;  5KAI C;  3WG7 H;  1IC8 A;  2AXL A;  4BYY A;  2X1D A;  2VC1 A;  5B1A H;  3I54 A;  1T0F C;  3MQ0 A;  1PDN C;  3LMM A;  4QWQ A;  2BW3 B;  2XF6 A;  4UVB A;  5HLT A;  3JTH A;  4B3X A;  3KZY A;  2BVL A;  5CQE A;  3ZQ7 A;  1RC9 A;  2A6T A;  2HYJ A;  3VYR B;  4HLX A;  5D5V B;  2FXA A;  4ZYG A;  1P4W A;  3LQQ A;  2O9L A;  1ETY A;  2RQP A;  2CQK A;  5IY5 H;  4KYW A;  3GTP J;  3BR2 A;  3RDI A;  5FKN A;  3D5R C;  2F6C A;  2QLZ A;  2FNP A;  3IH3 A;  1DU6 A;  4H4K C;  2K3P A;  4IPA A;  2R7O A;  4Z6Y A;  2XAF A;  2MFZ A;  2E36 A;  5B5E C;  4CIC A;  2ZME C;  3K4K A;  2HR3 A;  3CUQ C;  2QQB A;  4LB5 A;  1O7L A;  2BW3 A;  2IGO A;  3J7A O;  4BQQ A;  2EA2 A;  1TW3 A;  1WI3 A;  1YS7 A;  3ASO H;  3G2B A;  2K27 A;  5F04 A;  4CYD A;  1P7I A;  3ZQF A;  4RBO A;  3GLL A;  3JW4 A;  3HOV J;  2MD5 A;  2CW7 A;  4HF0 A;  3OYH A;  3W2V A;  2FRH A;  1DQU A;  5M5X J;  2ZJQ F;  4DZJ A;  2FEZ A;  3ZGK A;  2JPC A;  4II2 A;  3WTV C;  1VQ4 I;  1OYY A;  3BG6 A;  4HNV A;  1G59 A;  4A5N A;  1K78 A;  1XB4 A;  5GP9 A;  2H8R A;  3HPG A;  4P9F A;  1I3A A;  1LKX A;  3PFY A;  2IAI A;  2G0E A;  3CZ6 A;  3ESW B;  1BI0 A;  2KQR A;  2CRG A;  3CTA A;  3SHF A;  1MJA A;  1WSU A;  3GX4 X;  1ETV A;  5FLM J;  1NG6 A;  2XGE A;  3KLO A;  4MTD A;  2LMD A;  3BTI A;  4BBS J;  2EBI A;  2VPL A;  2I5U A;  1F4K A;  2Y0M A;  2V79 A;  1WJF A;  1Z3X A;  2EFW A;  4AIJ A;  3DEU A;  5HDG A;  1AKH B;  4IHW A;  5ICG A;  2JUG A;  1X2M A;  2OPT A;  1HDD C;  2R5Z B;  2PFB A;  1V4R A;  2IS2 A;  3LSH A;  1ZGJ A;  3HHG A;  1FIA A;  2P6S A;  2IGM A;  5C44 J;  3M9A A;  3LL7 A;  5C4J J;  4M73 A;  4E4H A;  4ZZD A;  2DTR A;  4L9T A;  4HF1 A;  4R79 A;  3A02 A;  4GXO A;  4IHV A;  1S3J A;  4CCN A;  4DYQ A;  1KA8 A;  1VQ7 I;  1XMA A;  5KK1 A;  3AFH A;  1MGT A;  1ZTR A;  4PDK A;  1UFM A;  2M5W A;  2V26 A;  5DUK A;  4BY7 J;  3PNV A;  3CCL I;  4A3C J;  1FT9 A;  2EK5 A;  2DK8 A;  1J0R A;  1D1A A;  4E6K G;  1Y39 A;  2LG4 A;  1PP8 F;  1O7F A;  5DM6 F;  2STW A;  4WK8 F;  5LGT A;  4A2U A;  1JTY A;  1WH7 A;  1RRJ A;  3LSJ A;  5DDG A;  2V4J C;  2L9R A;  3QAH A;  4U7B A;  3I59 B;  3IL2 A;  4A3M J;  3CLO A;  4N4O B;  2VQC A;  4EMS A;  4OIR F;  4IKF A;  2VE9 A;  1WH5 A;  1GV2 A;  5D4R A;  3OYM A;  4WXH A;  1SFK A;  3JR9 A;  1HLV A;  5FKO A;  2JPB A;  3HRU A;  1XC5 A;  3E6D A;  1LE8 B;  4DNC A;  1TWA J;  2OJE D;  2EIM H;  2F4I A;  1IN7 A;  2FF4 A;  2VKE A;  1S7O A;  3IH2 A;  1H88 C;  3CJT B;  3BJO A;  4UB8 C;  4J01 A;  1JUP A;  3I59 A;  1ZAO A;  3ZQI A;  1U2W A;  5F0F A;  3C1D A;  4ESF A;  3ABU A;  3DPL C;  5K7F A;  1JGS A;  2ID6 A;  2N8G A;  2Y69 H;  2CUE A;  1BC8 C;  1W0T A;  1SFX A;  1W5S A;  1U8R A;  1LVK A;  1FP1 D;  1U5T C;  1YIO A;  2Y30 A;  2XGX A;  4I0B A;  4HZF A;  5HLG A;  4BDZ A;  2E2H J;  3AL0 B;  4F91 B;  2EB7 A;  1LE8 A;  4BE1 A;  1UCR A;  2LH9 A;  3OYI A;  3OR1 C;  5FLX Z;  2M30 A;  4XLA A;  1MBH A;  1S6L A;  2DA6 A;  3Q9V A;  1B8I B;  2BVM A;  1Z7L A;  3CC4 I;  2LRE A;  4JX5 A;  3D5S C;  2HGC A;  2GIV A;  5EG0 A;  1KYZ A;  2G7U A;  4CGZ A;  3KYL A;  3I4M J;  3LA2 A;  5HOD A;  2OCC H;  3GCM A;  3R0J A;  1TTY A;  4F93 B;  3WTZ A;  4L5I A;  2E1M B;  4EV0 A;  2XIG A;  1G8X A;  3QPT A;  2OZU A;  4EJU A;  1QZE A;  2HKX A;  5D5W B;  2ID3 A;  3DPT A;  4RLQ A;  2RV8 A;  4IXA A;  1X1A A;  1BW5 A;  1B8I A;  2VBZ A;  1HC8 A;  3BG5 A;  3P9I A;  2ZSH B;  1JGG A;  3K4C A;  4R8H A;  3M3Y J;  3N05 A;  4RB3 C;  4HLY A;  1XMK A;  5IP6 A;  1RES A;  2EV0 A;  4HEA 2;  3NEU A;  2H1L A;  3ZQL A;  4KUM A;  4RAZ A;  4EEF G;  4EGZ A;  4A3J J;  3GTM J;  1ITY A;  2FBK A;  2VKH A;  5FB2 A;  2DOD A;  4HDV A;  1XTA A;  1HDP A;  5BOX A;  5CPR B;  4PJM A;  2XPU A;  1QPM A;  1TP4 A;  3F6O A;  5F27 A;  3PQK A;  2F5F A;  4LG0 B;  5J3L A;  2P8T A;  1JTX A;  3V8K A;  4XID A;  1J9I A;  2PN6 A;  4G6D A;  4GGG A;  5L3F A;  3S14 J;  4EJO A;  5LLQ A;  2ZBK A;  2L0K A;  4Y52 J;  2DOE A;  3ZMU A;  1LDK B;  1OYW A;  3I53 A;  4MHG A;  5D4S A;  3HG9 A;  4FX4 A;  1O3S A;  5BPD A;  1BIA A;  5IYB J;  5E1X A;  3F72 A;  3VB2 A;  4FT8 A;  1YIT I;  2EIL H;  1Z77 A;  1YHQ I;  3CC7 I;  3IUO A;  2HNH A;  2V1U A;  4HQE A;  1YTY A;  1JJ6 C;  3ABK H;  4KMU X;  5HS8 A;  4A3G J;  3CES A;  3FIS A;  4A3K J;  3IV5 A;  4LG0 A;  3SEZ A;  2A6E F;  3HGY A;  2MBF A;  1NHA A;  3VSK A;  2DT7 B;  2MSY A;  3E5Q A;  2ZKZ A;  1TWF J;  5E20 A;  4LOC A;  5FFZ A;  1ZLJ A;  2M3A A;  3ABM H;  3M7G A;  3AG2 H;  2V6E A;  1Q1H A;  2HVQ A;  1BN5 A;  3L00 A;  4M9Z A;  2EIN H;  4KIT B;  3TW7 A;  3H1C A;  3LST A;  1FYL A;  1MMG A;  2DU9 A;  2HYG D;  4CXF A;  2DA4 A;  4PJ0 C;  2FX0 A;  2X51 A;  3LSG A;  5EF6 A;  2UZK A;  4RAY A;  2FA5 A;  2VQL A;  2LDU A;  2PMZ N;  5J8F A;  4QTR A;  2DTZ A;  5LHH A;  3S2D J;  5CVU A;  5KAF C;  3CDI A;  4ENJ A;  5EEA A;  3FHN A;  2HYF A;  2XAQ A;  2FUG 2;  1T39 A;  3V42 A;  3KP3 A;  3HOU J;  1J7K A;  2UV1 A;  3IKV A;  1D8J A;  2PMH A;  1D3Y A;  5IT9 K;  2IA0 A;  3N97 A;  4BE2 A;  4HOB A;  3DQV C;  1Y56 A;  2MW8 A;  2PG4 A;  2QKL B;  3FMS A;  1MBG A;  2UUZ A;  1ZGA A;  1P2F A;  3WTS C;  4BJT A;  1ZR2 A;  1T2K A;  2EA4 A;  2YU9 J;  1GV5 A;  1Y6I A;  3DKY A;  1KON A;  4WXD A;  1P9Q C;  1NK2 P;  1T38 A;  1OYI A;  3FXO A;  3BLY A;  5CKT A;  3DLL F;  5EZG A;  5DD4 A;  1P4A A;  5KNL A;  2ELH A;  2Z99 A;  5F64 A;  2E19 A;  4XRS G;  2XRN A;  2P5K A;  1KQ9 A;  2F4O B;  3T1B A;  2BEO A;  1MBK A;  4Y15 A;  3H35 A;  1BBY A;  4W97 A;  3H3U A;  3HUG B;  1VQN I;  3JRH A;  1OCC H;  2PMZ A;  3HJE A;  3VPR A;  1WJ5 A;  2HQN A;  4QSH A;  2O5R A;  3BR3 A;  3DBR B;  4XKV A;  1Z6T A;  3HSR A;  3AL0 C;  3VDX A;  2EV5 A;  1ON1 A;  2XKP A;  3M8F A;  4AID A;  3G3Z A;  1X1D A;  3DEW A;  4A3B J;  3BZ6 A;  2DOF A;  3BQY A;  2KDZ A;  1X4O A;  4PK4 A;  2M7A A;  3G1L A;  3ZCO A;  3V7C A;  3GWZ A;  1WWX A;  3EUH A;  5JLW A;  1ZRC A;  2IW5 A;  1EH8 A;  1MDM A;  3HZJ A;  3MKZ A;  2EV6 A;  3JCU C;  3CMY A;  1GHC A;  3HUG A;  4A0Y A;  4UVC A;  1MSE C;  3RPU D;  3GEZ A;  5ILV A;  2Y9Y A;  1WHU A;  1XGN A;  4HF2 A;  4YG2 F;  3GTJ J;  2IA2 A;  3VYT B;  3CF5 F;  2KFD A;  3DTK A;  2R93 J;  3HOX J;  2ESN A;  2KPM A;  3C2B A;  2DMP A;  1IN5 A;  5IP7 J;  4I02 A;  1XPX A;  3CCJ I;  4NB5 A;  3BCA A;  1K83 J;  4PCQ A;  3CJR B;  4E7K A;  1FEX A;  3BR0 A;  3OL3 A;  1TL8 A;  1E3O C;  2MYS A;  3PUF A;  4LLG F;  3H9Q A;  3PL8 A;  3LOC A;  1MBJ A;  5ERI A;  1U78 A;  3VWB A;  2R7U A;  1BI2 A;  5E8G A;  2ZXI A;  3WTW C;  4NDL A;  5GAD J;  2VT3 A;  4D5F A;  2FU4 A;  2Q2E A;  2JQ7 A;  2P6T A;  3HOW J;  5F1J A;  2CG4 A;  2ZXJ A;  2ELK A;  1IDY A;  3L2U A;  3TL4 X;  5JVT A;  1ZKG A;  1OIS A;  2ZME B;  3HTU A;  5JR3 A;  3HXL A;  2GAU A;  4P9U A;  5LEK A;  3P9C A;  4IHT A;  3CUQ B;  1K4S A;  1SD4 A;  1T0F A;  1J2X A;  4AWX B;  1FOW A;  2J5P A;  4E7I A;  1HST A;  1YO5 C;  3TO6 A;  1QVU A;  2EZL A;  3S17 J;  1F1Z A;  1D5Y A;  2H8W A;  1HOM A;  5F0C A;  1K6Y A;  1TNT A;  1WVR A;  4LMY A;  4A93 J;  2FBI A;  2OA4 A;  2F4M B;  2FNA A;  1MH4 A;  2W85 A;  2FQ4 A;  3P5J A;  4DBQ A;  3FX3 A;  2A5W A;  2VUM J;  2P5V A;  2E7X A;  2LYC A;  3CUQ A;  5FD5 A;  2GLO A;  4KN4 X;  3C3W A;  4GCV A;  3K70 C;  3K0L A;  3VSL A;  5EGO B;  2ZCW A;  4MO7 A;  3R61 A;  4XRF A;  3U21 A;  2OUM A;  3S93 A;  5D6F A;  1FOY A;  1I6H J;  2HVR A;  2E60 A;  2NVY J;  3DEE A;  2K9L A;  3O3K A;  2VBX A;  2L4A A;  5H6Q A;  2R4G A;  3HRT A;  4XLC A;  3U1D A;  4RM2 A;  4L18 B;  3ZP5 A;  2UXX A;  1Z3Y A;  3P7N A;  1TBX A;  4M3B A;  3S1Q J;  3P9K A;  3WGI A;  3JSP A;  1GVD A;  2VBW A;  1KZH A;  1JHF A;  5DCM B;  4A3I J;  3GBG A;  1S7E A;  4UNO A;  4MGR A;  1JXS A;  3FXR A;  3PSI A;  2MH2 A;  3BJ6 A;  3BCB A;  5EGO A;  2NXN B;  2IPQ X;  3GZ5 A;  1A6Q A;  4IL6 C;  4U0V A;  1IXS B;  5F08 A;  2LKP A;  4RGR A;  2DT5 A;  2VKD A;  4KIG A;  2BBY A;  1KQ0 A;  4F52 A;  4IHY A;  3LA7 A;  1IN8 A;  2G9W A;  2LF8 A;  4D7M A;  1TWH J;  4RMN A;  4HX8 A;  4MFE A;  2QWW A;  3CCY A;  3RPQ A;  4BJ6 C;  4BDY A;  4U87 A;  2JA7 J;  2VAS A;  1YLF A;  3GO5 A;  1YOV B;  2EZH A;  5J8C A;  4I0A A;  4A0X A;  3H5R A;  5DCM A;  1MJ9 A;  3DKW A;  2HXO A;  1H8A C;  4ETS A;  2GZW A;  3G1M A;  5M3F J;  4BQN A;  4NNJ A;  2VC0 A;  5ICC A;  3OYJ A;  1KU3 A;  3S8P A;  4HNU A;  3RKW A;  2X6O A;  1H89 C;  1OFC X;  4CH7 A;  1EA3 A;  3K4L A;  1YG2 A;  2R0Q C;  1LFP A;  2DA7 A;  3FXQ A;  3W2A A;  4PJJ A;  3H0G J;  4JP0 A;  5K7Z A;  4M6V A;  4HAM A;  5E3N A;  1OPC A;  3UNG C;  1A5J A;  2DJN A;  3FWE A;  1UG0 A;  2K85 A;  3A01 B;  4CCO A;  1MW7 A;  5J4V A;  3RKY A;  3HOT A;  4Q47 A;  5H2F C;  2NVT J;  2JRM A;  3CO6 C;  3ZMZ A;  1BOA A;  1KGS A;  3DWL E;  4N4N B;  1FMW A;  3R6S A;  1U5T B;  1GXQ A;  1XCV A;  2BZT A;  1NK3 P;  1XS9 A;  2ZNY A;  1AOY A;  4A0Z A;  2FBH A;  3H3Z A;  2HQA A;  2HS5 A;  4OWR B;  3BTC A;  1V3F A;  4OAZ A;  1OCT C;  3W6V A;  3IKT A;  2STT A;  1FPQ A;  4JX4 A;  5TGT A;  4CO8 A;  4C3J J;  3ERM A;  2KIM A;  4HYE A;  3OYD A;  1IF1 A;  2E2J J;  1DGW Y;  3S16 J;  5HNH A;  4KJZ A;  3ZN1 A;  2HZD A;  4C30 A;  3ZMT A;  2XAS A;  4OMY A;  4B47 A;  2WB1 N;  2H94 A;  4LG3 A;  4U0W A;  3KP4 A;  5DEQ A;  2EH3 A;  3JRC A;  2RRE A;  4UHT A;  2CFO A;  1LDJ A;  1U5T A;  3S3M A;  3B6A A;  1AU7 A;  3W3C A;  3S15 J;  2DA3 A;  3FXU A;  1MIJ A;  3GFI A;  2IXS A;  1ZGW A;  2DMN A;  1MBE A;  2XGC A;  2YUS A;  4AIH A;  4Q4Z F;  1FWZ A;  2K5C A;  4UXN A;  2LVS A;  3DV8 A;  1Y8R B;  2RKH A;  2CW8 A;  1MMS A;  4M9S A;  2MGQ A;  4M72 A;  2O03 A;  1HF0 A;  1XGS A;  1BIB A;  1QZZ A;  3F0C A;  2HDW A;  3H3V K;  4Q5S F;  3W2W A;  4XKB A;  2HI3 A;  4G94 A;  4K2E A;  4CCJ A;  4OIP F;  2DK5 A;  1A35 A;  2A69 F;  4M74 A;  3GTO J;  2L02 A;  4M3D A;  1GUU A;  3FXL A;  4Y13 A;  3CCV I;  3O8G A;  3OYE A;  5M5Y J;  2DYR H;  2IRF G;  4J00 A;  2DAO A;  3D5L A;  3HL2 A;  3ZPL A;  5CVJ A;  2IA1 A;  3NQO A;  2F5E A;  4YIR X;  1YI2 I;  5FO5 A;  1Y1W J;  1TT5 B;  2LP0 A;  5CLS A;  1OCO H;  3G6E I;  2WB1 A;  1ODD A;  3K2Z A;  4XK4 A;  4BQA A;  4L0Z B;  4B1R A;  2DBB A;  1FTT A;  4G12 A;  1RR7 A;  4KIS A;  3A03 A;  2L7F P;  1SC7 A;  3FM3 A;  2VN2 A;  2V9P A;  3HSF A;  3KET A;  1U0J A;  5TJJ A;  2TCT A;  4WWC A;  2ACJ A;  1V5G A;  3C7J A;  1RPW A;  1E17 A;  1EF4 A;  2R7S A;  5CVI A;  1XDS A;  2HOA A;  3RJP A;  4L9N A;  3HRM A;  3SZG A;  1SFE A;  2DLL A;  2HPM A;  5EYR A;  3Q3S A;  2LD5 A;  1ACI A;  1I1S A;  3S1R J;  3RYR A;  3M1E A;  4JK1 X;  3PFI A;  5JHU A;  4V2F A;  1EKE A;  3K69 A;  1R36 A;  5D8K B;  3RKX A;  3IAM 2;  2QGU A;  5D6E A;  3ZOB A;  1FOK A;  1OKR A;  2VOO A;  3KYD B;  1FIP A;  1O3T A;  3CCU I;  2UXN A;  2ZNZ A;  3ZQQ A;  3H0D A;  4KNY A;  3KEQ A;  2FJ1 A;  3R60 A;  1U9N A;  2XF7 A;  2FML A;  2IGN A;  4NC6 A;  3KP7 A;  3SEQ A;  1B6A A;  4MNU A;  1XCB A;  2NS8 A;  3UR3 C;  1BA5 A;  1ZHF A;  3CMA I;  4QIW N;  3R0A A;  4RB2 C;  1FBS A;  4UUS B;  3HC7 A;  5BMZ A;  2JSC A;  1XGO A;  1WJE A;  2O8K A;  1D1C A;  2E1O A;  1RKT A;  4O5V A;  4U0Y A;  2I8D A;  4PJL A;  2VLA A;  1W7P D;  3K7A J;  1AKH A;  3WGG A;  3I4N J;  1WJC A;  4F3Q A;  1IN4 A;  2R5Z A;  4BAC A;  1YJN I;  3FK7 A;  2KRH A;  2JRT A;  2OC6 A;  2X9D A;  4PFP A;  2W25 A;  4XLP F;  4OU0 A;  1ONV A;  4KIC A;  3G71 I;  3MN2 A;  1QA6 A;  3DBH B;  1SMY F;  4X1E A;  1Q1V A;  5LHI A;  2IS1 A;  3B73 A;  1GXP A;  1IV6 A;  1XDU A;  1HBX G;  5TIS C;  1VQL I;  2IT0 A;  4HW0 A;  3E6B A;  2LC2 A;  3HYI A;  5DTD A;  2KHM A;  5JI6 A;  5JVG F;  1BR1 A;  3VEP A;  2HKO A;  3PQJ A;  2MLK A;  3PSF A;  1O57 A;  2WTE A;  5E18 F;  5BQT A;  1WZ2 A;  1UAA A;  1W1W E;  5LGU A;  2KIU A;  3SDB A;  3TKY A;  3LSR A;  2MG4 A;  4HG2 A;  1B72 B;  1H9T A;  2HQ5 A;  1WJA A;  1N75 A;  1FY7 A;  1QRY A;  4XLH A;  3VYU B;  2ZJR F;  2K40 A;  4JYK A;  2CH0 A;  2DT6 A;  3F6V A;  4II3 A;  5J1R A;  2EFQ A;  2LSO A;  4BUP A;  2BY2 A;  4XNF A;  2WAE A;  4HBL A;  5K5O A;  3ASN H;  3CD6 I;  2HZT A;  4E7L A;  3TBI A;  2Y0S N;  4GYG A;  2FOK A;  4XSX F;  2DDB A;  2R7X A;  1SVL A;  3KCC A;  2IP2 A;  4M3G A;  2WAF A;  3J81 Z;  2ZSI B;  1JKO C;  1MMA A;  3H92 A;  2EWN A;  1LFB A;  3QQA A;  2LFB A;  5IOY A;  1U9O A;  2QQ9 A;  3OS0 A;  2B9S A;  4F55 A;  1Z6R A;  3OIP A;  5J1U A;  2J5O A;  3KZZ A;  1MD0 A;  2VQG A;  3CP2 A;  5FKK A;  2P7C B;  2VXZ A;  1NH3 A;  2K3F A;  2HTS A;  2VBY A;  2TDX A;  4PFO A;  2JVH A;  4I98 B;  4DOZ A;  2ZO4 A;  3EDP A;  4CYC B;  1G2H A;  2HTJ A;  3GLX A;  2ME0 A;  1TLH B;  2NAZ A;  1NG7 A;  3BZK A;  1VI0 A;  2XC7 A;  4L0Y B; 
#chains in the Genus database with same CATH homology
 2X6Y A;  3DU5 A;  3H35 A;  3E0J B;  3HUG B;  4B43 A;  2PMZ A;  4XOR A;  2XDV A;  3RQ4 A;  2AQF A;  4ANJ A;  2BOL A;  1Z21 A;  2L5Q A;  2W7N A;  2V1N A;  1R6R A;  1WJ5 A;  3A1Y A;  4IQJ A;  1BR2 A;  2XF5 A;  2O5R A;  4XKV A;  4OAY A;  3TMO A;  3AL0 C;  2Y0S A;  3VDX A;  3K70 D;  4Y4R A;  3MMY B;  2W00 A;  2P0W A;  2WAD A;  1X1D A;  1DGR M;  4BEH B;  4Y3O A;  1X4O A;  3CP8 A;  2M7A A;  4PK4 A;  3KEY A;  3OIQ A;  3MKW B;  3ZCO A;  2ELJ A;  3C2G A;  2L9N A;  3HOS A;  2CV2 A;  4CCK A;  3FBI B;  3MKZ A;  1OR7 C;  4NC7 A;  3RPU D;  4DJA A;  3QYF A;  2JSP A;  3H5N A;  1PYV A;  4HPQ A;  3OR2 C;  3VYT B;  1YX3 A;  1E0E A;  2VJ4 A;  3DTK A;  2KPM A;  4X0G A;  3EUK L;  3EPZ A;  4BL0 B;  4DGW B;  1QU3 A;  4ZTF A;  3SYT A;  2L7K A;  3EUH C;  3BCA A;  4JQF A;  4BEH A;  3CJR B;  3QOD A;  4E7K A;  2RQQ A;  3OL3 A;  4RLF A;  4E7H A;  2MYS A;  4XN0 A;  2DJI A;  3H9Q A;  3PL8 A;  2XSJ C;  2E5Z A;  2DXI A;  3VWB A;  5HOO A;  2R7U A;  2WAQ A;  2ZXI A;  3AKZ A;  3PUB A;  2KLO A;  3A4C A;  2NOJ B;  3ZXS A;  2M0M A;  3K4B A;  2KDO A;  4XMY A;  2W1O A;  4NC8 A;  2R7V A;  3L2U A;  1W36 D;  1QHG A;  4IQ4 A;  4D9J A;  1D0Z A;  3TL4 X;  2E5N A;  3OY9 A;  4ZDL A;  3K4M A;  1WFX A;  4XQF A;  3J7A Y;  3HXL A;  3IAS 2;  4AYB A;  4FAS D;  4AU7 A;  4YRV A;  4ZDO A;  2GOM A;  3HKZ A;  2VJI A;  4DBR A;  3DU6 A;  1BOB A;  4E7I A;  3S3O A;  3OMY A;  3A2K A;  4ZC3 A;  3OOU A;  3RSN A;  3ZRG A;  2K9M A;  2ZFU A;  4FET A;  3DLA A;  2Q1Z B;  1K6Y A;  4JOM A;  2PJR B;  3QYB A;  2MD0 A;  1ZEL A;  4NUB A;  2X1D A;  2X1C A;  1T0F C;  4E7J A;  3LMM A;  3LSK A;  4XL9 A;  5FRM A;  1N77 A;  2BW3 B;  2WBM A;  1WJD A;  2XF6 A;  5HLT A;  2Z1D A;  2WY7 Q;  4B3X A;  5CQE A;  2BVL A;  4DBQ A;  3DKX A;  2WA0 A;  2A6T A;  2A5W A;  1HA8 A;  2LYC A;  3VYR B;  1D1B A;  2DCE A;  3K70 C;  4LIU A;  3VSL A;  1X1B A;  3L2W A;  4PUS A;  4D1Q A;  1V5E A;  4BE0 A;  3U21 A;  2OUM A;  4IX7 A;  3D5R C;  2F6C A;  3S93 A;  1MMD A;  2R7Q A;  4DIQ A;  2CUJ A;  2Z16 A;  2K3P A;  4H4K C;  2HVR A;  2OV7 A;  2E60 A;  2R7O A;  2K9L A;  3DEE A;  2MFZ A;  4RM3 A;  2R4G A;  4XLC A;  3L2Q A;  4RM2 A;  2XAU A;  3K4K A;  3CMM A;  4XKC A;  4PSX A;  1V5F A;  3OYB A;  5LFA A;  2BW3 A;  2IGO A;  1Z3Y A;  4BQQ A;  1MNE A;  3G2B A;  4CA0 A;  3GBG A;  2VJJ A;  3IP4 B;  2CUZ A;  3FKJ A;  3PSI A;  4XLF A;  3BCB A;  4CCM A;  1D0X A;  2CW7 A;  2DOA A;  4BQO A;  2V7F A;  3W2V A;  3OYH A;  2CV0 A;  2VJ5 A;  3S32 A;  2MAB A;  2VKD A;  3K6G A;  4ZJZ A;  4F52 A;  2W82 A;  1DQU A;  1N78 A;  4RMN A;  3ZGK A;  4II2 A;  2LOO A;  3M1C A;  2Z2S B;  3BG6 A;  3LSM A;  4LIT A;  4BJ6 C;  2VIX A;  3KX2 A;  4BDY A;  1G59 A;  4GRI A;  1X19 A;  4U87 A;  5KCM A;  2VAS A;  1FMV A;  2X6X A;  3ZR8 X;  3H5R A;  3HPG A;  3PFY A;  1LKX A;  1W36 C;  3CZ6 A;  2KQR A;  4BQN A;  4NNJ A;  3OYJ A;  1NG6 A;  2R7W A;  3S8P A;  4ZDP A;  4HNU A;  1TZL A;  2VPL A;  3VYS B;  4XN3 A;  3PNT A;  4CH7 A;  3OYF A;  1WJF A;  1Z3X A;  1EA3 A;  3K4L A;  1LFP A;  2JUG A;  2IS6 A;  3W2A A;  4PJJ A;  2IS2 A;  4E7S A;  3CJQ B;  3FDY A;  3LSH A;  4PSW A;  3BG7 A;  2IGM A;  3E1S A;  3I9V 2;  5LD2 C;  3UNG C;  3LL7 A;  2L9S A;  4E4H A;  1X4P A;  1UG0 A;  2KP6 A;  4R79 A;  4QPO A;  4CCN A;  4CCO A;  1MW7 A;  1GLN A;  2LBF B;  2M4G A;  3AFH A;  3HOT A;  3QOE A;  2V26 A;  3RTR A;  3PNV A;  3L2R A;  3LFU A;  1MMN A;  3OYK A;  3DWL E;  1D1A A;  1WJB A;  4N4N B;  4XOT A;  4CZC A;  1FMW A;  4E6K G;  2LG4 A;  4C9Y A;  2HQA A;  4OWR B;  2V4J C;  3PNY A;  4U7B A;  4OAZ A;  4N4O B;  2VQC A;  3FBN B;  4IKF A;  2LY1 A;  4IZZ A;  5TGT A;  3K4J A;  3OYD A;  2MC4 A;  2KZV A;  3OYM A;  4Y33 A;  1DGW Y;  5HNH A;  2KMU A;  1SFK A;  4KJZ A;  2HZD A;  4C30 A;  4B47 A;  4E7Z A;  4LG3 A;  3EUA A;  2JVG A;  2RRE A;  2CFO A;  5HVQ C;  2F4I A;  3H9G A;  3S3M A;  2M4K A;  1JI8 A;  3C2H A;  3W3C A;  3OWT A;  4F92 B;  4C2U A;  2IXS A;  4J01 A;  2K5C A;  1UEL B;  1BR4 A;  1PJR A;  2CW8 A;  1S9H A;  3DPL C;  4P1W A;  1QHH D;  2CS3 A;  4HRI A;  3LSI A;  1MND A;  2HDW A;  1LVK A;  2LRD A;  3W2W A;  4XKB A;  2PJR A;  3K10 A;  2VB6 A;  4CCJ A;  4BDZ A;  2GOX B;  3AL0 B;  4F91 B;  4CSW A;  4BE1 A;  4ZTJ A;  2LH9 A;  3OYI A;  3OR1 C;  3OYE A;  3OL4 A;  4BJ5 C;  4XLA A;  2VQH A;  4CCL A;  4J00 A;  3D5L A;  3HL2 A;  2KRC A;  4PJN A;  4XKW A;  2BVM A;  3RCO A;  1Z7L A;  2R7T A;  2LRE A;  3D5S C;  4ZYA A;  1IRX A;  2RNG A;  4YEJ A;  4XR6 A;  4BS9 A;  3KYL A;  2WB1 A;  5FRO A;  2HVS A;  4F93 B;  2E1M B;  1G8X A;  4KIS A;  3OYA A;  2X1E A;  3H9J A;  3MD2 A;  1U0J A;  3QYE A;  3DPT A;  4RLQ A;  1V5G A;  1X1A A;  2R7S A;  4KT6 A;  5JHF A;  3SZG A;  2ZSH B;  2WY8 Q;  4BU2 A;  3K4C A;  4CUG A;  2HPM A;  4HSR A;  3OS2 A;  3K4N A;  2HPI A;  4MLO A;  1YX5 A;  3N05 A;  4YEL A;  2X85 A;  3IAM 2;  2QKM B;  4HEA 2;  4XM3 A;  4C2T A;  4AVZ A;  3OYL A;  2VKH A;  3ZQQ A;  2M7B A;  3H5A A;  1D0Y A;  3H0D A;  5CPR B;  2F5V A;  4PJM A;  2XF7 A;  3DPU A;  2IGN A;  3SEQ A;  2Q2E B;  2VL8 A;  2E1M C;  3UR3 C;  2HU9 A;  2KL4 A;  4G6T B;  2UWM A;  3I3L A;  2ZXH A;  2VXD A;  3OS1 A;  3HC7 A;  1LDK B;  1WJE A;  1D1C A;  3HG9 A;  4ITV A;  2JA2 A;  2I8D A;  2CV1 A;  4PJL A;  2VLA A;  3L2V A;  4LIV A;  1WJC A;  4F3Q A;  2R7R A;  2AQE A;  3IUO A;  4BAC A;  2HNH A;  1J09 A;  1X1C A;  2KRH A;  5FRN A;  2OC6 A;  3CF2 A;  4PFP A;  5CQG A;  3OYG A;  3DTE A;  2V9K A;  3CES A;  5KHD A;  3MKY B;  3SEZ A;  1YE9 A;  3VSK A;  2DT7 B;  3NWT A;  2IS1 A;  5HNF A;  2LBF A;  2CMP A;  2LC2 A;  2M3A A;  2KHM A;  1VZ0 A;  2V6E A;  1BR1 A;  2HVQ A;  4HST A;  3PSF A;  4KIT B;  4P5O A;  4B44 A;  1UAA A;  1MMG A;  1DP3 A;  3ONQ A;  3SDB A;  4HG2 A;  3M8J A;  3LSG A;  2X51 A;  1AA7 A;  4BXF A;  1WJA A;  1N75 A;  4XLE A;  2VQL A;  4XLH A;  3VYU B;  2CH0 A;  2DT6 A;  4II3 A;  3OYC A;  3HPH A;  4HNT A;  4BGD A;  4BUP A;  2IS4 A;  4XNF A;  4B48 A;  2WAE A;  3FHN A;  2X6W A;  1OLT A;  4NQW B;  4E7L A;  2FUG 2;  3TBI A;  2IGK A;  1T95 A;  3DTI A;  3V42 A;  2R7X A;  1SAU A;  2WAF A;  2UV1 A;  2ZSI B;  4QPQ A;  1MMA A;  3PJR A;  3OYN A;  4BE2 A;  3DQV C;  1Y56 A;  2LY2 A;  2QKL B;  2UUZ A;  4XON A;  3OS0 A;  3S3N A;  4BJT A;  4F55 A;  3OIP A;  3BC8 A;  4EAT A;  3CP2 A;  2VQG A;  1Y6I A;  2W4S A;  3F9K A;  2VXZ A;  3DKY A;  1KON A;  1P9Q C;  2JVH A;  4DOZ A;  3BLY A;  5CKT A;  1TT0 A;  2L2O A;  4XOP A;  1ERD A;  1NG7 A;  5KNL A;  2XC7 A;  4PFO A;  3NWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...