2VQFI

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqfI00
3WU4A 4KHPE 5FLXQ 2HK2A 1H73A 4DR5I 1KKHA 2V2QA 4DR2I 4Z7CA 3V5RA 1B63A 3J80Q 1N32E 4JI8I 1IBME 1FJGE 4JI0E 1U2RA 4DUYE 2R42A 4X65I 4JI2I 2UXBE 4LF9I 1NZ0A 2UXBI 1J5EE 3PYDA 4DV2E 4DR6E 4LF8I 1XNRE 5IWAI 3ZKBA 4FWGA 5L3JA 4Z7YA 4DR6I 4YY3E 4M1KA 3LTOA 1XNRI 1OJ4A 2VQEE 4JG4A 1NHHA 5LMNE 4NXMI 2R3VA 1ZXMA 1FWLA 4DV7E 1ELOA 4AQYE 5IT9C 4DV5E 3M6AA 1ZM9A 4LF4E 1RREA 2ZITA 5LMUE 4MYUA 4ZVIA 4DXLA 1N34E 4LFAE 3PYEA 4LFAI 1DARA 1S4EA 4DR4E 4DR7E 4WUBA 4LF7I 1WUUA 3V2UC 1I94E 4K0KE 1HNWE 4DR4I 4DR7I 4ED4A 3J81C 1D6TA 1Z0WA 1I94I 2UUCE 4JI5E 1N0UA 4OX9E 4DR1E 2DEJA 4X64E 1RR9A 2A2CA 4JI5I 1N36I 4RPFA 1ZM4A 2Q2EB 1KTVA 4DPWA 2UXDI 1N33E 1FNMA 3T1HE 1EA6A 3ZM7A 1FWKA 4UTGA 3T1HI 1Z0GA 4JYAE 2X7IA 2UUBI 1XHKA 2UUAE 2BM0A 4DR3E 2UXCI 3CWVA 1HNZI 2EFGA 4EMDA 2UUAI 4B3MI 4B3TE 2ZM6E 4KHPI 2DEIA 1B62A 4FN5A 4DPXA 3JAMC 4USKA 2VF3A 3B78A 4JI6E 5IT9Q 3QT6A 4DV1E 3B8HA 1ZXNA 1XMOE 4PU9A 2UU9E 1N32I 1IBMI 1FJGI 4JI0I 2UU9I 2CZ9A 4DUYI 2V2ZA 1Z5AA 4HY1A 1EI1A 1XNQE 4DV6E 1J5EI 4DV2I 1H74A 4LFCE 3J81Q 1Z0BA 4YY3I 4NXNE 1KIJA 3LPSA 3K1JA 5A2QC 3H4LA 5LL6R 2VQEI 2F4VE 1Z0EA 4DUZE 4PRXA 1HNXE 1BKNA 5LMNI 2F4VI 4GKJE 4DUZI 3QT8A 1XMQE 4DV7I 4AQYI 1XMQI 3J7AG 4B3SE 5FLXC 1H7SA 4DV5I 4LF4I 2HKJA 4LF6E 4DU7A 5LMUI 2HK3A 4DPUA 4X66E 1N34I 3PYGA 3J80C 4DV0E 5BR8E 4WUDA 4DV0I 4K0KI 1HNWI 2NPFA 2HKEA 4FWDA 2UUCI 1K47A 1KVKA 4OX9I 4DR1I 4X62E 4X64I 2XEXA 1IBKE 5GMEA 1MX0A 1NHJA 4JI1E 1IBKI 4JI7E 3OTOE 1N33I 2HHHE 4LFBE 4JV5E 3OTOI 4DV3E 1PKPA 4GKKE 2A2DA 2HHHI 1Z0VA 4USMA 4LF5E 4JYAI 4WUCA 3PYFA 2V2VA 4DR3I 1FKAE 3F0NA 4JI3E 4B3RE 5A2QQ 2LJPA 4B3RI 1A6FA 4B3TI 4YHHE 2ZM6I 2E1RA 1MG7A 1NHIA 1PIEA 4JI6I 4DV1I 1XMOI 4DR5E 4DR2E 4HACB 1Z0TA 4JI8E 2HFUA 2BV3A 4JI2E 4X65E 1XNQI 4DV6I 4LF9E 3ZZ0A 2OI2A 4LFCI 2AJ4A 2V8PA 2V34A 4LF8E 4NXNI 1Z0CA 5IWAE 1QZRA 4P7AA 2J7KA 1HR0E 4XTJA 3T1YE 4FW9A 1HNXI 4GKJI 1HR0I 4URLA 3T1YI 4DV4E 5GMDA 1IBLE 4NXME 3D4JA 4FWHA 4B3SI 1Z5CA 4DV4I 4P52A 1IBLI 3GONA 4LF6I 2E5LE 1Z5BA 3QT5A 4X66I 1H72C 2E5LI 4HYMA 3K17A 3WU5A 4PRVA 4I3HA 5BR8I 1VISA 3QT7A 1H7UA 4DPTA 3JAMQ 4HXZA 4JI4E 4LF7E 4X62I 4JI4I 1MU5A 2X36A 1FI4A 3J7AM 4JI1I 3Q1QA 1N0VC 4JI7I 4MYTA 3HULA 1N36E 1Z59A 2BM1A 1PVGA 2WW4A 3ZKDA 1ZM2A 4DPYA 2UXDE 4LFBI 4DU8A 4JV5I 4DV3I 4UT4A 4GKKI 4HACA 3WU6A 2HFSA 4KQVA 1ZM3A 4LF5I 3ZZUA 2VQFE 4JI3I 3B82A 3WU3A 2ZBKB 3LNUA 2VQFI 2UUBE 1UEKA 3ZZTA 2UXCE 2GS8A 1HNZE 4R1FA 4YHHI 1S16A 4B3ME
chains in the Genus database with same CATH superfamily
3WU4A 4KHPE 5FLXQ 2HK2A 3PS3A 3DD6A 4J3DA 2IOQA 3U1KA 1H73A 1Y4SA 3PRYA 1RHYA 4DR5I 1KKHA 3P3EA 2V2QA 4DR2I 4Z7CA 3V5RA 3CDIA 1B63A 3J80Q 5C0XA 1N32E 4JI8I 2IOPA 1IBME 1FJGE 4JI0E 4MU0A 5JEAE 2O1TA 1U2RA 4DUYE 2R42A 4X65I 4JI2I 2CG9A 4MQYA 2UXBE 2NN6C 4LF9I 1USVA 1P42A 1NZ0A 5K36F 4IZKB 2UXBI 1J5EE 3PYDA 4DV2E 4DR6E 2NN6F 4LF8I 3P06A 1XNRE 5IWAI 3ZKBA 4FWGA 4LOMA 5L3JA 4Z7YA 4DR6I 4YY3E 4M1KA 3LTOA 1XNRI 5DROA 2GO4A 1OJ4A 5C0XE 2VQEE 4JG4A 1NHHA 3CDJA 5C0XB 5LMNE 4NXMI 2R3VA 1ZXMA 4BA1A 5FWKA 1FWLA 4DV7E 4MDTA 1ELOA 4AQYE 4IFDC 5IT9C 4DV5E 3M6AA 5JEAD 1UDOA 1ZM9A 4LF4E 1RREA 4OO1D 2ZITA 5LMUE 4MYUA 4ZVIA 2Z5BB 1Y6ZA 4DXLA 1N34E 4LFAE 2PNMA 3PYEA 4LFAI 1DARA 1S4EA 4DR4E 4DR7E 2PO2B 4WUBA 4LF7I 1WUUA 3V2UC 1I94E 4K0KE 1HNWE 4DR4I 4DR7I 4ED4A 2Z5CA 3J81C 1D6TA 1Y5YA 1Z0WA 1I94I 2UUCE 4JI5E 1N0UA 4OX9E 4DR1E 2DEJA 4X64E 2O1WA 1RR9A 4ISAA 2A2CA 4JI5I 1E3PA 4GQUA 4IFDE 1N36I 4RPFA 1ZM4A 2Q2EB 3HJCA 3K85A 1KTVA 4DPWA 4IFDB 4QNKA 4AIDA 2BA1G 2UXDI 4BA2A 1N33E 2JT2A 4U3BA 1FNMA 3T1HE 1EA6A 3ZM7A 1FWKA 4UTGA 3T1HI 1Z0GA 4JYAE 2X7IA 2UUBI 1XHKA 2UUAE 2BM0A 4DR3E 2UXCI 3H1CA 4IZKA 3CWVA 1HNZI 2EFGA 4EMDA 2UUAI 4B3MI 4B3TE 2PNLA 2ZM6E 2O1UA 4OKGA 1UDSA 4KHPI 2DEIA 2PNZB 1B62A 4FN5A 4DPXA 3JAMC 4BA2B 1R6MA 1OYPA 4USKA 3GMEA 4OZEA 2VF3A 5DRRA 3B78A 4FW6A 2WP8B 4JI6E 5IT9Q 3QT6A 4DV1E 4OO1F 3B8HA 1ZXNA 1XMOE 4IS9A 4PU9A 2UU9E 1N32I 5K36C 1Y60A 1IBMI 1FJGI 3Q6NA 4JI0I 3Q6MA 2UU9I 2CZ9A 1XXEA 1YHCA 4DUYI 2BA0G 3L7ZB 2V2ZA 1Z5AA 2NN6A 2Z5BA 4LCGA 2J65A 4HY1A 1EI1A 1XNQE 4DV6E 1J5EI 4DV2I 1H74A 4LFCE 3J81Q 1Z0BA 2C39A 4QNJA 4YY3I 1USUA 2PO2A 4NXNE 1KIJA 1OYSA 3K1JA 3LPSA 3H4LA 5A2QC 5LL6R 2VQEI 4N3OA 3M7NG 2F4VE 1Z0EA 4DUZE 4PRXA 1HNXE 1BKNA 5LMNI 2F4VI 1R6LA 4GKJE 5K36E 4DUZI 3QT8A 1XMQE 4DV7I 3M85G 2NN6E 4AQYI 1XMQI 5K36B 3J7AG 4B3SE 5FLXC 1H7SA 4DV5I 4LF4I 2HKJA 4NBQA 4IFDA 2NN6B 4LF6E 4DU7A 5LMUI 2HK3A 4LCHA 4DPUA 4X66E 2JE6A 5EL9A 1N34I 5DRPA 2C39B 3PYGA 4FW3A 3J80C 4DV0E 5BR8E 5C0XD 4WUDA 4DV0I 4LPFA 4MU4A 4K0KI 1HNWI 2NPFA 3M7ND 4FW7A 2HKEA 4FWDA 2CGEA 2UUCI 1K47A 1KVKA 4OX9I 4DR1I 4X62E 4X64I 2C38B 2F1DA 2PNZA 2XEXA 1IBKE 5GMEA 4IZJB 1MX0A 1NHJA 4JI1E 1IBKI 4JI7E 2JE6B 2WP8A 4FW5A 3OTOE 1N33I 2HHHE 1VI7A 4LFBE 4JV5E 3OTOI 4DV3E 1PKPA 4GKKE 2PO0B 2A2DA 2HHHI 2IESA 1Z0VA 3L7ZA 3P3GA 4USMA 4LF5E 4JYAI 4WUCA 3PYFA 5DNXA 2V2VA 4DR3I 3PS2A 1FKAE 3F0NA 4JI3E 4B3RE 3P3CA 5A2QQ 2LJPA 5JEAC 4B3RI 1A6FA 4B3TI 4YHHE 2ZM6I 1UDQA 4IFDD 4OO1C 2C37B 5JEAF 2E1RA 1MG7A 1NHIA 2BA1D 1PIEA 2Z5EA 2O3ZA 4JI6I 4DV1I 1XMOI 4DR5E 1OYRA 4LCFA 1UDNA 4DR2E 4HACB 3P76A 5C0XC 1E3HA 2JEBB 5K36A 2O1VA 2GO3A 2BR2B 3PS1A 1Z0TA 4MU3A 4JI8E 2PO1A 2JEAB 4FW4A 5C0XF 2HFUA 3GLLA 2BV3A 3U1YA 4JI2E 4X65E 1XNQI 4DV6I 4LF9E 3ZZ0A 2OI2A 4LFCI 2AJ4A 4OO1E 1YH8A 2V8PA 2V34A 2CVEA 4AIMA 5JEAB 4U3DA 2IERA 4LF8E 4NXNI 1Z0CA 5IWAE 4OO1B 2VESA 1QZRA 4P7AA 2J7KA 1HR0E 4XTJA 3T1YE 4FW9A 1HNXI 4GKJI 1HR0I 2C38A 4URLA 3T1YI 4DV4E 5GMDA 1IBLE 2PO1B 4IZJA 4NXME 3D4JA 2BA0D 4FWHA 4B3SI 1Z5CA 5DRQA 5DNLA 4DV4I 4P52A 1IBLI 3GONA 4LF6I 2E5LE 1Z5BA 3QT5A 4X66I 1H72C 2E5LI 2GQ0A 2PO0A 3B4TA 4HYMA 3K17A 3WU5A 4PRVA 4IFDF 4I3HA 4MU1A 5BR8I 1VISA 3QT7A 1H7UA 4DPTA 3JAMQ 3UHMA 4HXZA 4JI4E 4LF7E 5K36D 4X62I 4JI4I 3NZKA 3M85D 1MU5A 2NN6D 2X36A 2WNRA 2C37A 1Y4UA 4BA1B 1FI4A 3J7AM 4JI1I 3Q1QA 3KRNA 1N0VC 4JI7I 4MYTA 3HULA 1N36E 1Z59A 2BM1A 1PVGA 2WW4A 3HKMA 3ZKDA 1ZM2A 4DPYA 4AM3A 2UXDE 4LFBI 4DU8A 4JV5I 5ELWA 4UT4A 4DV3I 4GKKI 1HK7A 4HACA 3WU6A 2JEBA 2BR2A 2HFSA 4KQVA 1ZM3A 2AE8A 5EKWA 4LF5I 2JEAA 3ZZUA 2VQFE 4JI3I 3GCMA 3B82A 3WU3A 2ZBKB 3LNUA 2VQFI 2UUBE 4IZJD 1UEKA 3ZZTA 2UXCE 2GS8A 1HNZE 2WNRB 4R1FA 2Z5CB 5JEAA 1S16A 4YHHI 4B3ME 4OO1A
chains in the Genus database with same CATH topology
3WU4A 4KHPE 5FLXQ 2HK2A 2IOQA 1H73A 1Y4SA 3PRYA 4DR5I 1KKHA 2V2QA 4DR2I 4Z7CA 3V5RA 1B63A 3J80Q 1N32E 4JI8I 2IOPA 1IBME 1FJGE 4JI0E 2O1TA 1U2RA 4DUYE 2R42A 4X65I 4JI2I 2CG9A 2UXBE 4LF9I 1USVA 1NZ0A 4IZKB 2UXBI 1J5EE 3PYDA 4DV2E 4DR6E 4LF8I 3P06A 1XNRE 5IWAI 3ZKBA 4FWGA 5L3JA 4Z7YA 4DR6I 4YY3E 4M1KA 3LTOA 1XNRI 1OJ4A 2VQEE 4JG4A 1NHHA 5LMNE 4NXMI 2R3VA 1ZXMA 5FWKA 1FWLA 4DV7E 1ELOA 4AQYE 5IT9C 4DV5E 3M6AA 1ZM9A 4LF4E 1RREA 2ZITA 5LMUE 4MYUA 2Z5BB 4ZVIA 1Y6ZA 4DXLA 1N34E 4LFAE 2PNMA 3PYEA 4LFAI 1DARA 1S4EA 4DR4E 4DR7E 4WUBA 4LF7I 1WUUA 3V2UC 1I94E 4K0KE 1HNWE 4DR4I 4DR7I 4ED4A 2Z5CA 3J81C 1D6TA 1Z0WA 1I94I 2UUCE 4JI5E 1N0UA 4OX9E 4DR1E 2DEJA 4X64E 2O1WA 1RR9A 2A2CA 4JI5I 1N36I 4RPFA 1ZM4A 2Q2EB 3HJCA 3K85A 1KTVA 4DPWA 2UXDI 1N33E 1FNMA 3T1HE 1EA6A 3ZM7A 1FWKA 4UTGA 3T1HI 1Z0GA 4JYAE 2X7IA 2UUBI 1XHKA 2UUAE 2BM0A 4DR3E 2UXCI 4IZKA 3CWVA 1HNZI 2EFGA 4EMDA 2UUAI 4B3MI 4B3TE 2PNLA 2ZM6E 2O1UA 4KHPI 2DEIA 1B62A 4FN5A 4DPXA 3JAMC 4USKA 2VF3A 3B78A 4JI6E 5IT9Q 3QT6A 4DV1E 3B8HA 1ZXNA 1XMOE 4PU9A 2UU9E 1N32I 1IBMI 1FJGI 3Q6NA 4JI0I 3Q6MA 2UU9I 2CZ9A 4DUYI 2V2ZA 1Z5AA 2Z5BA 4HY1A 1EI1A 1XNQE 4DV6E 1J5EI 4DV2I 1H74A 4LFCE 3J81Q 1Z0BA 4YY3I 1USUA 4NXNE 1KIJA 3LPSA 3K1JA 5A2QC 3H4LA 5LL6R 2VQEI 4N3OA 2F4VE 1Z0EA 4DUZE 4PRXA 1HNXE 1BKNA 5LMNI 2F4VI 4GKJE 4DUZI 3QT8A 1XMQE 4DV7I 4AQYI 1XMQI 3J7AG 4B3SE 5FLXC 1H7SA 4DV5I 4LF4I 2HKJA 4LF6E 4DU7A 5LMUI 2HK3A 4X66E 4DPUA 1N34I 3PYGA 3J80C 4DV0E 5BR8E 4WUDA 4DV0I 4K0KI 1HNWI 2NPFA 2HKEA 4FWDA 2CGEA 2UUCI 1K47A 1KVKA 4OX9I 4DR1I 4X62E 4X64I 2XEXA 1IBKE 5GMEA 4IZJB 1MX0A 1NHJA 4JI1E 1IBKI 4JI7E 3OTOE 1N33I 2HHHE 4LFBE 4JV5E 3OTOI 4DV3E 1PKPA 4GKKE 2A2DA 2HHHI 1Z0VA 4USMA 4LF5E 4JYAI 4WUCA 3PYFA 2V2VA 4DR3I 1FKAE 3F0NA 4JI3E 4B3RE 5A2QQ 2LJPA 4B3RI 1A6FA 4B3TI 4YHHE 2ZM6I 2E1RA 1MG7A 1NHIA 1PIEA 2Z5EA 4JI6I 4DV1I 1XMOI 4DR5E 4DR2E 4HACB 2O1VA 1Z0TA 4JI8E 2HFUA 2BV3A 4JI2E 4X65E 1XNQI 4DV6I 4LF9E 3ZZ0A 2OI2A 4LFCI 2AJ4A 2V8PA 2V34A 4LF8E 4NXNI 1Z0CA 5IWAE 1QZRA 4P7AA 2J7KA 1HR0E 4XTJA 3T1YE 4FW9A 1HNXI 4GKJI 1HR0I 4URLA 3T1YI 4DV4E 5GMDA 1IBLE 4IZJA 4NXME 3D4JA 4FWHA 4B3SI 1Z5CA 4DV4I 4P52A 1IBLI 3GONA 4LF6I 2E5LE 1Z5BA 3QT5A 4X66I 1H72C 2E5LI 2GQ0A 4HYMA 3K17A 3WU5A 4PRVA 4I3HA 5BR8I 1VISA 3QT7A 1H7UA 4DPTA 3JAMQ 4HXZA 4JI4E 4LF7E 4X62I 4JI4I 1MU5A 2X36A 1Y4UA 1FI4A 3J7AM 4JI1I 3Q1QA 1N0VC 4JI7I 4MYTA 3HULA 1N36E 1Z59A 2BM1A 1PVGA 2WW4A 3ZKDA 1ZM2A 4DPYA 2UXDE 4LFBI 4DU8A 4JV5I 4DV3I 4UT4A 4GKKI 1HK7A 4HACA 3WU6A 2HFSA 4KQVA 1ZM3A 4LF5I 3ZZUA 2VQFE 4JI3I 3B82A 3WU3A 2ZBKB 3LNUA 2VQFI 2UUBE 4IZJD 1UEKA 3ZZTA 2UXCE 2GS8A 1HNZE 4R1FA 2Z5CB 4YHHI 1S16A 4B3ME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU4 A;  4KHP E;  5FLX Q;  2HK2 A;  1H73 A;  4DR5 I;  1KKH A;  2V2Q A;  4DR2 I;  4Z7C A;  3V5R A;  1B63 A;  3J80 Q;  1N32 E;  4JI8 I;  1IBM E;  1FJG E;  4JI0 E;  1U2R A;  4DUY E;  2R42 A;  4X65 I;  4JI2 I;  2UXB E;  4LF9 I;  1NZ0 A;  2UXB I;  1J5E E;  3PYD A;  4DV2 E;  4DR6 E;  4LF8 I;  1XNR E;  5IWA I;  3ZKB A;  4FWG A;  5L3J A;  4Z7Y A;  4DR6 I;  4YY3 E;  4M1K A;  3LTO A;  1XNR I;  1OJ4 A;  2VQE E;  4JG4 A;  1NHH A;  5LMN E;  4NXM I;  2R3V A;  1ZXM A;  1FWL A;  4DV7 E;  1ELO A;  4AQY E;  5IT9 C;  4DV5 E;  3M6A A;  1ZM9 A;  4LF4 E;  1RRE A;  2ZIT A;  5LMU E;  4MYU A;  4ZVI A;  4DXL A;  1N34 E;  4LFA E;  3PYE A;  4LFA I;  1DAR A;  1S4E A;  4DR4 E;  4DR7 E;  4WUB A;  4LF7 I;  1WUU A;  3V2U C;  1I94 E;  4K0K E;  1HNW E;  4DR4 I;  4DR7 I;  4ED4 A;  3J81 C;  1D6T A;  1Z0W A;  1I94 I;  2UUC E;  4JI5 E;  1N0U A;  4OX9 E;  4DR1 E;  2DEJ A;  4X64 E;  1RR9 A;  2A2C A;  4JI5 I;  1N36 I;  4RPF A;  1ZM4 A;  2Q2E B;  1KTV A;  4DPW A;  2UXD I;  1N33 E;  1FNM A;  3T1H E;  1EA6 A;  3ZM7 A;  1FWK A;  4UTG A;  3T1H I;  1Z0G A;  4JYA E;  2X7I A;  2UUB I;  1XHK A;  2UUA E;  2BM0 A;  4DR3 E;  2UXC I;  3CWV A;  1HNZ I;  2EFG A;  4EMD A;  2UUA I;  4B3M I;  4B3T E;  2ZM6 E;  4KHP I;  2DEI A;  1B62 A;  4FN5 A;  4DPX A;  3JAM C;  4USK A;  2VF3 A;  3B78 A;  4JI6 E;  5IT9 Q;  3QT6 A;  4DV1 E;  3B8H A;  1ZXN A;  1XMO E;  4PU9 A;  2UU9 E;  1N32 I;  1IBM I;  1FJG I;  4JI0 I;  2UU9 I;  2CZ9 A;  4DUY I;  2V2Z A;  1Z5A A;  4HY1 A;  1EI1 A;  1XNQ E;  4DV6 E;  1J5E I;  4DV2 I;  1H74 A;  4LFC E;  3J81 Q;  1Z0B A;  4YY3 I;  4NXN E;  1KIJ A;  3LPS A;  3K1J A;  5A2Q C;  3H4L A;  5LL6 R;  2VQE I;  2F4V E;  1Z0E A;  4DUZ E;  4PRX A;  1HNX E;  1BKN A;  5LMN I;  2F4V I;  4GKJ E;  4DUZ I;  3QT8 A;  1XMQ E;  4DV7 I;  4AQY I;  1XMQ I;  3J7A G;  4B3S E;  5FLX C;  1H7S A;  4DV5 I;  4LF4 I;  2HKJ A;  4LF6 E;  4DU7 A;  5LMU I;  2HK3 A;  4DPU A;  4X66 E;  1N34 I;  3PYG A;  3J80 C;  4DV0 E;  5BR8 E;  4WUD A;  4DV0 I;  4K0K I;  1HNW I;  2NPF A;  2HKE A;  4FWD A;  2UUC I;  1K47 A;  1KVK A;  4OX9 I;  4DR1 I;  4X62 E;  4X64 I;  2XEX A;  1IBK E;  5GME A;  1MX0 A;  1NHJ A;  4JI1 E;  1IBK I;  4JI7 E;  3OTO E;  1N33 I;  2HHH E;  4LFB E;  4JV5 E;  3OTO I;  4DV3 E;  1PKP A;  4GKK E;  2A2D A;  2HHH I;  1Z0V A;  4USM A;  4LF5 E;  4JYA I;  4WUC A;  3PYF A;  2V2V A;  4DR3 I;  1FKA E;  3F0N A;  4JI3 E;  4B3R E;  5A2Q Q;  2LJP A;  4B3R I;  1A6F A;  4B3T I;  4YHH E;  2ZM6 I;  2E1R A;  1MG7 A;  1NHI A;  1PIE A;  4JI6 I;  4DV1 I;  1XMO I;  4DR5 E;  4DR2 E;  4HAC B;  1Z0T A;  4JI8 E;  2HFU A;  2BV3 A;  4JI2 E;  4X65 E;  1XNQ I;  4DV6 I;  4LF9 E;  3ZZ0 A;  2OI2 A;  4LFC I;  2AJ4 A;  2V8P A;  2V34 A;  4LF8 E;  4NXN I;  1Z0C A;  5IWA E;  1QZR A;  4P7A A;  2J7K A;  1HR0 E;  4XTJ A;  3T1Y E;  4FW9 A;  1HNX I;  4GKJ I;  1HR0 I;  4URL A;  3T1Y I;  4DV4 E;  5GMD A;  1IBL E;  4NXM E;  3D4J A;  4FWH A;  4B3S I;  1Z5C A;  4DV4 I;  4P52 A;  1IBL I;  3GON A;  4LF6 I;  2E5L E;  1Z5B A;  3QT5 A;  4X66 I;  1H72 C;  2E5L I;  4HYM A;  3K17 A;  3WU5 A;  4PRV A;  4I3H A;  5BR8 I;  1VIS A;  3QT7 A;  1H7U A;  4DPT A;  3JAM Q;  4HXZ A;  4JI4 E;  4LF7 E;  4X62 I;  4JI4 I;  1MU5 A;  2X36 A;  1FI4 A;  3J7A M;  4JI1 I;  3Q1Q A;  1N0V C;  4JI7 I;  4MYT A;  3HUL A;  1N36 E;  1Z59 A;  2BM1 A;  1PVG A;  2WW4 A;  3ZKD A;  1ZM2 A;  4DPY A;  2UXD E;  4LFB I;  4DU8 A;  4JV5 I;  4DV3 I;  4UT4 A;  4GKK I;  4HAC A;  3WU6 A;  2HFS A;  4KQV A;  1ZM3 A;  4LF5 I;  3ZZU A;  2VQF E;  4JI3 I;  3B82 A;  3WU3 A;  2ZBK B;  3LNU A;  2VQF I;  2UUB E;  1UEK A;  3ZZT A;  2UXC E;  2GS8 A;  1HNZ E;  4R1F A;  4YHH I;  1S16 A;  4B3M E; 
#chains in the Genus database with same CATH topology
 3WU4 A;  4KHP E;  5FLX Q;  2HK2 A;  3PS3 A;  3DD6 A;  4J3D A;  2IOQ A;  3U1K A;  1H73 A;  1Y4S A;  3PRY A;  1RHY A;  4DR5 I;  1KKH A;  3P3E A;  2V2Q A;  4DR2 I;  4Z7C A;  3V5R A;  3CDI A;  1B63 A;  3J80 Q;  5C0X A;  1N32 E;  4JI8 I;  2IOP A;  1IBM E;  1FJG E;  4JI0 E;  4MU0 A;  5JEA E;  2O1T A;  1U2R A;  4DUY E;  2R42 A;  4X65 I;  4JI2 I;  2CG9 A;  4MQY A;  2UXB E;  2NN6 C;  4LF9 I;  1USV A;  1P42 A;  1NZ0 A;  5K36 F;  4IZK B;  2UXB I;  1J5E E;  3PYD A;  4DV2 E;  4DR6 E;  2NN6 F;  4LF8 I;  3P06 A;  1XNR E;  5IWA I;  3ZKB A;  4FWG A;  4LOM A;  5L3J A;  4Z7Y A;  4DR6 I;  4YY3 E;  4M1K A;  3LTO A;  1XNR I;  5DRO A;  2GO4 A;  1OJ4 A;  5C0X E;  2VQE E;  4JG4 A;  1NHH A;  3CDJ A;  5C0X B;  5LMN E;  4NXM I;  2R3V A;  1ZXM A;  4BA1 A;  5FWK A;  1FWL A;  4DV7 E;  4MDT A;  1ELO A;  4AQY E;  4IFD C;  5IT9 C;  4DV5 E;  3M6A A;  5JEA D;  1UDO A;  1ZM9 A;  4LF4 E;  1RRE A;  4OO1 D;  2ZIT A;  5LMU E;  4MYU A;  4ZVI A;  2Z5B B;  1Y6Z A;  4DXL A;  1N34 E;  4LFA E;  2PNM A;  3PYE A;  4LFA I;  1DAR A;  1S4E A;  4DR4 E;  4DR7 E;  2PO2 B;  4WUB A;  4LF7 I;  1WUU A;  3V2U C;  1I94 E;  4K0K E;  1HNW E;  4DR4 I;  4DR7 I;  4ED4 A;  2Z5C A;  3J81 C;  1D6T A;  1Y5Y A;  1Z0W A;  1I94 I;  2UUC E;  4JI5 E;  1N0U A;  4OX9 E;  4DR1 E;  2DEJ A;  4X64 E;  2O1W A;  1RR9 A;  4ISA A;  2A2C A;  4JI5 I;  1E3P A;  4GQU A;  4IFD E;  1N36 I;  4RPF A;  1ZM4 A;  2Q2E B;  3HJC A;  3K85 A;  1KTV A;  4DPW A;  4IFD B;  4QNK A;  4AID A;  2BA1 G;  2UXD I;  4BA2 A;  1N33 E;  2JT2 A;  4U3B A;  1FNM A;  3T1H E;  1EA6 A;  3ZM7 A;  1FWK A;  4UTG A;  3T1H I;  1Z0G A;  4JYA E;  2X7I A;  2UUB I;  1XHK A;  2UUA E;  2BM0 A;  4DR3 E;  2UXC I;  3H1C A;  4IZK A;  3CWV A;  1HNZ I;  2EFG A;  4EMD A;  2UUA I;  4B3M I;  4B3T E;  2PNL A;  2ZM6 E;  2O1U A;  4OKG A;  1UDS A;  4KHP I;  2DEI A;  2PNZ B;  1B62 A;  4FN5 A;  4DPX A;  3JAM C;  4BA2 B;  1R6M A;  1OYP A;  4USK A;  3GME A;  4OZE A;  2VF3 A;  5DRR A;  3B78 A;  4FW6 A;  2WP8 B;  4JI6 E;  5IT9 Q;  3QT6 A;  4DV1 E;  4OO1 F;  3B8H A;  1ZXN A;  1XMO E;  4IS9 A;  4PU9 A;  2UU9 E;  1N32 I;  5K36 C;  1Y60 A;  1IBM I;  1FJG I;  3Q6N A;  4JI0 I;  3Q6M A;  2UU9 I;  2CZ9 A;  1XXE A;  1YHC A;  4DUY I;  2BA0 G;  3L7Z B;  2V2Z A;  1Z5A A;  2NN6 A;  2Z5B A;  4LCG A;  2J65 A;  4HY1 A;  1EI1 A;  1XNQ E;  4DV6 E;  1J5E I;  4DV2 I;  1H74 A;  4LFC E;  3J81 Q;  1Z0B A;  2C39 A;  4QNJ A;  4YY3 I;  1USU A;  2PO2 A;  4NXN E;  1KIJ A;  1OYS A;  3K1J A;  3LPS A;  3H4L A;  5A2Q C;  5LL6 R;  2VQE I;  4N3O A;  3M7N G;  2F4V E;  1Z0E A;  4DUZ E;  4PRX A;  1HNX E;  1BKN A;  5LMN I;  2F4V I;  1R6L A;  4GKJ E;  5K36 E;  4DUZ I;  3QT8 A;  1XMQ E;  4DV7 I;  3M85 G;  2NN6 E;  4AQY I;  1XMQ I;  5K36 B;  3J7A G;  4B3S E;  5FLX C;  1H7S A;  4DV5 I;  4LF4 I;  2HKJ A;  4NBQ A;  4IFD A;  2NN6 B;  4LF6 E;  4DU7 A;  5LMU I;  2HK3 A;  4LCH A;  4DPU A;  4X66 E;  2JE6 A;  5EL9 A;  1N34 I;  5DRP A;  2C39 B;  3PYG A;  4FW3 A;  3J80 C;  4DV0 E;  5BR8 E;  5C0X D;  4WUD A;  4DV0 I;  4LPF A;  4MU4 A;  4K0K I;  1HNW I;  2NPF A;  3M7N D;  4FW7 A;  2HKE A;  4FWD A;  2CGE A;  2UUC I;  1K47 A;  1KVK A;  4OX9 I;  4DR1 I;  4X62 E;  4X64 I;  2C38 B;  2F1D A;  2PNZ A;  2XEX A;  1IBK E;  5GME A;  4IZJ B;  1MX0 A;  1NHJ A;  4JI1 E;  1IBK I;  4JI7 E;  2JE6 B;  2WP8 A;  4FW5 A;  3OTO E;  1N33 I;  2HHH E;  1VI7 A;  4LFB E;  4JV5 E;  3OTO I;  4DV3 E;  1PKP A;  4GKK E;  2PO0 B;  2A2D A;  2HHH I;  2IES A;  1Z0V A;  3L7Z A;  3P3G A;  4USM A;  4LF5 E;  4JYA I;  4WUC A;  3PYF A;  5DNX A;  2V2V A;  4DR3 I;  3PS2 A;  1FKA E;  3F0N A;  4JI3 E;  4B3R E;  3P3C A;  5A2Q Q;  2LJP A;  5JEA C;  4B3R I;  1A6F A;  4B3T I;  4YHH E;  2ZM6 I;  1UDQ A;  4IFD D;  4OO1 C;  2C37 B;  5JEA F;  2E1R A;  1MG7 A;  1NHI A;  2BA1 D;  1PIE A;  2Z5E A;  2O3Z A;  4JI6 I;  4DV1 I;  1XMO I;  4DR5 E;  1OYR A;  4LCF A;  1UDN A;  4DR2 E;  4HAC B;  3P76 A;  5C0X C;  1E3H A;  2JEB B;  5K36 A;  2O1V A;  2GO3 A;  2BR2 B;  3PS1 A;  1Z0T A;  4MU3 A;  4JI8 E;  2PO1 A;  2JEA B;  4FW4 A;  5C0X F;  2HFU A;  3GLL A;  2BV3 A;  3U1Y A;  4JI2 E;  4X65 E;  1XNQ I;  4DV6 I;  4LF9 E;  3ZZ0 A;  2OI2 A;  4LFC I;  2AJ4 A;  4OO1 E;  1YH8 A;  2V8P A;  2V34 A;  2CVE A;  4AIM A;  5JEA B;  4U3D A;  2IER A;  4LF8 E;  4NXN I;  1Z0C A;  5IWA E;  4OO1 B;  2VES A;  1QZR A;  4P7A A;  2J7K A;  1HR0 E;  4XTJ A;  3T1Y E;  4FW9 A;  1HNX I;  4GKJ I;  1HR0 I;  2C38 A;  4URL A;  3T1Y I;  4DV4 E;  5GMD A;  1IBL E;  2PO1 B;  4IZJ A;  4NXM E;  3D4J A;  2BA0 D;  4FWH A;  4B3S I;  1Z5C A;  5DRQ A;  5DNL A;  4DV4 I;  4P52 A;  1IBL I;  3GON A;  4LF6 I;  2E5L E;  1Z5B A;  3QT5 A;  4X66 I;  1H72 C;  2E5L I;  2GQ0 A;  2PO0 A;  3B4T A;  4HYM A;  3K17 A;  3WU5 A;  4PRV A;  4IFD F;  4I3H A;  4MU1 A;  5BR8 I;  1VIS A;  3QT7 A;  1H7U A;  4DPT A;  3JAM Q;  3UHM A;  4HXZ A;  4JI4 E;  4LF7 E;  5K36 D;  4X62 I;  4JI4 I;  3NZK A;  3M85 D;  1MU5 A;  2NN6 D;  2X36 A;  2WNR A;  2C37 A;  1Y4U A;  4BA1 B;  1FI4 A;  3J7A M;  4JI1 I;  3Q1Q A;  3KRN A;  1N0V C;  4JI7 I;  4MYT A;  3HUL A;  1N36 E;  1Z59 A;  2BM1 A;  1PVG A;  2WW4 A;  3HKM A;  3ZKD A;  1ZM2 A;  4DPY A;  4AM3 A;  2UXD E;  4LFB I;  4DU8 A;  4JV5 I;  5ELW A;  4UT4 A;  4DV3 I;  4GKK I;  1HK7 A;  4HAC A;  3WU6 A;  2JEB A;  2BR2 A;  2HFS A;  4KQV A;  1ZM3 A;  2AE8 A;  5EKW A;  4LF5 I;  2JEA A;  3ZZU A;  2VQF E;  4JI3 I;  3GCM A;  3B82 A;  3WU3 A;  2ZBK B;  3LNU A;  2VQF I;  2UUB E;  4IZJ D;  1UEK A;  3ZZT A;  2UXC E;  2GS8 A;  1HNZ E;  2WNR B;  4R1F A;  2Z5C B;  5JEA A;  1S16 A;  4YHH I;  4B3M E;  4OO1 A; 
#chains in the Genus database with same CATH homology
 3WU4 A;  4KHP E;  5FLX Q;  2HK2 A;  2IOQ A;  1H73 A;  1Y4S A;  3PRY A;  4DR5 I;  1KKH A;  2V2Q A;  4DR2 I;  4Z7C A;  3V5R A;  1B63 A;  3J80 Q;  1N32 E;  4JI8 I;  2IOP A;  1IBM E;  1FJG E;  4JI0 E;  2O1T A;  1U2R A;  4DUY E;  2R42 A;  4X65 I;  4JI2 I;  2CG9 A;  2UXB E;  4LF9 I;  1USV A;  1NZ0 A;  4IZK B;  2UXB I;  1J5E E;  3PYD A;  4DV2 E;  4DR6 E;  4LF8 I;  3P06 A;  1XNR E;  5IWA I;  3ZKB A;  4FWG A;  5L3J A;  4Z7Y A;  4DR6 I;  4YY3 E;  4M1K A;  3LTO A;  1XNR I;  1OJ4 A;  2VQE E;  4JG4 A;  1NHH A;  5LMN E;  4NXM I;  2R3V A;  1ZXM A;  5FWK A;  1FWL A;  4DV7 E;  1ELO A;  4AQY E;  5IT9 C;  4DV5 E;  3M6A A;  1ZM9 A;  4LF4 E;  1RRE A;  2ZIT A;  5LMU E;  4MYU A;  2Z5B B;  4ZVI A;  1Y6Z A;  4DXL A;  1N34 E;  4LFA E;  2PNM A;  3PYE A;  4LFA I;  1DAR A;  1S4E A;  4DR4 E;  4DR7 E;  4WUB A;  4LF7 I;  1WUU A;  3V2U C;  1I94 E;  4K0K E;  1HNW E;  4DR4 I;  4DR7 I;  4ED4 A;  2Z5C A;  3J81 C;  1D6T A;  1Z0W A;  1I94 I;  2UUC E;  4JI5 E;  1N0U A;  4OX9 E;  4DR1 E;  2DEJ A;  4X64 E;  2O1W A;  1RR9 A;  2A2C A;  4JI5 I;  1N36 I;  4RPF A;  1ZM4 A;  2Q2E B;  3HJC A;  3K85 A;  1KTV A;  4DPW A;  2UXD I;  1N33 E;  1FNM A;  3T1H E;  1EA6 A;  3ZM7 A;  1FWK A;  4UTG A;  3T1H I;  1Z0G A;  4JYA E;  2X7I A;  2UUB I;  1XHK A;  2UUA E;  2BM0 A;  4DR3 E;  2UXC I;  4IZK A;  3CWV A;  1HNZ I;  2EFG A;  4EMD A;  2UUA I;  4B3M I;  4B3T E;  2PNL A;  2ZM6 E;  2O1U A;  4KHP I;  2DEI A;  1B62 A;  4FN5 A;  4DPX A;  3JAM C;  4USK A;  2VF3 A;  3B78 A;  4JI6 E;  5IT9 Q;  3QT6 A;  4DV1 E;  3B8H A;  1ZXN A;  1XMO E;  4PU9 A;  2UU9 E;  1N32 I;  1IBM I;  1FJG I;  3Q6N A;  4JI0 I;  3Q6M A;  2UU9 I;  2CZ9 A;  4DUY I;  2V2Z A;  1Z5A A;  2Z5B A;  4HY1 A;  1EI1 A;  1XNQ E;  4DV6 E;  1J5E I;  4DV2 I;  1H74 A;  4LFC E;  3J81 Q;  1Z0B A;  4YY3 I;  1USU A;  4NXN E;  1KIJ A;  3LPS A;  3K1J A;  5A2Q C;  3H4L A;  5LL6 R;  2VQE I;  4N3O A;  2F4V E;  1Z0E A;  4DUZ E;  4PRX A;  1HNX E;  1BKN A;  5LMN I;  2F4V I;  4GKJ E;  4DUZ I;  3QT8 A;  1XMQ E;  4DV7 I;  4AQY I;  1XMQ I;  3J7A G;  4B3S E;  5FLX C;  1H7S A;  4DV5 I;  4LF4 I;  2HKJ A;  4LF6 E;  4DU7 A;  5LMU I;  2HK3 A;  4X66 E;  4DPU A;  1N34 I;  3PYG A;  3J80 C;  4DV0 E;  5BR8 E;  4WUD A;  4DV0 I;  4K0K I;  1HNW I;  2NPF A;  2HKE A;  4FWD A;  2CGE A;  2UUC I;  1K47 A;  1KVK A;  4OX9 I;  4DR1 I;  4X62 E;  4X64 I;  2XEX A;  1IBK E;  5GME A;  4IZJ B;  1MX0 A;  1NHJ A;  4JI1 E;  1IBK I;  4JI7 E;  3OTO E;  1N33 I;  2HHH E;  4LFB E;  4JV5 E;  3OTO I;  4DV3 E;  1PKP A;  4GKK E;  2A2D A;  2HHH I;  1Z0V A;  4USM A;  4LF5 E;  4JYA I;  4WUC A;  3PYF A;  2V2V A;  4DR3 I;  1FKA E;  3F0N A;  4JI3 E;  4B3R E;  5A2Q Q;  2LJP A;  4B3R I;  1A6F A;  4B3T I;  4YHH E;  2ZM6 I;  2E1R A;  1MG7 A;  1NHI A;  1PIE A;  2Z5E A;  4JI6 I;  4DV1 I;  1XMO I;  4DR5 E;  4DR2 E;  4HAC B;  2O1V A;  1Z0T A;  4JI8 E;  2HFU A;  2BV3 A;  4JI2 E;  4X65 E;  1XNQ I;  4DV6 I;  4LF9 E;  3ZZ0 A;  2OI2 A;  4LFC I;  2AJ4 A;  2V8P A;  2V34 A;  4LF8 E;  4NXN I;  1Z0C A;  5IWA E;  1QZR A;  4P7A A;  2J7K A;  1HR0 E;  4XTJ A;  3T1Y E;  4FW9 A;  1HNX I;  4GKJ I;  1HR0 I;  4URL A;  3T1Y I;  4DV4 E;  5GMD A;  1IBL E;  4IZJ A;  4NXM E;  3D4J A;  4FWH A;  4B3S I;  1Z5C A;  4DV4 I;  4P52 A;  1IBL I;  3GON A;  4LF6 I;  2E5L E;  1Z5B A;  3QT5 A;  4X66 I;  1H72 C;  2E5L I;  2GQ0 A;  4HYM A;  3K17 A;  3WU5 A;  4PRV A;  4I3H A;  5BR8 I;  1VIS A;  3QT7 A;  1H7U A;  4DPT A;  3JAM Q;  4HXZ A;  4JI4 E;  4LF7 E;  4X62 I;  4JI4 I;  1MU5 A;  2X36 A;  1Y4U A;  1FI4 A;  3J7A M;  4JI1 I;  3Q1Q A;  1N0V C;  4JI7 I;  4MYT A;  3HUL A;  1N36 E;  1Z59 A;  2BM1 A;  1PVG A;  2WW4 A;  3ZKD A;  1ZM2 A;  4DPY A;  2UXD E;  4LFB I;  4DU8 A;  4JV5 I;  4DV3 I;  4UT4 A;  4GKK I;  1HK7 A;  4HAC A;  3WU6 A;  2HFS A;  4KQV A;  1ZM3 A;  4LF5 I;  3ZZU A;  2VQF E;  4JI3 I;  3B82 A;  3WU3 A;  2ZBK B;  3LNU A;  2VQF I;  2UUB E;  4IZJ D;  1UEK A;  3ZZT A;  2UXC E;  2GS8 A;  1HNZ E;  4R1F A;  2Z5C B;  4YHH I;  1S16 A;  4B3M E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...