2VQFL

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqfL00
2AKWB 4B3SQ 3PUWA 4GLVB 4R4QA 1CKOA 4LF5L 2A1AA 1VQDA 4JI5Q 1J5EL 4A93G 4YHHQ 3PUZA 4X66L 5C44G 2IT1A 2UUAL 3M9BA 4GOPA 1FL0A 2Z6KC 3CCJA 2UXDQ 4A3GH 2Z0SA 2RHQB 5LMUQ 4GOPB 3T1HL 4JI7L 1EYGA 1SN8A 4DR5Q 4IPCA 2R7ZH 2JA8G 3PO2G 1PV4A 2L15A 3D31A 2NVTH 1Y14B 4OO1I 1MKHA 3IRBA 2F4VL 4RG1A 4X65L 4HJ9A 1NY4A 1Q8KA 4YWLA 4EX5A 3EIVA 2XGTA 3W1BA 4AYBG 4DR3L 4OXPA 1YHAA 1EIYB 3CXCA 4LFBL 5K36G 1G51A 2VW9A 2YV5A 1VQMA 4JI3Q 3I4NH 4DV3Q 4A3DG 1DGSA 3K80C 3JAMi 3A5ZB 3STBC 5JJLA 4FDBA 1HJPA 2WP8J 1PA6A 4DV5Q 1TWAH 3DM3A 3NBHB 5LMNQ 1TWGH 4A75A 1BBWA 4OWTB 2ZTEA 2JA5H 1XNQL 1IXRA 3KDFA 2WB1G 4PZ6A 4A3JH 4IFDJ 3S1RH 1KIXA 4LFAL 4IJLA 1IBML 4IOCA 3HOVG 1HZBA 3KDFB 1VQFA 4LUZA 4KLKA 4A3IH 1NJIC 4JBWA 1X65A 4YWKA 1PH3A 2OTLA 1C7YA 2C35B 4KI0A 1HR0W 3OTOL 4GLAC 4GS3A 3HOWG 4JI5L 1S40A 3GO5A 4GKJQ 4HIMA 2A8VA 3HOUH 1Y1WH 2MO0A 4JI0Q 3HOYG 2N78A 1HR0L 1HNWQ 1HH2P 2NZOA 1CSQA 1X54A 3CCLA 3M7NA 4L5QA 1C9OA 3PCOB 4DR4L 4NXMQ 3S16H 2FXQA 5GADC 2HHHQ 2QGQA 5IYBG 3RZDH 1XNRL 3AEVA 1K8AC 1E1TA 4LUVA 2Y0SG 3K0XA 2D0OA 3S24A 2B29A 4B3SL 1EWIA 1XMOQ 2GVBA 2NVXH 1MJEA 4HJ8A 3H3VI 4YHHL 1K3RA 1N33Q 1VQCA 2DUDA 2KHIA 4IOAA 2B63G 1XPOA 4DR2Q 3I4OA 4JOIC 1VQ9A 3E9HA 3GDEA 3CCMA 2UXDL 1E3PA 1J6QA 2D0PA 4PZ7A 3GTKH 5LMUL 2ES2A 3CC7A 4A3MH 4A3CH 2VL6A 4DR5L 4GKKQ 2E5LQ 4B3RQ 4PMWA 5JEAJ 2MNAA 1N9WA 5C4XH 3KOJA 1JJ2A 2JA7G 5IYDH 4GNXA 2R93G 1Q1BA 3MEFA 4RMFA 5IP9H 4AYBE 4GNXB 2ASBA 2F52A 2PNHA 2BA1A 1JT8A 2ZM6Q 1JMCA 3I4MH 5FJ8H 3EN2A 4QIWE 1WCMG 4DV1Q 2EXDA 4JI3L 4BA2I 4DK6C 3AYHB 4BBRH 4DV3L 1Q7YC 2I5LX 5C4JH 5LMNW 4DV7Q 4LF6Q 1HNXQ 3I7FA 4GNXC 4YY3Q 2E2IH 1QVFA 3S1NH 4DV5L 2CWAA 5LMNL 2WB1E 4DK3C 1KXLA 4LF7Q 1X3FA 2ZJPA 4R4OA 3GTJH 3CCRA 4X6AH 4A3GG 1FVIA 1WOCA 1D8LA 1K0RA 4HJ7A 1K9MC 2XTIA 3PUXA 3J7ZC 4NXNQ 3TQYA 3S1QH 2VNUD 2R7ZG 1YHQA 1PYBA 3L2PA 3HFZB 1A62A 4DV6Q 3KF8B 2VUMH 5GQOA 1XTDA 4JCVE 4GKJL 1PH7A 4ME3A 1OTCA 4L5RC 1XPUA 4Y52H 1ASYA 3D0FA 4JI0L 5FLMH 1QZGA 4C3HH 1M1KC 1HNWL 5C0XJ 1G291 2Y0SE 3K7UC 3UDIA 4NXML 1VQNA 1NTGA 1X55A 3UE1A 4P72A 2HHHL 2K50A 4R4TA 3I4NG 4KHZA 1B70B 1QVGA 2I5MX 2A19A 1VQBA 3WWVA 3NEMA 2ATWA 1XMOL 3CCQA 1SE8A 1GD7A 1I5FA 3BU2A 3KYHC 2Q2HA 3M4PA 1UE7A 1PH2A 1PH8A 1UWVA 3HKZE 3GD7A 4APVA 1YJWA 1EFWA 4DR2L 5C3EH 3U4ZA 3CP0A 4IPDA 5M5YH 4UPAA 2MFIA 4A3FH 5IYCH 3RNUA 2JA5G 1T9HA 5HY6A 4GKKL 4A3JG 2E5LL 4B3RL 4DKAC 4JBMA 4WJ3M 4JC0A 2EIFA 2VY3A 3ICEA 5M3FH 5M5WH 4A3IG 5AJ3Q 1E1OA 1IZ6A 2OQKA 4IPGA 5IY0A 4MZ9A 3I56A 2Q2TA 3S15H 4BY7H 3CQZH 2K5HA 1L1OC 3W1GA 3VDYA 1KC8C 4KHPQ 1XPRA 4HJ5A 3PV0A 1Y1WG 1QUQA 2ZM6L 1KRSA 2RHSB 4JI1Q 1HNZQ 5EAYA 4ALPA 3F2DA 1QUQB 1E22A 4DV1L 3J81j 2AWOA 3STBD 3H15A 1TWCH 2QA4A 4DV7L 1VQ7A 4LF6L 5IP7H 1HNXL 4L5TA 1KAWA 4YY3L 4BY1H 4DAMA 1Q46A 3PIOA 5M3MH 3J7A5 1KHIA 3RN5A 4BBSH 1H95A 1X56A 4LF7L 1N32Q 3PUYA 2YTVA 1SROA 2HT1A 5GAEC 1BBUA 1YHBA 2I5HA 4A3CG 2MO1A 4A3MG 1I94Q 4NXNL 3KJOA 1PYSB 3T1YQ 4POGA 2JQOA 3RN2A 1LM0A 2KCTA 1UE6A 4IFDG 4QQBX 5C4XG 2K75A 4UP8A 3CCEA 4DV6L 5IYDG 1RIPA 5IP9G 3FHWA 1RL2A 2WAQG 1VQ6A 4K0KQ 3M4OH 4HIDA 5ELNA 1PH4A 2AMCB 2VS1A 2VZAA 2IHFA 1YZ6A 1TXYA 3H3VH 1Q82C 3I4MG 5FJ8G 1PH5A 1X3GA 1CUKA 4JYAQ 1VQPA 1YIJA 2UXBQ 4NB3A 3H0GH 4BBRG 2UUBQ 4JOIA 3ULJA 5IT9c 2R6GA 4JI8Q 1K8GA 4LW1A 4JI6Q 4A3LH 1OXVA 2LXJA 3L0OA 3ULLA 1V1QA 3CCUA 2YTYA 2ID0A 3CW2C 2LSSA 3E0EA 3BZCA 3M4QA 2DGYA 4A4IA 1WYDA 1VQOA 3J80c 2E8GA 1XMQQ 5AJ3L 3PF4A 1VQ5A 1VQAA 5JEAG 4XTCS 4DUZQ 1YITA 2VUMG 3CCSA 1VQHA 5H1SE 4KHPL 1NBWA 3K81C 4TQUS 2BH8A 3NELA 4C3IH 4C2MH 1U0LA 5FLMG 4JI1L 1HNZL 1KD1C 3GTGH 1EIFA 3K7AH 4NPSA 3EBEA 4DNIA 1Z47A 3DLLA 3PO3H 2NVQH 1KRTA 2JK8A 3ER0A 5J3BA 1WI5A 4HJAA 4IPHA 3U58A 3W5OA 4H02A 2I0QA 1N32L 2CQOA 3CCVA 5C3EG 1O7IA 1BVSA 2YYZA 1N8RC 1VQ8A 5IYCG 1NMGA 2CKZB 1I94L 3T1YL 4A3BH 2NN6G 3F8TA 2WAQE 3PF5A 5GAHC 4DV0Q 2UUAQ 4R4CA 3S1MH 5IWAQ 5M3FG 2RF4A 5HGQA 1JB7A 2D62A 3ULPA 3S14H 1PH6A 4BY7G 1OXUA 3AFPA 4P73A 4AQYQ 1D7QA 3GTQH 4UP9A 4X64Q 2JA6H 1VQEA 4R4IA 2JE6I 4BA1I 4L5SA 2K4KA 1G6PA 4J15A 4O0AA 2PQAA 3KJPA 1FJGQ 4YCUA 1GKHA 4JYAL 2UXBL 3HOXH 2PQAB 4AIMA 1NMFA 1IL2A 2ALYB 2UUBL 4YCWA 5C0XG 3CF5A 3CD6A 1A63A 3FKIH 3MXNB 1VQKA 5IP7G 4JI8L 2HIXA 4IFDI 4BY1G 4GN4B 2JEBI 5M3MG 4P71A 1IBKQ 4LNQA 4BBSG 1IBLQ 3AQQA 4OWXB 3F2CA 3RZOH 3JC66 3ERSX 3CPFA 1YI2A 3G4SA 1L1OA 4PG3A 2PI2E 3Q8DA 3HOZH 1JJGA 1VCIA 3J80i 4GN5A 3CMEA 1XMQL 1MJCA 2AHOB 2CWPA 1L1OB 4TVAB 4LFCQ 2R92H 4DUZL 1PVOA 4MTNA 4UY8C 2ZTCA 2MQHA 5JJKA 3PIPA 4DR7Q 1WFQA 4DR1Q 1E24A 2N8NA 4DV2Q 1X9NA 1OXXK 1N34Q 4QL5A 5IE8A 3RR5A 2VQFQ 1VS0A 3HKSA 4YWMA 1Q81C 4B3TQ 4C3JH 1SRUA 5JJIA 3HOUG 3H0GG 3KLWA 4DUYQ 1EQRA 4BXXH 3S2DH 3B6YA 1HZAA 3OYYA 1XJVA 4LF8Q 1L0WA 1R9TH 4A3LG 2BA0A 3A74A 4LF9Q 2OQ0A 1VQIA 4JBJA 2WFWA 3BZKA 2CCZA 4JBKA 1HZCA 2K52A 3GTOH 2IHEA 3I55A 2UXCQ 5ELOA 1Y1VH 2JEAI 1E7ZA 4DV0L 3PSIA 2EQSA 5IWAL 3S2HH 4MNOA 1AH9A 1PH9A 3RLNA 1S72A 4AQYL 1I6HH 1OXSC 1TWHH 4X64L 3GTLH 1CKMA 1WJJA 1FJGL 1UE5A 4X62Q 3F2BA 2UU9Q 3F1ZA 1IYJB 1KQSA 5DLQE 1I50H 2NZHA 2NN6I 3OW2A 3TRZA 3PO3G 4GOPC 2OTJA 3SGIA 4A3EH 1LYLA 1Q12A 2B3GA 3UDGA 4GLXA 3CPWA 4OX9Q 1UEBA 4UP7A 1W3SA 5FLXc 4A3KH 1IBKL 1YEZA 4EQ5A 2ZJQA 1K73C 1IBLL 1CSPA 4B3MQ 3M3YH 3UE0A 4OWWB 1JE5A 4Y7NH 1SR3A 2F3IA 3J81c 2HIVA 3U50C 4A3BG 4JV5Q 1LTLA 3ZJYC 3GTPH 4LFCL 1B8AA 1FGUA 1AE3A 1YNXA 5C0XI 4DV4Q 3A5UA 3I2ZA 2V1CC 5E7NA 4A93H 2JJQA 5C44H 2KBNA 4DR7L 4A76A 3K8AA 4LF4Q 4DR1L 2JA6G 1PFSA 4DV2L 4QY7A 2R7FA 1N34L 1MIUA 1NE3A 3PUVA 4R1JA 2VQFL 4QGUA 4P75A 4B3TL 1KL9A 2JA8H 3HOXG 3PO2H 4DUYL 5BR8Q 3FKIG 4YCVA 4LF8L 1YJ9A 4DR6Q 2VQEQ 1GO3E 5GAGC 4HIOA 1CKNA 1N36Q 4LF9L 4JI2Q 4DPGA 2GVAA 1B7YB 1VQJA 3KF6A 2KCMA 1SFOH 1CKNB 2UUCQ 2BH2A 2UXCL 2N49A 3KF6B 2RCNA 4AH6A 3TREA 3G71A 3CC2A 2K14A 4A3DH 1P16A 4JI4Q 2ZJRA 1TWFH 1QVCA 3HOZG 1C0AA 4OO1G 1OXTA 1W2BA 4P74A 1HZ9A 3HKZG 4QJFA 1EOVA 4A3FG 2R92G 4LF5Q 2PMZE 1J5EQ 3UDFA 1A0IA 2H5XA 4X66Q 4LWCA 3TEHB 1X3EA 2CFMA 2Q2UA 1GVPA 4X62L 2UU9L 4K0KL 1BKBA 3T1HQ 4JI7Q 1K83H 1QZHA 3HOVH 2N3SA 3GTMH 1V9PA 3NENA 1U5KA 4GN3B 1S3OA 2JA9A 1SLJA 3RLOA 3HOWH 1Q86C 4BXXG 1V43A 1YJNA 2IY5B 3A0JA 2IX0A 4OX9L 2ZTDA 2KHJA 2R7DA 2F4VQ 2OWOA 3BJUA 2NVYH 4X65Q 3CAMA 1N33L 3HOYH 3AFQA 3L7ZC 2E2JH 4B3ML 2HQLA 2LXKA 2YTXA 1VQGA 1ASZA 2E2HH 1PHJA 4DR3Q 4JI6L 3G6EA 1SMXA 1UE1A 2YU9H 4JG2A 4LFBQ 3J81i 4JV5L 5IYBH 1Y1VG 1PH1A 1AE2A 2GN5A 3JAMc 1I3QH 2QEXA 1L2FA 1X6OA 4DV4L 1A8VA 3S17H 2B63H 1P8LA 4LF4L 1Z9FA 2KENA 2OCEA 3U4VA 2IX1A 5M5XH 3CC4A 1XNQQ 4HIKA 3E9IA 3TS2A 4LFAQ 1IBMQ 3FP9A 3PGZA 3UDXA 1EUJA 2JA7H 5BR8L 4DAYB 2Q2IA 4O2DA 1VQ4A 1EQQA 5GROA 4IO9A 4A3EG 2R93H 3G48A 4DR6L 3CMAA 1YBYA 4IJHA 4XIGS 3OTOQ 3M85A 2AWNA 2VQEL 1GM5A 1JJCB 2K5NA 4A3KG 1N36L 4JI2L 1LUZA 3KFUA 2Z6KA 1HR0Q 4LUOA 3LGJA 2K5VA 1WCMH 2UUCL 1M90C 3TS0A 1Q1EA 1VQLA 4POFA 4DR4Q 4JI4L 4WJ4A 2PI2A 1XNRQ 4OONA 3RLFA 1YVCA 4PZ8A
chains in the Genus database with same CATH superfamily
4RKBA 2PPBC 1A3VA 4GLVB 2RDGA 1CKOA 1VQDA 4A93G 2M9VA 3NK9A 3PUZA 4X66L 2IT1A 2R93B 2UXDQ 1RTNA 2RHQB 2XSCA 5LMUQ 3T1HL 1SSOA 3P7JA 1PZJD 4IPCA 1STNA 1XX8A 2NVTH 2EYPA 3R93A 4TKOB 4X65L 1J9OA 5E1FA 2WKDA 4YWLA 2EPBA 1A2UA 3EIVA 3NP8A 5JPMC 1VDZA 4AYBG 4DR3L 4MIUA 1G51A 2B8FA 1B53A 2AUJD 4QF4A 2WP8J 2R7ZB 5LMNQ 4A75A 3RMHA 4XXEA 4PZ6A 2WB1G 3D8GA 2F0TA 2F0VA 1SAPA 4KLKA 2EY1A 2C35B 4KI0A 4GKJQ 3GO5A 1MBYA 3HOUH 4XYQA 2MO0A 1D1IA 5ELDA 1Y1WH 2XWJB 1D5MC 2F0IA 1D5XC 2NZOA 1X54A 1C9OA 1TWAB 3S16H 2BDOA 5GADC 3RZDH 1GUWA 4O42A 2GVBA 3S1RB 3H3VI 1N33Q 3M4OB 1NR2A 2KHIA 1XPOA 3E9HA 3GDEA 4A3IB 2UXDL 1J6QA 2ZXOA 4XT3B 5LMUL 5JVG3 5FKAC 1STGA 1N9WA 3KOJA 1U4RA 1H9SA 2R93G 1FR3A 1BF4A 2B2WC 2L12A 3EN2A 2EXDA 4U673 4BA2I 5C4JH 2F3VA 4YY3Q 4DF7A 5LMNL 3GTGB 4LF7Q 1X3FA 4X6AH 3GTJH 5BN5A 1FVIA 3K5OA 5IGFA 3PUXA 3KF8A 2R7ZG 1YHQA 1Q3LA 1BOSA 1RF2D 1XTDA 4GKJL 1ASYA 3G6JB 4M1UB 5I2YA 1G6ZA 5CR3A 4N9PA 2L4NA 2QDBA 1VQNA 4OELB 3UE1A 2WACA 5I6WA 5JPNC 1RJTA 3WWVA 3WDNA 2ATWA 3CCQA 1I5FA 4NDXA 1OTCA 2Q2HA 3R2TA 1PH2A 4L5RC 2Z4IA 3HKZE 1N33L 4APVA 1LT5D 4ZQ3A 2EYMA 4UPAA 1EY9A 3RNUA 5HY6A 4N8FA 2B2YC 4LK1C 4A3IG 5AJ3Q 2OQKA 4IPGA 1UUPA 3CQZH 5D3DA 1GUNA 4HJ5A 3L9AX 5EAYA 4ALPA 1I4GA 2E75C 3CU7A 3H15A 2QA4A 4PV1C 4XQNA 1VQ7A 4A3FB 4YY3L 1Q46A 3M7GA 3RN5A 1H95A 4LF7L 1TS4A 4KV6A 1BNZA 1GOZA 1LTBD 4A3CG 3W2DA 3KJOA 4L6TB 1HHVA 3J7AV 4QQBX 3DEOA 4IFDG 5C4XG 4FXDA 5IYDG 1I4PA 4I7ZC 4V190 1JORA 2WAQG 5EKLA 1K8OA 3M4OH 1TWCB 5ELNA 4I7AA 5M3MB 1PH5A 1EYAA 1VQPA 2PNRC 2UXBQ 1FNVA 2UUBQ 5IT9E 3E5SA 5IT9c 2R6GA 5EPJA 1TIID 4BS9A 4A3LH 1TS2A 1TWHB 3OSOA 3ULLA 3T56B 2A6HD 5EBCA 3IFTA 3Q23A 3E0EA 3BZCA 4ZKBB 3J80E 2B2WA 1WYDA 3J80c 3I91A 2RKSA 1XMQQ 1DCZA 3FEWX 5AJ3L 3GQBA 5JEAG 4OHJA 5C5MA 1MHWC 2BH8A 2NTTA 4XYOA 3GTGH 1KD1C 3T13A 3K7AH 4NPSA 1CHQD 1Z47A 1ICWA 2JK8A 1WI5A 2EYLA 4N8X1 5T1GA 3W5OA 3MXPA 3TDQA 5C4HA 5IYCG 2CKZB 3PO2B 2UUAQ 4DV0Q 2F0GA 2PCFB 3E3XA 4R4CA 4IURA 4KMUC 1JB7A 4UP9A 5IGCA 4RAUC 4R4IA 2JE6I 4ZKCB 2F0FA 4J15A 3K59A 3QB3A 5IT9L 2NUCA 3HGBA 2X6LA 2UXBL 4AIMA 2UUBL 4YCWA 5C0XG 3CD6A 1A63A 2EXZA 3MXGA 2EY5A 3OIQA 3BDLA 5M3MG 4R8NA 1BQQT 3J80L 3JC66 2KVMA 3HOZH 1XMQL 1HPCA 2F0MA 4LFCQ 2CW0D 1PVOA 4MTNA 3I73A 2JSOA 3I70A 3HG9A 3C1EA 3FKIB 2N8NA 1N34Q 4QL5A 5IE8A 3HKSA 1Q81C 4DFAA 5CMDA 2Y0SB 2Z6BA 5JJIA 2SNSA 1HZAA 2A73B 1XJVA 1HQMC 4LF8Q 1R9TH 1PTOF 3A74A 1VQIA 3SHLA 2WFWA 2CCZA 2IHEA 5ELOA 5KYIA 2JEAI 2TMPA 4DV0L 5JJZA 1I6HH 1UEAB 1TWHH 1AP0A 1WJJA 1YNJD 4C3IG 2A6EC 3FDTA 4FXKC 1JWSD 4DA2A 3F2BA 2B8GA 2KA7A 1KQSA 5D3IB 3TRZA 4A3EH 1LYLA 2KCCA 4MTKA 5FLXE 2EVBA 5FLXc 5E4WC 4EQ5A 2ZJQA 1AW7A 3S2HB 1SR3A 1EL0A 1DJRD 4O1NA 3U50C 1LTLA 3ZJYC 4LFCL 4X3SA 1AE3A 1TR5A 4K2KA 2BE5C 2JA6G 1PFSA 1N34L 3QWNA 2ZT9C 1S4ZA 3N52A 3KLSA 1KL9A 3OMGA 4OIJA 3HOXG 3PO2H 4HSVA 5I2XA 3FKIG 4LF8L 4DR6Q 5E3FA 1C4QA 4PQXA 4IUPA 1CKNA 2EE1A 4CBVA 1CQFA 2JP1A 4DPGA 1N36Q 3GTPB 1B7YB 1VQJA 3EFXD 3KF6A 4I65A 5FK9C 2HCCA 1TQOA 2N49A 1C8CA 4AH6A 3CC2A 4JI4Q 4HCEA 2RQXA 2CH4W 4G7HC 1T5EA 3MXUA 3BS1A 3A54A 2BOSA 3TEHB 1BKBA 3H09A 4JI7Q 1D6EC 5FLXL 3OHXC 2IWHA 2N3SA 5KEEA 4KY5A 4RFBA 2IJ0A 1SE4A 4C3JG 1SFOB 2DJFC 3RLOA 3HOWH 1HRJA 3A0JA 2KHJA 2R7DA 2NVYH 1U4PA 4A3DB 3AFQA 2EJMA 1QCBD 3M4YA 3G6EA 1SMXA 2J7ZA 2EZVA 1Q8IA 2A68C 3JAME 3SDZA 2GN5A 1BO0A 3JAMc 2L0CA 3MVVA 2Q8IB 2FMCA 3S17H 1P8LA 1E2WA 1EOTA 1T5XD 2F0EA 1XNQQ 2EJFC 3E9IA 3HOYB 4FP5D 2KOLA 4DAYB 1VQ4A 5GROA 1CI3M 4DR6L 2YU9B 4H7BA 5BN4A 1BCPF 1TVXA 4JI5Q 2PO4A 1N36L 4EQOA 1I3QB 3BVZA 4LUOA 1M90C 2SDFA 4DR4Q 1H9RA 2B63B 4JI4L 4WJ4A 3EQLC 5IGDA 1ET9A 5M5XB 2ICIA 2HD3A 4K5VA 3U9OA 3Q0AA 5FO7B 3DWPA 5C6AA 4ZUIA 5C44G 5IOCA 2Z6KC 1DOLA 3A56A 1HTPA 2Z0SA 3QJYA 4GOPB 4JI7L 1EYGA 2C5CA 4DR5Q 2Z9HA 2JA8G 2F0SA 1WCMB 1Y14B 4OO1I 4QUCA 5CV5A 3T4AC 2KQ3A 4EX5A 4CKBA 2RSOA 2DN8A 4IALA 3W1BA 4OXPA 3CXCA 1R4PB 2VW9A 3QR8A 2YV5A 3I4NH 4DV3Q 1EYCA 4A3DG 5HGTA 3K80C 4FNFA 3LNNA 3STBC 5JJLA 1HJPA 1PA6A 1RTOA 4KY6A 3DM3A 3NBHB 2G9DA 2NVTB 2ZTEA 1XNQL 1IXRA 3KDFA 4A3JH 1KIXA 1PMRA 4IJLA 1ZXTA 3HOVG 2QEJC 1E2VA 5ELBA 5D65A 1NJIC 2OTLA 4BY1B 1HR0W 2B2VC 4GS3A 4JI5L 4HIMA 3HOYG 2A69C 3IKJA 2JYOA 2N78A 1JQYD 1HH2P 3M7NA 4DR4L 3PCOB 1SNMA 5NUCA 4NXMQ 1JOKA 2HHHQ 2QGQA 5K5PA 3AEVA 1K8AC 1E1TA 4LUVA 3K0XA 1EU3A 1EWIA 2NVXH 4HJ8A 1K3RA 4IOAA 2B63G 4ZCKA 4DAPA 4JOIC 1PFMA 1E0BA 3CC7A 2HCIA 4A3MH 2VL6A 4B08A 4DR5L 3HOUB 1Y1WB 4B3RQ 3K5MA 1QE6A 2MNAA 3DEPA 3DXJC 1JJ2A 2JA7G 4GNXA 1Q1BA 3MEFA 4DGZA 3TP6A 4AYBE 2ASBA 3RZDB 2BA1A 2ZM6Q 1LT6D 4QIWE 1WCMG 4DV1Q 1PFBA 3BZDB 4DV3L 5D14A 4LF6Q 1HNXQ 4IN3A 3I7FA 4RCOA 3OW7A 1QVFA 5G3LD 1Z6HA 2WB1E 1KXLA 3QIAA 2VXWA 5IODA 2F0QA 1K9MC 1DM0B 5LL6X 2VNUD 3L2PA 3HFZB 1A62A 2VUMH 1PH7A 4Y52H 1XPUA 1DONA 3EROA 1QZGA 3A8JE 4RHSA 4NXML 2HHHL 4RGNA 3K5NA 4C1NK 2I5MX 3SR1A 1VQBA 3GTJB 3NEMA 3BU2A 1ESFA 1PH8A 3M4PA 1KLGD 1UWVA 3GD7A 1EFWA 2QILA 5M5YH 2MFIA 4X3KA 3DWAA 1U4LA 4B3RL 1HTLD 4WJ3M 1PZKD 3E0JA 1HUMA 2EIFA 4FYDA 4ID6A 2L1BA 5M5WH 2K03A 4MZ9A 3KBGA 5KIXA 4RGTA 4KTAA 1I6VC 3VDYA 3W1GA 1Y1WG 2ZM6L 1KRSA 2RHSB 1JWMD 1QUQB 4K2LA 4DV1L 2AWOA 1ILPA 3L3OC 4LF6L 5IP7H 1HNXL 2ENBA 3AU7A 5M9OA 4BY1H 1CQVA 3J7A5 1KHIA 4B9XA 4BBSH 1X56A 2B2UC 2B2VA 3CQZB 4POGA 1PYSB 4QUFA 5ELFA 3OWEB 3ONAB 3IFDA 1UAPA 1FNWA 1K0SA 1A6XA 4RH6A 1PH4A 2VS1A 2VZAA 3TBIB 1EY6A 3K5LA 1CUKA 1YIJA 1O80A 2F0LA 4K14A 4JOIA 4N9TA 3D6WA 1B44D 1TT2A 1S5BD 1KABA 3L0OA 5CBAE 2YTYA 1ZKOA 2G9HD 4A4IA 4QMGA 4FF2A 1F77A 1VQ5A 1EY0A 3NSWA 1HA5A 1VQAA 3SXHA 4DUZQ 1YITA 3CCSA 1NAPA 2K6AA 3NELA 1PTOC 1U0LA 3TSSA 1SYEA 4Y7NB 1EIFA 1QNUA 4EQNA 3J7YW 2VB3X 3TN2A 4FF3A 1WTWA 4HJAA 3BVGA 4IPHA 1BVSA 5ELCA 1D5ZC 2OF1A 4WRDA 2NN6G 3F8TA 2WAQE 3PF5A 3S1MH 5DAUA 1IHZA 2RF4A 3K6OA 3K7AB 2WINB 2K7VA 3GTQH 1VQEA 3SEBA 4O0AA 3DUZA 3KJPA 3MXNA 2PQAB 3D3RA 1IL2A 2KEEA 2ALYB 1PLFA 3D4WA 1Q90A 4GN4B 2JEBI 1WTXA 1JOOA 4FVMA 1EZ6A 3KK7A 1IBLQ 2HDMA 3OWFA 4OWXB 1G2SA 3ERSX 1BUVT 3GTMB 2N88A 3Q8DA 3O13A 3J80i 1JJGA 4GN5A 3VYTA 3CMEA 2CWPA 5A2QE 4TVAB 1L1OB 3CHBD 4OO1H 4DUZL 2ZTCA 1NSNS 1TS3A 4F7XA 4DR7Q 3A8IE 1E24A 1F2MA 4B3TQ 4ME5A 1L0YB 2R3ZA 4DUYQ 4BXXH 2B2UA 3OYYA 2ZXRA 4A3LG 2KECA 3HOZB 4JBJA 4IZ8A 4DK0A 3HKZB 1SYBA 1GHJA 4KKSA 3GTOH 3KBXA 1Y1VH 3PSIA 5I4DA 2A5HA 2K1BA 4RHRA 3T53B 4KN4C 4RGMA 1ZEQX 1LTID 1RODA 4H13C 1QJOA 4X62Q 1R9TB 4L63B 5DLQE 2NZHA 3OW2A 2OT2A 3SGIA 1Q12A 3UDGA 4QB4A 4GLXA 1UEBA 4UP7A 2RVLA 5KYLA 2BE5D 1IBLL 5EQ0A 4OWWB 5A2QL 4Y7NH 3J81E 2F3IA 3J81c 1WTQA 1I6HB 1QB5D 1SNPA 1YNXA 3A7AB 2XRQD 4KN7C 3A5UA 1V1PB 4DR7L 1AEXA 4LF4Q 1BCPC 4A3EB 4RGOS 2R7FA 5CV9A 1S5FD 2C9OA 1HFNA 4ODGA 4B3TL 1EWCA 4DUYL 1NUCA 4ZYSA 4YCVA 1GO3E 5GAGC 2FFKB 2F3WA 4JI2Q 5CGKA 2GVAA 1VMCA 2E2DC 2JA5B 1WTRA 5K36H 2UUCQ 4C56C 3TREA 2QCPX 3Q22A 2LFNA 4MHEA 3SK8A 1P16A 3HOZG 1QVCA 3H94A 5EKKA 1I4XA 1OXTA 3VA7A 5LHY1 3HKZG 4A3FG 4LF5Q 2PMZE 4U68A 2XN9C 4Q5VA 3UDFA 4WFN3 3AMUA 5L37A 2KJXA 2JN4A 2CFMA 1WTHA 3I8ZA 1GVPA 4X62L 2ICEC 2I46A 3GTMH 1V9PA 1U5KA 4GN3B 2A68D 1SLJA 1SNCA 5T1IA 2ZTDA 3VYSA 2F4VQ 2OWOA 1IW7C 3J81L 1BBXC 1G8ZD 1EQTA 4K5XA 3GTKB 1LLRD 3G7LA 1DD2A 3RD4A 3FVQA 1UE1A 4JG2A 3MC0B 5IYBH 1AE2A 1KDAA 4RWSC 1HQRD 1ENFA 1K8MA 4DNRB 3NQIA 4LF4L 1BDOA 2KENA 2H1EA 3MWYW 3Q24A 5JEAH 3I4MB 3HOWB 4HIKA 2NVYB 3D4DA 2PZWA 1IBMQ 3WOEA 3UDXA 1EUJA 4A3EG 1YNNC 3S1NB 3OTOQ 2PZTA 1JJCB 4JI2L 1B1ZA 1WTPA 1LTRD 2L55A 2EYFA 2UUCL 1Q1EA 5I6YA 3S17B 2RBMA 3S1QB 3RLFA 1CA5A 2DJGC 4B3SQ 3PUWA 4LF5L 5I9PA 4YHHQ 1GUTA 2UUAL 1XWEA 3X3NA 3CCJA 1L0XB 4A3GH 1SN8A 1H9KA 5KNBA 3PO2G 1PV4A 2L15A 2B2TA 1MKHA 3IRBA 3V2TA 2F4VL 4XQJA 1NY4A 1O78A 1PRTF 3ITPA 4LAAA 1JWUD 1EIYB 2K28A 1VQMA 4JI3Q 1R4QB 3JAMi 3A5ZB 4IQZA 4DV5Q 2FJ2A 1NCVA 4EQPA 2PYKA 2A69D 2JA5H 2QKIC 2IX3A 1F9SA 2CH4A 1IBML 4IOCA 1HZBA 1VQFA 3BDOA 4LUZA 1ZYRD 2J4XA 4JBWA 1PH3A 3HOWG 1KTKA 3OTOL 4GLAC 4CDDC 3I4NB 4JI0Q 1QWYA 2WIIB 1EY7A 3OMCA 1QOHA 2K01A 1CSQA 2DY8A 2FXQA 5C3XA 4E6IA 2Y0SG 3S24A 2D0OA 4B3SL 1GUOA 3NHHA 1XMOQ 2HQEA 4A3JB 3NTKA 4YHHL 3CRLC 2L11A 1VQCA 2DUDA 3BYTB 3NTHA 1VQ9A 1LV9A 3I4OA 4DR2Q 3CCMA 1I4RA 2D0PA 3GTKH 2ES2A 1A15A 1PYWD 2E5LQ 2A6HC 1CA6A 3ND9A 1ONLA 5IP9H 4DU9A 3V96A 3H3VC 1H9SB 1WTOA 2PNHA 1STYA 3U9SA 4M8AA 4CKCA 3I4MH 5FJ8H 5JVH3 2NVXB 1PZID 1EU4A 4JI3L 4DK6C 3AYHB 4BBRH 1KNAA 1Q7YC 3C2PA 2EYJA 3NWSA 5LMNW 4DV7Q 3OOCA 4GNXC 2E2IH 5FO8B 4A3MB 1B9MA 3BVMA 4G4KA 4DV5L 3S1NH 4C2MB 2RDHA 4F87A 5EPLA 3J7ZC 3S1QH 3PO3B 4ZK9B 1ENCA 1NNXA 2Z1CA 3H91A 1PYBA 3R3OA 3VR5A 5DM73 4DV6Q 3KF8B 5IGBA 1B50A 3NXWA 5CC4A 1GXDC 2WV6D 2QW7A 1K28A 4JI0L 1SYFA 5FLMH 4C3HH 1M1KC 3EVQA 3CKIB 3TP8A 2J0TD 1ICFB 1G291 3K7UC 4A3BB 1NTGA 2WKCA 2K50A 4R4TA 3I4NG 1JR0D 1QVGA 4PMBA 1XMOL 3S14B 4CDEC 4C1NI 3KYHC 1UE7A 4IUQA 4DR2L 2MHVA 5C3EH 4IPDA 2VUMB 1B4OA 1Y8OB 4JVZA 2JXMB 4A3JG 2E5LL 3MA2B 4JC0A 2VY3A 4LMQD 5M3FH 1V1OA 1ESRA 1E1OA 1IZ6A 3DWQA 5IY0A 4FF1A 3VR3A 3S15H 4BY7H 4KHPQ 5C4ZA 1XPRA 3PV0A 5FO9B 3NQTA 3F2DA 3J7AF 4RA8A 4F8MA 3J81j 1ENAA 4DV7L 4G7OC 5M5YB 1KAWA 3NTIA 3JAML 3LWUA 1Z7TA 1EEID 1TS5A 1EY8A 3R2IA 3PUYA 5M5WB 1VMPA 4ZLTF 2HT1A 2I5HA 4A3MG 1I94Q 1ML0D 3RN2A 1LM0A 2K75A 4UP8A 4DV6L 1RIPA 4K0KQ 1RL2A 5EKIA 2AMCB 1TXYA 1FNUA 1Q82C 4ULLA 4DXGA 4K6LA 4BBSB 3H0GH 4B9WA 1SXTA 4JI8Q 1K8GA 4LW1A 4JI6Q 2L5TA 1MGSA 3C1FA 1M4VA 2AUKA 1V1QA 1QNKA 2EYHA 3CCUA 3MEHA 3CW2C 2LSSA 2CQAA 2DGYA 4XT1B 2E8GA 1AN8A 3PF4A 4XTCS 2VUMG 4A3KB 2K5DA 5H1SE 4KHPL 1V8QA 4WORA 3H6MA 5EPKA 4C2MH 1KDCA 3QOJA 4KK7A 2A74C 4DNIA 3PO3H 2NVQH 1KRTA 1ET6A 2F0KA 3ER0A 5J3BA 1CTMA 5C3WA 1F9RA 4DNTB 3U58A 3WOFA 4H02A 1SE2A 2I0QA 2F03A 2F0HA 1AZQA 2CQOA 3CCVA 3I90A 1CZWA 1UNSA 2Q8TA 1NMGA 2O2LD 1I94L 4A3BH 3NUCA 3K0YA 4NKLA 5E4XA 5GAHC 2MGSA 1XYIA 5IWAQ 1Y8PB 3I3CA 2XVSA 5HGQA 3S14H 3FMCA 1I4HA 1OXUA 4AQYQ 1D7QA 1RDPD 1KLUD 4X64Q 4CKEA 4BA1I 1DXMA 4V0BA 2K4KA 4AYBB 1FJGQ 1E2ZA 1GKHA 1F2YA 1LTGD 4QIWB 1TWFB 3W3AA 4JI8L 2HIXA 5IP7G 4IFDI 4BY1G 2CHBD 5LL6S 4P71A 2IPKD 4LNQA 4BBSG 4RCNA 3S1MB 1IKLA 2F0JA 2WB1B 1X3PA 1YI2A 1F9QA 3GTQB 4FXGC 1JT8A 1VCIA 4NP5A 2AHOB 4UHVA 4CJ0B 2R92H 4UY8C 3PIPA 1WFQA 4DV2Q 1X9NA 2HDLA 4YWMA 5CV8A 1SRUA 3HOUG 3PIP3 3S2DH 4DN4M 5CYUA 2LS01 3OPOA 3BZKA 2K52A 3VR2A 4R9WA 3TMEA 3A8KE 4PMCA 3ZYYX 2D5DA 1E7ZA 3VA5A 2K05A 4L8JA 5IWAL 2SEBD 4MNOA 1AH9A 3VYUA 1PH9A 3RLNA 1K3BC 4AQYL 2RA4A 4YIJA 4X64L 3GTLH 2ZXPA 1CKMA 3C46A 1FJGL 1PTOH 2UU9Q 3F1ZA 4LJZC 3KLSX 4GOPC 5I9OA 2OTJA 3GTOB 1NR4A 3MHBA 4OX9Q 3N6RA 1Y1VB 1W3SA 4A3KH 3MTSA 4DXFA 5ISRA 1K73C 3QO2A 3M3YH 4B3MQ 3UE0A 1BCPD 1BCPB 1JE5A 1LO5D 2EY6A 1B8AA 1FGUA 2E76C 5C0XI 4DV4Q 3I2ZA 2BCOA 5E7NA 4CJ2C 4FF4A 4A93H 2KBNA 1RCVD 1KDBA 3K8AA 1M8AA 4DV2L 1SE3A 3T51B 3PUVA 1NE3A 1SNDA 4QGUA 1XXGA 4P75A 1X3QA 4MN3A 3UI2A 5BR8Q 3HZXA 4R8IA 2X69A 1TWGB 4HIOA 2D2CC 3PQIA 2VB2X 1CKNB 1G2TA 3KF6B 2K5QA 3G71A 2K33A 2KHSA 1CT1D 2SNMA 2ZJRA 1Y69U 1TWFH 4HMJA 3TZUA 4GZYC 4OO1G 1CM9A 4OL7A 1W2BA 4P74A 2XNAC 1HZ9A 3T16A 4QJFA 5KNDA 1J5EQ 1A0IA 2H5XA 1IW7D 4F88A 1RHPA 3RUZA 5C5LA 1BR9A 1D1KA 1F9PA 1PRTC 2UU9L 3MFGA 1Y8NB 3R8BA 2JA9A 4BXXG 1V43A 2OXPA 4OX9L 3CAMA 1A2TA 3L7ZC 4B3ML 2LXKA 4ZAIA 1PHJA 4LFBQ 3J81i 1VF7A 1Y1VG 1PH1A 5C4XB 1KAAA 2M00A 2QEXA 4DV4L 4KHVA 1KNEA 2WAQB 1MSGA 1YNND 1B3QA 4KY7A 1SMYC 1Z9FA 3U4VA 2DNCA 2OCEA 1I4QA 3CC4A 3MZ5A 2M2LA 4NMZA 1S5DD 2RDFA 4DAYA 3GP7A 4LFAQ 3KUPA 2NYZD 5BR8L 1U9RA 3E6ZX 4O2DA 5DEHA 1EQQA 2R93H 3G48A 5CV6A 3M85A 3CMAA 2AWNA 4KD4A 2K5NA 1O7YA 4KD3A 1HR0Q 3LGJA 2K5VA 1SYCA 2GA4B 3SK6A 1VQLA 1AFPA 1OO9B 4POFA 2PI2A 5ELEA 1XNRQ 4OONA 1YVCA 4PZ8A 2AKWB 1X32A 4R4QA 2NN6H 2A6ED 2A1AA 4TSSA 1J5EL 1SEBD 3M9BA 5J22A 4GOPA 1FL0A 4DAVA 3A55A 1SYDA 2RSNA 2V4DA 2L9HA 1EIGA 4ILWA 1SYGA 1PXUA 2NTSA 5IGGA 2R7ZH 4KJOA 1FYCA 3D31A 1SBBB 1TKWB 3QOLA 4ZUJA 4G57A 2K5WA 4IUVA 4RG1A 5DM63 4HJ9A 4BWGB 1Q8KA 1WVLA 1EY4A 2XGTA 3P1HA 1YHAA 4LFBL 3MFYA 5K36G 1QILA 1DGSA 3CRKC 4CHTB 4A3GB 2B2TC 3P75A 3NBHA 4J6HA 3VYRA 4FDBA 3ERQA 4JPBW 1AZPA 1DYQA 1TWAH 2P5ZX 2F4IA 3VR4A 1LT4D 1TWGH 1BBWA 4OWTB 2R61A 4IFDJ 3S1RH 4LFAL 1SJED 1LT3D 4HMIA 3KDFB 4A3IH 4HAEA 4CJ1B 1RKNA 1X65A 3HS0C 3NWTA 4YWKA 1C7YA 1JE4A 1S40A 2A8VA 3I4LA 1B3AA 2XIWA 3ND8A 1HR0L 1EWHA 1HNWQ 3CCLA 2F0OA 2NZ1D 2K32A 2B39A 4L5QA 5EJWA 5IYBG 1XNRL 3X3MA 1O7ZA 3GV6A 2B29A 1HCZA 1MJEA 5IGEA 1E3PA 3V05A 4PZ7A 4A3CH 1HA6A 3I72A 4GKKQ 3BG3A 4PMWA 5JEAJ 5C4XH 4IFDH 5EGTA 5IYDH 3SK4A 4RMFA 4GNXB 2F52A 4NW2A 4IUUA 3IL8A 1JMCA 1GJXA 2MUYA 2X6GA 4JW0A 2FHTA 3DM1A 3S9WA 2I5LX 5F2DA 2MJ8A 2CWAA 4DK3C 4C3IB 1IYVA 2D9UA 2XRSD 3CCRA 2PMZB 4R4OA 4ABNA 3PMFA 2ZJPA 5AFWA 4A3GG 1WOCA 1D8LA 1K0RA 4HJ7A 2XTIA 5J39A 4NXNQ 3TQYA 2F0DA 3K58A 5DNFA 2BDNA 1S5ED 5GQOA 4JCVE 4ME3A 4BBRB 2F0PA 3D0FA 2MPMA 3TZDA 1HNWL 4CDCC 2E2IB 3LWEA 5COYA 3UDIA 2Y0SE 5C0XJ 1X55A 2B2YA 4P72A 4KHZA 1B70B 4UDUC 2A19A 2TSSA 1SE8A 1GD7A 5BN3A 2PW5A 1SJHD 1YJWA 1EZ8A 2KEDA 5TSSA 2JA6B 1FD7D 4XQQA 3U4ZA 3CP0A 4A3FH 5IYCH 1EFID 2JA5G 1T9HA 3HOXB 4GKKL 2F0UA 3KLRA 4DKAC 4JBMA 4HR7B 3C3LA 4C3HB 2IL8A 4FO2A 3ICEA 2H4OA 4OIKA 3LX0A 3I56A 2Q2TA 1JC7A 1H9MA 2K5HA 1L1OC 4K6DA 1KC8C 1QUQA 3RZOB 2LY7A 4JI1Q 1HNZQ 1E22A 1CFMA 1GUGA 3STBD 1TWCH 5C0XH 5CORA 5C3EB 1STBA 4L5TA 4DAMA 3PIOA 4UAIA 5M3MH 5J1ZA 2DY7A 1N32Q 5M3FB 2YTVA 1DOKA 1SNOA 1SROA 4CGYB 3S15B 5GAEC 4BY7B 1BBUA 1YHBA 3PIO3 2MO1A 4NXNL 3T1YQ 2JQOA 4C3JB 1SNQA 1VF5C 2AQ3B 2EOTA 2KCTA 1UE6A 3CCEA 5CBEE 5KGUA 1JCKB 5IP9G 3FHWA 1VQ6A 2O5JC 4HIDA 2IHFA 1YZ6A 1F2ZA 3H3VH 4EGVA 3I4MG 5FJ8G 4QCLA 1X3GA 2SOBA 4JYAQ 5KRUA 1BXTA 4NB3A 2EYOA 2F0WA 3D4RA 4BBRG 4X3UA 5G3LF 3ULJA 1OXVA 2LXJA 2IW3A 3BYYB 2ID0A 1G91A 1EQVA 3F2UA 1LACA 1W6KA 3M4QA 1VQOA 1I50B 3P20A 4Q0FA 4K8JA 4Z9CB 1J8IA 2NB0A 1VQHA 4J8QA 1NBWA 3K81C 4TQUS 4H44C 4TRDA 3H0GB 4C3IH 1H9JA 5FLMG 3FPPA 4JI1L 2FMMA 4C3HG 1HNZL 2K04A 1HFGA 3EBEA 2PW7A 2MP1A 3DLLA 5CV7A 3SVMA 3BDCA 1B2TA 4OEMB 1ILQA 5C44B 2I07B 4K8IA 3SK5A 1N32L 5C3EG 1O7IA 2EJGC 1SDFA 2YYZA 2LMCB 5KNCA 1N8RC 1C48A 1VQ8A 1WD1A 1LABA 3T1YL 2JA8B 3TP7A 1TY0A 5M3FG 2KCNA 2D62A 3ULPA 1PH6A 4BY7G 3AFPA 4P73A 1WTVA 2JA6H 2NVQB 4HCSA 4L5SA 1G6PA 1A3TA 2PQAA 4EVOA 1HXYD 4YCUA 1B9NA 4JYAL 3HOXH 1NMFA 2XWBB 3CF5A 1STAA 3FKIH 3MXNB 2Z8LA 3GV3A 4DK1A 1VQKA 2G5DA 3HP3A 2NWGA 4JK1C 1PFNA 1JOQA 1IBKQ 1MSHA 3FRPB 1F2LA 3AQQA 3F2CA 3RZOH 3CPFA 1K83B 5JAVA 4HTHA 3Q6SA 3G4SA 4HN7A 3HOVB 1L1OA 2OEOA 2PI2E 1DOMA 4PG3A 4KJNA 1MJCA 3NE5B 4S3SA 2MQHA 5JJKA 2E2JB 4DR1Q 1XTCD 5FOBB 1IL8A 5IIFA 2E2HB 1OXXK 3RR5A 2VQFQ 1VS0A 1IYUA 1IKMA 1MI2A 2CW0C 4C3JH 3H0GG 3KLWA 2Z4HA 1EQRA 1HUNA 3B6YA 1DZ1A 3AB9A 1L0WA 3DHQA 2BA0A 4LF9Q 2OQ0A 4JBKA 2R92B 1HZCA 1STEA 3I55A 2UXCQ 1EY5A 2JA7B 4OGQC 4XDXA 2EQSA 3S2HH 1S72A 5EBDA 1LTAD 1OXSC 4CDFC 1EIHA 3S2DB 1UE5A 2PZUA 3SE0A 1JB3A 1IYJB 3NPPA 1I50H 2NN6I 3PO3G 2DNEA 2B3GA 2PQEA 1CZGA 3CPWA 3VR6A 1IBKL 3QG1A 1YNJC 1YEZA 1CSPA 3FPUB 2FINB 4ZRZA 1PDQA 4X3TA 1EYDA 2HIVA 3GTLB 3IAYA 4A3BG 4JV5Q 1O7LA 3GTPH 3URYA 4P2CB 1V1PA 1PTOD 1RD9D 4H0LC 1PTOB 2V1CC 3HEJA 5JOBA 1FGBD 2JJQA 2Q8RE 5C44H 4A76A 4DR1L 4QY7A 4RKLA 1MIUA 4R1JA 2VQFL 4WJWA 4HSPA 2JA8H 2EDGA 3M3YB 1TY2A 2N55A 4IUTA 1CHPD 1YJ9A 2VQEQ 1ZYRC 4LF9L 5HURA 1W6JA 2KCMA 1SFOH 1LTSD 3A7LA 2BH2A 4A93B 2UXCL 2RCNA 2K14A 1PRTD 2O4XA 4A3DH 3HRZC 1PRTB 3NBIA 1EEFD 1C0AA 2R92G 1EOVA 1II3A 2AQ2B 2O5IC 1CK1A 5CV4A 4X66Q 4LWCA 1GHKA 1X3EA 1D2BA 2Q2UA 4K0KL 3T1HQ 3S16B 1K83H 1QZHA 3HOVH 1JICA 3NENA 1S3OA 4J1MA 1Q86C 1A3UA 1YJNA 2IY5B 2IX0A 3BJUA 4X65Q 1TU2B 2NBFA 3HOYH 2E2JH 4PNYA 2QF7A 2HQLA 4KKUA 1SMYD 2YTXA 1VQGA 1ASZA 2E2HH 2F1MA 4DR3Q 4JI6L 2YU9H 2CVRA 3MAQA 4JV5L 2LKVA 3D6CA 4G7ZC 1I3QH 1S5CD 1L2FA 1X6OA 4HEDA 1A8VA 1U4MA 2B63H 2IX1A 5M5XH 1LTTD 3DMUA 1MD2D 3TS2A 2E74C 3FP9A 1STHA 3PGZA 5C4JB 2JA7H 2Q2IA 3EA6A 4IO9A 2F0NA 2HUGA 5A35A 2EY2A 1YBYA 4IJHA 2AQ1B 4XIGS 2VQEL 1WD0A 1GM5A 2QDLA 3OIPA 2KUMA 4A3KG 3KFUA 1LUZA 4IUNA 4KKTA 2Z6KA 2RCFA 1WCMH 3TS0A 1QG7A 1GUSA 4K5WA 3TP5A 3EJIA 3K57A
chains in the Genus database with same CATH topology
2AKWB 4B3SQ 3PUWA 4GLVB 4R4QA 1CKOA 4LF5L 2A1AA 1VQDA 4JI5Q 1J5EL 4A93G 4YHHQ 3PUZA 4X66L 5C44G 2IT1A 2UUAL 3M9BA 4GOPA 1FL0A 2Z6KC 3CCJA 2UXDQ 4A3GH 2Z0SA 2RHQB 5LMUQ 4GOPB 3T1HL 4JI7L 1EYGA 1SN8A 4DR5Q 4IPCA 2R7ZH 2JA8G 3PO2G 1PV4A 2L15A 3D31A 2NVTH 1Y14B 4OO1I 1MKHA 3IRBA 2F4VL 4RG1A 4X65L 4HJ9A 1NY4A 1Q8KA 4YWLA 4EX5A 3EIVA 2XGTA 3W1BA 4AYBG 4DR3L 4OXPA 1YHAA 1EIYB 3CXCA 4LFBL 5K36G 1G51A 2VW9A 2YV5A 1VQMA 4JI3Q 3I4NH 4DV3Q 4A3DG 1DGSA 3K80C 3JAMi 3A5ZB 3STBC 5JJLA 4FDBA 1HJPA 2WP8J 1PA6A 4DV5Q 1TWAH 3DM3A 3NBHB 5LMNQ 1TWGH 4A75A 1BBWA 4OWTB 2ZTEA 2JA5H 1XNQL 1IXRA 3KDFA 2WB1G 4PZ6A 4A3JH 4IFDJ 3S1RH 1KIXA 4LFAL 4IJLA 1IBML 4IOCA 3HOVG 1HZBA 3KDFB 1VQFA 4LUZA 4KLKA 4A3IH 1NJIC 4JBWA 1X65A 4YWKA 1PH3A 2OTLA 1C7YA 2C35B 4KI0A 1HR0W 3OTOL 4GLAC 4GS3A 3HOWG 4JI5L 1S40A 3GO5A 4GKJQ 4HIMA 2A8VA 3HOUH 1Y1WH 2MO0A 4JI0Q 3HOYG 2N78A 1HR0L 1HNWQ 1HH2P 2NZOA 1CSQA 1X54A 3CCLA 3M7NA 4L5QA 1C9OA 3PCOB 4DR4L 4NXMQ 3S16H 2FXQA 5GADC 2HHHQ 2QGQA 5IYBG 3RZDH 1XNRL 3AEVA 1K8AC 1E1TA 4LUVA 2Y0SG 3K0XA 2D0OA 3S24A 2B29A 4B3SL 1EWIA 1XMOQ 2GVBA 2NVXH 1MJEA 4HJ8A 3H3VI 4YHHL 1K3RA 1N33Q 1VQCA 2DUDA 2KHIA 4IOAA 2B63G 1XPOA 4DR2Q 3I4OA 4JOIC 1VQ9A 3E9HA 3GDEA 3CCMA 2UXDL 1E3PA 1J6QA 2D0PA 4PZ7A 3GTKH 5LMUL 2ES2A 3CC7A 4A3MH 4A3CH 2VL6A 4DR5L 4GKKQ 2E5LQ 4B3RQ 4PMWA 5JEAJ 2MNAA 1N9WA 5C4XH 3KOJA 1JJ2A 2JA7G 5IYDH 4GNXA 2R93G 1Q1BA 3MEFA 4RMFA 5IP9H 4AYBE 4GNXB 2ASBA 2F52A 2PNHA 2BA1A 1JT8A 2ZM6Q 1JMCA 3I4MH 5FJ8H 3EN2A 4QIWE 1WCMG 4DV1Q 2EXDA 4JI3L 4BA2I 4DK6C 3AYHB 4BBRH 4DV3L 1Q7YC 2I5LX 5C4JH 5LMNW 4DV7Q 4LF6Q 1HNXQ 3I7FA 4GNXC 4YY3Q 2E2IH 1QVFA 3S1NH 4DV5L 2CWAA 5LMNL 2WB1E 4DK3C 1KXLA 4LF7Q 1X3FA 2ZJPA 4R4OA 3GTJH 3CCRA 4X6AH 4A3GG 1FVIA 1WOCA 1D8LA 1K0RA 4HJ7A 1K9MC 2XTIA 3PUXA 3J7ZC 4NXNQ 3TQYA 3S1QH 2VNUD 2R7ZG 1YHQA 1PYBA 3L2PA 3HFZB 1A62A 4DV6Q 3KF8B 2VUMH 5GQOA 1XTDA 4JCVE 4GKJL 1PH7A 4ME3A 1OTCA 4L5RC 1XPUA 4Y52H 1ASYA 3D0FA 4JI0L 5FLMH 1QZGA 4C3HH 1M1KC 1HNWL 5C0XJ 1G291 2Y0SE 3K7UC 3UDIA 4NXML 1VQNA 1NTGA 1X55A 3UE1A 4P72A 2HHHL 2K50A 4R4TA 3I4NG 4KHZA 1B70B 1QVGA 2I5MX 2A19A 1VQBA 3WWVA 3NEMA 2ATWA 1XMOL 3CCQA 1SE8A 1GD7A 1I5FA 3BU2A 3KYHC 2Q2HA 3M4PA 1UE7A 1PH2A 1PH8A 1UWVA 3HKZE 3GD7A 4APVA 1YJWA 1EFWA 4DR2L 5C3EH 3U4ZA 3CP0A 4IPDA 5M5YH 4UPAA 2MFIA 4A3FH 5IYCH 3RNUA 2JA5G 1T9HA 5HY6A 4GKKL 4A3JG 2E5LL 4B3RL 4DKAC 4JBMA 4WJ3M 4JC0A 2EIFA 2VY3A 3ICEA 5M3FH 5M5WH 4A3IG 5AJ3Q 1E1OA 1IZ6A 2OQKA 4IPGA 5IY0A 4MZ9A 3I56A 2Q2TA 3S15H 4BY7H 3CQZH 2K5HA 1L1OC 3W1GA 3VDYA 1KC8C 4KHPQ 1XPRA 4HJ5A 3PV0A 1Y1WG 1QUQA 2ZM6L 1KRSA 2RHSB 4JI1Q 1HNZQ 5EAYA 4ALPA 3F2DA 1QUQB 1E22A 4DV1L 3J81j 2AWOA 3STBD 3H15A 1TWCH 2QA4A 4DV7L 1VQ7A 4LF6L 5IP7H 1HNXL 4L5TA 1KAWA 4YY3L 4BY1H 4DAMA 1Q46A 3PIOA 5M3MH 3J7A5 1KHIA 3RN5A 4BBSH 1H95A 1X56A 4LF7L 1N32Q 3PUYA 2YTVA 1SROA 2HT1A 5GAEC 1BBUA 1YHBA 2I5HA 4A3CG 2MO1A 4A3MG 1I94Q 4NXNL 3KJOA 1PYSB 3T1YQ 4POGA 2JQOA 3RN2A 1LM0A 2KCTA 1UE6A 4IFDG 4QQBX 5C4XG 2K75A 4UP8A 3CCEA 4DV6L 5IYDG 1RIPA 5IP9G 3FHWA 1RL2A 2WAQG 1VQ6A 4K0KQ 3M4OH 4HIDA 5ELNA 1PH4A 2AMCB 2VS1A 2VZAA 2IHFA 1YZ6A 1TXYA 3H3VH 1Q82C 3I4MG 5FJ8G 1PH5A 1X3GA 1CUKA 4JYAQ 1VQPA 1YIJA 2UXBQ 4NB3A 3H0GH 4BBRG 2UUBQ 4JOIA 3ULJA 5IT9c 2R6GA 4JI8Q 1K8GA 4LW1A 4JI6Q 4A3LH 1OXVA 2LXJA 3L0OA 3ULLA 1V1QA 3CCUA 2YTYA 2ID0A 3CW2C 2LSSA 3E0EA 3BZCA 3M4QA 2DGYA 4A4IA 1WYDA 1VQOA 3J80c 2E8GA 1XMQQ 5AJ3L 3PF4A 1VQ5A 1VQAA 5JEAG 4XTCS 4DUZQ 1YITA 2VUMG 3CCSA 1VQHA 5H1SE 4KHPL 1NBWA 3K81C 4TQUS 2BH8A 3NELA 4C3IH 4C2MH 1U0LA 5FLMG 4JI1L 1HNZL 1KD1C 3GTGH 1EIFA 3K7AH 4NPSA 3EBEA 4DNIA 1Z47A 3DLLA 3PO3H 2NVQH 1KRTA 2JK8A 3ER0A 5J3BA 1WI5A 4HJAA 4IPHA 3U58A 3W5OA 4H02A 2I0QA 1N32L 2CQOA 3CCVA 5C3EG 1O7IA 1BVSA 2YYZA 1N8RC 1VQ8A 5IYCG 1NMGA 2CKZB 1I94L 3T1YL 4A3BH 2NN6G 3F8TA 2WAQE 3PF5A 5GAHC 4DV0Q 2UUAQ 4R4CA 3S1MH 5IWAQ 5M3FG 2RF4A 5HGQA 1JB7A 2D62A 3ULPA 3S14H 1PH6A 4BY7G 1OXUA 3AFPA 4P73A 4AQYQ 1D7QA 3GTQH 4UP9A 4X64Q 2JA6H 1VQEA 4R4IA 2JE6I 4BA1I 4L5SA 2K4KA 1G6PA 4J15A 4O0AA 2PQAA 3KJPA 1FJGQ 4YCUA 1GKHA 4JYAL 2UXBL 3HOXH 2PQAB 4AIMA 1NMFA 1IL2A 2ALYB 2UUBL 4YCWA 5C0XG 3CF5A 3CD6A 1A63A 3FKIH 3MXNB 1VQKA 5IP7G 4JI8L 2HIXA 4IFDI 4BY1G 4GN4B 2JEBI 5M3MG 4P71A 1IBKQ 4LNQA 4BBSG 1IBLQ 3AQQA 4OWXB 3F2CA 3RZOH 3JC66 3ERSX 3CPFA 1YI2A 3G4SA 1L1OA 4PG3A 2PI2E 3Q8DA 3HOZH 1JJGA 1VCIA 3J80i 4GN5A 3CMEA 1XMQL 1MJCA 2AHOB 2CWPA 1L1OB 4TVAB 4LFCQ 2R92H 4DUZL 1PVOA 4MTNA 4UY8C 2ZTCA 2MQHA 5JJKA 3PIPA 4DR7Q 1WFQA 4DR1Q 1E24A 2N8NA 4DV2Q 1X9NA 1OXXK 1N34Q 4QL5A 5IE8A 3RR5A 2VQFQ 1VS0A 3HKSA 4YWMA 1Q81C 4B3TQ 4C3JH 1SRUA 5JJIA 3HOUG 3H0GG 3KLWA 4DUYQ 1EQRA 4BXXH 3S2DH 3B6YA 1HZAA 3OYYA 1XJVA 4LF8Q 1L0WA 1R9TH 4A3LG 2BA0A 3A74A 4LF9Q 2OQ0A 1VQIA 4JBJA 2WFWA 3BZKA 2CCZA 4JBKA 1HZCA 2K52A 3GTOH 2IHEA 3I55A 2UXCQ 5ELOA 1Y1VH 2JEAI 1E7ZA 4DV0L 3PSIA 2EQSA 5IWAL 3S2HH 4MNOA 1AH9A 1PH9A 3RLNA 1S72A 4AQYL 1I6HH 1OXSC 1TWHH 4X64L 3GTLH 1CKMA 1WJJA 1FJGL 1UE5A 4X62Q 3F2BA 2UU9Q 3F1ZA 1IYJB 1KQSA 5DLQE 1I50H 2NZHA 2NN6I 3OW2A 3TRZA 3PO3G 4GOPC 2OTJA 3SGIA 4A3EH 1LYLA 1Q12A 2B3GA 3UDGA 4GLXA 3CPWA 4OX9Q 1UEBA 4UP7A 1W3SA 5FLXc 4A3KH 1IBKL 1YEZA 4EQ5A 2ZJQA 1K73C 1IBLL 1CSPA 4B3MQ 3M3YH 3UE0A 4OWWB 1JE5A 4Y7NH 1SR3A 2F3IA 3J81c 2HIVA 3U50C 4A3BG 4JV5Q 1LTLA 3ZJYC 3GTPH 4LFCL 1B8AA 1FGUA 1AE3A 1YNXA 5C0XI 4DV4Q 3A5UA 3I2ZA 2V1CC 5E7NA 4A93H 2JJQA 5C44H 2KBNA 4DR7L 4A76A 3K8AA 4LF4Q 4DR1L 2JA6G 1PFSA 4DV2L 4QY7A 2R7FA 1N34L 1MIUA 1NE3A 3PUVA 4R1JA 2VQFL 4QGUA 4P75A 4B3TL 1KL9A 2JA8H 3HOXG 3PO2H 4DUYL 5BR8Q 3FKIG 4YCVA 4LF8L 1YJ9A 4DR6Q 2VQEQ 1GO3E 5GAGC 4HIOA 1CKNA 1N36Q 4LF9L 4JI2Q 4DPGA 2GVAA 1B7YB 1VQJA 3KF6A 2KCMA 1SFOH 1CKNB 2UUCQ 2BH2A 2UXCL 2N49A 3KF6B 2RCNA 4AH6A 3TREA 3G71A 3CC2A 2K14A 4A3DH 1P16A 4JI4Q 2ZJRA 1TWFH 1QVCA 3HOZG 1C0AA 4OO1G 1OXTA 1W2BA 4P74A 1HZ9A 3HKZG 4QJFA 1EOVA 4A3FG 2R92G 4LF5Q 2PMZE 1J5EQ 3UDFA 1A0IA 2H5XA 4X66Q 4LWCA 3TEHB 1X3EA 2CFMA 2Q2UA 1GVPA 4X62L 2UU9L 4K0KL 1BKBA 3T1HQ 4JI7Q 1K83H 1QZHA 3HOVH 2N3SA 3GTMH 1V9PA 3NENA 1U5KA 4GN3B 1S3OA 2JA9A 1SLJA 3RLOA 3HOWH 1Q86C 4BXXG 1V43A 1YJNA 2IY5B 3A0JA 2IX0A 4OX9L 2ZTDA 2KHJA 2R7DA 2F4VQ 2OWOA 3BJUA 2NVYH 4X65Q 3CAMA 1N33L 3HOYH 3AFQA 3L7ZC 2E2JH 4B3ML 2HQLA 2LXKA 2YTXA 1VQGA 1ASZA 2E2HH 1PHJA 4DR3Q 4JI6L 3G6EA 1SMXA 1UE1A 2YU9H 4JG2A 4LFBQ 3J81i 4JV5L 5IYBH 1Y1VG 1PH1A 1AE2A 2GN5A 3JAMc 1I3QH 2QEXA 1L2FA 1X6OA 4DV4L 1A8VA 3S17H 2B63H 1P8LA 4LF4L 1Z9FA 2KENA 2OCEA 3U4VA 2IX1A 5M5XH 3CC4A 1XNQQ 4HIKA 3E9IA 3TS2A 4LFAQ 1IBMQ 3FP9A 3PGZA 3UDXA 1EUJA 2JA7H 5BR8L 4DAYB 2Q2IA 4O2DA 1VQ4A 1EQQA 5GROA 4IO9A 4A3EG 2R93H 3G48A 4DR6L 3CMAA 1YBYA 4IJHA 4XIGS 3OTOQ 3M85A 2AWNA 2VQEL 1GM5A 1JJCB 2K5NA 4A3KG 1N36L 4JI2L 1LUZA 3KFUA 2Z6KA 1HR0Q 4LUOA 3LGJA 2K5VA 1WCMH 2UUCL 1M90C 3TS0A 1Q1EA 1VQLA 4POFA 4DR4Q 4JI4L 4WJ4A 2PI2A 1XNRQ 4OONA 3RLFA 1YVCA 4PZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKW B;  4B3S Q;  3PUW A;  4GLV B;  4R4Q A;  1CKO A;  4LF5 L;  2A1A A;  1VQD A;  4JI5 Q;  1J5E L;  4A93 G;  4YHH Q;  3PUZ A;  4X66 L;  5C44 G;  2IT1 A;  2UUA L;  3M9B A;  4GOP A;  1FL0 A;  2Z6K C;  3CCJ A;  2UXD Q;  4A3G H;  2Z0S A;  2RHQ B;  5LMU Q;  4GOP B;  3T1H L;  4JI7 L;  1EYG A;  1SN8 A;  4DR5 Q;  4IPC A;  2R7Z H;  2JA8 G;  3PO2 G;  1PV4 A;  2L15 A;  3D31 A;  2NVT H;  1Y14 B;  4OO1 I;  1MKH A;  3IRB A;  2F4V L;  4RG1 A;  4X65 L;  4HJ9 A;  1NY4 A;  1Q8K A;  4YWL A;  4EX5 A;  3EIV A;  2XGT A;  3W1B A;  4AYB G;  4DR3 L;  4OXP A;  1YHA A;  1EIY B;  3CXC A;  4LFB L;  5K36 G;  1G51 A;  2VW9 A;  2YV5 A;  1VQM A;  4JI3 Q;  3I4N H;  4DV3 Q;  4A3D G;  1DGS A;  3K80 C;  3JAM i;  3A5Z B;  3STB C;  5JJL A;  4FDB A;  1HJP A;  2WP8 J;  1PA6 A;  4DV5 Q;  1TWA H;  3DM3 A;  3NBH B;  5LMN Q;  1TWG H;  4A75 A;  1BBW A;  4OWT B;  2ZTE A;  2JA5 H;  1XNQ L;  1IXR A;  3KDF A;  2WB1 G;  4PZ6 A;  4A3J H;  4IFD J;  3S1R H;  1KIX A;  4LFA L;  4IJL A;  1IBM L;  4IOC A;  3HOV G;  1HZB A;  3KDF B;  1VQF A;  4LUZ A;  4KLK A;  4A3I H;  1NJI C;  4JBW A;  1X65 A;  4YWK A;  1PH3 A;  2OTL A;  1C7Y A;  2C35 B;  4KI0 A;  1HR0 W;  3OTO L;  4GLA C;  4GS3 A;  3HOW G;  4JI5 L;  1S40 A;  3GO5 A;  4GKJ Q;  4HIM A;  2A8V A;  3HOU H;  1Y1W H;  2MO0 A;  4JI0 Q;  3HOY G;  2N78 A;  1HR0 L;  1HNW Q;  1HH2 P;  2NZO A;  1CSQ A;  1X54 A;  3CCL A;  3M7N A;  4L5Q A;  1C9O A;  3PCO B;  4DR4 L;  4NXM Q;  3S16 H;  2FXQ A;  5GAD C;  2HHH Q;  2QGQ A;  5IYB G;  3RZD H;  1XNR L;  3AEV A;  1K8A C;  1E1T A;  4LUV A;  2Y0S G;  3K0X A;  2D0O A;  3S24 A;  2B29 A;  4B3S L;  1EWI A;  1XMO Q;  2GVB A;  2NVX H;  1MJE A;  4HJ8 A;  3H3V I;  4YHH L;  1K3R A;  1N33 Q;  1VQC A;  2DUD A;  2KHI A;  4IOA A;  2B63 G;  1XPO A;  4DR2 Q;  3I4O A;  4JOI C;  1VQ9 A;  3E9H A;  3GDE A;  3CCM A;  2UXD L;  1E3P A;  1J6Q A;  2D0P A;  4PZ7 A;  3GTK H;  5LMU L;  2ES2 A;  3CC7 A;  4A3M H;  4A3C H;  2VL6 A;  4DR5 L;  4GKK Q;  2E5L Q;  4B3R Q;  4PMW A;  5JEA J;  2MNA A;  1N9W A;  5C4X H;  3KOJ A;  1JJ2 A;  2JA7 G;  5IYD H;  4GNX A;  2R93 G;  1Q1B A;  3MEF A;  4RMF A;  5IP9 H;  4AYB E;  4GNX B;  2ASB A;  2F52 A;  2PNH A;  2BA1 A;  1JT8 A;  2ZM6 Q;  1JMC A;  3I4M H;  5FJ8 H;  3EN2 A;  4QIW E;  1WCM G;  4DV1 Q;  2EXD A;  4JI3 L;  4BA2 I;  4DK6 C;  3AYH B;  4BBR H;  4DV3 L;  1Q7Y C;  2I5L X;  5C4J H;  5LMN W;  4DV7 Q;  4LF6 Q;  1HNX Q;  3I7F A;  4GNX C;  4YY3 Q;  2E2I H;  1QVF A;  3S1N H;  4DV5 L;  2CWA A;  5LMN L;  2WB1 E;  4DK3 C;  1KXL A;  4LF7 Q;  1X3F A;  2ZJP A;  4R4O A;  3GTJ H;  3CCR A;  4X6A H;  4A3G G;  1FVI A;  1WOC A;  1D8L A;  1K0R A;  4HJ7 A;  1K9M C;  2XTI A;  3PUX A;  3J7Z C;  4NXN Q;  3TQY A;  3S1Q H;  2VNU D;  2R7Z G;  1YHQ A;  1PYB A;  3L2P A;  3HFZ B;  1A62 A;  4DV6 Q;  3KF8 B;  2VUM H;  5GQO A;  1XTD A;  4JCV E;  4GKJ L;  1PH7 A;  4ME3 A;  1OTC A;  4L5R C;  1XPU A;  4Y52 H;  1ASY A;  3D0F A;  4JI0 L;  5FLM H;  1QZG A;  4C3H H;  1M1K C;  1HNW L;  5C0X J;  1G29 1;  2Y0S E;  3K7U C;  3UDI A;  4NXM L;  1VQN A;  1NTG A;  1X55 A;  3UE1 A;  4P72 A;  2HHH L;  2K50 A;  4R4T A;  3I4N G;  4KHZ A;  1B70 B;  1QVG A;  2I5M X;  2A19 A;  1VQB A;  3WWV A;  3NEM A;  2ATW A;  1XMO L;  3CCQ A;  1SE8 A;  1GD7 A;  1I5F A;  3BU2 A;  3KYH C;  2Q2H A;  3M4P A;  1UE7 A;  1PH2 A;  1PH8 A;  1UWV A;  3HKZ E;  3GD7 A;  4APV A;  1YJW A;  1EFW A;  4DR2 L;  5C3E H;  3U4Z A;  3CP0 A;  4IPD A;  5M5Y H;  4UPA A;  2MFI A;  4A3F H;  5IYC H;  3RNU A;  2JA5 G;  1T9H A;  5HY6 A;  4GKK L;  4A3J G;  2E5L L;  4B3R L;  4DKA C;  4JBM A;  4WJ3 M;  4JC0 A;  2EIF A;  2VY3 A;  3ICE A;  5M3F H;  5M5W H;  4A3I G;  5AJ3 Q;  1E1O A;  1IZ6 A;  2OQK A;  4IPG A;  5IY0 A;  4MZ9 A;  3I56 A;  2Q2T A;  3S15 H;  4BY7 H;  3CQZ H;  2K5H A;  1L1O C;  3W1G A;  3VDY A;  1KC8 C;  4KHP Q;  1XPR A;  4HJ5 A;  3PV0 A;  1Y1W G;  1QUQ A;  2ZM6 L;  1KRS A;  2RHS B;  4JI1 Q;  1HNZ Q;  5EAY A;  4ALP A;  3F2D A;  1QUQ B;  1E22 A;  4DV1 L;  3J81 j;  2AWO A;  3STB D;  3H15 A;  1TWC H;  2QA4 A;  4DV7 L;  1VQ7 A;  4LF6 L;  5IP7 H;  1HNX L;  4L5T A;  1KAW A;  4YY3 L;  4BY1 H;  4DAM A;  1Q46 A;  3PIO A;  5M3M H;  3J7A 5;  1KHI A;  3RN5 A;  4BBS H;  1H95 A;  1X56 A;  4LF7 L;  1N32 Q;  3PUY A;  2YTV A;  1SRO A;  2HT1 A;  5GAE C;  1BBU A;  1YHB A;  2I5H A;  4A3C G;  2MO1 A;  4A3M G;  1I94 Q;  4NXN L;  3KJO A;  1PYS B;  3T1Y Q;  4POG A;  2JQO A;  3RN2 A;  1LM0 A;  2KCT A;  1UE6 A;  4IFD G;  4QQB X;  5C4X G;  2K75 A;  4UP8 A;  3CCE A;  4DV6 L;  5IYD G;  1RIP A;  5IP9 G;  3FHW A;  1RL2 A;  2WAQ G;  1VQ6 A;  4K0K Q;  3M4O H;  4HID A;  5ELN A;  1PH4 A;  2AMC B;  2VS1 A;  2VZA A;  2IHF A;  1YZ6 A;  1TXY A;  3H3V H;  1Q82 C;  3I4M G;  5FJ8 G;  1PH5 A;  1X3G A;  1CUK A;  4JYA Q;  1VQP A;  1YIJ A;  2UXB Q;  4NB3 A;  3H0G H;  4BBR G;  2UUB Q;  4JOI A;  3ULJ A;  5IT9 c;  2R6G A;  4JI8 Q;  1K8G A;  4LW1 A;  4JI6 Q;  4A3L H;  1OXV A;  2LXJ A;  3L0O A;  3ULL A;  1V1Q A;  3CCU A;  2YTY A;  2ID0 A;  3CW2 C;  2LSS A;  3E0E A;  3BZC A;  3M4Q A;  2DGY A;  4A4I A;  1WYD A;  1VQO A;  3J80 c;  2E8G A;  1XMQ Q;  5AJ3 L;  3PF4 A;  1VQ5 A;  1VQA A;  5JEA G;  4XTC S;  4DUZ Q;  1YIT A;  2VUM G;  3CCS A;  1VQH A;  5H1S E;  4KHP L;  1NBW A;  3K81 C;  4TQU S;  2BH8 A;  3NEL A;  4C3I H;  4C2M H;  1U0L A;  5FLM G;  4JI1 L;  1HNZ L;  1KD1 C;  3GTG H;  1EIF A;  3K7A H;  4NPS A;  3EBE A;  4DNI A;  1Z47 A;  3DLL A;  3PO3 H;  2NVQ H;  1KRT A;  2JK8 A;  3ER0 A;  5J3B A;  1WI5 A;  4HJA A;  4IPH A;  3U58 A;  3W5O A;  4H02 A;  2I0Q A;  1N32 L;  2CQO A;  3CCV A;  5C3E G;  1O7I A;  1BVS A;  2YYZ A;  1N8R C;  1VQ8 A;  5IYC G;  1NMG A;  2CKZ B;  1I94 L;  3T1Y L;  4A3B H;  2NN6 G;  3F8T A;  2WAQ E;  3PF5 A;  5GAH C;  4DV0 Q;  2UUA Q;  4R4C A;  3S1M H;  5IWA Q;  5M3F G;  2RF4 A;  5HGQ A;  1JB7 A;  2D62 A;  3ULP A;  3S14 H;  1PH6 A;  4BY7 G;  1OXU A;  3AFP A;  4P73 A;  4AQY Q;  1D7Q A;  3GTQ H;  4UP9 A;  4X64 Q;  2JA6 H;  1VQE A;  4R4I A;  2JE6 I;  4BA1 I;  4L5S A;  2K4K A;  1G6P A;  4J15 A;  4O0A A;  2PQA A;  3KJP A;  1FJG Q;  4YCU A;  1GKH A;  4JYA L;  2UXB L;  3HOX H;  2PQA B;  4AIM A;  1NMF A;  1IL2 A;  2ALY B;  2UUB L;  4YCW A;  5C0X G;  3CF5 A;  3CD6 A;  1A63 A;  3FKI H;  3MXN B;  1VQK A;  5IP7 G;  4JI8 L;  2HIX A;  4IFD I;  4BY1 G;  4GN4 B;  2JEB I;  5M3M G;  4P71 A;  1IBK Q;  4LNQ A;  4BBS G;  1IBL Q;  3AQQ A;  4OWX B;  3F2C A;  3RZO H;  3JC6 6;  3ERS X;  3CPF A;  1YI2 A;  3G4S A;  1L1O A;  4PG3 A;  2PI2 E;  3Q8D A;  3HOZ H;  1JJG A;  1VCI A;  3J80 i;  4GN5 A;  3CME A;  1XMQ L;  1MJC A;  2AHO B;  2CWP A;  1L1O B;  4TVA B;  4LFC Q;  2R92 H;  4DUZ L;  1PVO A;  4MTN A;  4UY8 C;  2ZTC A;  2MQH A;  5JJK A;  3PIP A;  4DR7 Q;  1WFQ A;  4DR1 Q;  1E24 A;  2N8N A;  4DV2 Q;  1X9N A;  1OXX K;  1N34 Q;  4QL5 A;  5IE8 A;  3RR5 A;  2VQF Q;  1VS0 A;  3HKS A;  4YWM A;  1Q81 C;  4B3T Q;  4C3J H;  1SRU A;  5JJI A;  3HOU G;  3H0G G;  3KLW A;  4DUY Q;  1EQR A;  4BXX H;  3S2D H;  3B6Y A;  1HZA A;  3OYY A;  1XJV A;  4LF8 Q;  1L0W A;  1R9T H;  4A3L G;  2BA0 A;  3A74 A;  4LF9 Q;  2OQ0 A;  1VQI A;  4JBJ A;  2WFW A;  3BZK A;  2CCZ A;  4JBK A;  1HZC A;  2K52 A;  3GTO H;  2IHE A;  3I55 A;  2UXC Q;  5ELO A;  1Y1V H;  2JEA I;  1E7Z A;  4DV0 L;  3PSI A;  2EQS A;  5IWA L;  3S2H H;  4MNO A;  1AH9 A;  1PH9 A;  3RLN A;  1S72 A;  4AQY L;  1I6H H;  1OXS C;  1TWH H;  4X64 L;  3GTL H;  1CKM A;  1WJJ A;  1FJG L;  1UE5 A;  4X62 Q;  3F2B A;  2UU9 Q;  3F1Z A;  1IYJ B;  1KQS A;  5DLQ E;  1I50 H;  2NZH A;  2NN6 I;  3OW2 A;  3TRZ A;  3PO3 G;  4GOP C;  2OTJ A;  3SGI A;  4A3E H;  1LYL A;  1Q12 A;  2B3G A;  3UDG A;  4GLX A;  3CPW A;  4OX9 Q;  1UEB A;  4UP7 A;  1W3S A;  5FLX c;  4A3K H;  1IBK L;  1YEZ A;  4EQ5 A;  2ZJQ A;  1K73 C;  1IBL L;  1CSP A;  4B3M Q;  3M3Y H;  3UE0 A;  4OWW B;  1JE5 A;  4Y7N H;  1SR3 A;  2F3I A;  3J81 c;  2HIV A;  3U50 C;  4A3B G;  4JV5 Q;  1LTL A;  3ZJY C;  3GTP H;  4LFC L;  1B8A A;  1FGU A;  1AE3 A;  1YNX A;  5C0X I;  4DV4 Q;  3A5U A;  3I2Z A;  2V1C C;  5E7N A;  4A93 H;  2JJQ A;  5C44 H;  2KBN A;  4DR7 L;  4A76 A;  3K8A A;  4LF4 Q;  4DR1 L;  2JA6 G;  1PFS A;  4DV2 L;  4QY7 A;  2R7F A;  1N34 L;  1MIU A;  1NE3 A;  3PUV A;  4R1J A;  2VQF L;  4QGU A;  4P75 A;  4B3T L;  1KL9 A;  2JA8 H;  3HOX G;  3PO2 H;  4DUY L;  5BR8 Q;  3FKI G;  4YCV A;  4LF8 L;  1YJ9 A;  4DR6 Q;  2VQE Q;  1GO3 E;  5GAG C;  4HIO A;  1CKN A;  1N36 Q;  4LF9 L;  4JI2 Q;  4DPG A;  2GVA A;  1B7Y B;  1VQJ A;  3KF6 A;  2KCM A;  1SFO H;  1CKN B;  2UUC Q;  2BH2 A;  2UXC L;  2N49 A;  3KF6 B;  2RCN A;  4AH6 A;  3TRE A;  3G71 A;  3CC2 A;  2K14 A;  4A3D H;  1P16 A;  4JI4 Q;  2ZJR A;  1TWF H;  1QVC A;  3HOZ G;  1C0A A;  4OO1 G;  1OXT A;  1W2B A;  4P74 A;  1HZ9 A;  3HKZ G;  4QJF A;  1EOV A;  4A3F G;  2R92 G;  4LF5 Q;  2PMZ E;  1J5E Q;  3UDF A;  1A0I A;  2H5X A;  4X66 Q;  4LWC A;  3TEH B;  1X3E A;  2CFM A;  2Q2U A;  1GVP A;  4X62 L;  2UU9 L;  4K0K L;  1BKB A;  3T1H Q;  4JI7 Q;  1K83 H;  1QZH A;  3HOV H;  2N3S A;  3GTM H;  1V9P A;  3NEN A;  1U5K A;  4GN3 B;  1S3O A;  2JA9 A;  1SLJ A;  3RLO A;  3HOW H;  1Q86 C;  4BXX G;  1V43 A;  1YJN A;  2IY5 B;  3A0J A;  2IX0 A;  4OX9 L;  2ZTD A;  2KHJ A;  2R7D A;  2F4V Q;  2OWO A;  3BJU A;  2NVY H;  4X65 Q;  3CAM A;  1N33 L;  3HOY H;  3AFQ A;  3L7Z C;  2E2J H;  4B3M L;  2HQL A;  2LXK A;  2YTX A;  1VQG A;  1ASZ A;  2E2H H;  1PHJ A;  4DR3 Q;  4JI6 L;  3G6E A;  1SMX A;  1UE1 A;  2YU9 H;  4JG2 A;  4LFB Q;  3J81 i;  4JV5 L;  5IYB H;  1Y1V G;  1PH1 A;  1AE2 A;  2GN5 A;  3JAM c;  1I3Q H;  2QEX A;  1L2F A;  1X6O A;  4DV4 L;  1A8V A;  3S17 H;  2B63 H;  1P8L A;  4LF4 L;  1Z9F A;  2KEN A;  2OCE A;  3U4V A;  2IX1 A;  5M5X H;  3CC4 A;  1XNQ Q;  4HIK A;  3E9I A;  3TS2 A;  4LFA Q;  1IBM Q;  3FP9 A;  3PGZ A;  3UDX A;  1EUJ A;  2JA7 H;  5BR8 L;  4DAY B;  2Q2I A;  4O2D A;  1VQ4 A;  1EQQ A;  5GRO A;  4IO9 A;  4A3E G;  2R93 H;  3G48 A;  4DR6 L;  3CMA A;  1YBY A;  4IJH A;  4XIG S;  3OTO Q;  3M85 A;  2AWN A;  2VQE L;  1GM5 A;  1JJC B;  2K5N A;  4A3K G;  1N36 L;  4JI2 L;  1LUZ A;  3KFU A;  2Z6K A;  1HR0 Q;  4LUO A;  3LGJ A;  2K5V A;  1WCM H;  2UUC L;  1M90 C;  3TS0 A;  1Q1E A;  1VQL A;  4POF A;  4DR4 Q;  4JI4 L;  4WJ4 A;  2PI2 A;  1XNR Q;  4OON A;  3RLF A;  1YVC A;  4PZ8 A; 
#chains in the Genus database with same CATH topology
 4RKB A;  2PPB C;  1A3V A;  4GLV B;  2RDG A;  1CKO A;  1VQD A;  4A93 G;  2M9V A;  3NK9 A;  3PUZ A;  4X66 L;  2IT1 A;  2R93 B;  2UXD Q;  1RTN A;  2RHQ B;  2XSC A;  5LMU Q;  3T1H L;  1SSO A;  3P7J A;  1PZJ D;  4IPC A;  1STN A;  1XX8 A;  2NVT H;  2EYP A;  3R93 A;  4TKO B;  4X65 L;  1J9O A;  5E1F A;  2WKD A;  4YWL A;  2EPB A;  1A2U A;  3EIV A;  3NP8 A;  5JPM C;  1VDZ A;  4AYB G;  4DR3 L;  4MIU A;  1G51 A;  2B8F A;  1B53 A;  2AUJ D;  4QF4 A;  2WP8 J;  2R7Z B;  5LMN Q;  4A75 A;  3RMH A;  4XXE A;  4PZ6 A;  2WB1 G;  3D8G A;  2F0T A;  2F0V A;  1SAP A;  4KLK A;  2EY1 A;  2C35 B;  4KI0 A;  4GKJ Q;  3GO5 A;  1MBY A;  3HOU H;  4XYQ A;  2MO0 A;  1D1I A;  5ELD A;  1Y1W H;  2XWJ B;  1D5M C;  2F0I A;  1D5X C;  2NZO A;  1X54 A;  1C9O A;  1TWA B;  3S16 H;  2BDO A;  5GAD C;  3RZD H;  1GUW A;  4O42 A;  2GVB A;  3S1R B;  3H3V I;  1N33 Q;  3M4O B;  1NR2 A;  2KHI A;  1XPO A;  3E9H A;  3GDE A;  4A3I B;  2UXD L;  1J6Q A;  2ZXO A;  4XT3 B;  5LMU L;  5JVG 3;  5FKA C;  1STG A;  1N9W A;  3KOJ A;  1U4R A;  1H9S A;  2R93 G;  1FR3 A;  1BF4 A;  2B2W C;  2L12 A;  3EN2 A;  2EXD A;  4U67 3;  4BA2 I;  5C4J H;  2F3V A;  4YY3 Q;  4DF7 A;  5LMN L;  3GTG B;  4LF7 Q;  1X3F A;  4X6A H;  3GTJ H;  5BN5 A;  1FVI A;  3K5O A;  5IGF A;  3PUX A;  3KF8 A;  2R7Z G;  1YHQ A;  1Q3L A;  1BOS A;  1RF2 D;  1XTD A;  4GKJ L;  1ASY A;  3G6J B;  4M1U B;  5I2Y A;  1G6Z A;  5CR3 A;  4N9P A;  2L4N A;  2QDB A;  1VQN A;  4OEL B;  3UE1 A;  2WAC A;  5I6W A;  5JPN C;  1RJT A;  3WWV A;  3WDN A;  2ATW A;  3CCQ A;  1I5F A;  4NDX A;  1OTC A;  2Q2H A;  3R2T A;  1PH2 A;  4L5R C;  2Z4I A;  3HKZ E;  1N33 L;  4APV A;  1LT5 D;  4ZQ3 A;  2EYM A;  4UPA A;  1EY9 A;  3RNU A;  5HY6 A;  4N8F A;  2B2Y C;  4LK1 C;  4A3I G;  5AJ3 Q;  2OQK A;  4IPG A;  1UUP A;  3CQZ H;  5D3D A;  1GUN A;  4HJ5 A;  3L9A X;  5EAY A;  4ALP A;  1I4G A;  2E75 C;  3CU7 A;  3H15 A;  2QA4 A;  4PV1 C;  4XQN A;  1VQ7 A;  4A3F B;  4YY3 L;  1Q46 A;  3M7G A;  3RN5 A;  1H95 A;  4LF7 L;  1TS4 A;  4KV6 A;  1BNZ A;  1GOZ A;  1LTB D;  4A3C G;  3W2D A;  3KJO A;  4L6T B;  1HHV A;  3J7A V;  4QQB X;  3DEO A;  4IFD G;  5C4X G;  4FXD A;  5IYD G;  1I4P A;  4I7Z C;  4V19 0;  1JOR A;  2WAQ G;  5EKL A;  1K8O A;  3M4O H;  1TWC B;  5ELN A;  4I7A A;  5M3M B;  1PH5 A;  1EYA A;  1VQP A;  2PNR C;  2UXB Q;  1FNV A;  2UUB Q;  5IT9 E;  3E5S A;  5IT9 c;  2R6G A;  5EPJ A;  1TII D;  4BS9 A;  4A3L H;  1TS2 A;  1TWH B;  3OSO A;  3ULL A;  3T56 B;  2A6H D;  5EBC A;  3IFT A;  3Q23 A;  3E0E A;  3BZC A;  4ZKB B;  3J80 E;  2B2W A;  1WYD A;  3J80 c;  3I91 A;  2RKS A;  1XMQ Q;  1DCZ A;  3FEW X;  5AJ3 L;  3GQB A;  5JEA G;  4OHJ A;  5C5M A;  1MHW C;  2BH8 A;  2NTT A;  4XYO A;  3GTG H;  1KD1 C;  3T13 A;  3K7A H;  4NPS A;  1CHQ D;  1Z47 A;  1ICW A;  2JK8 A;  1WI5 A;  2EYL A;  4N8X 1;  5T1G A;  3W5O A;  3MXP A;  3TDQ A;  5C4H A;  5IYC G;  2CKZ B;  3PO2 B;  2UUA Q;  4DV0 Q;  2F0G A;  2PCF B;  3E3X A;  4R4C A;  4IUR A;  4KMU C;  1JB7 A;  4UP9 A;  5IGC A;  4RAU C;  4R4I A;  2JE6 I;  4ZKC B;  2F0F A;  4J15 A;  3K59 A;  3QB3 A;  5IT9 L;  2NUC A;  3HGB A;  2X6L A;  2UXB L;  4AIM A;  2UUB L;  4YCW A;  5C0X G;  3CD6 A;  1A63 A;  2EXZ A;  3MXG A;  2EY5 A;  3OIQ A;  3BDL A;  5M3M G;  4R8N A;  1BQQ T;  3J80 L;  3JC6 6;  2KVM A;  3HOZ H;  1XMQ L;  1HPC A;  2F0M A;  4LFC Q;  2CW0 D;  1PVO A;  4MTN A;  3I73 A;  2JSO A;  3I70 A;  3HG9 A;  3C1E A;  3FKI B;  2N8N A;  1N34 Q;  4QL5 A;  5IE8 A;  3HKS A;  1Q81 C;  4DFA A;  5CMD A;  2Y0S B;  2Z6B A;  5JJI A;  2SNS A;  1HZA A;  2A73 B;  1XJV A;  1HQM C;  4LF8 Q;  1R9T H;  1PTO F;  3A74 A;  1VQI A;  3SHL A;  2WFW A;  2CCZ A;  2IHE A;  5ELO A;  5KYI A;  2JEA I;  2TMP A;  4DV0 L;  5JJZ A;  1I6H H;  1UEA B;  1TWH H;  1AP0 A;  1WJJ A;  1YNJ D;  4C3I G;  2A6E C;  3FDT A;  4FXK C;  1JWS D;  4DA2 A;  3F2B A;  2B8G A;  2KA7 A;  1KQS A;  5D3I B;  3TRZ A;  4A3E H;  1LYL A;  2KCC A;  4MTK A;  5FLX E;  2EVB A;  5FLX c;  5E4W C;  4EQ5 A;  2ZJQ A;  1AW7 A;  3S2H B;  1SR3 A;  1EL0 A;  1DJR D;  4O1N A;  3U50 C;  1LTL A;  3ZJY C;  4LFC L;  4X3S A;  1AE3 A;  1TR5 A;  4K2K A;  2BE5 C;  2JA6 G;  1PFS A;  1N34 L;  3QWN A;  2ZT9 C;  1S4Z A;  3N52 A;  3KLS A;  1KL9 A;  3OMG A;  4OIJ A;  3HOX G;  3PO2 H;  4HSV A;  5I2X A;  3FKI G;  4LF8 L;  4DR6 Q;  5E3F A;  1C4Q A;  4PQX A;  4IUP A;  1CKN A;  2EE1 A;  4CBV A;  1CQF A;  2JP1 A;  4DPG A;  1N36 Q;  3GTP B;  1B7Y B;  1VQJ A;  3EFX D;  3KF6 A;  4I65 A;  5FK9 C;  2HCC A;  1TQO A;  2N49 A;  1C8C A;  4AH6 A;  3CC2 A;  4JI4 Q;  4HCE A;  2RQX A;  2CH4 W;  4G7H C;  1T5E A;  3MXU A;  3BS1 A;  3A54 A;  2BOS A;  3TEH B;  1BKB A;  3H09 A;  4JI7 Q;  1D6E C;  5FLX L;  3OHX C;  2IWH A;  2N3S A;  5KEE A;  4KY5 A;  4RFB A;  2IJ0 A;  1SE4 A;  4C3J G;  1SFO B;  2DJF C;  3RLO A;  3HOW H;  1HRJ A;  3A0J A;  2KHJ A;  2R7D A;  2NVY H;  1U4P A;  4A3D B;  3AFQ A;  2EJM A;  1QCB D;  3M4Y A;  3G6E A;  1SMX A;  2J7Z A;  2EZV A;  1Q8I A;  2A68 C;  3JAM E;  3SDZ A;  2GN5 A;  1BO0 A;  3JAM c;  2L0C A;  3MVV A;  2Q8I B;  2FMC A;  3S17 H;  1P8L A;  1E2W A;  1EOT A;  1T5X D;  2F0E A;  1XNQ Q;  2EJF C;  3E9I A;  3HOY B;  4FP5 D;  2KOL A;  4DAY B;  1VQ4 A;  5GRO A;  1CI3 M;  4DR6 L;  2YU9 B;  4H7B A;  5BN4 A;  1BCP F;  1TVX A;  4JI5 Q;  2PO4 A;  1N36 L;  4EQO A;  1I3Q B;  3BVZ A;  4LUO A;  1M90 C;  2SDF A;  4DR4 Q;  1H9R A;  2B63 B;  4JI4 L;  4WJ4 A;  3EQL C;  5IGD A;  1ET9 A;  5M5X B;  2ICI A;  2HD3 A;  4K5V A;  3U9O A;  3Q0A A;  5FO7 B;  3DWP A;  5C6A A;  4ZUI A;  5C44 G;  5IOC A;  2Z6K C;  1DOL A;  3A56 A;  1HTP A;  2Z0S A;  3QJY A;  4GOP B;  4JI7 L;  1EYG A;  2C5C A;  4DR5 Q;  2Z9H A;  2JA8 G;  2F0S A;  1WCM B;  1Y14 B;  4OO1 I;  4QUC A;  5CV5 A;  3T4A C;  2KQ3 A;  4EX5 A;  4CKB A;  2RSO A;  2DN8 A;  4IAL A;  3W1B A;  4OXP A;  3CXC A;  1R4P B;  2VW9 A;  3QR8 A;  2YV5 A;  3I4N H;  4DV3 Q;  1EYC A;  4A3D G;  5HGT A;  3K80 C;  4FNF A;  3LNN A;  3STB C;  5JJL A;  1HJP A;  1PA6 A;  1RTO A;  4KY6 A;  3DM3 A;  3NBH B;  2G9D A;  2NVT B;  2ZTE A;  1XNQ L;  1IXR A;  3KDF A;  4A3J H;  1KIX A;  1PMR A;  4IJL A;  1ZXT A;  3HOV G;  2QEJ C;  1E2V A;  5ELB A;  5D65 A;  1NJI C;  2OTL A;  4BY1 B;  1HR0 W;  2B2V C;  4GS3 A;  4JI5 L;  4HIM A;  3HOY G;  2A69 C;  3IKJ A;  2JYO A;  2N78 A;  1JQY D;  1HH2 P;  3M7N A;  4DR4 L;  3PCO B;  1SNM A;  5NUC A;  4NXM Q;  1JOK A;  2HHH Q;  2QGQ A;  5K5P A;  3AEV A;  1K8A C;  1E1T A;  4LUV A;  3K0X A;  1EU3 A;  1EWI A;  2NVX H;  4HJ8 A;  1K3R A;  4IOA A;  2B63 G;  4ZCK A;  4DAP A;  4JOI C;  1PFM A;  1E0B A;  3CC7 A;  2HCI A;  4A3M H;  2VL6 A;  4B08 A;  4DR5 L;  3HOU B;  1Y1W B;  4B3R Q;  3K5M A;  1QE6 A;  2MNA A;  3DEP A;  3DXJ C;  1JJ2 A;  2JA7 G;  4GNX A;  1Q1B A;  3MEF A;  4DGZ A;  3TP6 A;  4AYB E;  2ASB A;  3RZD B;  2BA1 A;  2ZM6 Q;  1LT6 D;  4QIW E;  1WCM G;  4DV1 Q;  1PFB A;  3BZD B;  4DV3 L;  5D14 A;  4LF6 Q;  1HNX Q;  4IN3 A;  3I7F A;  4RCO A;  3OW7 A;  1QVF A;  5G3L D;  1Z6H A;  2WB1 E;  1KXL A;  3QIA A;  2VXW A;  5IOD A;  2F0Q A;  1K9M C;  1DM0 B;  5LL6 X;  2VNU D;  3L2P A;  3HFZ B;  1A62 A;  2VUM H;  1PH7 A;  4Y52 H;  1XPU A;  1DON A;  3ERO A;  1QZG A;  3A8J E;  4RHS A;  4NXM L;  2HHH L;  4RGN A;  3K5N A;  4C1N K;  2I5M X;  3SR1 A;  1VQB A;  3GTJ B;  3NEM A;  3BU2 A;  1ESF A;  1PH8 A;  3M4P A;  1KLG D;  1UWV A;  3GD7 A;  1EFW A;  2QIL A;  5M5Y H;  2MFI A;  4X3K A;  3DWA A;  1U4L A;  4B3R L;  1HTL D;  4WJ3 M;  1PZK D;  3E0J A;  1HUM A;  2EIF A;  4FYD A;  4ID6 A;  2L1B A;  5M5W H;  2K03 A;  4MZ9 A;  3KBG A;  5KIX A;  4RGT A;  4KTA A;  1I6V C;  3VDY A;  3W1G A;  1Y1W G;  2ZM6 L;  1KRS A;  2RHS B;  1JWM D;  1QUQ B;  4K2L A;  4DV1 L;  2AWO A;  1ILP A;  3L3O C;  4LF6 L;  5IP7 H;  1HNX L;  2ENB A;  3AU7 A;  5M9O A;  4BY1 H;  1CQV A;  3J7A 5;  1KHI A;  4B9X A;  4BBS H;  1X56 A;  2B2U C;  2B2V A;  3CQZ B;  4POG A;  1PYS B;  4QUF A;  5ELF A;  3OWE B;  3ONA B;  3IFD A;  1UAP A;  1FNW A;  1K0S A;  1A6X A;  4RH6 A;  1PH4 A;  2VS1 A;  2VZA A;  3TBI B;  1EY6 A;  3K5L A;  1CUK A;  1YIJ A;  1O80 A;  2F0L A;  4K14 A;  4JOI A;  4N9T A;  3D6W A;  1B44 D;  1TT2 A;  1S5B D;  1KAB A;  3L0O A;  5CBA E;  2YTY A;  1ZKO A;  2G9H D;  4A4I A;  4QMG A;  4FF2 A;  1F77 A;  1VQ5 A;  1EY0 A;  3NSW A;  1HA5 A;  1VQA A;  3SXH A;  4DUZ Q;  1YIT A;  3CCS A;  1NAP A;  2K6A A;  3NEL A;  1PTO C;  1U0L A;  3TSS A;  1SYE A;  4Y7N B;  1EIF A;  1QNU A;  4EQN A;  3J7Y W;  2VB3 X;  3TN2 A;  4FF3 A;  1WTW A;  4HJA A;  3BVG A;  4IPH A;  1BVS A;  5ELC A;  1D5Z C;  2OF1 A;  4WRD A;  2NN6 G;  3F8T A;  2WAQ E;  3PF5 A;  3S1M H;  5DAU A;  1IHZ A;  2RF4 A;  3K6O A;  3K7A B;  2WIN B;  2K7V A;  3GTQ H;  1VQE A;  3SEB A;  4O0A A;  3DUZ A;  3KJP A;  3MXN A;  2PQA B;  3D3R A;  1IL2 A;  2KEE A;  2ALY B;  1PLF A;  3D4W A;  1Q90 A;  4GN4 B;  2JEB I;  1WTX A;  1JOO A;  4FVM A;  1EZ6 A;  3KK7 A;  1IBL Q;  2HDM A;  3OWF A;  4OWX B;  1G2S A;  3ERS X;  1BUV T;  3GTM B;  2N88 A;  3Q8D A;  3O13 A;  3J80 i;  1JJG A;  4GN5 A;  3VYT A;  3CME A;  2CWP A;  5A2Q E;  4TVA B;  1L1O B;  3CHB D;  4OO1 H;  4DUZ L;  2ZTC A;  1NSN S;  1TS3 A;  4F7X A;  4DR7 Q;  3A8I E;  1E24 A;  1F2M A;  4B3T Q;  4ME5 A;  1L0Y B;  2R3Z A;  4DUY Q;  4BXX H;  2B2U A;  3OYY A;  2ZXR A;  4A3L G;  2KEC A;  3HOZ B;  4JBJ A;  4IZ8 A;  4DK0 A;  3HKZ B;  1SYB A;  1GHJ A;  4KKS A;  3GTO H;  3KBX A;  1Y1V H;  3PSI A;  5I4D A;  2A5H A;  2K1B A;  4RHR A;  3T53 B;  4KN4 C;  4RGM A;  1ZEQ X;  1LTI D;  1ROD A;  4H13 C;  1QJO A;  4X62 Q;  1R9T B;  4L63 B;  5DLQ E;  2NZH A;  3OW2 A;  2OT2 A;  3SGI A;  1Q12 A;  3UDG A;  4QB4 A;  4GLX A;  1UEB A;  4UP7 A;  2RVL A;  5KYL A;  2BE5 D;  1IBL L;  5EQ0 A;  4OWW B;  5A2Q L;  4Y7N H;  3J81 E;  2F3I A;  3J81 c;  1WTQ A;  1I6H B;  1QB5 D;  1SNP A;  1YNX A;  3A7A B;  2XRQ D;  4KN7 C;  3A5U A;  1V1P B;  4DR7 L;  1AEX A;  4LF4 Q;  1BCP C;  4A3E B;  4RGO S;  2R7F A;  5CV9 A;  1S5F D;  2C9O A;  1HFN A;  4ODG A;  4B3T L;  1EWC A;  4DUY L;  1NUC A;  4ZYS A;  4YCV A;  1GO3 E;  5GAG C;  2FFK B;  2F3W A;  4JI2 Q;  5CGK A;  2GVA A;  1VMC A;  2E2D C;  2JA5 B;  1WTR A;  5K36 H;  2UUC Q;  4C56 C;  3TRE A;  2QCP X;  3Q22 A;  2LFN A;  4MHE A;  3SK8 A;  1P16 A;  3HOZ G;  1QVC A;  3H94 A;  5EKK A;  1I4X A;  1OXT A;  3VA7 A;  5LHY 1;  3HKZ G;  4A3F G;  4LF5 Q;  2PMZ E;  4U68 A;  2XN9 C;  4Q5V A;  3UDF A;  4WFN 3;  3AMU A;  5L37 A;  2KJX A;  2JN4 A;  2CFM A;  1WTH A;  3I8Z A;  1GVP A;  4X62 L;  2ICE C;  2I46 A;  3GTM H;  1V9P A;  1U5K A;  4GN3 B;  2A68 D;  1SLJ A;  1SNC A;  5T1I A;  2ZTD A;  3VYS A;  2F4V Q;  2OWO A;  1IW7 C;  3J81 L;  1BBX C;  1G8Z D;  1EQT A;  4K5X A;  3GTK B;  1LLR D;  3G7L A;  1DD2 A;  3RD4 A;  3FVQ A;  1UE1 A;  4JG2 A;  3MC0 B;  5IYB H;  1AE2 A;  1KDA A;  4RWS C;  1HQR D;  1ENF A;  1K8M A;  4DNR B;  3NQI A;  4LF4 L;  1BDO A;  2KEN A;  2H1E A;  3MWY W;  3Q24 A;  5JEA H;  3I4M B;  3HOW B;  4HIK A;  2NVY B;  3D4D A;  2PZW A;  1IBM Q;  3WOE A;  3UDX A;  1EUJ A;  4A3E G;  1YNN C;  3S1N B;  3OTO Q;  2PZT A;  1JJC B;  4JI2 L;  1B1Z A;  1WTP A;  1LTR D;  2L55 A;  2EYF A;  2UUC L;  1Q1E A;  5I6Y A;  3S17 B;  2RBM A;  3S1Q B;  3RLF A;  1CA5 A;  2DJG C;  4B3S Q;  3PUW A;  4LF5 L;  5I9P A;  4YHH Q;  1GUT A;  2UUA L;  1XWE A;  3X3N A;  3CCJ A;  1L0X B;  4A3G H;  1SN8 A;  1H9K A;  5KNB A;  3PO2 G;  1PV4 A;  2L15 A;  2B2T A;  1MKH A;  3IRB A;  3V2T A;  2F4V L;  4XQJ A;  1NY4 A;  1O78 A;  1PRT F;  3ITP A;  4LAA A;  1JWU D;  1EIY B;  2K28 A;  1VQM A;  4JI3 Q;  1R4Q B;  3JAM i;  3A5Z B;  4IQZ A;  4DV5 Q;  2FJ2 A;  1NCV A;  4EQP A;  2PYK A;  2A69 D;  2JA5 H;  2QKI C;  2IX3 A;  1F9S A;  2CH4 A;  1IBM L;  4IOC A;  1HZB A;  1VQF A;  3BDO A;  4LUZ A;  1ZYR D;  2J4X A;  4JBW A;  1PH3 A;  3HOW G;  1KTK A;  3OTO L;  4GLA C;  4CDD C;  3I4N B;  4JI0 Q;  1QWY A;  2WII B;  1EY7 A;  3OMC A;  1QOH A;  2K01 A;  1CSQ A;  2DY8 A;  2FXQ A;  5C3X A;  4E6I A;  2Y0S G;  3S24 A;  2D0O A;  4B3S L;  1GUO A;  3NHH A;  1XMO Q;  2HQE A;  4A3J B;  3NTK A;  4YHH L;  3CRL C;  2L11 A;  1VQC A;  2DUD A;  3BYT B;  3NTH A;  1VQ9 A;  1LV9 A;  3I4O A;  4DR2 Q;  3CCM A;  1I4R A;  2D0P A;  3GTK H;  2ES2 A;  1A15 A;  1PYW D;  2E5L Q;  2A6H C;  1CA6 A;  3ND9 A;  1ONL A;  5IP9 H;  4DU9 A;  3V96 A;  3H3V C;  1H9S B;  1WTO A;  2PNH A;  1STY A;  3U9S A;  4M8A A;  4CKC A;  3I4M H;  5FJ8 H;  5JVH 3;  2NVX B;  1PZI D;  1EU4 A;  4JI3 L;  4DK6 C;  3AYH B;  4BBR H;  1KNA A;  1Q7Y C;  3C2P A;  2EYJ A;  3NWS A;  5LMN W;  4DV7 Q;  3OOC A;  4GNX C;  2E2I H;  5FO8 B;  4A3M B;  1B9M A;  3BVM A;  4G4K A;  4DV5 L;  3S1N H;  4C2M B;  2RDH A;  4F87 A;  5EPL A;  3J7Z C;  3S1Q H;  3PO3 B;  4ZK9 B;  1ENC A;  1NNX A;  2Z1C A;  3H91 A;  1PYB A;  3R3O A;  3VR5 A;  5DM7 3;  4DV6 Q;  3KF8 B;  5IGB A;  1B50 A;  3NXW A;  5CC4 A;  1GXD C;  2WV6 D;  2QW7 A;  1K28 A;  4JI0 L;  1SYF A;  5FLM H;  4C3H H;  1M1K C;  3EVQ A;  3CKI B;  3TP8 A;  2J0T D;  1ICF B;  1G29 1;  3K7U C;  4A3B B;  1NTG A;  2WKC A;  2K50 A;  4R4T A;  3I4N G;  1JR0 D;  1QVG A;  4PMB A;  1XMO L;  3S14 B;  4CDE C;  4C1N I;  3KYH C;  1UE7 A;  4IUQ A;  4DR2 L;  2MHV A;  5C3E H;  4IPD A;  2VUM B;  1B4O A;  1Y8O B;  4JVZ A;  2JXM B;  4A3J G;  2E5L L;  3MA2 B;  4JC0 A;  2VY3 A;  4LMQ D;  5M3F H;  1V1O A;  1ESR A;  1E1O A;  1IZ6 A;  3DWQ A;  5IY0 A;  4FF1 A;  3VR3 A;  3S15 H;  4BY7 H;  4KHP Q;  5C4Z A;  1XPR A;  3PV0 A;  5FO9 B;  3NQT A;  3F2D A;  3J7A F;  4RA8 A;  4F8M A;  3J81 j;  1ENA A;  4DV7 L;  4G7O C;  5M5Y B;  1KAW A;  3NTI A;  3JAM L;  3LWU A;  1Z7T A;  1EEI D;  1TS5 A;  1EY8 A;  3R2I A;  3PUY A;  5M5W B;  1VMP A;  4ZLT F;  2HT1 A;  2I5H A;  4A3M G;  1I94 Q;  1ML0 D;  3RN2 A;  1LM0 A;  2K75 A;  4UP8 A;  4DV6 L;  1RIP A;  4K0K Q;  1RL2 A;  5EKI A;  2AMC B;  1TXY A;  1FNU A;  1Q82 C;  4ULL A;  4DXG A;  4K6L A;  4BBS B;  3H0G H;  4B9W A;  1SXT A;  4JI8 Q;  1K8G A;  4LW1 A;  4JI6 Q;  2L5T A;  1MGS A;  3C1F A;  1M4V A;  2AUK A;  1V1Q A;  1QNK A;  2EYH A;  3CCU A;  3MEH A;  3CW2 C;  2LSS A;  2CQA A;  2DGY A;  4XT1 B;  2E8G A;  1AN8 A;  3PF4 A;  4XTC S;  2VUM G;  4A3K B;  2K5D A;  5H1S E;  4KHP L;  1V8Q A;  4WOR A;  3H6M A;  5EPK A;  4C2M H;  1KDC A;  3QOJ A;  4KK7 A;  2A74 C;  4DNI A;  3PO3 H;  2NVQ H;  1KRT A;  1ET6 A;  2F0K A;  3ER0 A;  5J3B A;  1CTM A;  5C3W A;  1F9R A;  4DNT B;  3U58 A;  3WOF A;  4H02 A;  1SE2 A;  2I0Q A;  2F03 A;  2F0H A;  1AZQ A;  2CQO A;  3CCV A;  3I90 A;  1CZW A;  1UNS A;  2Q8T A;  1NMG A;  2O2L D;  1I94 L;  4A3B H;  3NUC A;  3K0Y A;  4NKL A;  5E4X A;  5GAH C;  2MGS A;  1XYI A;  5IWA Q;  1Y8P B;  3I3C A;  2XVS A;  5HGQ A;  3S14 H;  3FMC A;  1I4H A;  1OXU A;  4AQY Q;  1D7Q A;  1RDP D;  1KLU D;  4X64 Q;  4CKE A;  4BA1 I;  1DXM A;  4V0B A;  2K4K A;  4AYB B;  1FJG Q;  1E2Z A;  1GKH A;  1F2Y A;  1LTG D;  4QIW B;  1TWF B;  3W3A A;  4JI8 L;  2HIX A;  5IP7 G;  4IFD I;  4BY1 G;  2CHB D;  5LL6 S;  4P71 A;  2IPK D;  4LNQ A;  4BBS G;  4RCN A;  3S1M B;  1IKL A;  2F0J A;  2WB1 B;  1X3P A;  1YI2 A;  1F9Q A;  3GTQ B;  4FXG C;  1JT8 A;  1VCI A;  4NP5 A;  2AHO B;  4UHV A;  4CJ0 B;  2R92 H;  4UY8 C;  3PIP A;  1WFQ A;  4DV2 Q;  1X9N A;  2HDL A;  4YWM A;  5CV8 A;  1SRU A;  3HOU G;  3PIP 3;  3S2D H;  4DN4 M;  5CYU A;  2LS0 1;  3OPO A;  3BZK A;  2K52 A;  3VR2 A;  4R9W A;  3TME A;  3A8K E;  4PMC A;  3ZYY X;  2D5D A;  1E7Z A;  3VA5 A;  2K05 A;  4L8J A;  5IWA L;  2SEB D;  4MNO A;  1AH9 A;  3VYU A;  1PH9 A;  3RLN A;  1K3B C;  4AQY L;  2RA4 A;  4YIJ A;  4X64 L;  3GTL H;  2ZXP A;  1CKM A;  3C46 A;  1FJG L;  1PTO H;  2UU9 Q;  3F1Z A;  4LJZ C;  3KLS X;  4GOP C;  5I9O A;  2OTJ A;  3GTO B;  1NR4 A;  3MHB A;  4OX9 Q;  3N6R A;  1Y1V B;  1W3S A;  4A3K H;  3MTS A;  4DXF A;  5ISR A;  1K73 C;  3QO2 A;  3M3Y H;  4B3M Q;  3UE0 A;  1BCP D;  1BCP B;  1JE5 A;  1LO5 D;  2EY6 A;  1B8A A;  1FGU A;  2E76 C;  5C0X I;  4DV4 Q;  3I2Z A;  2BCO A;  5E7N A;  4CJ2 C;  4FF4 A;  4A93 H;  2KBN A;  1RCV D;  1KDB A;  3K8A A;  1M8A A;  4DV2 L;  1SE3 A;  3T51 B;  3PUV A;  1NE3 A;  1SND A;  4QGU A;  1XXG A;  4P75 A;  1X3Q A;  4MN3 A;  3UI2 A;  5BR8 Q;  3HZX A;  4R8I A;  2X69 A;  1TWG B;  4HIO A;  2D2C C;  3PQI A;  2VB2 X;  1CKN B;  1G2T A;  3KF6 B;  2K5Q A;  3G71 A;  2K33 A;  2KHS A;  1CT1 D;  2SNM A;  2ZJR A;  1Y69 U;  1TWF H;  4HMJ A;  3TZU A;  4GZY C;  4OO1 G;  1CM9 A;  4OL7 A;  1W2B A;  4P74 A;  2XNA C;  1HZ9 A;  3T16 A;  4QJF A;  5KND A;  1J5E Q;  1A0I A;  2H5X A;  1IW7 D;  4F88 A;  1RHP A;  3RUZ A;  5C5L A;  1BR9 A;  1D1K A;  1F9P A;  1PRT C;  2UU9 L;  3MFG A;  1Y8N B;  3R8B A;  2JA9 A;  4BXX G;  1V43 A;  2OXP A;  4OX9 L;  3CAM A;  1A2T A;  3L7Z C;  4B3M L;  2LXK A;  4ZAI A;  1PHJ A;  4LFB Q;  3J81 i;  1VF7 A;  1Y1V G;  1PH1 A;  5C4X B;  1KAA A;  2M00 A;  2QEX A;  4DV4 L;  4KHV A;  1KNE A;  2WAQ B;  1MSG A;  1YNN D;  1B3Q A;  4KY7 A;  1SMY C;  1Z9F A;  3U4V A;  2DNC A;  2OCE A;  1I4Q A;  3CC4 A;  3MZ5 A;  2M2L A;  4NMZ A;  1S5D D;  2RDF A;  4DAY A;  3GP7 A;  4LFA Q;  3KUP A;  2NYZ D;  5BR8 L;  1U9R A;  3E6Z X;  4O2D A;  5DEH A;  1EQQ A;  2R93 H;  3G48 A;  5CV6 A;  3M85 A;  3CMA A;  2AWN A;  4KD4 A;  2K5N A;  1O7Y A;  4KD3 A;  1HR0 Q;  3LGJ A;  2K5V A;  1SYC A;  2GA4 B;  3SK6 A;  1VQL A;  1AFP A;  1OO9 B;  4POF A;  2PI2 A;  5ELE A;  1XNR Q;  4OON A;  1YVC A;  4PZ8 A;  2AKW B;  1X32 A;  4R4Q A;  2NN6 H;  2A6E D;  2A1A A;  4TSS A;  1J5E L;  1SEB D;  3M9B A;  5J22 A;  4GOP A;  1FL0 A;  4DAV A;  3A55 A;  1SYD A;  2RSN A;  2V4D A;  2L9H A;  1EIG A;  4ILW A;  1SYG A;  1PXU A;  2NTS A;  5IGG A;  2R7Z H;  4KJO A;  1FYC A;  3D31 A;  1SBB B;  1TKW B;  3QOL A;  4ZUJ A;  4G57 A;  2K5W A;  4IUV A;  4RG1 A;  5DM6 3;  4HJ9 A;  4BWG B;  1Q8K A;  1WVL A;  1EY4 A;  2XGT A;  3P1H A;  1YHA A;  4LFB L;  3MFY A;  5K36 G;  1QIL A;  1DGS A;  3CRK C;  4CHT B;  4A3G B;  2B2T C;  3P75 A;  3NBH A;  4J6H A;  3VYR A;  4FDB A;  3ERQ A;  4JPB W;  1AZP A;  1DYQ A;  1TWA H;  2P5Z X;  2F4I A;  3VR4 A;  1LT4 D;  1TWG H;  1BBW A;  4OWT B;  2R61 A;  4IFD J;  3S1R H;  4LFA L;  1SJE D;  1LT3 D;  4HMI A;  3KDF B;  4A3I H;  4HAE A;  4CJ1 B;  1RKN A;  1X65 A;  3HS0 C;  3NWT A;  4YWK A;  1C7Y A;  1JE4 A;  1S40 A;  2A8V A;  3I4L A;  1B3A A;  2XIW A;  3ND8 A;  1HR0 L;  1EWH A;  1HNW Q;  3CCL A;  2F0O A;  2NZ1 D;  2K32 A;  2B39 A;  4L5Q A;  5EJW A;  5IYB G;  1XNR L;  3X3M A;  1O7Z A;  3GV6 A;  2B29 A;  1HCZ A;  1MJE A;  5IGE A;  1E3P A;  3V05 A;  4PZ7 A;  4A3C H;  1HA6 A;  3I72 A;  4GKK Q;  3BG3 A;  4PMW A;  5JEA J;  5C4X H;  4IFD H;  5EGT A;  5IYD H;  3SK4 A;  4RMF A;  4GNX B;  2F52 A;  4NW2 A;  4IUU A;  3IL8 A;  1JMC A;  1GJX A;  2MUY A;  2X6G A;  4JW0 A;  2FHT A;  3DM1 A;  3S9W A;  2I5L X;  5F2D A;  2MJ8 A;  2CWA A;  4DK3 C;  4C3I B;  1IYV A;  2D9U A;  2XRS D;  3CCR A;  2PMZ B;  4R4O A;  4ABN A;  3PMF A;  2ZJP A;  5AFW A;  4A3G G;  1WOC A;  1D8L A;  1K0R A;  4HJ7 A;  2XTI A;  5J39 A;  4NXN Q;  3TQY A;  2F0D A;  3K58 A;  5DNF A;  2BDN A;  1S5E D;  5GQO A;  4JCV E;  4ME3 A;  4BBR B;  2F0P A;  3D0F A;  2MPM A;  3TZD A;  1HNW L;  4CDC C;  2E2I B;  3LWE A;  5COY A;  3UDI A;  2Y0S E;  5C0X J;  1X55 A;  2B2Y A;  4P72 A;  4KHZ A;  1B70 B;  4UDU C;  2A19 A;  2TSS A;  1SE8 A;  1GD7 A;  5BN3 A;  2PW5 A;  1SJH D;  1YJW A;  1EZ8 A;  2KED A;  5TSS A;  2JA6 B;  1FD7 D;  4XQQ A;  3U4Z A;  3CP0 A;  4A3F H;  5IYC H;  1EFI D;  2JA5 G;  1T9H A;  3HOX B;  4GKK L;  2F0U A;  3KLR A;  4DKA C;  4JBM A;  4HR7 B;  3C3L A;  4C3H B;  2IL8 A;  4FO2 A;  3ICE A;  2H4O A;  4OIK A;  3LX0 A;  3I56 A;  2Q2T A;  1JC7 A;  1H9M A;  2K5H A;  1L1O C;  4K6D A;  1KC8 C;  1QUQ A;  3RZO B;  2LY7 A;  4JI1 Q;  1HNZ Q;  1E22 A;  1CFM A;  1GUG A;  3STB D;  1TWC H;  5C0X H;  5COR A;  5C3E B;  1STB A;  4L5T A;  4DAM A;  3PIO A;  4UAI A;  5M3M H;  5J1Z A;  2DY7 A;  1N32 Q;  5M3F B;  2YTV A;  1DOK A;  1SNO A;  1SRO A;  4CGY B;  3S15 B;  5GAE C;  4BY7 B;  1BBU A;  1YHB A;  3PIO 3;  2MO1 A;  4NXN L;  3T1Y Q;  2JQO A;  4C3J B;  1SNQ A;  1VF5 C;  2AQ3 B;  2EOT A;  2KCT A;  1UE6 A;  3CCE A;  5CBE E;  5KGU A;  1JCK B;  5IP9 G;  3FHW A;  1VQ6 A;  2O5J C;  4HID A;  2IHF A;  1YZ6 A;  1F2Z A;  3H3V H;  4EGV A;  3I4M G;  5FJ8 G;  4QCL A;  1X3G A;  2SOB A;  4JYA Q;  5KRU A;  1BXT A;  4NB3 A;  2EYO A;  2F0W A;  3D4R A;  4BBR G;  4X3U A;  5G3L F;  3ULJ A;  1OXV A;  2LXJ A;  2IW3 A;  3BYY B;  2ID0 A;  1G91 A;  1EQV A;  3F2U A;  1LAC A;  1W6K A;  3M4Q A;  1VQO A;  1I50 B;  3P20 A;  4Q0F A;  4K8J A;  4Z9C B;  1J8I A;  2NB0 A;  1VQH A;  4J8Q A;  1NBW A;  3K81 C;  4TQU S;  4H44 C;  4TRD A;  3H0G B;  4C3I H;  1H9J A;  5FLM G;  3FPP A;  4JI1 L;  2FMM A;  4C3H G;  1HNZ L;  2K04 A;  1HFG A;  3EBE A;  2PW7 A;  2MP1 A;  3DLL A;  5CV7 A;  3SVM A;  3BDC A;  1B2T A;  4OEM B;  1ILQ A;  5C44 B;  2I07 B;  4K8I A;  3SK5 A;  1N32 L;  5C3E G;  1O7I A;  2EJG C;  1SDF A;  2YYZ A;  2LMC B;  5KNC A;  1N8R C;  1C48 A;  1VQ8 A;  1WD1 A;  1LAB A;  3T1Y L;  2JA8 B;  3TP7 A;  1TY0 A;  5M3F G;  2KCN A;  2D62 A;  3ULP A;  1PH6 A;  4BY7 G;  3AFP A;  4P73 A;  1WTV A;  2JA6 H;  2NVQ B;  4HCS A;  4L5S A;  1G6P A;  1A3T A;  2PQA A;  4EVO A;  1HXY D;  4YCU A;  1B9N A;  4JYA L;  3HOX H;  1NMF A;  2XWB B;  3CF5 A;  1STA A;  3FKI H;  3MXN B;  2Z8L A;  3GV3 A;  4DK1 A;  1VQK A;  2G5D A;  3HP3 A;  2NWG A;  4JK1 C;  1PFN A;  1JOQ A;  1IBK Q;  1MSH A;  3FRP B;  1F2L A;  3AQQ A;  3F2C A;  3RZO H;  3CPF A;  1K83 B;  5JAV A;  4HTH A;  3Q6S A;  3G4S A;  4HN7 A;  3HOV B;  1L1O A;  2OEO A;  2PI2 E;  1DOM A;  4PG3 A;  4KJN A;  1MJC A;  3NE5 B;  4S3S A;  2MQH A;  5JJK A;  2E2J B;  4DR1 Q;  1XTC D;  5FOB B;  1IL8 A;  5IIF A;  2E2H B;  1OXX K;  3RR5 A;  2VQF Q;  1VS0 A;  1IYU A;  1IKM A;  1MI2 A;  2CW0 C;  4C3J H;  3H0G G;  3KLW A;  2Z4H A;  1EQR A;  1HUN A;  3B6Y A;  1DZ1 A;  3AB9 A;  1L0W A;  3DHQ A;  2BA0 A;  4LF9 Q;  2OQ0 A;  4JBK A;  2R92 B;  1HZC A;  1STE A;  3I55 A;  2UXC Q;  1EY5 A;  2JA7 B;  4OGQ C;  4XDX A;  2EQS A;  3S2H H;  1S72 A;  5EBD A;  1LTA D;  1OXS C;  4CDF C;  1EIH A;  3S2D B;  1UE5 A;  2PZU A;  3SE0 A;  1JB3 A;  1IYJ B;  3NPP A;  1I50 H;  2NN6 I;  3PO3 G;  2DNE A;  2B3G A;  2PQE A;  1CZG A;  3CPW A;  3VR6 A;  1IBK L;  3QG1 A;  1YNJ C;  1YEZ A;  1CSP A;  3FPU B;  2FIN B;  4ZRZ A;  1PDQ A;  4X3T A;  1EYD A;  2HIV A;  3GTL B;  3IAY A;  4A3B G;  4JV5 Q;  1O7L A;  3GTP H;  3URY A;  4P2C B;  1V1P A;  1PTO D;  1RD9 D;  4H0L C;  1PTO B;  2V1C C;  3HEJ A;  5JOB A;  1FGB D;  2JJQ A;  2Q8R E;  5C44 H;  4A76 A;  4DR1 L;  4QY7 A;  4RKL A;  1MIU A;  4R1J A;  2VQF L;  4WJW A;  4HSP A;  2JA8 H;  2EDG A;  3M3Y B;  1TY2 A;  2N55 A;  4IUT A;  1CHP D;  1YJ9 A;  2VQE Q;  1ZYR C;  4LF9 L;  5HUR A;  1W6J A;  2KCM A;  1SFO H;  1LTS D;  3A7L A;  2BH2 A;  4A93 B;  2UXC L;  2RCN A;  2K14 A;  1PRT D;  2O4X A;  4A3D H;  3HRZ C;  1PRT B;  3NBI A;  1EEF D;  1C0A A;  2R92 G;  1EOV A;  1II3 A;  2AQ2 B;  2O5I C;  1CK1 A;  5CV4 A;  4X66 Q;  4LWC A;  1GHK A;  1X3E A;  1D2B A;  2Q2U A;  4K0K L;  3T1H Q;  3S16 B;  1K83 H;  1QZH A;  3HOV H;  1JIC A;  3NEN A;  1S3O A;  4J1M A;  1Q86 C;  1A3U A;  1YJN A;  2IY5 B;  2IX0 A;  3BJU A;  4X65 Q;  1TU2 B;  2NBF A;  3HOY H;  2E2J H;  4PNY A;  2QF7 A;  2HQL A;  4KKU A;  1SMY D;  2YTX A;  1VQG A;  1ASZ A;  2E2H H;  2F1M A;  4DR3 Q;  4JI6 L;  2YU9 H;  2CVR A;  3MAQ A;  4JV5 L;  2LKV A;  3D6C A;  4G7Z C;  1I3Q H;  1S5C D;  1L2F A;  1X6O A;  4HED A;  1A8V A;  1U4M A;  2B63 H;  2IX1 A;  5M5X H;  1LTT D;  3DMU A;  1MD2 D;  3TS2 A;  2E74 C;  3FP9 A;  1STH A;  3PGZ A;  5C4J B;  2JA7 H;  2Q2I A;  3EA6 A;  4IO9 A;  2F0N A;  2HUG A;  5A35 A;  2EY2 A;  1YBY A;  4IJH A;  2AQ1 B;  4XIG S;  2VQE L;  1WD0 A;  1GM5 A;  2QDL A;  3OIP A;  2KUM A;  4A3K G;  3KFU A;  1LUZ A;  4IUN A;  4KKT A;  2Z6K A;  2RCF A;  1WCM H;  3TS0 A;  1QG7 A;  1GUS A;  4K5W A;  3TP5 A;  3EJI A;  3K57 A; 
#chains in the Genus database with same CATH homology
 2AKW B;  4B3S Q;  3PUW A;  4GLV B;  4R4Q A;  1CKO A;  4LF5 L;  2A1A A;  1VQD A;  4JI5 Q;  1J5E L;  4A93 G;  4YHH Q;  3PUZ A;  4X66 L;  5C44 G;  2IT1 A;  2UUA L;  3M9B A;  4GOP A;  1FL0 A;  2Z6K C;  3CCJ A;  2UXD Q;  4A3G H;  2Z0S A;  2RHQ B;  5LMU Q;  4GOP B;  3T1H L;  4JI7 L;  1EYG A;  1SN8 A;  4DR5 Q;  4IPC A;  2R7Z H;  2JA8 G;  3PO2 G;  1PV4 A;  2L15 A;  3D31 A;  2NVT H;  1Y14 B;  4OO1 I;  1MKH A;  3IRB A;  2F4V L;  4RG1 A;  4X65 L;  4HJ9 A;  1NY4 A;  1Q8K A;  4YWL A;  4EX5 A;  3EIV A;  2XGT A;  3W1B A;  4AYB G;  4DR3 L;  4OXP A;  1YHA A;  1EIY B;  3CXC A;  4LFB L;  5K36 G;  1G51 A;  2VW9 A;  2YV5 A;  1VQM A;  4JI3 Q;  3I4N H;  4DV3 Q;  4A3D G;  1DGS A;  3K80 C;  3JAM i;  3A5Z B;  3STB C;  5JJL A;  4FDB A;  1HJP A;  2WP8 J;  1PA6 A;  4DV5 Q;  1TWA H;  3DM3 A;  3NBH B;  5LMN Q;  1TWG H;  4A75 A;  1BBW A;  4OWT B;  2ZTE A;  2JA5 H;  1XNQ L;  1IXR A;  3KDF A;  2WB1 G;  4PZ6 A;  4A3J H;  4IFD J;  3S1R H;  1KIX A;  4LFA L;  4IJL A;  1IBM L;  4IOC A;  3HOV G;  1HZB A;  3KDF B;  1VQF A;  4LUZ A;  4KLK A;  4A3I H;  1NJI C;  4JBW A;  1X65 A;  4YWK A;  1PH3 A;  2OTL A;  1C7Y A;  2C35 B;  4KI0 A;  1HR0 W;  3OTO L;  4GLA C;  4GS3 A;  3HOW G;  4JI5 L;  1S40 A;  3GO5 A;  4GKJ Q;  4HIM A;  2A8V A;  3HOU H;  1Y1W H;  2MO0 A;  4JI0 Q;  3HOY G;  2N78 A;  1HR0 L;  1HNW Q;  1HH2 P;  2NZO A;  1CSQ A;  1X54 A;  3CCL A;  3M7N A;  4L5Q A;  1C9O A;  3PCO B;  4DR4 L;  4NXM Q;  3S16 H;  2FXQ A;  5GAD C;  2HHH Q;  2QGQ A;  5IYB G;  3RZD H;  1XNR L;  3AEV A;  1K8A C;  1E1T A;  4LUV A;  2Y0S G;  3K0X A;  2D0O A;  3S24 A;  2B29 A;  4B3S L;  1EWI A;  1XMO Q;  2GVB A;  2NVX H;  1MJE A;  4HJ8 A;  3H3V I;  4YHH L;  1K3R A;  1N33 Q;  1VQC A;  2DUD A;  2KHI A;  4IOA A;  2B63 G;  1XPO A;  4DR2 Q;  3I4O A;  4JOI C;  1VQ9 A;  3E9H A;  3GDE A;  3CCM A;  2UXD L;  1E3P A;  1J6Q A;  2D0P A;  4PZ7 A;  3GTK H;  5LMU L;  2ES2 A;  3CC7 A;  4A3M H;  4A3C H;  2VL6 A;  4DR5 L;  4GKK Q;  2E5L Q;  4B3R Q;  4PMW A;  5JEA J;  2MNA A;  1N9W A;  5C4X H;  3KOJ A;  1JJ2 A;  2JA7 G;  5IYD H;  4GNX A;  2R93 G;  1Q1B A;  3MEF A;  4RMF A;  5IP9 H;  4AYB E;  4GNX B;  2ASB A;  2F52 A;  2PNH A;  2BA1 A;  1JT8 A;  2ZM6 Q;  1JMC A;  3I4M H;  5FJ8 H;  3EN2 A;  4QIW E;  1WCM G;  4DV1 Q;  2EXD A;  4JI3 L;  4BA2 I;  4DK6 C;  3AYH B;  4BBR H;  4DV3 L;  1Q7Y C;  2I5L X;  5C4J H;  5LMN W;  4DV7 Q;  4LF6 Q;  1HNX Q;  3I7F A;  4GNX C;  4YY3 Q;  2E2I H;  1QVF A;  3S1N H;  4DV5 L;  2CWA A;  5LMN L;  2WB1 E;  4DK3 C;  1KXL A;  4LF7 Q;  1X3F A;  2ZJP A;  4R4O A;  3GTJ H;  3CCR A;  4X6A H;  4A3G G;  1FVI A;  1WOC A;  1D8L A;  1K0R A;  4HJ7 A;  1K9M C;  2XTI A;  3PUX A;  3J7Z C;  4NXN Q;  3TQY A;  3S1Q H;  2VNU D;  2R7Z G;  1YHQ A;  1PYB A;  3L2P A;  3HFZ B;  1A62 A;  4DV6 Q;  3KF8 B;  2VUM H;  5GQO A;  1XTD A;  4JCV E;  4GKJ L;  1PH7 A;  4ME3 A;  1OTC A;  4L5R C;  1XPU A;  4Y52 H;  1ASY A;  3D0F A;  4JI0 L;  5FLM H;  1QZG A;  4C3H H;  1M1K C;  1HNW L;  5C0X J;  1G29 1;  2Y0S E;  3K7U C;  3UDI A;  4NXM L;  1VQN A;  1NTG A;  1X55 A;  3UE1 A;  4P72 A;  2HHH L;  2K50 A;  4R4T A;  3I4N G;  4KHZ A;  1B70 B;  1QVG A;  2I5M X;  2A19 A;  1VQB A;  3WWV A;  3NEM A;  2ATW A;  1XMO L;  3CCQ A;  1SE8 A;  1GD7 A;  1I5F A;  3BU2 A;  3KYH C;  2Q2H A;  3M4P A;  1UE7 A;  1PH2 A;  1PH8 A;  1UWV A;  3HKZ E;  3GD7 A;  4APV A;  1YJW A;  1EFW A;  4DR2 L;  5C3E H;  3U4Z A;  3CP0 A;  4IPD A;  5M5Y H;  4UPA A;  2MFI A;  4A3F H;  5IYC H;  3RNU A;  2JA5 G;  1T9H A;  5HY6 A;  4GKK L;  4A3J G;  2E5L L;  4B3R L;  4DKA C;  4JBM A;  4WJ3 M;  4JC0 A;  2EIF A;  2VY3 A;  3ICE A;  5M3F H;  5M5W H;  4A3I G;  5AJ3 Q;  1E1O A;  1IZ6 A;  2OQK A;  4IPG A;  5IY0 A;  4MZ9 A;  3I56 A;  2Q2T A;  3S15 H;  4BY7 H;  3CQZ H;  2K5H A;  1L1O C;  3W1G A;  3VDY A;  1KC8 C;  4KHP Q;  1XPR A;  4HJ5 A;  3PV0 A;  1Y1W G;  1QUQ A;  2ZM6 L;  1KRS A;  2RHS B;  4JI1 Q;  1HNZ Q;  5EAY A;  4ALP A;  3F2D A;  1QUQ B;  1E22 A;  4DV1 L;  3J81 j;  2AWO A;  3STB D;  3H15 A;  1TWC H;  2QA4 A;  4DV7 L;  1VQ7 A;  4LF6 L;  5IP7 H;  1HNX L;  4L5T A;  1KAW A;  4YY3 L;  4BY1 H;  4DAM A;  1Q46 A;  3PIO A;  5M3M H;  3J7A 5;  1KHI A;  3RN5 A;  4BBS H;  1H95 A;  1X56 A;  4LF7 L;  1N32 Q;  3PUY A;  2YTV A;  1SRO A;  2HT1 A;  5GAE C;  1BBU A;  1YHB A;  2I5H A;  4A3C G;  2MO1 A;  4A3M G;  1I94 Q;  4NXN L;  3KJO A;  1PYS B;  3T1Y Q;  4POG A;  2JQO A;  3RN2 A;  1LM0 A;  2KCT A;  1UE6 A;  4IFD G;  4QQB X;  5C4X G;  2K75 A;  4UP8 A;  3CCE A;  4DV6 L;  5IYD G;  1RIP A;  5IP9 G;  3FHW A;  1RL2 A;  2WAQ G;  1VQ6 A;  4K0K Q;  3M4O H;  4HID A;  5ELN A;  1PH4 A;  2AMC B;  2VS1 A;  2VZA A;  2IHF A;  1YZ6 A;  1TXY A;  3H3V H;  1Q82 C;  3I4M G;  5FJ8 G;  1PH5 A;  1X3G A;  1CUK A;  4JYA Q;  1VQP A;  1YIJ A;  2UXB Q;  4NB3 A;  3H0G H;  4BBR G;  2UUB Q;  4JOI A;  3ULJ A;  5IT9 c;  2R6G A;  4JI8 Q;  1K8G A;  4LW1 A;  4JI6 Q;  4A3L H;  1OXV A;  2LXJ A;  3L0O A;  3ULL A;  1V1Q A;  3CCU A;  2YTY A;  2ID0 A;  3CW2 C;  2LSS A;  3E0E A;  3BZC A;  3M4Q A;  2DGY A;  4A4I A;  1WYD A;  1VQO A;  3J80 c;  2E8G A;  1XMQ Q;  5AJ3 L;  3PF4 A;  1VQ5 A;  1VQA A;  5JEA G;  4XTC S;  4DUZ Q;  1YIT A;  2VUM G;  3CCS A;  1VQH A;  5H1S E;  4KHP L;  1NBW A;  3K81 C;  4TQU S;  2BH8 A;  3NEL A;  4C3I H;  4C2M H;  1U0L A;  5FLM G;  4JI1 L;  1HNZ L;  1KD1 C;  3GTG H;  1EIF A;  3K7A H;  4NPS A;  3EBE A;  4DNI A;  1Z47 A;  3DLL A;  3PO3 H;  2NVQ H;  1KRT A;  2JK8 A;  3ER0 A;  5J3B A;  1WI5 A;  4HJA A;  4IPH A;  3U58 A;  3W5O A;  4H02 A;  2I0Q A;  1N32 L;  2CQO A;  3CCV A;  5C3E G;  1O7I A;  1BVS A;  2YYZ A;  1N8R C;  1VQ8 A;  5IYC G;  1NMG A;  2CKZ B;  1I94 L;  3T1Y L;  4A3B H;  2NN6 G;  3F8T A;  2WAQ E;  3PF5 A;  5GAH C;  4DV0 Q;  2UUA Q;  4R4C A;  3S1M H;  5IWA Q;  5M3F G;  2RF4 A;  5HGQ A;  1JB7 A;  2D62 A;  3ULP A;  3S14 H;  1PH6 A;  4BY7 G;  1OXU A;  3AFP A;  4P73 A;  4AQY Q;  1D7Q A;  3GTQ H;  4UP9 A;  4X64 Q;  2JA6 H;  1VQE A;  4R4I A;  2JE6 I;  4BA1 I;  4L5S A;  2K4K A;  1G6P A;  4J15 A;  4O0A A;  2PQA A;  3KJP A;  1FJG Q;  4YCU A;  1GKH A;  4JYA L;  2UXB L;  3HOX H;  2PQA B;  4AIM A;  1NMF A;  1IL2 A;  2ALY B;  2UUB L;  4YCW A;  5C0X G;  3CF5 A;  3CD6 A;  1A63 A;  3FKI H;  3MXN B;  1VQK A;  5IP7 G;  4JI8 L;  2HIX A;  4IFD I;  4BY1 G;  4GN4 B;  2JEB I;  5M3M G;  4P71 A;  1IBK Q;  4LNQ A;  4BBS G;  1IBL Q;  3AQQ A;  4OWX B;  3F2C A;  3RZO H;  3JC6 6;  3ERS X;  3CPF A;  1YI2 A;  3G4S A;  1L1O A;  4PG3 A;  2PI2 E;  3Q8D A;  3HOZ H;  1JJG A;  1VCI A;  3J80 i;  4GN5 A;  3CME A;  1XMQ L;  1MJC A;  2AHO B;  2CWP A;  1L1O B;  4TVA B;  4LFC Q;  2R92 H;  4DUZ L;  1PVO A;  4MTN A;  4UY8 C;  2ZTC A;  2MQH A;  5JJK A;  3PIP A;  4DR7 Q;  1WFQ A;  4DR1 Q;  1E24 A;  2N8N A;  4DV2 Q;  1X9N A;  1OXX K;  1N34 Q;  4QL5 A;  5IE8 A;  3RR5 A;  2VQF Q;  1VS0 A;  3HKS A;  4YWM A;  1Q81 C;  4B3T Q;  4C3J H;  1SRU A;  5JJI A;  3HOU G;  3H0G G;  3KLW A;  4DUY Q;  1EQR A;  4BXX H;  3S2D H;  3B6Y A;  1HZA A;  3OYY A;  1XJV A;  4LF8 Q;  1L0W A;  1R9T H;  4A3L G;  2BA0 A;  3A74 A;  4LF9 Q;  2OQ0 A;  1VQI A;  4JBJ A;  2WFW A;  3BZK A;  2CCZ A;  4JBK A;  1HZC A;  2K52 A;  3GTO H;  2IHE A;  3I55 A;  2UXC Q;  5ELO A;  1Y1V H;  2JEA I;  1E7Z A;  4DV0 L;  3PSI A;  2EQS A;  5IWA L;  3S2H H;  4MNO A;  1AH9 A;  1PH9 A;  3RLN A;  1S72 A;  4AQY L;  1I6H H;  1OXS C;  1TWH H;  4X64 L;  3GTL H;  1CKM A;  1WJJ A;  1FJG L;  1UE5 A;  4X62 Q;  3F2B A;  2UU9 Q;  3F1Z A;  1IYJ B;  1KQS A;  5DLQ E;  1I50 H;  2NZH A;  2NN6 I;  3OW2 A;  3TRZ A;  3PO3 G;  4GOP C;  2OTJ A;  3SGI A;  4A3E H;  1LYL A;  1Q12 A;  2B3G A;  3UDG A;  4GLX A;  3CPW A;  4OX9 Q;  1UEB A;  4UP7 A;  1W3S A;  5FLX c;  4A3K H;  1IBK L;  1YEZ A;  4EQ5 A;  2ZJQ A;  1K73 C;  1IBL L;  1CSP A;  4B3M Q;  3M3Y H;  3UE0 A;  4OWW B;  1JE5 A;  4Y7N H;  1SR3 A;  2F3I A;  3J81 c;  2HIV A;  3U50 C;  4A3B G;  4JV5 Q;  1LTL A;  3ZJY C;  3GTP H;  4LFC L;  1B8A A;  1FGU A;  1AE3 A;  1YNX A;  5C0X I;  4DV4 Q;  3A5U A;  3I2Z A;  2V1C C;  5E7N A;  4A93 H;  2JJQ A;  5C44 H;  2KBN A;  4DR7 L;  4A76 A;  3K8A A;  4LF4 Q;  4DR1 L;  2JA6 G;  1PFS A;  4DV2 L;  4QY7 A;  2R7F A;  1N34 L;  1MIU A;  1NE3 A;  3PUV A;  4R1J A;  2VQF L;  4QGU A;  4P75 A;  4B3T L;  1KL9 A;  2JA8 H;  3HOX G;  3PO2 H;  4DUY L;  5BR8 Q;  3FKI G;  4YCV A;  4LF8 L;  1YJ9 A;  4DR6 Q;  2VQE Q;  1GO3 E;  5GAG C;  4HIO A;  1CKN A;  1N36 Q;  4LF9 L;  4JI2 Q;  4DPG A;  2GVA A;  1B7Y B;  1VQJ A;  3KF6 A;  2KCM A;  1SFO H;  1CKN B;  2UUC Q;  2BH2 A;  2UXC L;  2N49 A;  3KF6 B;  2RCN A;  4AH6 A;  3TRE A;  3G71 A;  3CC2 A;  2K14 A;  4A3D H;  1P16 A;  4JI4 Q;  2ZJR A;  1TWF H;  1QVC A;  3HOZ G;  1C0A A;  4OO1 G;  1OXT A;  1W2B A;  4P74 A;  1HZ9 A;  3HKZ G;  4QJF A;  1EOV A;  4A3F G;  2R92 G;  4LF5 Q;  2PMZ E;  1J5E Q;  3UDF A;  1A0I A;  2H5X A;  4X66 Q;  4LWC A;  3TEH B;  1X3E A;  2CFM A;  2Q2U A;  1GVP A;  4X62 L;  2UU9 L;  4K0K L;  1BKB A;  3T1H Q;  4JI7 Q;  1K83 H;  1QZH A;  3HOV H;  2N3S A;  3GTM H;  1V9P A;  3NEN A;  1U5K A;  4GN3 B;  1S3O A;  2JA9 A;  1SLJ A;  3RLO A;  3HOW H;  1Q86 C;  4BXX G;  1V43 A;  1YJN A;  2IY5 B;  3A0J A;  2IX0 A;  4OX9 L;  2ZTD A;  2KHJ A;  2R7D A;  2F4V Q;  2OWO A;  3BJU A;  2NVY H;  4X65 Q;  3CAM A;  1N33 L;  3HOY H;  3AFQ A;  3L7Z C;  2E2J H;  4B3M L;  2HQL A;  2LXK A;  2YTX A;  1VQG A;  1ASZ A;  2E2H H;  1PHJ A;  4DR3 Q;  4JI6 L;  3G6E A;  1SMX A;  1UE1 A;  2YU9 H;  4JG2 A;  4LFB Q;  3J81 i;  4JV5 L;  5IYB H;  1Y1V G;  1PH1 A;  1AE2 A;  2GN5 A;  3JAM c;  1I3Q H;  2QEX A;  1L2F A;  1X6O A;  4DV4 L;  1A8V A;  3S17 H;  2B63 H;  1P8L A;  4LF4 L;  1Z9F A;  2KEN A;  2OCE A;  3U4V A;  2IX1 A;  5M5X H;  3CC4 A;  1XNQ Q;  4HIK A;  3E9I A;  3TS2 A;  4LFA Q;  1IBM Q;  3FP9 A;  3PGZ A;  3UDX A;  1EUJ A;  2JA7 H;  5BR8 L;  4DAY B;  2Q2I A;  4O2D A;  1VQ4 A;  1EQQ A;  5GRO A;  4IO9 A;  4A3E G;  2R93 H;  3G48 A;  4DR6 L;  3CMA A;  1YBY A;  4IJH A;  4XIG S;  3OTO Q;  3M85 A;  2AWN A;  2VQE L;  1GM5 A;  1JJC B;  2K5N A;  4A3K G;  1N36 L;  4JI2 L;  1LUZ A;  3KFU A;  2Z6K A;  1HR0 Q;  4LUO A;  3LGJ A;  2K5V A;  1WCM H;  2UUC L;  1M90 C;  3TS0 A;  1Q1E A;  1VQL A;  4POF A;  4DR4 Q;  4JI4 L;  4WJ4 A;  2PI2 A;  1XNR Q;  4OON A;  3RLF A;  1YVC A;  4PZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...