2VQFL

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqfL00
3GTJH 3TS2A 4LF9L 1GM5A 3HOUH 3L0OA 4IFDG 1XPRA 1T9HA 2ZTCA 1K83H 4YWLA 5C0XI 1E3PA 3CCEA 4KHPQ 3HOYG 1HNWQ 4LUOA 4NXMQ 4IFDJ 2A8VA 1Y14B 2K52A 4JBKA 4IFDI 4JOIC 4JI6L 1OXUA 1Q7YC 1QVFA 4UP7A 4DV7L 2HHHL 4FDBA 2F3IA 2JEBI 4A3MH 5FLMH 1XMQL 4LF7Q 3HOUG 2BH8A 3G48A 2UUAQ 3HOWH 2PQAB 4R4CA 5ELNA 4NXNQ 1NY4A 2AMCB 1K3RA 3F2CA 4JBWA 2ZJRA 2Z0SA 5GAHC 1IL2A 1CUKA 2RHSB 1XMOL 4DR6Q 1E1TA 4B3SL 4PMWA 3A0JA 1J5EL 2L15A 2ZJPA 4A3MG 1YEZA 1X54A 1VQDA 4L5SA 1JT8A 5HGQA 2K50A 2UUCQ 4GOPB 1PH2A 4X65Q 2Q2HA 1WI5A 4BBSG 1SFOH 4GN4B 2VQEL 4DUZQ 1SRUA 2OWOA 4R1JA 4JI7L 3GTQH 4DR4L 1VQGA 1CKMA 2VY3A 1Q12A 1C7YA 5LMUQ 4DV6L 2F52A 3KOJA 3TS0A 1K0RA 1NMGA 1HNZL 2IHEA 3RLNA 1YHBA 3HOZG 2ZJQA 2PI2A 4GKJL 1RL2A 2E2JH 4P75A 3CCJA 3CP0A 4OXPA 1YZ6A 1N36Q 3M85A 1WCMG 3EN2A 3PGZA 2Z6KA 4LWCA 4A3GH 5FLXc 2JA6H 2EXDA 2B63H 3HOVH 1FJGL 2WB1G 4POFA 2NVYH 3S24A 4A3IH 5C4XH 4DR3Q 3T1HQ 3RN5A 1SE8A 4GKKL 2Q2TA 5C44H 3CAMA 4LFCL 1X65A 4Y52H 1SN8A 3RN2A 3OW2A 1FGUA 1MIUA 2ALYB 4A3JH 3PO2H 4A3GG 1VQCA 1V9PA 2JA6G 2B63G 1S3OA 3HOVG 1EQRA 3GD7A 4A3IG 1OXTA 5C4XG 3ULJA 4JI4Q 1B8AA 2CCZA 1VQ9A 1QZHA 1I5FA 4YHHQ 4IO9A 5C44G 1HR0Q 1N32Q 1VQBA 5AJ3L 2WAQE 4KHZA 3J81j 3DM3A 2UUBQ 2ATWA 3W1GA 4A3JG 3STBD 1R9TH 4LF8Q 3HKZE 4JBJA 1OXXK 4DPGA 1M1KC 4X62L 4BXXH 4IPHA 1Q82C 1JE5A 4QL5A 2ZM6L 1Q8KA 4A3BH 4A3DG 1VQIA 2BH2A 3UDXA 1XNQL 4DK3C 5EAYA 1VQNA 2R92H 3D31A 4JI2Q 5M5WH 3KF6A 4RMFA 1HJPA 1QZGA 3I4MG 3SGIA 4BXXG 1BBWA 4C2MH 3AYHB 1SROA 1O7IA 1BKBA 3GO5A 3S2DH 4BA2I 2ES2A 2H5XA 3PSIA 4A3FH 4JBMA 2R92G 4JI3L 1EFWA 1UE5A 3GTGH 1A0IA 4DV3Q 1H95A 4LUVA 4MTNA 1IBLL 2IY5B 4HJ8A 1FVIA 4B3TL 2JA5H 3GTOH 2OTJA 3S1NH 4JI0Q 5GQOA 2BA0A 3W5OA 3CC4A 3KFUA 4LFAL 3L7ZC 4DKAC 1B7YB 2D0OA 5IYCH 1K73C 3S17H 3NENA 1DGSA 4DV0Q 1I6HH 1WFQA 3VDYA 1X3EA 1LTLA 5BR8Q 4JI5Q 4L5TA 4O0AA 2JA5G 3TRZA 4LF9Q 2MO1A 2Q2IA 2D0PA 1FL0A 4PG3A 2I5MX 2JA8H 3HKSA 1YIJA 1XNRL 1LYLA 1P8LA 3UDFA 3A5ZB 4JI6Q 3F2BA 1E1OA 2F4VQ 4AQYL 3I55A 2AKWB 1P16A 3F1ZA 3UE1A 3WWVA 5C3EG 2NVTH 2UXBQ 1KRTA 4GOPA 3KLWA 1XMQQ 3W1BA 3J81c 3E9HA 5IE8A 4OO1G 4IPDA 1I94L 2C35B 1VS0A 3H15A 3B6YA 4AH6A 3AEVA 1NBWA 1D7QA 4OWXB 4B3ML 4DR1Q 2R93G 1TXYA 4OO1I 3PF5A 1A63A 1J5EQ 2B3GA 4P72A 2K4KA 3UDGA 1PYBA 1VQKA 5J3BA 2CKZB 2KBNA 2XTIA 4JYAQ 1YVCA 4A93G 2K5NA 4X64Q 1KC8C 3PUZA 3UE0A 4YCUA 5H1SE 3J80i 1GVPA 2N8NA 2KHJA 1JMCA 3H3VH 1UEBA 3BZKA 4JI7Q 4LF5Q 2FXQA 4JCVE 1PH5A 1L1OA 4QY7A 1MKHA 2CQOA 3GTMH 5HY6A 4DR7Q 4HJAA 4YWMA 3S16H 1YITA 1Z47A 3MEFA 3J7ZC 2UXCQ 5LMNW 5M5XH 3Q8DA 4A3EH 2GVBA 4BY1H 2VNUD 3K7UC 4OX9Q 1HZAA 4JV5Q 4DUYL 2E8GA 1VQ5A 3M4PA 4R4QA 1TWGH 2JA7H 5FLMG 4JI8L 2VUMH 2A1AA 3HOWG 2YYZA 2K14A 1KQSA 1KIXA 4YY3Q 3OTOL 4A3LH 5IYBH 4DR2L 2UXDL 5IYDH 4A3EG 4BY1G 5C4JH 3MXNB 4RG1A 4KI0A 3I4NH 1HZCA 4JOIA 2VQFQ 5GROA 3PIOA 2DUDA 2JA7G 2I0QA 2VUMG 2WB1E 1C0AA 4LFCQ 4K0KL 1XPUA 5IYBG 4LF4Q 1W2BA 5IYDG 4B3RL 2K75A 3I4NG 2CWAA 4A75A 1A62A 4QGUA 3ULPA 1N34Q 1PH6A 1XPOA 3AFPA 1X55A 1L1OB 3G6EA 4KHPL 1HNWL 4UP9A 3J81i 1EOVA 2VS1A 3JAMc 3CPFA 2Y0SG 1EUJA 1EQQA 1D8LA 3PIPA 4DV5Q 1VQ6A 2ZTEA 3KJPA 3PUVA 1Y1WH 1IXRA 3RLOA 5IY0A 4X62Q 1PH8A 1U0LA 3EIVA 2UUAL 1KHIA 4NXNL 2ZM6Q 3M4OH 1NE3A 2NVQH 1E22A 1Q86C 3K8AA 1U5KA 4YCWA 4BY7H 2VL6A 2QA4A 3CCVA 2WFWA 1X56A 4DR6L 2MFIA 1X3FA 3BU2A 5FJ8H 2GVAA 3I4OA 4XTCS 2UUCL 1OXVA 2PNHA 4H02A 4A3CH 2E5LL 4LFBL 5JJKA 1E24A 3TEHB 5GAEC 2UU9L 2K5HA 4DUZL 4BY7G 4JI3Q 1G51A 1PFSA 3GDEA 4A3KH 3PO2G 1AE2A 2N3SA 2I5HA 2RHQB 3CXCA 4A76A 1VQLA 1KD1C 4DNIA 1Y1VH 5LMNL 4GNXC 4DV1L 4A3CG 3GTLH 1VCIA 1IBKQ 1NMFA 4LFAQ 2JA9A 2IX1A 3AQQA 4QQBX 4A3KG 5JJIA 4HJ5A 1VQ7A 2LSSA 4PZ6A 4PZ7A 1TWCH 4QJFA 1VQFA 4DR5L 1IBMQ 4A3BG 3CCUA 1Y1VG 4MNOA 1BVSA 1XNRQ 1GKHA 1N33Q 3K0XA 4DR3L 3T1HL 2D62A 1XTDA 1MJCA 4LUZA 2QEXA 4HIDA 3T1YQ 4JI1L 4JG2A 4HJ7A 4P73A 1EIYB 4A3FG 3TQYA 3ERSX 4IOCA 2HQLA 4O2DA 1EWIA 4DV4L 1A8VA 1V1QA 1I94Q 1AH9A 1YHAA 4BBRH 1HZBA 3KJOA 4YHHL 4HIMA 3KYHC 1HR0L 3PV0A 2YU9H 1W3SA 4B3MQ 1N32L 2UUBL 5K36G 5IP7H 3K80C 2PI2E 1PH3A 3K7AH 3S2HH 5IYCG 1CKOA 3NBHB 4KLKA 4DK6C 1TWFH 4HJ9A 4GS3A 1Q81C 4LF6L 4J15A 4BBRG 4DV7Q 2HHHQ 3OYYA 3CPWA 4IPCA 3E9IA 3CCRA 4UY8C 4IPGA 4IJLA 2JA8G 1WJJA 4DAMA 4JI2L 2GN5A 5IP7G 4DV2L 4C3IH 3I56A 2KCMA 4AIMA 3S15H 1NJIC 1L2FA 3S14H 4NPSA 4WJ4A 4R4OA 3RR5A 1XMOQ 4DUYQ 2OQ0A 3CW2C 4B3SQ 1ASZA 3TREA 1NTGA 2PMZE 2QGQA 3PO3H 3KF8B 4JI8Q 4AYBG 1SMXA 4PZ8A 3H0GH 3CC7A 3RNUA 4DV3L 4WJ3M 1KXLA 4DR2Q 3EBEA 2AWOA 2KHIA 2VQEQ 1KAWA 2LXKA 4EX5A 1VQ4A 1K9MC 1QUQA 4OWWB 4DR4Q 2Q2UA 2LXJA 4JI0L 2MO0A 3IRBA 1CSPA 3GTKH 4LNQA 3NELA 4DV6Q 1BBUA 3PO3G 2KENA 3HOXH 2E2IH 1UWVA 1AE3A 3H0GG 2WP8J 3KDFA 1HNZQ 2NZHA 3CC2A 4K0KQ 3CMEA 4X66L 5BR8L 1JJCB 4IJHA 3CCQA 1PH7A 4GKJQ 2AWNA 4B3RQ 3I2ZA 1E7ZA 5IWAL 1VQ8A 2ZTDA 1K8AC 2JE6I 5C0XJ 1YBYA 1JJ2A 1YNXA 1HZ9A 4ME3A 4C3JH 3GTPH 3JC66 3H3VI 3HOXG 1IYJB 1HNXL 2F4VL 1N9WA 5GADC 1FJGQ 2IX0A 3CD6A 2VW9A 1Q1BA 1SLJA 2UXBL 2Y0SE 2HIVA 1VQPA 3G4SA 4GKKQ 4BA1I 1TWHH 4X6AH 5IP9H 3G71A 4L5RC 3NEMA 1PHJA 3S1QH 4XIGS 1JB7A 4BBSH 2R7DA 1UE7A 4A3LG 2RCNA 5DLQE 3CCLA 2RF4A 2R7ZH 3J7A5 1J6QA 4TVAB 1CKNB 3CCSA 5M3MH 4DR1L 3ULLA 3RZDH 1PV4A 4POGA 2Z6KC 5M5YH 1CSQA 1QUQB 3LGJA 2JJQA 4JYAL 4NXML 1KRSA 1HR0W 4X64L 5IP9G 3STBC 4EQ5A 4R4TA 5AJ3Q 5E7NA 3CF5A 2E5LQ 1SR3A 4UPAA 2UU9Q 3HOZH 4LFBQ 3F8TA 3KDFB 2OTLA 4LF5L 4R4IA 4GLXA 1GD7A 2R7ZG 4LF7L 3M9BA 4LW1A 5M3MG 2YTXA 3M4QA 3DLLA 1MJEA 4DR7L 3ICEA 1S40A 4Y7NH 2R6GA 2UXCL 1WCMH 4YWKA 1VQMA 2XGTA 5LMNQ 1XNQQ 2VZAA 4DV1Q 4OX9L 4JV5L 2NN6G 2BA1A 1X9NA 1Y1WG 3U4VA 2CWPA 3S1MH 1Q1EA 1TWAH 2ID0A 2NN6I 2N49A 4JC0A 4P74A 4YY3L 4X65L 4DR5Q 1K8GA 1OXSC 4HIOA 5IT9c 2A19A 1L0WA 1OTCA 4HIKA 1VQJA 1JJGA 1YI2A 2HIXA 4GN3B 2VQFL 1IBLQ 4APVA 5FJ8G 2ASBA 4B3TQ 3RZOH 4UP8A 4GN5A 5LMUL 3BZCA 4JI1Q 2JK8A 1LUZA 1S72A 4LF4L 1N8RC 3BJUA 4ALPA 4MZ9A 1PH9A 2HT1A 4DV4Q 1N34L 3CMAA 1M90C 1N36L 2YTYA 3U4ZA 5ELOA 3CCMA 4A3DH 4NB3A 3M3YH 1C9OA 2KCTA 3FP9A 1XJVA 1VQEA 4C3HH 2IHFA 3PUWA 3U50C 4DV5L 4DAYB 2OCEA 1PA6A 2JQOA 3A74A 4L5QA 2K5VA 3I4MH 1WYDA 3K81C 4LF6Q 4OWTB 2N78A 3PCOB 4AQYQ 5M3FH 3I7FA 3D0FA 4YCVA 2MQHA 1KL9A 3A5UA 1V43A 1QVCA 3JAMi 2E2HH 1RIPA 3FKIH 4GNXA 4DV2Q 1Z9FA 3J80c 1G6PA 2WAQG 4QIWE 1EIFA 1GO3E 4JI4L 3F2DA 5M3FG 3HKZG 4OONA 1YHQA 1PVOA 1UE1A 3S1RH 3ZJYC 4TQUS 1I50H 1LM0A 1VQAA 2NVXH 4LF8L 5JJLA 4IOAA 3FKIG 3E0EA 4A4IA 4GOPC 3PF4A 2I5LX 4GLVB 3RLFA 4AYBE 2AHOB 1VQHA 3M7NA 1IBKL 1WOCA 3PUYA 1YJNA 1UE6A 1EYGA 5JEAG 3U58A 1YJWA 2OQKA 3AFQA 4X66Q 2CFMA 1PYSB 2DGYA 5C3EH 1VQOA 1ASYA 2PQAA 5JEAJ 1IBML 4P71A 1PH1A 3HFZB 5IWAQ 1G291 2IT1A 3PUXA 1N33L 3L2PA 1PH4A 1B70B 2YV5A 3OTOQ 1QVGA 1L1OC 2EQSA 1CKNA 1HH2P 3ER0A 2JEAI 1X3GA 3KF6B 2UXDQ 2V1CC 3FHWA 4GNXB 3T1YL 1HNXQ 5GAGC 1X6OA 2R93H 2NZOA 4GLAC 3UDIA 1Q46A 2EIFA 3CQZH 2R7FA 1I3QH 3HOYH 2B29A 4A93H 4DV0L 1YJ9A 2MNAA 1IZ6A 4JI5L 5C0XG 2YTVA
chains in the Genus database with same CATH superfamily
3HP3A 3L0OA 2ZTCA 1LV9A 1SJHD 4KHPQ 2HD3A 4LUOA 1Y14B 3P7JA 1EY4A 4JOIC 1OXUA 2HHHL 1PFMA 4A3MH 3TP8A 1XMQL 1SYGA 4LF7Q 5DEHA 2UUAQ 3VYRA 1VF7A 2AMCB 1RHPA 2DNCA 2EOTA 2X6LA 2F0PA 2Z0SA 3NE5B 1CUKA 5FK9C 4ZUIA 1E1TA 1FNUA 1XTCD 5FO9B 4A3MG 2ZJPA 4GOPB 3J81E 4X65Q 4GN4B 5KNCA 2VQEL 4DUZQ 4DR4L 1F9QA 4IQZA 1CKMA 1B53A 2K04A 1C7YA 1L0YB 2F52A 3KOJA 1K0RA 1HNZL 1A6XA 3D6WA 3R2TA 3HOZG 1EOTA 2PI2A 2F0OA 1TS4A 3L3OC 1BCPC 4P75A 3S2DB 4DNRB 3EN2A 4A3FB 2Z6KA 3C1FA 3TMEA 2JA6H 3UI2A 2B63H 1FJGL 3VR3A 3GTGB 4POFA 2NVYH 2KEDA 2KCNA 1C4QA 4LFCL 1XXGA 1SN8A 1EY8A 1LO5D 3OW2A 2ALYB 1VQCA 2JA6G 2B63G 3H09A 1EZ6A 2CCZA 1QZHA 4YHHQ 4IO9A 1N32Q 2BDOA 1WTPA 1HUMA 4QIWB 3DM3A 2UUBQ 5C5MA 3A54A 4F7XA 3HKZE 4DPGA 5JVG3 1M1KC 1TWFB 4X62L 1PTOB 1C48A 2DJGC 2F1MA 4ILWA 4A3DG 2EYJA 4KJNA 4DK3C 1VQNA 2A6HC 2KJXA 3D31A 4JI2Q 5M5WH 1I4RA 4C3IB 3DEPA 1QZGA 3SGIA 1SROA 3GO5A 2KHSA 4MHEA 4ZLTF 3ZYYX 3NUCA 4JBMA 5EJWA 1DXMA 2F4IA 2B2UA 5D65A 4CDDC 3QWNA 1SBBB 4DAPA 3GTOH 2F3VA 4RHRA 3S1NH 3GTMB 1RTOA 2BA0A 3KFUA 3S16B 1EY9A 1I4GA 1B7YB 5IYCH 1DGSA 1WFQA 5FKAC 1Y8OB 1LTLA 3TRZA 4LF9Q 3TBIB 2RDGA 2K32A 2I5MX 2JA8H 1XNRL 4OO1H 3UDFA 2BOSA 4JI6Q 1W6KA 5CV5A 4AQYL 3I55A 4B08A 1P16A 1SNPA 5EKKA 4O42A 4RGMA 3K0YA 3P20A 1QWYA 1JCKB 2Z1CA 3KLSA 5IE8A 4OO1G 3AB9A 4JPBW 4CDFC 4AH6A 3AEVA 1NBWA 2ICIA 4OWXB 5IODA 3NSWA 1J5EQ 2ENBA 1VQKA 2KVMA 5CC4A 2CKZB 2K5NA 1KC8C 1PXUA 1ESFA 1GVPA 3FRPB 1LTRD 3VA5A 1JMCA 3H3VH 1UEBA 2FXQA 1PH5A 1ICFB 1X3QA 1Y1WB 1PMRA 2UXCQ 5EPKA 3J7ZC 1B44D 2F0WA 2R3ZA 4QMGA 2E8GA 5JPMC 1VQ5A 4WFN3 4DU9A 2OT2A 1CZWA 3S1MB 2ZXRA 5IGDA 1EQTA 5IYBH 4DR2L 3FPUB 3K5OA 3IFTA 1GOZA 4KI0A 2I07B 1HZCA 1HQMC 2VQFQ 3PIOA 2DUDA 3RZOB 3OWEB 2XRSD 2WB1E 4K0KL 2H1EA 3GV3A 3BYTB 5IYBG 4LF4Q 4ZYSA 4KHPL 3M3YB 2XIWA 4CKCA 3JAMc 1EUJA 5FOBB 1EQQA 3PMFA 3V05A 2XSCA 3PUVA 1PH8A 2UUAL 1STGA 2ZM6Q 4F87A 1K8OA 5KNBA 1B50A 1X3PA 1U5KA 4YCWA 4J6HA 2QA4A 4S3SA 2F0NA 2L9HA 3I4OA 4XTCS 1OXVA 3K5LA 3A7LA 5GAEC 2UU9L 4DUZL 4A3KH 1AE2A 2MPMA 2QILA 4K14A 1QNKA 3VA7A 3NBHA 1G2SA 2C5CA 3SDZA 2IX1A 4A3KG 1SYFA 2EVBA 2LSSA 3WOEA 4CJ1B 5LHY1 3Q24A 1IBMQ 4KD4A 2EY6A 4IUNA 1N33Q 2F0DA 1SYBA 1U4RA 1XTDA 4ABNA 2O5JC 3Q6SA 3CQZB 1S5CD 2Z9HA 1SEBD 4IOCA 1AH9A 2PZWA 1HZBA 1EYCA 3KJOA 5JOBA 4YHHL 1N32L 1W3SA 5ELDA 4B3MQ 2UUBL 4FYDA 1S5DD 3IL8A 1CKOA 3NBHB 4GS3A 4LF6L 3U9OA 2HCIA 3FPPA 2RDFA 4UDUC 4A3MB 3E9IA 4UY8C 1KNAA 4X3SA 1HTLD 1BDOA 1GHJA 4JI2L 1LTGD 2GN5A 2LS01 3FDTA 1ILQA 1AEXA 2A6HD 1NJIC 1L2FA 4NDXA 4R4OA 1XMOQ 4XQJA 5JAVA 1JOOA 1JE4A 4JI8Q 5I2YA 4AYBG 4PZ8A 4WJ3M 3HOZB 2P5ZX 1TY0A 4IUQA 1U9RA 2Q2UA 2LXJA 1JOKA 3IRBA 4QUFA 2F0HA 3HOXH 1UWVA 3T53B 2NZHA 4X66L 1JJCB 4GKJQ 2K1BA 4B3RQ 1E7ZA 2A6EC 2ZTDA 1YBYA 3NBIA 1HZ9A 4PV1C 4C3JH 3GTPH 3VYTA 1ZEQX 3HOXG 1IYJB 2JSOA 2JA6B 1N9WA 2B63B 2IX0A 3CD6A 1ONLA 2VW9A 1LACA 1CT1D 3G4SA 4X6AH 5IP9H 4C3JG 5EBCA 3S1QH 4BBSH 1UE7A 2RF4A 2R7ZH 3E0JA 1PV4A 5M3MH 3A8KE 5M5YH 4H13C 4A3DB 2JJQA 1HR0W 5IP9G 3STBC 4C1NI 4R4TA 4LFBQ 5E7NA 4UPAA 3BDOA 2D2CC 1GD7A 2R7ZG 3M9BA 5M3MG 5I6YA 1EL0A 2UXCL 4YWKA 2BE5C 3H3VC 3BYYB 4JW0A 3PIP3 1BQQT 5LMNQ 3E3XA 4HEDA 5M5WB 1TR5A 1U4MA 5I2XA 2KCCA 1V1PA 1TWAH 3S1RB 4C1NK 1K8GA 2EYOA 5T1IA 3LWUA 4F88A 4HIOA 1YI2A 2HIXA 4GN3B 2VQFL 1STAA 2AQ1B 5LMUL 3GTOB 3S1NB 2F0KA 2B8FA 4LF4L 1AN8A 3CMAA 3U4ZA 3N6RA 2F03A 4QUCA 1C9OA 5C4HA 1VQEA 2JA8B 1G2TA 4UAIA 1LT4D 2JQOA 4L5QA 3I4MH 3NTKA 3W2DA 1WYDA 1CHQD 3PCOB 1K8MA 3KF8A 3HG9A 4KKSA 3A55A 1V1PB 1QVCA 2E2HH 5LL6X 1Y69U 4DV2Q 3J80c 2F3WA 5IT9E 4QIWE 4XT3B 2EJFC 4CJ2C 4LF8L 5JJLA 4IOAA 1M4VA 5FO8B 2PMZB 3J7AF 3E0EA 2IW3A 1B3QA 4R9WA 4KKUA 1H9KA 3RLFA 4L63B 2A74C 3D4RA 1EZ8A 1NUCA 3AFQA 1PYSB 5C3EH 4H44C 5KGUA 2PQAA 5JEAJ 1IBML 5NUCA 5IWAQ 1G291 2IT1A 1N33L 3T4AC 3OTOQ 1EYAA 1QVGA 1S4ZA 1HH2P 2NBFA 3ER0A 1HHVA 1HNXQ 1LTSD 3GTQB 5IGGA 5GAGC 4IFDH 2R93H 4GLAC 1I3QH 3HOYH 4A93H 1SXTA 4NW2A 5A2QL 2L1BA 2CHBD 5IIFA 4HJ5A 2OF1A 3TS2A 1GM5A 4IFDG 1T9HA 1JR0D 2JYOA 5C0XI 3HOYG 2SNMA 4NXMQ 1F77A 2K52A 1Q7YC 4I7AA 2F3IA 1A3UA 4R8IA 2BH8A 3G48A 3HOWH 2PQAB 4R4CA 5ELNA 4NXNQ 1NY4A 1FR3A 3NXWA 3OW7A 5CBEE 5GAHC 5CR3A 1XMOL 3MEHA 1YEZA 3R8BA 2UUCQ 4X3KA 2WKCA 3CHBD 4JI7L 4A3KB 1I4PA 2VY3A 1JB3A 1PFNA 1J8IA 1E2WA 2F0VA 3I70A 4GKJL 2E2JH 4CKBA 3KUPA 4OXPA 4IURA 3M85A 2E74C 2CVRA 2M00A 2X69A 2K5DA 1K3BC 5FLXc 3DXJC 3HOVH 2F0TA 3S24A 3RN5A 2B2WA 5KRUA 5C44H 3CAMA 4N8X1 3SK8A 2KA7A 1X65A 4ZK9B 3RN2A 1SYDA 5CORA 1EY0A 3HOVG 3BG3A 2OXPA 3ULJA 2B2TC 4JI4Q 1B2TA 1VQ9A 1HXYD 4XYOA 5IOCA 5ELEA 5C44G 4G57A 4QB4A 3I4LA 2ATWA 3W1GA 4HTHA 5KYLA 3STBD 1S5FD 3QO2A 4JBJA 1R9TH 4KN4C 1Q82C 1JE5A 4RCNA 1RKNA 1JOQA 1Q8KA 3BVGA 4A3BH 4AYBB 2BE5D 1PFBA 3KF6A 1HJPA 5L37A 4BA2I 1BKBA 1CA6A 1IW7C 5A2QE 1SYCA 1LTID 3C3LA 2FINB 4HJ8A 3I3CA 2JA5H 1A3TA 1D6EC 4JI0Q 3HOXB 2D0OA 1K73C 2EPBA 4DV0Q 1X3EA 2JA5G 2ZXPA 2E76C 2Q2IA 3EROA 1FL0A 5EKIA 5CV9A 5E3FA 4C3JB 3GTPB 4JVZA 1R4PB 1E1OA 2RBMA 3NTHA 2AKWB 1F2MA 1KRTA 2NTTA 3KLWA 3SK5A 4GOPA 3W1BA 5CV7A 5D3DA 1DOMA 1C8CA 3S1QB 1I94L 2C35B 4BBSB 1D7QA 2RQXA 2R7ZB 5M3MB 2ICEC 5M5YB 1BR9A 2RKSA 1D1KA 1PYBA 3PUZA 3SHLA 5H1SE 2RA4A 2N8NA 1PYWD 1B9MA 1BO0A 4QY7A 1MKHA 2CQOA 4DR7Q 4QF4A 1Z47A 3O13A 2JN4A 1FD7D 5M5XH 3Q8DA 2CQAA 4OX9Q 4DUYL 4R4QA 3MFGA 4KJOA 1KTKA 1STBA 2YYZA 1KQSA 1TWAB 1KIXA 3OTOL 1GJXA 4A3LH 5IYDH 1SNDA 5C4JH 1NAPA 1RODA 3H91A 4JOIA 2MP1A 2PO4A 2DY8A 3GQBA 3U9SA 1C0AA 1EWHA 2IJ0A 3K58A 5IYDG 5EQ0A 4C56C 5D14A 2CWAA 4A75A 1A62A 4QGUA 1WD1A 1XPOA 3AFPA 2B2VA 1PRTB 3G6EA 2QDLA 3TP5A 4UP9A 3K57A 1JQYD 2Y0SG 4DV5Q 1VQ6A 3KJPA 1F2LA 4CDEC 3EIVA 4NXNL 1NE3A 1FNWA 5EBDA 1E22A 2L0CA 3X3NA 3MFYA 2F0QA 5HGTA 3BU2A 4EGVA 1LLRD 1HFNA 2UUCL 1AFPA 2EJGC 3VR5A 2O2LD 3HRZC 2E5LL 3LX0A 1E24A 4JI3Q 1G51A 1EWCA 2Z4HA 3OHXC 4A76A 4ZUJA 1KD1C 1U4LA 3GTLH 4LFAQ 1OO9B 2JA9A 4IZ8A 3AQQA 2C9OA 1ENCA 1LTAD 3NPPA 1VQ7A 3S15B 3VYSA 4PZ6A 3BZDB 3TDQA 4PZ7A 1TWCH 1VQFA 4NP5A 4K5VA 3RUZA 1X32A 1EIHA 1Y8PB 5C3WA 5JVH3 1MJCA 2QEXA 2R93B 4JG2A 3GTKB 3I8ZA 4P73A 4K5WA 1I3QB 3HOYB 1BCPB 2EYFA 4A93B 3SE0A 2HDMA 2HQLA 1EWIA 2EYPA 4DV4L 1A8VA 1V1QA 2F0SA 3PV0A 1SYEA 3OOCA 1PH3A 5IYCG 2RSOA 4KLKA 2WACA 1Q81C 1EFID 3HS0C 3E6ZX 1MHWC 3OYYA 3CPWA 2RSNA 4IJLA 2JA8G 1EY7A 3S14H 4NPSA 4WJ4A 1LT3D 2EY5A 4FO2A 1ASZA 2FMCA 2PMZE 1D5XC 5HURA 3DWQA 1IW7D 1SMXA 3H0GH 3RNUA 5EKLA 2F0UA 3HEJA 5C0XH 1KAWA 2LXKA 1VQ4A 4JI0L 2MO0A 1CSPA 4LNQA 3NELA 1BBUA 1IKMA 2KENA 2E2IH 3H0GG 1SSOA 2K01A 1BNZA 2E2JB 1H9MA 1PRTF 3I2ZA 5J1ZA 1K8AC 2JE6I 1YNXA 4ME3A 2EYLA 2KUMA 2SDFA 1GUWA 4LMQD 3HOVB 1DJRD 1DD2A 5TSSA 1PRTD 1TWHH 5C44B 1D5MC 4L5RC 1JB7A 4JK1C 2O5IC 3J7A5 3CCLA 2PNRC 1J6QA 3RZDH 3CCSA 4G7OC 1LTTD 3ERQA 4OELB 1CSQA 4OGQC 4HMJA 3IKJA 3S9WA 3CF5A 5AJ3Q 2EYMA 4DK0A 2WV6D 1EYDA 1R9TB 2CH4W 2B8GA 3EVQA 4LF7L 4LW1A 2YTXA 4DR7L 1NSNS 1A2TA 4Y7NH 1S40A 1WCMH 1VQMA 5ISRA 1GUGA 4DV1Q 4PQXA 4OX9L 4G4KA 1X9NA 3QR8A 3U4VA 2CWPA 4DR5Q 2NN6I 2N49A 4P74A 1HQRD 4X65L 1KNEA 5IT9c 1L0WA 4HIKA 1VQJA 1IBLQ 3J7YW 4APVA 4B3TQ 2JA5B 4UP8A 4RGTA 4JI1Q 2BCOA 1BCPF 3MC0B 1LUZA 5T1GA 1G6ZA 4LJZC 1KLUD 3MWYW 4WRDA 1V8QA 1BCPD 1XJVA 4C3HH 3SR1A 3PUWA 4DV5L 1WTHA 2PYKA 3K81C 4E6IA 4K2KA 4K5XA 4HCSA 2MQHA 4IUVA 1AZQA 2D5DA 1Z9FA 3Q0AA 2KOLA 2WAQG 2I46A 1EIFA 2EYHA 1SE3A 1MSGA 4YIJA 1PVOA 1YHQA 3EA6A 5C6AA 1I50H 4XYQA 4A4IA 3PF4A 4AYBE 1QCBD 4HMIA 4O1NA 3C2PA 1YJNA 1QILA 1EYGA 1YJWA 1ASYA 2DGYA 3G7LA 5A35A 4ZCKA 1QNUA 1WTVA 2PW5A 1PH4A 4I65A 1L1OC 3JAML 3OSOA 3NK9A 3KLRA 1GUSA 1W6JA 4FXDA 1HA6A 3MZ5A 2Y0SB 2PZTA 4N9PA 4K2LA 2YTVA 4LF9L 1XPRA 4N9TA 1K83H 3CCEA 1HNWQ 1CA5A 3MXUA 2A8VA 4ZKBB 3Q22A 4JI6L 3SK6A 1QVFA 4ZKCB 2NVYB 1F9RA 5EGTA 2JEBI 2XWBB 3D6CA 5COYA 5FLMH 4OHJA 4Q5VA 2D9UA 3OIPA 2Z8LA 1UNSA 1K3RA 2IPKD 3F2CA 4FF2A 1I4XA 2IX3A 5K5PA 4K8IA 1IL2A 3ND9A 4FNFA 4PMWA 3KBGA 4DA2A 3A0JA 1J5EL 2L15A 4L5SA 1IYVA 5HGQA 1JT8A 1PH2A 1O7LA 2Q2HA 4BBSG 1SFOH 4R1JA 2VB3X 1VQGA 5CYUA 1Q12A 2IHEA 4LAAA 4H7BA 3GTLB 1Q3LA 4RWSC 1RL2A 4K8JA 2EDGA 3DWPA 4IUPA 3CP0A 4U68A 1IHZA 1N36Q 1EY5A 4V190 5D3IB 5DAUA 2EXDA 3MXGA 5C4XH 4DR3Q 2BDNA 2Q2TA 3HKZB 1K28A 4Y52H 1FGUA 1MIUA 1EQVA 4A3JH 3PO2H 1TQOA 1S3OA 4FXGC 1EQRA 1STYA 3GD7A 1OXTA 5C4XG 4UHVA 1B8AA 1HR0Q 1VQBA 5AJ3L 2L55A 4KHZA 3J81j 1E2ZA 5LL6S 3A8IE 3X3MA 4A3JG 3KBXA 4BXXH 2XN9C 1CM9A 4IPHA 2K5WA 4QL5A 2ZM6L 3P75A 2A73B 3UDXA 1J9OA 2FJ2A 2MHVA 2R92H 1NR2A 3DM1A 3TZDA 3I4MG 4BXXG 1BBWA 2HQEA 3S14B 3S2DH 2TMPA 2ES2A 1AZPA 1F9SA 2H5XA 3DHQA 4A3FH 2R92G 3H0GB 1EFWA 2XWJB 1CQFA 3GTGH 1A0IA 2IL8A 4DV3Q 2PZUA 4LUVA 1IBLL 4B3TL 2OTJA 5C3XA 2EZVA 4L8JA 3W5OA 3L7ZC 4DKAC 2E2IB 3S17H 4EQNA 1UAPA 4JI5Q 4EQOA 2LY7A 4PMBA 1HA5A 2MO1A 1U4PA 2F0FA 4PG3A 4GZYC 2QCPX 1LYLA 4XQNA 3A5ZB 2IWHA 1ICWA 3F1ZA 3WWVA 4I7ZC 5C3EG 1S5ED 2NVTH 1STHA 2EJMA 1XMQQ 1TWHB 2FHTA 3E9HA 3MVVA 3J81c 4WJWA 3URYA 2DN8A 3H6MA 5KYIA 1PZID 3MXNA 4IPDA 4B3ML 2R93G 1TXYA 4OO1I 1T5XD 2B3GA 3UDGA 1O78A 1QOHA 1LABA 2XTIA 4JYAQ 1YVCA 4A93G 5CBAE 1DOKA 4YCUA 5KNDA 2KHJA 2MJ8A 3BZKA 4WORA 3GTMH 1MGSA 1SNQA 2L12A 1K0SA 3S16H 4Y7NB 1YITA 5ELFA 3TP7A 4BY1H 2GVBA 2VNUD 4RFBA 2F0EA 3K7UC 1XWEA 3G6JB 4JV5Q 4DNTB 3K5NA 3WOFA 1TWGH 2Q8RE 4JI8L 3HOWG 1CFMA 1JICA 2QW7A 4BY1G 3MXNB 1HFGA 3I4NH 5GROA 3I91A 1DONA 1DM0B 4LFCQ 2WKDA 3CKIB 4B3RL 3I4NG 3ULPA 2EY1A 1N34Q 1RJTA 1PH6A 4CGYB 1X55A 1HRJA 3J80L 1HNWL 1EOVA 2A6ED 2LMCB 1F2YA 2VS1A 3CPFA 2PCFB 3VR6A 3PIPA 2B2WC 2NN6H 2ZTEA 2WAQB 1Y1WH 1IXRA 4X62Q 5IY0A 1U0LA 2F0MA 1KHIA 3M4OH 2NVQH 1D5ZC 2A69C 4BY7H 2VL6A 3CCVA 2WFWA 4IUUA 2Z4IA 1X56A 1Z6HA 1EEID 5FJ8H 2GVAA 4MIUA 4A3CH 4LFBL 5JJKA 1SMYC 3V96A 1I50B 4BY7G 1H9RA 3GDEA 2HDLA 2J7ZA 3DMUA 2N3SA 4ZQ3A 3CXCA 5DM73 1VQLA 1Y1VH 5LMNL 1E0BA 4GNXC 4A3CG 2SEBD 4QQBX 5JJIA 2NTSA 2B2YC 4QJFA 4A3BG 4MTKA 2A5HA 1PDQA 1Y1VG 2B2TA 5AFWA 3TSSA 1BVSA 1XNRQ 4BWGB 3TZUA 3K0XA 1JWMD 4DR3L 3QG1A 3QOJA 3SEBA 1SE2A 3BS1A 4HIDA 3T1YQ 1VMCA 3D4DA 4IALA 3K6OA 4HJ7A 5K36H 1ESRA 1EIYB 2PPBC 2OEOA 4KK7A 1A15A 1D2BA 1WTOA 4BBRH 2A68C 1HR0L 2YU9H 2K6AA 2K5QA 1K83B 5K36G 5IP7H 3QIAA 1LT5D 3K7AH 3S2HH 4DK6C 4BBRG 4DV7Q 3ITPA 2ZT9C 3CCRA 2VXWA 1NNXA 2DY7A 1WJJA 5BN5A 5IP7G 4DV2L 3EQLC 4AIMA 2JXMB 3DEOA 1A3VA 2V4DA 3CW2C 4B3SQ 2E2DC 3TREA 4RA8A 1NTGA 2QGQA 3PO3H 4XDXA 4FP5D 1CHPD 4DV3L 4DR2Q 1XYIA 2AWOA 1SFOB 2KHIA 4G7HC 1JORA 3PQIA 3RD4A 1QUQA 5FLXL 4ME5A 1II3A 4DFAA 1TT2A 4DV6Q 3PO3G 3A7AB 3KDFA 2WP8J 2G9DA 2N55A 4K0KQ 2GA4B 4IJHA 3MTSA 2M2LA 1PH7A 2AWNA 1VQ8A 5IWAL 1Y8NB 2K7VA 1JJ2A 3JC66 1HNXL 1HUNA 5GADC 5I6WA 1SLJA 4ULLA 5C4XB 2Y0SE 2HIVA 2K28A 4GKKQ 3QOLA 4ZRZA 4DXFA 1PTOC 4X3UA 3G71A 1PHJA 4A3LG 1H9SB 2R7DA 2NUCA 4A3JB 3PO2B 2B2VC 3PIO3 4TVAB 1CKNB 4POGA 3ULLA 4TKOB 2Z6KC 1QUQB 2KEEA 3LGJA 1PLFA 4JYAL 4NXML 4EQ5A 4PNYA 1YNNC 3HOZH 2UU9Q 3KDFB 1F9PA 1UEAB 4R4IA 4CHTB 4GLXA 3I4MB 1SNMA 5JJZA 3M4QA 3DLLA 3IAYA 1WTXA 3FMCA 2R6GA 1RCVD 4DAYA 1XNQQ 2KECA 2E2HB 2R92B 2F0IA 3VR2A 4JV5L 1ZXTA 3N52A 4PMCA 4FF3A 4V0BA 2NWGA 3HGBA 2F0GA 4JC0A 5I4DA 1EY6A 3J7AV 5E1FA 3LNNA 1OXSC 2J0TD 2A19A 1JJGA 3OMGA 2TSSA 5CV6A 2ASBA 4GN5A 3BZCA 1YNJC 2JK8A 2EE1A 4B9WA 1QB5D 1N8RC 3CRLC 3BJUA 3S17B 1AP0A 4N8FA 4ALPA 1PH9A 1N34L 1M90C 5C3EB 3CCMA 5F2DA 4A3DH 1TS2A 3FP9A 4FVMA 2B2UC 4HR7B 1A2UA 3NWTA 1TIID 2IHFA 3U50C 2B39A 3MAQA 4DAYB 2OCEA 2K5VA 4TSSA 4LF6Q 1WTQA 4OWTB 5IGFA 1VF5C 5M3FH 3I7FA 2NVTB 4YCVA 1V43A 3JAMi 2AQ3B 1RIPA 3AU7A 3FKIH 2A69D 5FLXE 3Q23A 4JI4L 3F2DA 5M3FG 2CW0C 3HKZG 4HSVA 5KEEA 1UE1A 3S1RH 2EXZA 4TQUS 1KABA 5J22A 1ZKOA 2NVXH 1DOLA 5JEAH 3FKIG 1SMYD 2F0LA 3I73A 2AHOB 3NWSA 1VQHA 3HOWB 1WOCA 3PUYA 4RCOA 2XVSA 5JEAG 3U58A 4BY1B 2OQKA 4X66Q 1S5BD 4J1MA 2CFMA 1VQOA 1PZKD 2VB2X 4KD3A 3VYUA 1TWGB 4P71A 3HFZB 2K05A 2L5TA 3PUXA 1VDZA 3L2PA 2YV5A 2UXDQ 3VR4A 1X3GA 1RTNA 3FHWA 3T1YL 3I4NB 2NZOA 3UDIA 1Q46A 2EIFA 2R7FA 1UUPA 1FGBD 4NMZA 4DV0L 2MNAA 1ENAA 1IZ6A 5M9OA 5C0XG 1B3AA 3GTJH 2Q8IB 3HOUH 2M9VA 3OWFA 4YWLA 2A68D 1E3PA 5J39A 3RMHA 1MBYA 4IFDJ 4ODGA 2FMMA 1O7ZA 2CH4A 5JPNC 4JBKA 4IFDI 4UP7A 1TU2B 4DGZA 4FDBA 4DV7L 2O4XA 4DXGA 3HOUG 2XRQD 3M4OB 5FO7B 2NVQB 2RCFA 2K03A 4BY7B 4JBWA 2ZJRA 2RHSB 4CDCC 4DR6Q 3AMUA 4B3SL 1AW7A 4ID6A 1KAAA 1X54A 1VQDA 2K50A 3I90A 3ONAB 1WI5A 2OWOA 1SRUA 4IN3A 3GTQH 5E4XA 3MA2B 2R61A 4A3BB 5LMUQ 4DV6L 3TS0A 1NMGA 1Y1VB 3RLNA 1YHBA 3WDNA 1XX8A 1Q90A 2XNAC 2ZJQA 2NZ1D 2RDHA 3NTIA 3CCJA 1YZ6A 4KKTA 1GUOA 1WCMG 3PGZA 4LWCA 4A3GH 1HTPA 2WB1G 4A3IH 1PTOF 3T1HQ 1WTRA 1ZYRC 1SE8A 4GKKL 3D8GA 4OL7A 1E2VA 2KQ3A 4RKBA 3BVZA 4HAEA 4A3GG 3A56A 1L0XB 1PTOD 1V9PA 2F0JA 4A3IG 1LTBD 4BBRB 4OIKA 1I5FA 2YU9B 4ZAIA 2WAQE 3K7AB 3S2HB 4LF8Q 3C46A 1OXXK 1YNND 1TY2A 1GXDC 1VQIA 2BH2A 1XNQL 5EAYA 4C3HG 5C5LA 2HUGA 2NYZD 1B9NA 4RMFA 3M4YA 4R8NA 4KY7A 4C2MH 2AUKA 3AYHB 2SNSA 1O7IA 2G9HD 3BVMA 3PSIA 3PO3B 3R3OA 4JI3L 1STNA 1UE5A 1H95A 4MTNA 4Q0FA 2IY5B 1FVIA 1ET6A 5BN4A 4G7ZC 2PQEA 1D1IA 5GQOA 3CC4A 4LFAL 1YNJD 3KLSX 1I6HH 3NENA 5M5XB 4H0LC 3VDYA 5BR8Q 4LK1C 1HPCA 4L5TA 4O0AA 1ML0D 3MHBA 3OIQA 3KK7A 2D0PA 5E4WC 4DN4M 2E75C 3HKSA 1LT6D 1YIJA 5IGEA 3FVQA 1P8LA 1CI3M 2EY2A 1M8AA 4L6TB 5C4JB 2Q8TA 3F2BA 1O7YA 2F4VQ 3UE1A 3GV6A 2UXBQ 1I6VC 4DK1A 4KN7C 4TRDA 1RD9D 3H15A 1VS0A 3K5MA 3B6YA 4XQQA 4DR1Q 3PF5A 1A63A 4P72A 2K4KA 5J3BA 2KBNA 2CW0D 4M1UB 4X64Q 3DUZA 3UE0A 2SOBA 3J80i 4LF5Q 4JI7Q 1JWSD 4RAUC 4JCVE 1L1OA 2LFNA 5IT9L 3M7GA 1WTWA 5HY6A 4HJAA 4YWMA 1QE6A 3MEFA 1TS3A 5LMNW 1Z7TA 2JP1A 4A3EH 1GUTA 4K6DA 4X3TA 1HZAA 4EVOA 3M4PA 1EEFD 3R93A 5FLMG 2JA7H 3DWAA 3F2UA 2VUMH 1CZGA 2A1AA 1NR4A 3V2TA 2K14A 4YY3Q 2UXDL 4A3EG 4RG1A 1PZJD 3W3AA 3H94A 1DCZA 2JA7G 2I0QA 2VUMG 1XPUA 1CTMA 1W2BA 3LWEA 3NQTA 3SK4A 2K75A 3HZXA 4OEMB 3ND8A 1KDCA 1L1OB 4HCEA 1TWCB 3NQIA 3MXPA 3J81i 4DAVA 4RGNA 1SNOA 2WINB 1D8LA 1FNVA 1EIGA 3T13A 2ZXOA 1B1ZA 3RLOA 4KTAA 5M3FB 2J4XA 3D4WA 5IGBA 4CJ0B 3K8AA 1Q86C 1NCVA 3C1EA 4CKEA 2AUJD 2X6GA 3FKIB 4DR6L 2MFIA 1X3FA 2DNEA 1V1OA 3TN2A 2PNHA 4H02A 1BBXC 4HN7A 5DNFA 4FF1A 3TEHB 2K5HA 2NVXB 1GUNA 3PO2G 1PFSA 2N88A 2I5HA 1QG7A 3CRKC 1WD0A 2RHQB 1BUVT 4DNIA 4DV1L 1VCIA 3T51B 1IBKQ 1NMFA 2QEJC 3JAME 4M8AA 4RH6A 3QB3A 1H9JA 3NP8A 2L11A 4DR5L 3CCUA 5ELBA 4MNOA 1GKHA 1G8ZD 2DJFC 3SVMA 3T1HL 2D62A 3FEWX 4LUZA 1CQVA 4JI1L 4RGOS 1ZYRD 1RDPD 3BDLA 3TQYA 4A3FG 3ERSX 1SNCA 4O2DA 4QCLA 2PW7A 1I94Q 1RF2D 2HCCA 1YHAA 3GTJB 5EPJA 4HIMA 3HOUB 3KYHC 1ET9A 1VMPA 3E5SA 3NHHA 3OPOA 2AQ2B 3K80C 2PI2E 4MN3A 4RHSA 1WVLA 1TWFH 4HJ9A 3T56B 3P1HA 4J15A 1PTOH 2RVLA 2HHHQ 5I9PA 5KIXA 4IPCA 3L9AX 1IKLA 4IPGA 4DAMA 3EJIA 5CMDA 1BXTA 4C3IH 3D3RA 3I56A 1JC7A 2KCMA 3S15H 5EPLA 3RZDB 3RR5A 4DUYQ 2OQ0A 1GHKA 3KF8B 4CBVA 1Q8IA 3CC7A 4C3IG 2LKVA 1KXLA 5BN3A 3EBEA 1HCZA 2VQEQ 4EX5A 1K9MC 4U673 4OWWB 4DR4Q 3IFDA 3GTKH 3R2IA 4KY5A 5C4ZA 1WCMB 1AE3A 1HNZQ 3CC2A 4BS9A 3CMEA 2FFKB 5BR8L 1IL8A 3CCQA 2WB1B 5C0XJ 1KDAA 3BDCA 3H3VI 3T16A 4EQPA 1TKWB 2K33A 4A3GB 2G5DA 2F4VL 5I9OA 4F8MA 5IGCA 1FJGQ 4A3IB 3OMCA 1Q1BA 2UXBL 1VQPA 4J8QA 3TP6A 1DYQA 4BA1I 2L4NA 1EU3A 3NEMA 4XIGS 2QF7A 1EU4A 1F2ZA 2RCNA 5DLQE 5CGKA 1SE4A 1O80A 4DR1L 1TVXA 4XT1B 1KRSA 4FF4A 4X64L 4C3HB 2E5LQ 1IYUA 1SR3A 5ELCA 2NB0A 2Z6BA 3F8TA 2OTLA 4LF5L 3I72A 1MJEA 3ICEA 2XGTA 1DZ1A 2VZAA 1MD2D 1FYCA 4XXEA 1SDFA 4IUTA 2NN6G 1R4QB 2BA1A 3A8JE 4C2MB 1Y1WG 2H4OA 3S1MH 1Q1EA 4YY3L 2ID0A 4FXKC 1SJED 4KV6A 1OTCA 5FJ8G 5DM63 3RZOH 1ILPA 5CV8A 4B9XA 1S72A 5CV4A 4Z9CB 1I6HB 4K6LA 4MZ9A 2HT1A 3J81L 4DV4Q 1N36L 2YTYA 5ELOA 3EFXD 4NB3A 3M3YH 1I4HA 2KCTA 3K59A 1PA6A 3A74A 4KHVA 3QJYA 2N78A 4AQYQ 1I4QA 3D0FA 1KL9A 5G3LF 1T5EA 3A5UA 3CU7A 1STEA 4KY6A 4GNXA 1G6PA 2MGSA 1G91A 1GO3E 1SAPA 1MI2A 2MUYA 5G3LD 4OONA 4OIJA 3ZJYC 2B2YA 1B4OA 1LM0A 1VQAA 1ENFA 1CK1A 4GOPC 2I5LX 4GLVB 1BF4A 3M7NA 3SXHA 1IBKL 1QJOA 1UE6A 1KLGD 4A3EB 3GP7A 1TS5A 4RKLA 1KDBA 1BOSA 2JA7B 1PH1A 2QDBA 2VUMB 1H9SA 4DF7A 1B70B 4P2CB 1PRTC 2JEAI 2EQSA 1CKNA 2QKIC 3KF6B 2V1CC 4GNXB 3J80E 2WIIB 1X6OA 1MSHA 3CQZH 2B29A 1YJ9A 4HSPA 1JWUD 4JI5L 4KMUC 4NKLA
chains in the Genus database with same CATH topology
3GTJH 3TS2A 4LF9L 1GM5A 3HOUH 3L0OA 4IFDG 1XPRA 1T9HA 2ZTCA 1K83H 4YWLA 5C0XI 1E3PA 3CCEA 4KHPQ 3HOYG 1HNWQ 4LUOA 4NXMQ 4IFDJ 2A8VA 1Y14B 2K52A 4JBKA 4IFDI 4JOIC 4JI6L 1OXUA 1Q7YC 1QVFA 4UP7A 4DV7L 2HHHL 4FDBA 2F3IA 2JEBI 4A3MH 5FLMH 1XMQL 4LF7Q 3HOUG 2BH8A 3G48A 2UUAQ 3HOWH 2PQAB 4R4CA 5ELNA 4NXNQ 1NY4A 2AMCB 1K3RA 3F2CA 4JBWA 2ZJRA 2Z0SA 5GAHC 1IL2A 1CUKA 2RHSB 1XMOL 4DR6Q 1E1TA 4B3SL 4PMWA 3A0JA 1J5EL 2L15A 2ZJPA 4A3MG 1YEZA 1X54A 1VQDA 4L5SA 1JT8A 5HGQA 2K50A 2UUCQ 4GOPB 1PH2A 4X65Q 2Q2HA 1WI5A 4BBSG 1SFOH 4GN4B 2VQEL 4DUZQ 1SRUA 2OWOA 4R1JA 4JI7L 3GTQH 4DR4L 1VQGA 1CKMA 2VY3A 1Q12A 1C7YA 5LMUQ 4DV6L 2F52A 3KOJA 3TS0A 1K0RA 1NMGA 1HNZL 2IHEA 3RLNA 1YHBA 3HOZG 2ZJQA 2PI2A 4GKJL 1RL2A 2E2JH 4P75A 3CCJA 3CP0A 4OXPA 1YZ6A 1N36Q 3M85A 1WCMG 3EN2A 3PGZA 2Z6KA 4LWCA 4A3GH 5FLXc 2JA6H 2EXDA 2B63H 3HOVH 1FJGL 2WB1G 4POFA 2NVYH 3S24A 4A3IH 5C4XH 4DR3Q 3T1HQ 3RN5A 1SE8A 4GKKL 2Q2TA 5C44H 3CAMA 4LFCL 1X65A 4Y52H 1SN8A 3RN2A 3OW2A 1FGUA 1MIUA 2ALYB 4A3JH 3PO2H 4A3GG 1VQCA 1V9PA 2JA6G 2B63G 1S3OA 3HOVG 1EQRA 3GD7A 4A3IG 1OXTA 5C4XG 3ULJA 4JI4Q 1B8AA 2CCZA 1VQ9A 1QZHA 1I5FA 4YHHQ 4IO9A 5C44G 1HR0Q 1N32Q 1VQBA 5AJ3L 2WAQE 4KHZA 3J81j 3DM3A 2UUBQ 2ATWA 3W1GA 4A3JG 3STBD 1R9TH 4LF8Q 3HKZE 4JBJA 1OXXK 4DPGA 1M1KC 4X62L 4BXXH 4IPHA 1Q82C 1JE5A 4QL5A 2ZM6L 1Q8KA 4A3BH 4A3DG 1VQIA 2BH2A 3UDXA 1XNQL 4DK3C 5EAYA 1VQNA 2R92H 3D31A 4JI2Q 5M5WH 3KF6A 4RMFA 1HJPA 1QZGA 3I4MG 3SGIA 4BXXG 1BBWA 4C2MH 3AYHB 1SROA 1O7IA 1BKBA 3GO5A 3S2DH 4BA2I 2ES2A 2H5XA 3PSIA 4A3FH 4JBMA 2R92G 4JI3L 1EFWA 1UE5A 3GTGH 1A0IA 4DV3Q 1H95A 4LUVA 4MTNA 1IBLL 2IY5B 4HJ8A 1FVIA 4B3TL 2JA5H 3GTOH 2OTJA 3S1NH 4JI0Q 5GQOA 2BA0A 3W5OA 3CC4A 3KFUA 4LFAL 3L7ZC 4DKAC 1B7YB 2D0OA 5IYCH 1K73C 3S17H 3NENA 1DGSA 4DV0Q 1I6HH 1WFQA 3VDYA 1X3EA 1LTLA 5BR8Q 4JI5Q 4L5TA 4O0AA 2JA5G 3TRZA 4LF9Q 2MO1A 2Q2IA 2D0PA 1FL0A 4PG3A 2I5MX 2JA8H 3HKSA 1YIJA 1XNRL 1LYLA 1P8LA 3UDFA 3A5ZB 4JI6Q 3F2BA 1E1OA 2F4VQ 4AQYL 3I55A 2AKWB 1P16A 3F1ZA 3UE1A 3WWVA 5C3EG 2NVTH 2UXBQ 1KRTA 4GOPA 3KLWA 1XMQQ 3W1BA 3J81c 3E9HA 5IE8A 4OO1G 4IPDA 1I94L 2C35B 1VS0A 3H15A 3B6YA 4AH6A 3AEVA 1NBWA 1D7QA 4OWXB 4B3ML 4DR1Q 2R93G 1TXYA 4OO1I 3PF5A 1A63A 1J5EQ 2B3GA 4P72A 2K4KA 3UDGA 1PYBA 1VQKA 5J3BA 2CKZB 2KBNA 2XTIA 4JYAQ 1YVCA 4A93G 2K5NA 4X64Q 1KC8C 3PUZA 3UE0A 4YCUA 5H1SE 3J80i 1GVPA 2N8NA 2KHJA 1JMCA 3H3VH 1UEBA 3BZKA 4JI7Q 4LF5Q 2FXQA 4JCVE 1PH5A 1L1OA 4QY7A 1MKHA 2CQOA 3GTMH 5HY6A 4DR7Q 4HJAA 4YWMA 3S16H 1YITA 1Z47A 3MEFA 3J7ZC 2UXCQ 5LMNW 5M5XH 3Q8DA 4A3EH 2GVBA 4BY1H 2VNUD 3K7UC 4OX9Q 1HZAA 4JV5Q 4DUYL 2E8GA 1VQ5A 3M4PA 4R4QA 1TWGH 2JA7H 5FLMG 4JI8L 2VUMH 2A1AA 3HOWG 2YYZA 2K14A 1KQSA 1KIXA 4YY3Q 3OTOL 4A3LH 5IYBH 4DR2L 2UXDL 5IYDH 4A3EG 4BY1G 5C4JH 3MXNB 4RG1A 4KI0A 3I4NH 1HZCA 4JOIA 2VQFQ 5GROA 3PIOA 2DUDA 2JA7G 2I0QA 2VUMG 2WB1E 1C0AA 4LFCQ 4K0KL 1XPUA 5IYBG 4LF4Q 1W2BA 5IYDG 4B3RL 2K75A 3I4NG 2CWAA 4A75A 1A62A 4QGUA 3ULPA 1N34Q 1PH6A 1XPOA 3AFPA 1X55A 1L1OB 3G6EA 4KHPL 1HNWL 4UP9A 3J81i 1EOVA 2VS1A 3JAMc 3CPFA 2Y0SG 1EUJA 1EQQA 1D8LA 3PIPA 4DV5Q 1VQ6A 2ZTEA 3KJPA 3PUVA 1Y1WH 1IXRA 3RLOA 5IY0A 4X62Q 1PH8A 1U0LA 3EIVA 2UUAL 1KHIA 4NXNL 2ZM6Q 3M4OH 1NE3A 2NVQH 1E22A 1Q86C 3K8AA 1U5KA 4YCWA 4BY7H 2VL6A 2QA4A 3CCVA 2WFWA 1X56A 4DR6L 2MFIA 1X3FA 3BU2A 5FJ8H 2GVAA 3I4OA 4XTCS 2UUCL 1OXVA 2PNHA 4H02A 4A3CH 2E5LL 4LFBL 5JJKA 1E24A 3TEHB 5GAEC 2UU9L 2K5HA 4DUZL 4BY7G 4JI3Q 1G51A 1PFSA 3GDEA 4A3KH 3PO2G 1AE2A 2N3SA 2I5HA 2RHQB 3CXCA 4A76A 1VQLA 1KD1C 4DNIA 1Y1VH 5LMNL 4GNXC 4DV1L 4A3CG 3GTLH 1VCIA 1IBKQ 1NMFA 4LFAQ 2JA9A 2IX1A 3AQQA 4QQBX 4A3KG 5JJIA 4HJ5A 1VQ7A 2LSSA 4PZ6A 4PZ7A 1TWCH 4QJFA 1VQFA 4DR5L 1IBMQ 4A3BG 3CCUA 1Y1VG 4MNOA 1BVSA 1XNRQ 1GKHA 1N33Q 3K0XA 4DR3L 3T1HL 2D62A 1XTDA 1MJCA 4LUZA 2QEXA 4HIDA 3T1YQ 4JI1L 4JG2A 4HJ7A 4P73A 1EIYB 4A3FG 3TQYA 3ERSX 4IOCA 2HQLA 4O2DA 1EWIA 4DV4L 1A8VA 1V1QA 1I94Q 1AH9A 1YHAA 4BBRH 1HZBA 3KJOA 4YHHL 4HIMA 3KYHC 1HR0L 3PV0A 2YU9H 1W3SA 4B3MQ 1N32L 2UUBL 5K36G 5IP7H 3K80C 2PI2E 1PH3A 3K7AH 3S2HH 5IYCG 1CKOA 3NBHB 4KLKA 4DK6C 1TWFH 4HJ9A 4GS3A 1Q81C 4LF6L 4J15A 4BBRG 4DV7Q 2HHHQ 3OYYA 3CPWA 4IPCA 3E9IA 3CCRA 4UY8C 4IPGA 4IJLA 2JA8G 1WJJA 4DAMA 4JI2L 2GN5A 5IP7G 4DV2L 4C3IH 3I56A 2KCMA 4AIMA 3S15H 1NJIC 1L2FA 3S14H 4NPSA 4WJ4A 4R4OA 3RR5A 1XMOQ 4DUYQ 2OQ0A 3CW2C 4B3SQ 1ASZA 3TREA 1NTGA 2PMZE 2QGQA 3PO3H 3KF8B 4JI8Q 4AYBG 1SMXA 4PZ8A 3H0GH 3CC7A 3RNUA 4DV3L 4WJ3M 1KXLA 4DR2Q 3EBEA 2AWOA 2KHIA 2VQEQ 1KAWA 2LXKA 4EX5A 1VQ4A 1K9MC 1QUQA 4OWWB 4DR4Q 2Q2UA 2LXJA 4JI0L 2MO0A 3IRBA 1CSPA 3GTKH 4LNQA 3NELA 4DV6Q 1BBUA 3PO3G 2KENA 3HOXH 2E2IH 1UWVA 1AE3A 3H0GG 2WP8J 3KDFA 1HNZQ 2NZHA 3CC2A 4K0KQ 3CMEA 4X66L 5BR8L 1JJCB 4IJHA 3CCQA 1PH7A 4GKJQ 2AWNA 4B3RQ 3I2ZA 1E7ZA 5IWAL 1VQ8A 2ZTDA 1K8AC 2JE6I 5C0XJ 1YBYA 1JJ2A 1YNXA 1HZ9A 4ME3A 4C3JH 3GTPH 3JC66 3H3VI 3HOXG 1IYJB 1HNXL 2F4VL 1N9WA 5GADC 1FJGQ 2IX0A 3CD6A 2VW9A 1Q1BA 1SLJA 2UXBL 2Y0SE 2HIVA 1VQPA 3G4SA 4GKKQ 4BA1I 1TWHH 4X6AH 5IP9H 3G71A 4L5RC 3NEMA 1PHJA 3S1QH 4XIGS 1JB7A 4BBSH 2R7DA 1UE7A 4A3LG 2RCNA 5DLQE 3CCLA 2RF4A 2R7ZH 3J7A5 1J6QA 4TVAB 1CKNB 3CCSA 5M3MH 4DR1L 3ULLA 3RZDH 1PV4A 4POGA 2Z6KC 5M5YH 1CSQA 1QUQB 3LGJA 2JJQA 4JYAL 4NXML 1KRSA 1HR0W 4X64L 5IP9G 3STBC 4EQ5A 4R4TA 5AJ3Q 5E7NA 3CF5A 2E5LQ 1SR3A 4UPAA 2UU9Q 3HOZH 4LFBQ 3F8TA 3KDFB 2OTLA 4LF5L 4R4IA 4GLXA 1GD7A 2R7ZG 4LF7L 3M9BA 4LW1A 5M3MG 2YTXA 3M4QA 3DLLA 1MJEA 4DR7L 3ICEA 1S40A 4Y7NH 2R6GA 2UXCL 1WCMH 4YWKA 1VQMA 2XGTA 5LMNQ 1XNQQ 2VZAA 4DV1Q 4OX9L 4JV5L 2NN6G 2BA1A 1X9NA 1Y1WG 3U4VA 2CWPA 3S1MH 1Q1EA 1TWAH 2ID0A 2NN6I 2N49A 4JC0A 4P74A 4YY3L 4X65L 4DR5Q 1K8GA 1OXSC 4HIOA 5IT9c 2A19A 1L0WA 1OTCA 4HIKA 1VQJA 1JJGA 1YI2A 2HIXA 4GN3B 2VQFL 1IBLQ 4APVA 5FJ8G 2ASBA 4B3TQ 3RZOH 4UP8A 4GN5A 5LMUL 3BZCA 4JI1Q 2JK8A 1LUZA 1S72A 4LF4L 1N8RC 3BJUA 4ALPA 4MZ9A 1PH9A 2HT1A 4DV4Q 1N34L 3CMAA 1M90C 1N36L 2YTYA 3U4ZA 5ELOA 3CCMA 4A3DH 4NB3A 3M3YH 1C9OA 2KCTA 3FP9A 1XJVA 1VQEA 4C3HH 2IHFA 3PUWA 3U50C 4DV5L 4DAYB 2OCEA 1PA6A 2JQOA 3A74A 4L5QA 2K5VA 3I4MH 1WYDA 3K81C 4LF6Q 4OWTB 2N78A 3PCOB 4AQYQ 5M3FH 3I7FA 3D0FA 4YCVA 2MQHA 1KL9A 3A5UA 1V43A 1QVCA 3JAMi 2E2HH 1RIPA 3FKIH 4GNXA 4DV2Q 1Z9FA 3J80c 1G6PA 2WAQG 4QIWE 1EIFA 1GO3E 4JI4L 3F2DA 5M3FG 3HKZG 4OONA 1YHQA 1PVOA 1UE1A 3S1RH 3ZJYC 4TQUS 1I50H 1LM0A 1VQAA 2NVXH 4LF8L 5JJLA 4IOAA 3FKIG 3E0EA 4A4IA 4GOPC 3PF4A 2I5LX 4GLVB 3RLFA 4AYBE 2AHOB 1VQHA 3M7NA 1IBKL 1WOCA 3PUYA 1YJNA 1UE6A 1EYGA 5JEAG 3U58A 1YJWA 2OQKA 3AFQA 4X66Q 2CFMA 1PYSB 2DGYA 5C3EH 1VQOA 1ASYA 2PQAA 5JEAJ 1IBML 4P71A 1PH1A 3HFZB 5IWAQ 1G291 2IT1A 3PUXA 1N33L 3L2PA 1PH4A 1B70B 2YV5A 3OTOQ 1QVGA 1L1OC 2EQSA 1CKNA 1HH2P 3ER0A 2JEAI 1X3GA 3KF6B 2UXDQ 2V1CC 3FHWA 4GNXB 3T1YL 1HNXQ 5GAGC 1X6OA 2R93H 2NZOA 4GLAC 3UDIA 1Q46A 2EIFA 3CQZH 2R7FA 1I3QH 3HOYH 2B29A 4A93H 4DV0L 1YJ9A 2MNAA 1IZ6A 4JI5L 5C0XG 2YTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ H;  3TS2 A;  4LF9 L;  1GM5 A;  3HOU H;  3L0O A;  4IFD G;  1XPR A;  1T9H A;  2ZTC A;  1K83 H;  4YWL A;  5C0X I;  1E3P A;  3CCE A;  4KHP Q;  3HOY G;  1HNW Q;  4LUO A;  4NXM Q;  4IFD J;  2A8V A;  1Y14 B;  2K52 A;  4JBK A;  4IFD I;  4JOI C;  4JI6 L;  1OXU A;  1Q7Y C;  1QVF A;  4UP7 A;  4DV7 L;  2HHH L;  4FDB A;  2F3I A;  2JEB I;  4A3M H;  5FLM H;  1XMQ L;  4LF7 Q;  3HOU G;  2BH8 A;  3G48 A;  2UUA Q;  3HOW H;  2PQA B;  4R4C A;  5ELN A;  4NXN Q;  1NY4 A;  2AMC B;  1K3R A;  3F2C A;  4JBW A;  2ZJR A;  2Z0S A;  5GAH C;  1IL2 A;  1CUK A;  2RHS B;  1XMO L;  4DR6 Q;  1E1T A;  4B3S L;  4PMW A;  3A0J A;  1J5E L;  2L15 A;  2ZJP A;  4A3M G;  1YEZ A;  1X54 A;  1VQD A;  4L5S A;  1JT8 A;  5HGQ A;  2K50 A;  2UUC Q;  4GOP B;  1PH2 A;  4X65 Q;  2Q2H A;  1WI5 A;  4BBS G;  1SFO H;  4GN4 B;  2VQE L;  4DUZ Q;  1SRU A;  2OWO A;  4R1J A;  4JI7 L;  3GTQ H;  4DR4 L;  1VQG A;  1CKM A;  2VY3 A;  1Q12 A;  1C7Y A;  5LMU Q;  4DV6 L;  2F52 A;  3KOJ A;  3TS0 A;  1K0R A;  1NMG A;  1HNZ L;  2IHE A;  3RLN A;  1YHB A;  3HOZ G;  2ZJQ A;  2PI2 A;  4GKJ L;  1RL2 A;  2E2J H;  4P75 A;  3CCJ A;  3CP0 A;  4OXP A;  1YZ6 A;  1N36 Q;  3M85 A;  1WCM G;  3EN2 A;  3PGZ A;  2Z6K A;  4LWC A;  4A3G H;  5FLX c;  2JA6 H;  2EXD A;  2B63 H;  3HOV H;  1FJG L;  2WB1 G;  4POF A;  2NVY H;  3S24 A;  4A3I H;  5C4X H;  4DR3 Q;  3T1H Q;  3RN5 A;  1SE8 A;  4GKK L;  2Q2T A;  5C44 H;  3CAM A;  4LFC L;  1X65 A;  4Y52 H;  1SN8 A;  3RN2 A;  3OW2 A;  1FGU A;  1MIU A;  2ALY B;  4A3J H;  3PO2 H;  4A3G G;  1VQC A;  1V9P A;  2JA6 G;  2B63 G;  1S3O A;  3HOV G;  1EQR A;  3GD7 A;  4A3I G;  1OXT A;  5C4X G;  3ULJ A;  4JI4 Q;  1B8A A;  2CCZ A;  1VQ9 A;  1QZH A;  1I5F A;  4YHH Q;  4IO9 A;  5C44 G;  1HR0 Q;  1N32 Q;  1VQB A;  5AJ3 L;  2WAQ E;  4KHZ A;  3J81 j;  3DM3 A;  2UUB Q;  2ATW A;  3W1G A;  4A3J G;  3STB D;  1R9T H;  4LF8 Q;  3HKZ E;  4JBJ A;  1OXX K;  4DPG A;  1M1K C;  4X62 L;  4BXX H;  4IPH A;  1Q82 C;  1JE5 A;  4QL5 A;  2ZM6 L;  1Q8K A;  4A3B H;  4A3D G;  1VQI A;  2BH2 A;  3UDX A;  1XNQ L;  4DK3 C;  5EAY A;  1VQN A;  2R92 H;  3D31 A;  4JI2 Q;  5M5W H;  3KF6 A;  4RMF A;  1HJP A;  1QZG A;  3I4M G;  3SGI A;  4BXX G;  1BBW A;  4C2M H;  3AYH B;  1SRO A;  1O7I A;  1BKB A;  3GO5 A;  3S2D H;  4BA2 I;  2ES2 A;  2H5X A;  3PSI A;  4A3F H;  4JBM A;  2R92 G;  4JI3 L;  1EFW A;  1UE5 A;  3GTG H;  1A0I A;  4DV3 Q;  1H95 A;  4LUV A;  4MTN A;  1IBL L;  2IY5 B;  4HJ8 A;  1FVI A;  4B3T L;  2JA5 H;  3GTO H;  2OTJ A;  3S1N H;  4JI0 Q;  5GQO A;  2BA0 A;  3W5O A;  3CC4 A;  3KFU A;  4LFA L;  3L7Z C;  4DKA C;  1B7Y B;  2D0O A;  5IYC H;  1K73 C;  3S17 H;  3NEN A;  1DGS A;  4DV0 Q;  1I6H H;  1WFQ A;  3VDY A;  1X3E A;  1LTL A;  5BR8 Q;  4JI5 Q;  4L5T A;  4O0A A;  2JA5 G;  3TRZ A;  4LF9 Q;  2MO1 A;  2Q2I A;  2D0P A;  1FL0 A;  4PG3 A;  2I5M X;  2JA8 H;  3HKS A;  1YIJ A;  1XNR L;  1LYL A;  1P8L A;  3UDF A;  3A5Z B;  4JI6 Q;  3F2B A;  1E1O A;  2F4V Q;  4AQY L;  3I55 A;  2AKW B;  1P16 A;  3F1Z A;  3UE1 A;  3WWV A;  5C3E G;  2NVT H;  2UXB Q;  1KRT A;  4GOP A;  3KLW A;  1XMQ Q;  3W1B A;  3J81 c;  3E9H A;  5IE8 A;  4OO1 G;  4IPD A;  1I94 L;  2C35 B;  1VS0 A;  3H15 A;  3B6Y A;  4AH6 A;  3AEV A;  1NBW A;  1D7Q A;  4OWX B;  4B3M L;  4DR1 Q;  2R93 G;  1TXY A;  4OO1 I;  3PF5 A;  1A63 A;  1J5E Q;  2B3G A;  4P72 A;  2K4K A;  3UDG A;  1PYB A;  1VQK A;  5J3B A;  2CKZ B;  2KBN A;  2XTI A;  4JYA Q;  1YVC A;  4A93 G;  2K5N A;  4X64 Q;  1KC8 C;  3PUZ A;  3UE0 A;  4YCU A;  5H1S E;  3J80 i;  1GVP A;  2N8N A;  2KHJ A;  1JMC A;  3H3V H;  1UEB A;  3BZK A;  4JI7 Q;  4LF5 Q;  2FXQ A;  4JCV E;  1PH5 A;  1L1O A;  4QY7 A;  1MKH A;  2CQO A;  3GTM H;  5HY6 A;  4DR7 Q;  4HJA A;  4YWM A;  3S16 H;  1YIT A;  1Z47 A;  3MEF A;  3J7Z C;  2UXC Q;  5LMN W;  5M5X H;  3Q8D A;  4A3E H;  2GVB A;  4BY1 H;  2VNU D;  3K7U C;  4OX9 Q;  1HZA A;  4JV5 Q;  4DUY L;  2E8G A;  1VQ5 A;  3M4P A;  4R4Q A;  1TWG H;  2JA7 H;  5FLM G;  4JI8 L;  2VUM H;  2A1A A;  3HOW G;  2YYZ A;  2K14 A;  1KQS A;  1KIX A;  4YY3 Q;  3OTO L;  4A3L H;  5IYB H;  4DR2 L;  2UXD L;  5IYD H;  4A3E G;  4BY1 G;  5C4J H;  3MXN B;  4RG1 A;  4KI0 A;  3I4N H;  1HZC A;  4JOI A;  2VQF Q;  5GRO A;  3PIO A;  2DUD A;  2JA7 G;  2I0Q A;  2VUM G;  2WB1 E;  1C0A A;  4LFC Q;  4K0K L;  1XPU A;  5IYB G;  4LF4 Q;  1W2B A;  5IYD G;  4B3R L;  2K75 A;  3I4N G;  2CWA A;  4A75 A;  1A62 A;  4QGU A;  3ULP A;  1N34 Q;  1PH6 A;  1XPO A;  3AFP A;  1X55 A;  1L1O B;  3G6E A;  4KHP L;  1HNW L;  4UP9 A;  3J81 i;  1EOV A;  2VS1 A;  3JAM c;  3CPF A;  2Y0S G;  1EUJ A;  1EQQ A;  1D8L A;  3PIP A;  4DV5 Q;  1VQ6 A;  2ZTE A;  3KJP A;  3PUV A;  1Y1W H;  1IXR A;  3RLO A;  5IY0 A;  4X62 Q;  1PH8 A;  1U0L A;  3EIV A;  2UUA L;  1KHI A;  4NXN L;  2ZM6 Q;  3M4O H;  1NE3 A;  2NVQ H;  1E22 A;  1Q86 C;  3K8A A;  1U5K A;  4YCW A;  4BY7 H;  2VL6 A;  2QA4 A;  3CCV A;  2WFW A;  1X56 A;  4DR6 L;  2MFI A;  1X3F A;  3BU2 A;  5FJ8 H;  2GVA A;  3I4O A;  4XTC S;  2UUC L;  1OXV A;  2PNH A;  4H02 A;  4A3C H;  2E5L L;  4LFB L;  5JJK A;  1E24 A;  3TEH B;  5GAE C;  2UU9 L;  2K5H A;  4DUZ L;  4BY7 G;  4JI3 Q;  1G51 A;  1PFS A;  3GDE A;  4A3K H;  3PO2 G;  1AE2 A;  2N3S A;  2I5H A;  2RHQ B;  3CXC A;  4A76 A;  1VQL A;  1KD1 C;  4DNI A;  1Y1V H;  5LMN L;  4GNX C;  4DV1 L;  4A3C G;  3GTL H;  1VCI A;  1IBK Q;  1NMF A;  4LFA Q;  2JA9 A;  2IX1 A;  3AQQ A;  4QQB X;  4A3K G;  5JJI A;  4HJ5 A;  1VQ7 A;  2LSS A;  4PZ6 A;  4PZ7 A;  1TWC H;  4QJF A;  1VQF A;  4DR5 L;  1IBM Q;  4A3B G;  3CCU A;  1Y1V G;  4MNO A;  1BVS A;  1XNR Q;  1GKH A;  1N33 Q;  3K0X A;  4DR3 L;  3T1H L;  2D62 A;  1XTD A;  1MJC A;  4LUZ A;  2QEX A;  4HID A;  3T1Y Q;  4JI1 L;  4JG2 A;  4HJ7 A;  4P73 A;  1EIY B;  4A3F G;  3TQY A;  3ERS X;  4IOC A;  2HQL A;  4O2D A;  1EWI A;  4DV4 L;  1A8V A;  1V1Q A;  1I94 Q;  1AH9 A;  1YHA A;  4BBR H;  1HZB A;  3KJO A;  4YHH L;  4HIM A;  3KYH C;  1HR0 L;  3PV0 A;  2YU9 H;  1W3S A;  4B3M Q;  1N32 L;  2UUB L;  5K36 G;  5IP7 H;  3K80 C;  2PI2 E;  1PH3 A;  3K7A H;  3S2H H;  5IYC G;  1CKO A;  3NBH B;  4KLK A;  4DK6 C;  1TWF H;  4HJ9 A;  4GS3 A;  1Q81 C;  4LF6 L;  4J15 A;  4BBR G;  4DV7 Q;  2HHH Q;  3OYY A;  3CPW A;  4IPC A;  3E9I A;  3CCR A;  4UY8 C;  4IPG A;  4IJL A;  2JA8 G;  1WJJ A;  4DAM A;  4JI2 L;  2GN5 A;  5IP7 G;  4DV2 L;  4C3I H;  3I56 A;  2KCM A;  4AIM A;  3S15 H;  1NJI C;  1L2F A;  3S14 H;  4NPS A;  4WJ4 A;  4R4O A;  3RR5 A;  1XMO Q;  4DUY Q;  2OQ0 A;  3CW2 C;  4B3S Q;  1ASZ A;  3TRE A;  1NTG A;  2PMZ E;  2QGQ A;  3PO3 H;  3KF8 B;  4JI8 Q;  4AYB G;  1SMX A;  4PZ8 A;  3H0G H;  3CC7 A;  3RNU A;  4DV3 L;  4WJ3 M;  1KXL A;  4DR2 Q;  3EBE A;  2AWO A;  2KHI A;  2VQE Q;  1KAW A;  2LXK A;  4EX5 A;  1VQ4 A;  1K9M C;  1QUQ A;  4OWW B;  4DR4 Q;  2Q2U A;  2LXJ A;  4JI0 L;  2MO0 A;  3IRB A;  1CSP A;  3GTK H;  4LNQ A;  3NEL A;  4DV6 Q;  1BBU A;  3PO3 G;  2KEN A;  3HOX H;  2E2I H;  1UWV A;  1AE3 A;  3H0G G;  2WP8 J;  3KDF A;  1HNZ Q;  2NZH A;  3CC2 A;  4K0K Q;  3CME A;  4X66 L;  5BR8 L;  1JJC B;  4IJH A;  3CCQ A;  1PH7 A;  4GKJ Q;  2AWN A;  4B3R Q;  3I2Z A;  1E7Z A;  5IWA L;  1VQ8 A;  2ZTD A;  1K8A C;  2JE6 I;  5C0X J;  1YBY A;  1JJ2 A;  1YNX A;  1HZ9 A;  4ME3 A;  4C3J H;  3GTP H;  3JC6 6;  3H3V I;  3HOX G;  1IYJ B;  1HNX L;  2F4V L;  1N9W A;  5GAD C;  1FJG Q;  2IX0 A;  3CD6 A;  2VW9 A;  1Q1B A;  1SLJ A;  2UXB L;  2Y0S E;  2HIV A;  1VQP A;  3G4S A;  4GKK Q;  4BA1 I;  1TWH H;  4X6A H;  5IP9 H;  3G71 A;  4L5R C;  3NEM A;  1PHJ A;  3S1Q H;  4XIG S;  1JB7 A;  4BBS H;  2R7D A;  1UE7 A;  4A3L G;  2RCN A;  5DLQ E;  3CCL A;  2RF4 A;  2R7Z H;  3J7A 5;  1J6Q A;  4TVA B;  1CKN B;  3CCS A;  5M3M H;  4DR1 L;  3ULL A;  3RZD H;  1PV4 A;  4POG A;  2Z6K C;  5M5Y H;  1CSQ A;  1QUQ B;  3LGJ A;  2JJQ A;  4JYA L;  4NXM L;  1KRS A;  1HR0 W;  4X64 L;  5IP9 G;  3STB C;  4EQ5 A;  4R4T A;  5AJ3 Q;  5E7N A;  3CF5 A;  2E5L Q;  1SR3 A;  4UPA A;  2UU9 Q;  3HOZ H;  4LFB Q;  3F8T A;  3KDF B;  2OTL A;  4LF5 L;  4R4I A;  4GLX A;  1GD7 A;  2R7Z G;  4LF7 L;  3M9B A;  4LW1 A;  5M3M G;  2YTX A;  3M4Q A;  3DLL A;  1MJE A;  4DR7 L;  3ICE A;  1S40 A;  4Y7N H;  2R6G A;  2UXC L;  1WCM H;  4YWK A;  1VQM A;  2XGT A;  5LMN Q;  1XNQ Q;  2VZA A;  4DV1 Q;  4OX9 L;  4JV5 L;  2NN6 G;  2BA1 A;  1X9N A;  1Y1W G;  3U4V A;  2CWP A;  3S1M H;  1Q1E A;  1TWA H;  2ID0 A;  2NN6 I;  2N49 A;  4JC0 A;  4P74 A;  4YY3 L;  4X65 L;  4DR5 Q;  1K8G A;  1OXS C;  4HIO A;  5IT9 c;  2A19 A;  1L0W A;  1OTC A;  4HIK A;  1VQJ A;  1JJG A;  1YI2 A;  2HIX A;  4GN3 B;  2VQF L;  1IBL Q;  4APV A;  5FJ8 G;  2ASB A;  4B3T Q;  3RZO H;  4UP8 A;  4GN5 A;  5LMU L;  3BZC A;  4JI1 Q;  2JK8 A;  1LUZ A;  1S72 A;  4LF4 L;  1N8R C;  3BJU A;  4ALP A;  4MZ9 A;  1PH9 A;  2HT1 A;  4DV4 Q;  1N34 L;  3CMA A;  1M90 C;  1N36 L;  2YTY A;  3U4Z A;  5ELO A;  3CCM A;  4A3D H;  4NB3 A;  3M3Y H;  1C9O A;  2KCT A;  3FP9 A;  1XJV A;  1VQE A;  4C3H H;  2IHF A;  3PUW A;  3U50 C;  4DV5 L;  4DAY B;  2OCE A;  1PA6 A;  2JQO A;  3A74 A;  4L5Q A;  2K5V A;  3I4M H;  1WYD A;  3K81 C;  4LF6 Q;  4OWT B;  2N78 A;  3PCO B;  4AQY Q;  5M3F H;  3I7F A;  3D0F A;  4YCV A;  2MQH A;  1KL9 A;  3A5U A;  1V43 A;  1QVC A;  3JAM i;  2E2H H;  1RIP A;  3FKI H;  4GNX A;  4DV2 Q;  1Z9F A;  3J80 c;  1G6P A;  2WAQ G;  4QIW E;  1EIF A;  1GO3 E;  4JI4 L;  3F2D A;  5M3F G;  3HKZ G;  4OON A;  1YHQ A;  1PVO A;  1UE1 A;  3S1R H;  3ZJY C;  4TQU S;  1I50 H;  1LM0 A;  1VQA A;  2NVX H;  4LF8 L;  5JJL A;  4IOA A;  3FKI G;  3E0E A;  4A4I A;  4GOP C;  3PF4 A;  2I5L X;  4GLV B;  3RLF A;  4AYB E;  2AHO B;  1VQH A;  3M7N A;  1IBK L;  1WOC A;  3PUY A;  1YJN A;  1UE6 A;  1EYG A;  5JEA G;  3U58 A;  1YJW A;  2OQK A;  3AFQ A;  4X66 Q;  2CFM A;  1PYS B;  2DGY A;  5C3E H;  1VQO A;  1ASY A;  2PQA A;  5JEA J;  1IBM L;  4P71 A;  1PH1 A;  3HFZ B;  5IWA Q;  1G29 1;  2IT1 A;  3PUX A;  1N33 L;  3L2P A;  1PH4 A;  1B70 B;  2YV5 A;  3OTO Q;  1QVG A;  1L1O C;  2EQS A;  1CKN A;  1HH2 P;  3ER0 A;  2JEA I;  1X3G A;  3KF6 B;  2UXD Q;  2V1C C;  3FHW A;  4GNX B;  3T1Y L;  1HNX Q;  5GAG C;  1X6O A;  2R93 H;  2NZO A;  4GLA C;  3UDI A;  1Q46 A;  2EIF A;  3CQZ H;  2R7F A;  1I3Q H;  3HOY H;  2B29 A;  4A93 H;  4DV0 L;  1YJ9 A;  2MNA A;  1IZ6 A;  4JI5 L;  5C0X G;  2YTV A; 
#chains in the Genus database with same CATH topology
 3HP3 A;  3L0O A;  2ZTC A;  1LV9 A;  1SJH D;  4KHP Q;  2HD3 A;  4LUO A;  1Y14 B;  3P7J A;  1EY4 A;  4JOI C;  1OXU A;  2HHH L;  1PFM A;  4A3M H;  3TP8 A;  1XMQ L;  1SYG A;  4LF7 Q;  5DEH A;  2UUA Q;  3VYR A;  1VF7 A;  2AMC B;  1RHP A;  2DNC A;  2EOT A;  2X6L A;  2F0P A;  2Z0S A;  3NE5 B;  1CUK A;  5FK9 C;  4ZUI A;  1E1T A;  1FNU A;  1XTC D;  5FO9 B;  4A3M G;  2ZJP A;  4GOP B;  3J81 E;  4X65 Q;  4GN4 B;  5KNC A;  2VQE L;  4DUZ Q;  4DR4 L;  1F9Q A;  4IQZ A;  1CKM A;  1B53 A;  2K04 A;  1C7Y A;  1L0Y B;  2F52 A;  3KOJ A;  1K0R A;  1HNZ L;  1A6X A;  3D6W A;  3R2T A;  3HOZ G;  1EOT A;  2PI2 A;  2F0O A;  1TS4 A;  3L3O C;  1BCP C;  4P75 A;  3S2D B;  4DNR B;  3EN2 A;  4A3F B;  2Z6K A;  3C1F A;  3TME A;  2JA6 H;  3UI2 A;  2B63 H;  1FJG L;  3VR3 A;  3GTG B;  4POF A;  2NVY H;  2KED A;  2KCN A;  1C4Q A;  4LFC L;  1XXG A;  1SN8 A;  1EY8 A;  1LO5 D;  3OW2 A;  2ALY B;  1VQC A;  2JA6 G;  2B63 G;  3H09 A;  1EZ6 A;  2CCZ A;  1QZH A;  4YHH Q;  4IO9 A;  1N32 Q;  2BDO A;  1WTP A;  1HUM A;  4QIW B;  3DM3 A;  2UUB Q;  5C5M A;  3A54 A;  4F7X A;  3HKZ E;  4DPG A;  5JVG 3;  1M1K C;  1TWF B;  4X62 L;  1PTO B;  1C48 A;  2DJG C;  2F1M A;  4ILW A;  4A3D G;  2EYJ A;  4KJN A;  4DK3 C;  1VQN A;  2A6H C;  2KJX A;  3D31 A;  4JI2 Q;  5M5W H;  1I4R A;  4C3I B;  3DEP A;  1QZG A;  3SGI A;  1SRO A;  3GO5 A;  2KHS A;  4MHE A;  4ZLT F;  3ZYY X;  3NUC A;  4JBM A;  5EJW A;  1DXM A;  2F4I A;  2B2U A;  5D65 A;  4CDD C;  3QWN A;  1SBB B;  4DAP A;  3GTO H;  2F3V A;  4RHR A;  3S1N H;  3GTM B;  1RTO A;  2BA0 A;  3KFU A;  3S16 B;  1EY9 A;  1I4G A;  1B7Y B;  5IYC H;  1DGS A;  1WFQ A;  5FKA C;  1Y8O B;  1LTL A;  3TRZ A;  4LF9 Q;  3TBI B;  2RDG A;  2K32 A;  2I5M X;  2JA8 H;  1XNR L;  4OO1 H;  3UDF A;  2BOS A;  4JI6 Q;  1W6K A;  5CV5 A;  4AQY L;  3I55 A;  4B08 A;  1P16 A;  1SNP A;  5EKK A;  4O42 A;  4RGM A;  3K0Y A;  3P20 A;  1QWY A;  1JCK B;  2Z1C A;  3KLS A;  5IE8 A;  4OO1 G;  3AB9 A;  4JPB W;  4CDF C;  4AH6 A;  3AEV A;  1NBW A;  2ICI A;  4OWX B;  5IOD A;  3NSW A;  1J5E Q;  2ENB A;  1VQK A;  2KVM A;  5CC4 A;  2CKZ B;  2K5N A;  1KC8 C;  1PXU A;  1ESF A;  1GVP A;  3FRP B;  1LTR D;  3VA5 A;  1JMC A;  3H3V H;  1UEB A;  2FXQ A;  1PH5 A;  1ICF B;  1X3Q A;  1Y1W B;  1PMR A;  2UXC Q;  5EPK A;  3J7Z C;  1B44 D;  2F0W A;  2R3Z A;  4QMG A;  2E8G A;  5JPM C;  1VQ5 A;  4WFN 3;  4DU9 A;  2OT2 A;  1CZW A;  3S1M B;  2ZXR A;  5IGD A;  1EQT A;  5IYB H;  4DR2 L;  3FPU B;  3K5O A;  3IFT A;  1GOZ A;  4KI0 A;  2I07 B;  1HZC A;  1HQM C;  2VQF Q;  3PIO A;  2DUD A;  3RZO B;  3OWE B;  2XRS D;  2WB1 E;  4K0K L;  2H1E A;  3GV3 A;  3BYT B;  5IYB G;  4LF4 Q;  4ZYS A;  4KHP L;  3M3Y B;  2XIW A;  4CKC A;  3JAM c;  1EUJ A;  5FOB B;  1EQQ A;  3PMF A;  3V05 A;  2XSC A;  3PUV A;  1PH8 A;  2UUA L;  1STG A;  2ZM6 Q;  4F87 A;  1K8O A;  5KNB A;  1B50 A;  1X3P A;  1U5K A;  4YCW A;  4J6H A;  2QA4 A;  4S3S A;  2F0N A;  2L9H A;  3I4O A;  4XTC S;  1OXV A;  3K5L A;  3A7L A;  5GAE C;  2UU9 L;  4DUZ L;  4A3K H;  1AE2 A;  2MPM A;  2QIL A;  4K14 A;  1QNK A;  3VA7 A;  3NBH A;  1G2S A;  2C5C A;  3SDZ A;  2IX1 A;  4A3K G;  1SYF A;  2EVB A;  2LSS A;  3WOE A;  4CJ1 B;  5LHY 1;  3Q24 A;  1IBM Q;  4KD4 A;  2EY6 A;  4IUN A;  1N33 Q;  2F0D A;  1SYB A;  1U4R A;  1XTD A;  4ABN A;  2O5J C;  3Q6S A;  3CQZ B;  1S5C D;  2Z9H A;  1SEB D;  4IOC A;  1AH9 A;  2PZW A;  1HZB A;  1EYC A;  3KJO A;  5JOB A;  4YHH L;  1N32 L;  1W3S A;  5ELD A;  4B3M Q;  2UUB L;  4FYD A;  1S5D D;  3IL8 A;  1CKO A;  3NBH B;  4GS3 A;  4LF6 L;  3U9O A;  2HCI A;  3FPP A;  2RDF A;  4UDU C;  4A3M B;  3E9I A;  4UY8 C;  1KNA A;  4X3S A;  1HTL D;  1BDO A;  1GHJ A;  4JI2 L;  1LTG D;  2GN5 A;  2LS0 1;  3FDT A;  1ILQ A;  1AEX A;  2A6H D;  1NJI C;  1L2F A;  4NDX A;  4R4O A;  1XMO Q;  4XQJ A;  5JAV A;  1JOO A;  1JE4 A;  4JI8 Q;  5I2Y A;  4AYB G;  4PZ8 A;  4WJ3 M;  3HOZ B;  2P5Z X;  1TY0 A;  4IUQ A;  1U9R A;  2Q2U A;  2LXJ A;  1JOK A;  3IRB A;  4QUF A;  2F0H A;  3HOX H;  1UWV A;  3T53 B;  2NZH A;  4X66 L;  1JJC B;  4GKJ Q;  2K1B A;  4B3R Q;  1E7Z A;  2A6E C;  2ZTD A;  1YBY A;  3NBI A;  1HZ9 A;  4PV1 C;  4C3J H;  3GTP H;  3VYT A;  1ZEQ X;  3HOX G;  1IYJ B;  2JSO A;  2JA6 B;  1N9W A;  2B63 B;  2IX0 A;  3CD6 A;  1ONL A;  2VW9 A;  1LAC A;  1CT1 D;  3G4S A;  4X6A H;  5IP9 H;  4C3J G;  5EBC A;  3S1Q H;  4BBS H;  1UE7 A;  2RF4 A;  2R7Z H;  3E0J A;  1PV4 A;  5M3M H;  3A8K E;  5M5Y H;  4H13 C;  4A3D B;  2JJQ A;  1HR0 W;  5IP9 G;  3STB C;  4C1N I;  4R4T A;  4LFB Q;  5E7N A;  4UPA A;  3BDO A;  2D2C C;  1GD7 A;  2R7Z G;  3M9B A;  5M3M G;  5I6Y A;  1EL0 A;  2UXC L;  4YWK A;  2BE5 C;  3H3V C;  3BYY B;  4JW0 A;  3PIP 3;  1BQQ T;  5LMN Q;  3E3X A;  4HED A;  5M5W B;  1TR5 A;  1U4M A;  5I2X A;  2KCC A;  1V1P A;  1TWA H;  3S1R B;  4C1N K;  1K8G A;  2EYO A;  5T1I A;  3LWU A;  4F88 A;  4HIO A;  1YI2 A;  2HIX A;  4GN3 B;  2VQF L;  1STA A;  2AQ1 B;  5LMU L;  3GTO B;  3S1N B;  2F0K A;  2B8F A;  4LF4 L;  1AN8 A;  3CMA A;  3U4Z A;  3N6R A;  2F03 A;  4QUC A;  1C9O A;  5C4H A;  1VQE A;  2JA8 B;  1G2T A;  4UAI A;  1LT4 D;  2JQO A;  4L5Q A;  3I4M H;  3NTK A;  3W2D A;  1WYD A;  1CHQ D;  3PCO B;  1K8M A;  3KF8 A;  3HG9 A;  4KKS A;  3A55 A;  1V1P B;  1QVC A;  2E2H H;  5LL6 X;  1Y69 U;  4DV2 Q;  3J80 c;  2F3W A;  5IT9 E;  4QIW E;  4XT3 B;  2EJF C;  4CJ2 C;  4LF8 L;  5JJL A;  4IOA A;  1M4V A;  5FO8 B;  2PMZ B;  3J7A F;  3E0E A;  2IW3 A;  1B3Q A;  4R9W A;  4KKU A;  1H9K A;  3RLF A;  4L63 B;  2A74 C;  3D4R A;  1EZ8 A;  1NUC A;  3AFQ A;  1PYS B;  5C3E H;  4H44 C;  5KGU A;  2PQA A;  5JEA J;  1IBM L;  5NUC A;  5IWA Q;  1G29 1;  2IT1 A;  1N33 L;  3T4A C;  3OTO Q;  1EYA A;  1QVG A;  1S4Z A;  1HH2 P;  2NBF A;  3ER0 A;  1HHV A;  1HNX Q;  1LTS D;  3GTQ B;  5IGG A;  5GAG C;  4IFD H;  2R93 H;  4GLA C;  1I3Q H;  3HOY H;  4A93 H;  1SXT A;  4NW2 A;  5A2Q L;  2L1B A;  2CHB D;  5IIF A;  4HJ5 A;  2OF1 A;  3TS2 A;  1GM5 A;  4IFD G;  1T9H A;  1JR0 D;  2JYO A;  5C0X I;  3HOY G;  2SNM A;  4NXM Q;  1F77 A;  2K52 A;  1Q7Y C;  4I7A A;  2F3I A;  1A3U A;  4R8I A;  2BH8 A;  3G48 A;  3HOW H;  2PQA B;  4R4C A;  5ELN A;  4NXN Q;  1NY4 A;  1FR3 A;  3NXW A;  3OW7 A;  5CBE E;  5GAH C;  5CR3 A;  1XMO L;  3MEH A;  1YEZ A;  3R8B A;  2UUC Q;  4X3K A;  2WKC A;  3CHB D;  4JI7 L;  4A3K B;  1I4P A;  2VY3 A;  1JB3 A;  1PFN A;  1J8I A;  1E2W A;  2F0V A;  3I70 A;  4GKJ L;  2E2J H;  4CKB A;  3KUP A;  4OXP A;  4IUR A;  3M85 A;  2E74 C;  2CVR A;  2M00 A;  2X69 A;  2K5D A;  1K3B C;  5FLX c;  3DXJ C;  3HOV H;  2F0T A;  3S24 A;  3RN5 A;  2B2W A;  5KRU A;  5C44 H;  3CAM A;  4N8X 1;  3SK8 A;  2KA7 A;  1X65 A;  4ZK9 B;  3RN2 A;  1SYD A;  5COR A;  1EY0 A;  3HOV G;  3BG3 A;  2OXP A;  3ULJ A;  2B2T C;  4JI4 Q;  1B2T A;  1VQ9 A;  1HXY D;  4XYO A;  5IOC A;  5ELE A;  5C44 G;  4G57 A;  4QB4 A;  3I4L A;  2ATW A;  3W1G A;  4HTH A;  5KYL A;  3STB D;  1S5F D;  3QO2 A;  4JBJ A;  1R9T H;  4KN4 C;  1Q82 C;  1JE5 A;  4RCN A;  1RKN A;  1JOQ A;  1Q8K A;  3BVG A;  4A3B H;  4AYB B;  2BE5 D;  1PFB A;  3KF6 A;  1HJP A;  5L37 A;  4BA2 I;  1BKB A;  1CA6 A;  1IW7 C;  5A2Q E;  1SYC A;  1LTI D;  3C3L A;  2FIN B;  4HJ8 A;  3I3C A;  2JA5 H;  1A3T A;  1D6E C;  4JI0 Q;  3HOX B;  2D0O A;  1K73 C;  2EPB A;  4DV0 Q;  1X3E A;  2JA5 G;  2ZXP A;  2E76 C;  2Q2I A;  3ERO A;  1FL0 A;  5EKI A;  5CV9 A;  5E3F A;  4C3J B;  3GTP B;  4JVZ A;  1R4P B;  1E1O A;  2RBM A;  3NTH A;  2AKW B;  1F2M A;  1KRT A;  2NTT A;  3KLW A;  3SK5 A;  4GOP A;  3W1B A;  5CV7 A;  5D3D A;  1DOM A;  1C8C A;  3S1Q B;  1I94 L;  2C35 B;  4BBS B;  1D7Q A;  2RQX A;  2R7Z B;  5M3M B;  2ICE C;  5M5Y B;  1BR9 A;  2RKS A;  1D1K A;  1PYB A;  3PUZ A;  3SHL A;  5H1S E;  2RA4 A;  2N8N A;  1PYW D;  1B9M A;  1BO0 A;  4QY7 A;  1MKH A;  2CQO A;  4DR7 Q;  4QF4 A;  1Z47 A;  3O13 A;  2JN4 A;  1FD7 D;  5M5X H;  3Q8D A;  2CQA A;  4OX9 Q;  4DUY L;  4R4Q A;  3MFG A;  4KJO A;  1KTK A;  1STB A;  2YYZ A;  1KQS A;  1TWA B;  1KIX A;  3OTO L;  1GJX A;  4A3L H;  5IYD H;  1SND A;  5C4J H;  1NAP A;  1ROD A;  3H91 A;  4JOI A;  2MP1 A;  2PO4 A;  2DY8 A;  3GQB A;  3U9S A;  1C0A A;  1EWH A;  2IJ0 A;  3K58 A;  5IYD G;  5EQ0 A;  4C56 C;  5D14 A;  2CWA A;  4A75 A;  1A62 A;  4QGU A;  1WD1 A;  1XPO A;  3AFP A;  2B2V A;  1PRT B;  3G6E A;  2QDL A;  3TP5 A;  4UP9 A;  3K57 A;  1JQY D;  2Y0S G;  4DV5 Q;  1VQ6 A;  3KJP A;  1F2L A;  4CDE C;  3EIV A;  4NXN L;  1NE3 A;  1FNW A;  5EBD A;  1E22 A;  2L0C A;  3X3N A;  3MFY A;  2F0Q A;  5HGT A;  3BU2 A;  4EGV A;  1LLR D;  1HFN A;  2UUC L;  1AFP A;  2EJG C;  3VR5 A;  2O2L D;  3HRZ C;  2E5L L;  3LX0 A;  1E24 A;  4JI3 Q;  1G51 A;  1EWC A;  2Z4H A;  3OHX C;  4A76 A;  4ZUJ A;  1KD1 C;  1U4L A;  3GTL H;  4LFA Q;  1OO9 B;  2JA9 A;  4IZ8 A;  3AQQ A;  2C9O A;  1ENC A;  1LTA D;  3NPP A;  1VQ7 A;  3S15 B;  3VYS A;  4PZ6 A;  3BZD B;  3TDQ A;  4PZ7 A;  1TWC H;  1VQF A;  4NP5 A;  4K5V A;  3RUZ A;  1X32 A;  1EIH A;  1Y8P B;  5C3W A;  5JVH 3;  1MJC A;  2QEX A;  2R93 B;  4JG2 A;  3GTK B;  3I8Z A;  4P73 A;  4K5W A;  1I3Q B;  3HOY B;  1BCP B;  2EYF A;  4A93 B;  3SE0 A;  2HDM A;  2HQL A;  1EWI A;  2EYP A;  4DV4 L;  1A8V A;  1V1Q A;  2F0S A;  3PV0 A;  1SYE A;  3OOC A;  1PH3 A;  5IYC G;  2RSO A;  4KLK A;  2WAC A;  1Q81 C;  1EFI D;  3HS0 C;  3E6Z X;  1MHW C;  3OYY A;  3CPW A;  2RSN A;  4IJL A;  2JA8 G;  1EY7 A;  3S14 H;  4NPS A;  4WJ4 A;  1LT3 D;  2EY5 A;  4FO2 A;  1ASZ A;  2FMC A;  2PMZ E;  1D5X C;  5HUR A;  3DWQ A;  1IW7 D;  1SMX A;  3H0G H;  3RNU A;  5EKL A;  2F0U A;  3HEJ A;  5C0X H;  1KAW A;  2LXK A;  1VQ4 A;  4JI0 L;  2MO0 A;  1CSP A;  4LNQ A;  3NEL A;  1BBU A;  1IKM A;  2KEN A;  2E2I H;  3H0G G;  1SSO A;  2K01 A;  1BNZ A;  2E2J B;  1H9M A;  1PRT F;  3I2Z A;  5J1Z A;  1K8A C;  2JE6 I;  1YNX A;  4ME3 A;  2EYL A;  2KUM A;  2SDF A;  1GUW A;  4LMQ D;  3HOV B;  1DJR D;  1DD2 A;  5TSS A;  1PRT D;  1TWH H;  5C44 B;  1D5M C;  4L5R C;  1JB7 A;  4JK1 C;  2O5I C;  3J7A 5;  3CCL A;  2PNR C;  1J6Q A;  3RZD H;  3CCS A;  4G7O C;  1LTT D;  3ERQ A;  4OEL B;  1CSQ A;  4OGQ C;  4HMJ A;  3IKJ A;  3S9W A;  3CF5 A;  5AJ3 Q;  2EYM A;  4DK0 A;  2WV6 D;  1EYD A;  1R9T B;  2CH4 W;  2B8G A;  3EVQ A;  4LF7 L;  4LW1 A;  2YTX A;  4DR7 L;  1NSN S;  1A2T A;  4Y7N H;  1S40 A;  1WCM H;  1VQM A;  5ISR A;  1GUG A;  4DV1 Q;  4PQX A;  4OX9 L;  4G4K A;  1X9N A;  3QR8 A;  3U4V A;  2CWP A;  4DR5 Q;  2NN6 I;  2N49 A;  4P74 A;  1HQR D;  4X65 L;  1KNE A;  5IT9 c;  1L0W A;  4HIK A;  1VQJ A;  1IBL Q;  3J7Y W;  4APV A;  4B3T Q;  2JA5 B;  4UP8 A;  4RGT A;  4JI1 Q;  2BCO A;  1BCP F;  3MC0 B;  1LUZ A;  5T1G A;  1G6Z A;  4LJZ C;  1KLU D;  3MWY W;  4WRD A;  1V8Q A;  1BCP D;  1XJV A;  4C3H H;  3SR1 A;  3PUW A;  4DV5 L;  1WTH A;  2PYK A;  3K81 C;  4E6I A;  4K2K A;  4K5X A;  4HCS A;  2MQH A;  4IUV A;  1AZQ A;  2D5D A;  1Z9F A;  3Q0A A;  2KOL A;  2WAQ G;  2I46 A;  1EIF A;  2EYH A;  1SE3 A;  1MSG A;  4YIJ A;  1PVO A;  1YHQ A;  3EA6 A;  5C6A A;  1I50 H;  4XYQ A;  4A4I A;  3PF4 A;  4AYB E;  1QCB D;  4HMI A;  4O1N A;  3C2P A;  1YJN A;  1QIL A;  1EYG A;  1YJW A;  1ASY A;  2DGY A;  3G7L A;  5A35 A;  4ZCK A;  1QNU A;  1WTV A;  2PW5 A;  1PH4 A;  4I65 A;  1L1O C;  3JAM L;  3OSO A;  3NK9 A;  3KLR A;  1GUS A;  1W6J A;  4FXD A;  1HA6 A;  3MZ5 A;  2Y0S B;  2PZT A;  4N9P A;  4K2L A;  2YTV A;  4LF9 L;  1XPR A;  4N9T A;  1K83 H;  3CCE A;  1HNW Q;  1CA5 A;  3MXU A;  2A8V A;  4ZKB B;  3Q22 A;  4JI6 L;  3SK6 A;  1QVF A;  4ZKC B;  2NVY B;  1F9R A;  5EGT A;  2JEB I;  2XWB B;  3D6C A;  5COY A;  5FLM H;  4OHJ A;  4Q5V A;  2D9U A;  3OIP A;  2Z8L A;  1UNS A;  1K3R A;  2IPK D;  3F2C A;  4FF2 A;  1I4X A;  2IX3 A;  5K5P A;  4K8I A;  1IL2 A;  3ND9 A;  4FNF A;  4PMW A;  3KBG A;  4DA2 A;  3A0J A;  1J5E L;  2L15 A;  4L5S A;  1IYV A;  5HGQ A;  1JT8 A;  1PH2 A;  1O7L A;  2Q2H A;  4BBS G;  1SFO H;  4R1J A;  2VB3 X;  1VQG A;  5CYU A;  1Q12 A;  2IHE A;  4LAA A;  4H7B A;  3GTL B;  1Q3L A;  4RWS C;  1RL2 A;  4K8J A;  2EDG A;  3DWP A;  4IUP A;  3CP0 A;  4U68 A;  1IHZ A;  1N36 Q;  1EY5 A;  4V19 0;  5D3I B;  5DAU A;  2EXD A;  3MXG A;  5C4X H;  4DR3 Q;  2BDN A;  2Q2T A;  3HKZ B;  1K28 A;  4Y52 H;  1FGU A;  1MIU A;  1EQV A;  4A3J H;  3PO2 H;  1TQO A;  1S3O A;  4FXG C;  1EQR A;  1STY A;  3GD7 A;  1OXT A;  5C4X G;  4UHV A;  1B8A A;  1HR0 Q;  1VQB A;  5AJ3 L;  2L55 A;  4KHZ A;  3J81 j;  1E2Z A;  5LL6 S;  3A8I E;  3X3M A;  4A3J G;  3KBX A;  4BXX H;  2XN9 C;  1CM9 A;  4IPH A;  2K5W A;  4QL5 A;  2ZM6 L;  3P75 A;  2A73 B;  3UDX A;  1J9O A;  2FJ2 A;  2MHV A;  2R92 H;  1NR2 A;  3DM1 A;  3TZD A;  3I4M G;  4BXX G;  1BBW A;  2HQE A;  3S14 B;  3S2D H;  2TMP A;  2ES2 A;  1AZP A;  1F9S A;  2H5X A;  3DHQ A;  4A3F H;  2R92 G;  3H0G B;  1EFW A;  2XWJ B;  1CQF A;  3GTG H;  1A0I A;  2IL8 A;  4DV3 Q;  2PZU A;  4LUV A;  1IBL L;  4B3T L;  2OTJ A;  5C3X A;  2EZV A;  4L8J A;  3W5O A;  3L7Z C;  4DKA C;  2E2I B;  3S17 H;  4EQN A;  1UAP A;  4JI5 Q;  4EQO A;  2LY7 A;  4PMB A;  1HA5 A;  2MO1 A;  1U4P A;  2F0F A;  4PG3 A;  4GZY C;  2QCP X;  1LYL A;  4XQN A;  3A5Z B;  2IWH A;  1ICW A;  3F1Z A;  3WWV A;  4I7Z C;  5C3E G;  1S5E D;  2NVT H;  1STH A;  2EJM A;  1XMQ Q;  1TWH B;  2FHT A;  3E9H A;  3MVV A;  3J81 c;  4WJW A;  3URY A;  2DN8 A;  3H6M A;  5KYI A;  1PZI D;  3MXN A;  4IPD A;  4B3M L;  2R93 G;  1TXY A;  4OO1 I;  1T5X D;  2B3G A;  3UDG A;  1O78 A;  1QOH A;  1LAB A;  2XTI A;  4JYA Q;  1YVC A;  4A93 G;  5CBA E;  1DOK A;  4YCU A;  5KND A;  2KHJ A;  2MJ8 A;  3BZK A;  4WOR A;  3GTM H;  1MGS A;  1SNQ A;  2L12 A;  1K0S A;  3S16 H;  4Y7N B;  1YIT A;  5ELF A;  3TP7 A;  4BY1 H;  2GVB A;  2VNU D;  4RFB A;  2F0E A;  3K7U C;  1XWE A;  3G6J B;  4JV5 Q;  4DNT B;  3K5N A;  3WOF A;  1TWG H;  2Q8R E;  4JI8 L;  3HOW G;  1CFM A;  1JIC A;  2QW7 A;  4BY1 G;  3MXN B;  1HFG A;  3I4N H;  5GRO A;  3I91 A;  1DON A;  1DM0 B;  4LFC Q;  2WKD A;  3CKI B;  4B3R L;  3I4N G;  3ULP A;  2EY1 A;  1N34 Q;  1RJT A;  1PH6 A;  4CGY B;  1X55 A;  1HRJ A;  3J80 L;  1HNW L;  1EOV A;  2A6E D;  2LMC B;  1F2Y A;  2VS1 A;  3CPF A;  2PCF B;  3VR6 A;  3PIP A;  2B2W C;  2NN6 H;  2ZTE A;  2WAQ B;  1Y1W H;  1IXR A;  4X62 Q;  5IY0 A;  1U0L A;  2F0M A;  1KHI A;  3M4O H;  2NVQ H;  1D5Z C;  2A69 C;  4BY7 H;  2VL6 A;  3CCV A;  2WFW A;  4IUU A;  2Z4I A;  1X56 A;  1Z6H A;  1EEI D;  5FJ8 H;  2GVA A;  4MIU A;  4A3C H;  4LFB L;  5JJK A;  1SMY C;  3V96 A;  1I50 B;  4BY7 G;  1H9R A;  3GDE A;  2HDL A;  2J7Z A;  3DMU A;  2N3S A;  4ZQ3 A;  3CXC A;  5DM7 3;  1VQL A;  1Y1V H;  5LMN L;  1E0B A;  4GNX C;  4A3C G;  2SEB D;  4QQB X;  5JJI A;  2NTS A;  2B2Y C;  4QJF A;  4A3B G;  4MTK A;  2A5H A;  1PDQ A;  1Y1V G;  2B2T A;  5AFW A;  3TSS A;  1BVS A;  1XNR Q;  4BWG B;  3TZU A;  3K0X A;  1JWM D;  4DR3 L;  3QG1 A;  3QOJ A;  3SEB A;  1SE2 A;  3BS1 A;  4HID A;  3T1Y Q;  1VMC A;  3D4D A;  4IAL A;  3K6O A;  4HJ7 A;  5K36 H;  1ESR A;  1EIY B;  2PPB C;  2OEO A;  4KK7 A;  1A15 A;  1D2B A;  1WTO A;  4BBR H;  2A68 C;  1HR0 L;  2YU9 H;  2K6A A;  2K5Q A;  1K83 B;  5K36 G;  5IP7 H;  3QIA A;  1LT5 D;  3K7A H;  3S2H H;  4DK6 C;  4BBR G;  4DV7 Q;  3ITP A;  2ZT9 C;  3CCR A;  2VXW A;  1NNX A;  2DY7 A;  1WJJ A;  5BN5 A;  5IP7 G;  4DV2 L;  3EQL C;  4AIM A;  2JXM B;  3DEO A;  1A3V A;  2V4D A;  3CW2 C;  4B3S Q;  2E2D C;  3TRE A;  4RA8 A;  1NTG A;  2QGQ A;  3PO3 H;  4XDX A;  4FP5 D;  1CHP D;  4DV3 L;  4DR2 Q;  1XYI A;  2AWO A;  1SFO B;  2KHI A;  4G7H C;  1JOR A;  3PQI A;  3RD4 A;  1QUQ A;  5FLX L;  4ME5 A;  1II3 A;  4DFA A;  1TT2 A;  4DV6 Q;  3PO3 G;  3A7A B;  3KDF A;  2WP8 J;  2G9D A;  2N55 A;  4K0K Q;  2GA4 B;  4IJH A;  3MTS A;  2M2L A;  1PH7 A;  2AWN A;  1VQ8 A;  5IWA L;  1Y8N B;  2K7V A;  1JJ2 A;  3JC6 6;  1HNX L;  1HUN A;  5GAD C;  5I6W A;  1SLJ A;  4ULL A;  5C4X B;  2Y0S E;  2HIV A;  2K28 A;  4GKK Q;  3QOL A;  4ZRZ A;  4DXF A;  1PTO C;  4X3U A;  3G71 A;  1PHJ A;  4A3L G;  1H9S B;  2R7D A;  2NUC A;  4A3J B;  3PO2 B;  2B2V C;  3PIO 3;  4TVA B;  1CKN B;  4POG A;  3ULL A;  4TKO B;  2Z6K C;  1QUQ B;  2KEE A;  3LGJ A;  1PLF A;  4JYA L;  4NXM L;  4EQ5 A;  4PNY A;  1YNN C;  3HOZ H;  2UU9 Q;  3KDF B;  1F9P A;  1UEA B;  4R4I A;  4CHT B;  4GLX A;  3I4M B;  1SNM A;  5JJZ A;  3M4Q A;  3DLL A;  3IAY A;  1WTX A;  3FMC A;  2R6G A;  1RCV D;  4DAY A;  1XNQ Q;  2KEC A;  2E2H B;  2R92 B;  2F0I A;  3VR2 A;  4JV5 L;  1ZXT A;  3N52 A;  4PMC A;  4FF3 A;  4V0B A;  2NWG A;  3HGB A;  2F0G A;  4JC0 A;  5I4D A;  1EY6 A;  3J7A V;  5E1F A;  3LNN A;  1OXS C;  2J0T D;  2A19 A;  1JJG A;  3OMG A;  2TSS A;  5CV6 A;  2ASB A;  4GN5 A;  3BZC A;  1YNJ C;  2JK8 A;  2EE1 A;  4B9W A;  1QB5 D;  1N8R C;  3CRL C;  3BJU A;  3S17 B;  1AP0 A;  4N8F A;  4ALP A;  1PH9 A;  1N34 L;  1M90 C;  5C3E B;  3CCM A;  5F2D A;  4A3D H;  1TS2 A;  3FP9 A;  4FVM A;  2B2U C;  4HR7 B;  1A2U A;  3NWT A;  1TII D;  2IHF A;  3U50 C;  2B39 A;  3MAQ A;  4DAY B;  2OCE A;  2K5V A;  4TSS A;  4LF6 Q;  1WTQ A;  4OWT B;  5IGF A;  1VF5 C;  5M3F H;  3I7F A;  2NVT B;  4YCV A;  1V43 A;  3JAM i;  2AQ3 B;  1RIP A;  3AU7 A;  3FKI H;  2A69 D;  5FLX E;  3Q23 A;  4JI4 L;  3F2D A;  5M3F G;  2CW0 C;  3HKZ G;  4HSV A;  5KEE A;  1UE1 A;  3S1R H;  2EXZ A;  4TQU S;  1KAB A;  5J22 A;  1ZKO A;  2NVX H;  1DOL A;  5JEA H;  3FKI G;  1SMY D;  2F0L A;  3I73 A;  2AHO B;  3NWS A;  1VQH A;  3HOW B;  1WOC A;  3PUY A;  4RCO A;  2XVS A;  5JEA G;  3U58 A;  4BY1 B;  2OQK A;  4X66 Q;  1S5B D;  4J1M A;  2CFM A;  1VQO A;  1PZK D;  2VB2 X;  4KD3 A;  3VYU A;  1TWG B;  4P71 A;  3HFZ B;  2K05 A;  2L5T A;  3PUX A;  1VDZ A;  3L2P A;  2YV5 A;  2UXD Q;  3VR4 A;  1X3G A;  1RTN A;  3FHW A;  3T1Y L;  3I4N B;  2NZO A;  3UDI A;  1Q46 A;  2EIF A;  2R7F A;  1UUP A;  1FGB D;  4NMZ A;  4DV0 L;  2MNA A;  1ENA A;  1IZ6 A;  5M9O A;  5C0X G;  1B3A A;  3GTJ H;  2Q8I B;  3HOU H;  2M9V A;  3OWF A;  4YWL A;  2A68 D;  1E3P A;  5J39 A;  3RMH A;  1MBY A;  4IFD J;  4ODG A;  2FMM A;  1O7Z A;  2CH4 A;  5JPN C;  4JBK A;  4IFD I;  4UP7 A;  1TU2 B;  4DGZ A;  4FDB A;  4DV7 L;  2O4X A;  4DXG A;  3HOU G;  2XRQ D;  3M4O B;  5FO7 B;  2NVQ B;  2RCF A;  2K03 A;  4BY7 B;  4JBW A;  2ZJR A;  2RHS B;  4CDC C;  4DR6 Q;  3AMU A;  4B3S L;  1AW7 A;  4ID6 A;  1KAA A;  1X54 A;  1VQD A;  2K50 A;  3I90 A;  3ONA B;  1WI5 A;  2OWO A;  1SRU A;  4IN3 A;  3GTQ H;  5E4X A;  3MA2 B;  2R61 A;  4A3B B;  5LMU Q;  4DV6 L;  3TS0 A;  1NMG A;  1Y1V B;  3RLN A;  1YHB A;  3WDN A;  1XX8 A;  1Q90 A;  2XNA C;  2ZJQ A;  2NZ1 D;  2RDH A;  3NTI A;  3CCJ A;  1YZ6 A;  4KKT A;  1GUO A;  1WCM G;  3PGZ A;  4LWC A;  4A3G H;  1HTP A;  2WB1 G;  4A3I H;  1PTO F;  3T1H Q;  1WTR A;  1ZYR C;  1SE8 A;  4GKK L;  3D8G A;  4OL7 A;  1E2V A;  2KQ3 A;  4RKB A;  3BVZ A;  4HAE A;  4A3G G;  3A56 A;  1L0X B;  1PTO D;  1V9P A;  2F0J A;  4A3I G;  1LTB D;  4BBR B;  4OIK A;  1I5F A;  2YU9 B;  4ZAI A;  2WAQ E;  3K7A B;  3S2H B;  4LF8 Q;  3C46 A;  1OXX K;  1YNN D;  1TY2 A;  1GXD C;  1VQI A;  2BH2 A;  1XNQ L;  5EAY A;  4C3H G;  5C5L A;  2HUG A;  2NYZ D;  1B9N A;  4RMF A;  3M4Y A;  4R8N A;  4KY7 A;  4C2M H;  2AUK A;  3AYH B;  2SNS A;  1O7I A;  2G9H D;  3BVM A;  3PSI A;  3PO3 B;  3R3O A;  4JI3 L;  1STN A;  1UE5 A;  1H95 A;  4MTN A;  4Q0F A;  2IY5 B;  1FVI A;  1ET6 A;  5BN4 A;  4G7Z C;  2PQE A;  1D1I A;  5GQO A;  3CC4 A;  4LFA L;  1YNJ D;  3KLS X;  1I6H H;  3NEN A;  5M5X B;  4H0L C;  3VDY A;  5BR8 Q;  4LK1 C;  1HPC A;  4L5T A;  4O0A A;  1ML0 D;  3MHB A;  3OIQ A;  3KK7 A;  2D0P A;  5E4W C;  4DN4 M;  2E75 C;  3HKS A;  1LT6 D;  1YIJ A;  5IGE A;  3FVQ A;  1P8L A;  1CI3 M;  2EY2 A;  1M8A A;  4L6T B;  5C4J B;  2Q8T A;  3F2B A;  1O7Y A;  2F4V Q;  3UE1 A;  3GV6 A;  2UXB Q;  1I6V C;  4DK1 A;  4KN7 C;  4TRD A;  1RD9 D;  3H15 A;  1VS0 A;  3K5M A;  3B6Y A;  4XQQ A;  4DR1 Q;  3PF5 A;  1A63 A;  4P72 A;  2K4K A;  5J3B A;  2KBN A;  2CW0 D;  4M1U B;  4X64 Q;  3DUZ A;  3UE0 A;  2SOB A;  3J80 i;  4LF5 Q;  4JI7 Q;  1JWS D;  4RAU C;  4JCV E;  1L1O A;  2LFN A;  5IT9 L;  3M7G A;  1WTW A;  5HY6 A;  4HJA A;  4YWM A;  1QE6 A;  3MEF A;  1TS3 A;  5LMN W;  1Z7T A;  2JP1 A;  4A3E H;  1GUT A;  4K6D A;  4X3T A;  1HZA A;  4EVO A;  3M4P A;  1EEF D;  3R93 A;  5FLM G;  2JA7 H;  3DWA A;  3F2U A;  2VUM H;  1CZG A;  2A1A A;  1NR4 A;  3V2T A;  2K14 A;  4YY3 Q;  2UXD L;  4A3E G;  4RG1 A;  1PZJ D;  3W3A A;  3H94 A;  1DCZ A;  2JA7 G;  2I0Q A;  2VUM G;  1XPU A;  1CTM A;  1W2B A;  3LWE A;  3NQT A;  3SK4 A;  2K75 A;  3HZX A;  4OEM B;  3ND8 A;  1KDC A;  1L1O B;  4HCE A;  1TWC B;  3NQI A;  3MXP A;  3J81 i;  4DAV A;  4RGN A;  1SNO A;  2WIN B;  1D8L A;  1FNV A;  1EIG A;  3T13 A;  2ZXO A;  1B1Z A;  3RLO A;  4KTA A;  5M3F B;  2J4X A;  3D4W A;  5IGB A;  4CJ0 B;  3K8A A;  1Q86 C;  1NCV A;  3C1E A;  4CKE A;  2AUJ D;  2X6G A;  3FKI B;  4DR6 L;  2MFI A;  1X3F A;  2DNE A;  1V1O A;  3TN2 A;  2PNH A;  4H02 A;  1BBX C;  4HN7 A;  5DNF A;  4FF1 A;  3TEH B;  2K5H A;  2NVX B;  1GUN A;  3PO2 G;  1PFS A;  2N88 A;  2I5H A;  1QG7 A;  3CRK C;  1WD0 A;  2RHQ B;  1BUV T;  4DNI A;  4DV1 L;  1VCI A;  3T51 B;  1IBK Q;  1NMF A;  2QEJ C;  3JAM E;  4M8A A;  4RH6 A;  3QB3 A;  1H9J A;  3NP8 A;  2L11 A;  4DR5 L;  3CCU A;  5ELB A;  4MNO A;  1GKH A;  1G8Z D;  2DJF C;  3SVM A;  3T1H L;  2D62 A;  3FEW X;  4LUZ A;  1CQV A;  4JI1 L;  4RGO S;  1ZYR D;  1RDP D;  3BDL A;  3TQY A;  4A3F G;  3ERS X;  1SNC A;  4O2D A;  4QCL A;  2PW7 A;  1I94 Q;  1RF2 D;  2HCC A;  1YHA A;  3GTJ B;  5EPJ A;  4HIM A;  3HOU B;  3KYH C;  1ET9 A;  1VMP A;  3E5S A;  3NHH A;  3OPO A;  2AQ2 B;  3K80 C;  2PI2 E;  4MN3 A;  4RHS A;  1WVL A;  1TWF H;  4HJ9 A;  3T56 B;  3P1H A;  4J15 A;  1PTO H;  2RVL A;  2HHH Q;  5I9P A;  5KIX A;  4IPC A;  3L9A X;  1IKL A;  4IPG A;  4DAM A;  3EJI A;  5CMD A;  1BXT A;  4C3I H;  3D3R A;  3I56 A;  1JC7 A;  2KCM A;  3S15 H;  5EPL A;  3RZD B;  3RR5 A;  4DUY Q;  2OQ0 A;  1GHK A;  3KF8 B;  4CBV A;  1Q8I A;  3CC7 A;  4C3I G;  2LKV A;  1KXL A;  5BN3 A;  3EBE A;  1HCZ A;  2VQE Q;  4EX5 A;  1K9M C;  4U67 3;  4OWW B;  4DR4 Q;  3IFD A;  3GTK H;  3R2I A;  4KY5 A;  5C4Z A;  1WCM B;  1AE3 A;  1HNZ Q;  3CC2 A;  4BS9 A;  3CME A;  2FFK B;  5BR8 L;  1IL8 A;  3CCQ A;  2WB1 B;  5C0X J;  1KDA A;  3BDC A;  3H3V I;  3T16 A;  4EQP A;  1TKW B;  2K33 A;  4A3G B;  2G5D A;  2F4V L;  5I9O A;  4F8M A;  5IGC A;  1FJG Q;  4A3I B;  3OMC A;  1Q1B A;  2UXB L;  1VQP A;  4J8Q A;  3TP6 A;  1DYQ A;  4BA1 I;  2L4N A;  1EU3 A;  3NEM A;  4XIG S;  2QF7 A;  1EU4 A;  1F2Z A;  2RCN A;  5DLQ E;  5CGK A;  1SE4 A;  1O80 A;  4DR1 L;  1TVX A;  4XT1 B;  1KRS A;  4FF4 A;  4X64 L;  4C3H B;  2E5L Q;  1IYU A;  1SR3 A;  5ELC A;  2NB0 A;  2Z6B A;  3F8T A;  2OTL A;  4LF5 L;  3I72 A;  1MJE A;  3ICE A;  2XGT A;  1DZ1 A;  2VZA A;  1MD2 D;  1FYC A;  4XXE A;  1SDF A;  4IUT A;  2NN6 G;  1R4Q B;  2BA1 A;  3A8J E;  4C2M B;  1Y1W G;  2H4O A;  3S1M H;  1Q1E A;  4YY3 L;  2ID0 A;  4FXK C;  1SJE D;  4KV6 A;  1OTC A;  5FJ8 G;  5DM6 3;  3RZO H;  1ILP A;  5CV8 A;  4B9X A;  1S72 A;  5CV4 A;  4Z9C B;  1I6H B;  4K6L A;  4MZ9 A;  2HT1 A;  3J81 L;  4DV4 Q;  1N36 L;  2YTY A;  5ELO A;  3EFX D;  4NB3 A;  3M3Y H;  1I4H A;  2KCT A;  3K59 A;  1PA6 A;  3A74 A;  4KHV A;  3QJY A;  2N78 A;  4AQY Q;  1I4Q A;  3D0F A;  1KL9 A;  5G3L F;  1T5E A;  3A5U A;  3CU7 A;  1STE A;  4KY6 A;  4GNX A;  1G6P A;  2MGS A;  1G91 A;  1GO3 E;  1SAP A;  1MI2 A;  2MUY A;  5G3L D;  4OON A;  4OIJ A;  3ZJY C;  2B2Y A;  1B4O A;  1LM0 A;  1VQA A;  1ENF A;  1CK1 A;  4GOP C;  2I5L X;  4GLV B;  1BF4 A;  3M7N A;  3SXH A;  1IBK L;  1QJO A;  1UE6 A;  1KLG D;  4A3E B;  3GP7 A;  1TS5 A;  4RKL A;  1KDB A;  1BOS A;  2JA7 B;  1PH1 A;  2QDB A;  2VUM B;  1H9S A;  4DF7 A;  1B70 B;  4P2C B;  1PRT C;  2JEA I;  2EQS A;  1CKN A;  2QKI C;  3KF6 B;  2V1C C;  4GNX B;  3J80 E;  2WII B;  1X6O A;  1MSH A;  3CQZ H;  2B29 A;  1YJ9 A;  4HSP A;  1JWU D;  4JI5 L;  4KMU C;  4NKL A; 
#chains in the Genus database with same CATH homology
 3GTJ H;  3TS2 A;  4LF9 L;  1GM5 A;  3HOU H;  3L0O A;  4IFD G;  1XPR A;  1T9H A;  2ZTC A;  1K83 H;  4YWL A;  5C0X I;  1E3P A;  3CCE A;  4KHP Q;  3HOY G;  1HNW Q;  4LUO A;  4NXM Q;  4IFD J;  2A8V A;  1Y14 B;  2K52 A;  4JBK A;  4IFD I;  4JOI C;  4JI6 L;  1OXU A;  1Q7Y C;  1QVF A;  4UP7 A;  4DV7 L;  2HHH L;  4FDB A;  2F3I A;  2JEB I;  4A3M H;  5FLM H;  1XMQ L;  4LF7 Q;  3HOU G;  2BH8 A;  3G48 A;  2UUA Q;  3HOW H;  2PQA B;  4R4C A;  5ELN A;  4NXN Q;  1NY4 A;  2AMC B;  1K3R A;  3F2C A;  4JBW A;  2ZJR A;  2Z0S A;  5GAH C;  1IL2 A;  1CUK A;  2RHS B;  1XMO L;  4DR6 Q;  1E1T A;  4B3S L;  4PMW A;  3A0J A;  1J5E L;  2L15 A;  2ZJP A;  4A3M G;  1YEZ A;  1X54 A;  1VQD A;  4L5S A;  1JT8 A;  5HGQ A;  2K50 A;  2UUC Q;  4GOP B;  1PH2 A;  4X65 Q;  2Q2H A;  1WI5 A;  4BBS G;  1SFO H;  4GN4 B;  2VQE L;  4DUZ Q;  1SRU A;  2OWO A;  4R1J A;  4JI7 L;  3GTQ H;  4DR4 L;  1VQG A;  1CKM A;  2VY3 A;  1Q12 A;  1C7Y A;  5LMU Q;  4DV6 L;  2F52 A;  3KOJ A;  3TS0 A;  1K0R A;  1NMG A;  1HNZ L;  2IHE A;  3RLN A;  1YHB A;  3HOZ G;  2ZJQ A;  2PI2 A;  4GKJ L;  1RL2 A;  2E2J H;  4P75 A;  3CCJ A;  3CP0 A;  4OXP A;  1YZ6 A;  1N36 Q;  3M85 A;  1WCM G;  3EN2 A;  3PGZ A;  2Z6K A;  4LWC A;  4A3G H;  5FLX c;  2JA6 H;  2EXD A;  2B63 H;  3HOV H;  1FJG L;  2WB1 G;  4POF A;  2NVY H;  3S24 A;  4A3I H;  5C4X H;  4DR3 Q;  3T1H Q;  3RN5 A;  1SE8 A;  4GKK L;  2Q2T A;  5C44 H;  3CAM A;  4LFC L;  1X65 A;  4Y52 H;  1SN8 A;  3RN2 A;  3OW2 A;  1FGU A;  1MIU A;  2ALY B;  4A3J H;  3PO2 H;  4A3G G;  1VQC A;  1V9P A;  2JA6 G;  2B63 G;  1S3O A;  3HOV G;  1EQR A;  3GD7 A;  4A3I G;  1OXT A;  5C4X G;  3ULJ A;  4JI4 Q;  1B8A A;  2CCZ A;  1VQ9 A;  1QZH A;  1I5F A;  4YHH Q;  4IO9 A;  5C44 G;  1HR0 Q;  1N32 Q;  1VQB A;  5AJ3 L;  2WAQ E;  4KHZ A;  3J81 j;  3DM3 A;  2UUB Q;  2ATW A;  3W1G A;  4A3J G;  3STB D;  1R9T H;  4LF8 Q;  3HKZ E;  4JBJ A;  1OXX K;  4DPG A;  1M1K C;  4X62 L;  4BXX H;  4IPH A;  1Q82 C;  1JE5 A;  4QL5 A;  2ZM6 L;  1Q8K A;  4A3B H;  4A3D G;  1VQI A;  2BH2 A;  3UDX A;  1XNQ L;  4DK3 C;  5EAY A;  1VQN A;  2R92 H;  3D31 A;  4JI2 Q;  5M5W H;  3KF6 A;  4RMF A;  1HJP A;  1QZG A;  3I4M G;  3SGI A;  4BXX G;  1BBW A;  4C2M H;  3AYH B;  1SRO A;  1O7I A;  1BKB A;  3GO5 A;  3S2D H;  4BA2 I;  2ES2 A;  2H5X A;  3PSI A;  4A3F H;  4JBM A;  2R92 G;  4JI3 L;  1EFW A;  1UE5 A;  3GTG H;  1A0I A;  4DV3 Q;  1H95 A;  4LUV A;  4MTN A;  1IBL L;  2IY5 B;  4HJ8 A;  1FVI A;  4B3T L;  2JA5 H;  3GTO H;  2OTJ A;  3S1N H;  4JI0 Q;  5GQO A;  2BA0 A;  3W5O A;  3CC4 A;  3KFU A;  4LFA L;  3L7Z C;  4DKA C;  1B7Y B;  2D0O A;  5IYC H;  1K73 C;  3S17 H;  3NEN A;  1DGS A;  4DV0 Q;  1I6H H;  1WFQ A;  3VDY A;  1X3E A;  1LTL A;  5BR8 Q;  4JI5 Q;  4L5T A;  4O0A A;  2JA5 G;  3TRZ A;  4LF9 Q;  2MO1 A;  2Q2I A;  2D0P A;  1FL0 A;  4PG3 A;  2I5M X;  2JA8 H;  3HKS A;  1YIJ A;  1XNR L;  1LYL A;  1P8L A;  3UDF A;  3A5Z B;  4JI6 Q;  3F2B A;  1E1O A;  2F4V Q;  4AQY L;  3I55 A;  2AKW B;  1P16 A;  3F1Z A;  3UE1 A;  3WWV A;  5C3E G;  2NVT H;  2UXB Q;  1KRT A;  4GOP A;  3KLW A;  1XMQ Q;  3W1B A;  3J81 c;  3E9H A;  5IE8 A;  4OO1 G;  4IPD A;  1I94 L;  2C35 B;  1VS0 A;  3H15 A;  3B6Y A;  4AH6 A;  3AEV A;  1NBW A;  1D7Q A;  4OWX B;  4B3M L;  4DR1 Q;  2R93 G;  1TXY A;  4OO1 I;  3PF5 A;  1A63 A;  1J5E Q;  2B3G A;  4P72 A;  2K4K A;  3UDG A;  1PYB A;  1VQK A;  5J3B A;  2CKZ B;  2KBN A;  2XTI A;  4JYA Q;  1YVC A;  4A93 G;  2K5N A;  4X64 Q;  1KC8 C;  3PUZ A;  3UE0 A;  4YCU A;  5H1S E;  3J80 i;  1GVP A;  2N8N A;  2KHJ A;  1JMC A;  3H3V H;  1UEB A;  3BZK A;  4JI7 Q;  4LF5 Q;  2FXQ A;  4JCV E;  1PH5 A;  1L1O A;  4QY7 A;  1MKH A;  2CQO A;  3GTM H;  5HY6 A;  4DR7 Q;  4HJA A;  4YWM A;  3S16 H;  1YIT A;  1Z47 A;  3MEF A;  3J7Z C;  2UXC Q;  5LMN W;  5M5X H;  3Q8D A;  4A3E H;  2GVB A;  4BY1 H;  2VNU D;  3K7U C;  4OX9 Q;  1HZA A;  4JV5 Q;  4DUY L;  2E8G A;  1VQ5 A;  3M4P A;  4R4Q A;  1TWG H;  2JA7 H;  5FLM G;  4JI8 L;  2VUM H;  2A1A A;  3HOW G;  2YYZ A;  2K14 A;  1KQS A;  1KIX A;  4YY3 Q;  3OTO L;  4A3L H;  5IYB H;  4DR2 L;  2UXD L;  5IYD H;  4A3E G;  4BY1 G;  5C4J H;  3MXN B;  4RG1 A;  4KI0 A;  3I4N H;  1HZC A;  4JOI A;  2VQF Q;  5GRO A;  3PIO A;  2DUD A;  2JA7 G;  2I0Q A;  2VUM G;  2WB1 E;  1C0A A;  4LFC Q;  4K0K L;  1XPU A;  5IYB G;  4LF4 Q;  1W2B A;  5IYD G;  4B3R L;  2K75 A;  3I4N G;  2CWA A;  4A75 A;  1A62 A;  4QGU A;  3ULP A;  1N34 Q;  1PH6 A;  1XPO A;  3AFP A;  1X55 A;  1L1O B;  3G6E A;  4KHP L;  1HNW L;  4UP9 A;  3J81 i;  1EOV A;  2VS1 A;  3JAM c;  3CPF A;  2Y0S G;  1EUJ A;  1EQQ A;  1D8L A;  3PIP A;  4DV5 Q;  1VQ6 A;  2ZTE A;  3KJP A;  3PUV A;  1Y1W H;  1IXR A;  3RLO A;  5IY0 A;  4X62 Q;  1PH8 A;  1U0L A;  3EIV A;  2UUA L;  1KHI A;  4NXN L;  2ZM6 Q;  3M4O H;  1NE3 A;  2NVQ H;  1E22 A;  1Q86 C;  3K8A A;  1U5K A;  4YCW A;  4BY7 H;  2VL6 A;  2QA4 A;  3CCV A;  2WFW A;  1X56 A;  4DR6 L;  2MFI A;  1X3F A;  3BU2 A;  5FJ8 H;  2GVA A;  3I4O A;  4XTC S;  2UUC L;  1OXV A;  2PNH A;  4H02 A;  4A3C H;  2E5L L;  4LFB L;  5JJK A;  1E24 A;  3TEH B;  5GAE C;  2UU9 L;  2K5H A;  4DUZ L;  4BY7 G;  4JI3 Q;  1G51 A;  1PFS A;  3GDE A;  4A3K H;  3PO2 G;  1AE2 A;  2N3S A;  2I5H A;  2RHQ B;  3CXC A;  4A76 A;  1VQL A;  1KD1 C;  4DNI A;  1Y1V H;  5LMN L;  4GNX C;  4DV1 L;  4A3C G;  3GTL H;  1VCI A;  1IBK Q;  1NMF A;  4LFA Q;  2JA9 A;  2IX1 A;  3AQQ A;  4QQB X;  4A3K G;  5JJI A;  4HJ5 A;  1VQ7 A;  2LSS A;  4PZ6 A;  4PZ7 A;  1TWC H;  4QJF A;  1VQF A;  4DR5 L;  1IBM Q;  4A3B G;  3CCU A;  1Y1V G;  4MNO A;  1BVS A;  1XNR Q;  1GKH A;  1N33 Q;  3K0X A;  4DR3 L;  3T1H L;  2D62 A;  1XTD A;  1MJC A;  4LUZ A;  2QEX A;  4HID A;  3T1Y Q;  4JI1 L;  4JG2 A;  4HJ7 A;  4P73 A;  1EIY B;  4A3F G;  3TQY A;  3ERS X;  4IOC A;  2HQL A;  4O2D A;  1EWI A;  4DV4 L;  1A8V A;  1V1Q A;  1I94 Q;  1AH9 A;  1YHA A;  4BBR H;  1HZB A;  3KJO A;  4YHH L;  4HIM A;  3KYH C;  1HR0 L;  3PV0 A;  2YU9 H;  1W3S A;  4B3M Q;  1N32 L;  2UUB L;  5K36 G;  5IP7 H;  3K80 C;  2PI2 E;  1PH3 A;  3K7A H;  3S2H H;  5IYC G;  1CKO A;  3NBH B;  4KLK A;  4DK6 C;  1TWF H;  4HJ9 A;  4GS3 A;  1Q81 C;  4LF6 L;  4J15 A;  4BBR G;  4DV7 Q;  2HHH Q;  3OYY A;  3CPW A;  4IPC A;  3E9I A;  3CCR A;  4UY8 C;  4IPG A;  4IJL A;  2JA8 G;  1WJJ A;  4DAM A;  4JI2 L;  2GN5 A;  5IP7 G;  4DV2 L;  4C3I H;  3I56 A;  2KCM A;  4AIM A;  3S15 H;  1NJI C;  1L2F A;  3S14 H;  4NPS A;  4WJ4 A;  4R4O A;  3RR5 A;  1XMO Q;  4DUY Q;  2OQ0 A;  3CW2 C;  4B3S Q;  1ASZ A;  3TRE A;  1NTG A;  2PMZ E;  2QGQ A;  3PO3 H;  3KF8 B;  4JI8 Q;  4AYB G;  1SMX A;  4PZ8 A;  3H0G H;  3CC7 A;  3RNU A;  4DV3 L;  4WJ3 M;  1KXL A;  4DR2 Q;  3EBE A;  2AWO A;  2KHI A;  2VQE Q;  1KAW A;  2LXK A;  4EX5 A;  1VQ4 A;  1K9M C;  1QUQ A;  4OWW B;  4DR4 Q;  2Q2U A;  2LXJ A;  4JI0 L;  2MO0 A;  3IRB A;  1CSP A;  3GTK H;  4LNQ A;  3NEL A;  4DV6 Q;  1BBU A;  3PO3 G;  2KEN A;  3HOX H;  2E2I H;  1UWV A;  1AE3 A;  3H0G G;  2WP8 J;  3KDF A;  1HNZ Q;  2NZH A;  3CC2 A;  4K0K Q;  3CME A;  4X66 L;  5BR8 L;  1JJC B;  4IJH A;  3CCQ A;  1PH7 A;  4GKJ Q;  2AWN A;  4B3R Q;  3I2Z A;  1E7Z A;  5IWA L;  1VQ8 A;  2ZTD A;  1K8A C;  2JE6 I;  5C0X J;  1YBY A;  1JJ2 A;  1YNX A;  1HZ9 A;  4ME3 A;  4C3J H;  3GTP H;  3JC6 6;  3H3V I;  3HOX G;  1IYJ B;  1HNX L;  2F4V L;  1N9W A;  5GAD C;  1FJG Q;  2IX0 A;  3CD6 A;  2VW9 A;  1Q1B A;  1SLJ A;  2UXB L;  2Y0S E;  2HIV A;  1VQP A;  3G4S A;  4GKK Q;  4BA1 I;  1TWH H;  4X6A H;  5IP9 H;  3G71 A;  4L5R C;  3NEM A;  1PHJ A;  3S1Q H;  4XIG S;  1JB7 A;  4BBS H;  2R7D A;  1UE7 A;  4A3L G;  2RCN A;  5DLQ E;  3CCL A;  2RF4 A;  2R7Z H;  3J7A 5;  1J6Q A;  4TVA B;  1CKN B;  3CCS A;  5M3M H;  4DR1 L;  3ULL A;  3RZD H;  1PV4 A;  4POG A;  2Z6K C;  5M5Y H;  1CSQ A;  1QUQ B;  3LGJ A;  2JJQ A;  4JYA L;  4NXM L;  1KRS A;  1HR0 W;  4X64 L;  5IP9 G;  3STB C;  4EQ5 A;  4R4T A;  5AJ3 Q;  5E7N A;  3CF5 A;  2E5L Q;  1SR3 A;  4UPA A;  2UU9 Q;  3HOZ H;  4LFB Q;  3F8T A;  3KDF B;  2OTL A;  4LF5 L;  4R4I A;  4GLX A;  1GD7 A;  2R7Z G;  4LF7 L;  3M9B A;  4LW1 A;  5M3M G;  2YTX A;  3M4Q A;  3DLL A;  1MJE A;  4DR7 L;  3ICE A;  1S40 A;  4Y7N H;  2R6G A;  2UXC L;  1WCM H;  4YWK A;  1VQM A;  2XGT A;  5LMN Q;  1XNQ Q;  2VZA A;  4DV1 Q;  4OX9 L;  4JV5 L;  2NN6 G;  2BA1 A;  1X9N A;  1Y1W G;  3U4V A;  2CWP A;  3S1M H;  1Q1E A;  1TWA H;  2ID0 A;  2NN6 I;  2N49 A;  4JC0 A;  4P74 A;  4YY3 L;  4X65 L;  4DR5 Q;  1K8G A;  1OXS C;  4HIO A;  5IT9 c;  2A19 A;  1L0W A;  1OTC A;  4HIK A;  1VQJ A;  1JJG A;  1YI2 A;  2HIX A;  4GN3 B;  2VQF L;  1IBL Q;  4APV A;  5FJ8 G;  2ASB A;  4B3T Q;  3RZO H;  4UP8 A;  4GN5 A;  5LMU L;  3BZC A;  4JI1 Q;  2JK8 A;  1LUZ A;  1S72 A;  4LF4 L;  1N8R C;  3BJU A;  4ALP A;  4MZ9 A;  1PH9 A;  2HT1 A;  4DV4 Q;  1N34 L;  3CMA A;  1M90 C;  1N36 L;  2YTY A;  3U4Z A;  5ELO A;  3CCM A;  4A3D H;  4NB3 A;  3M3Y H;  1C9O A;  2KCT A;  3FP9 A;  1XJV A;  1VQE A;  4C3H H;  2IHF A;  3PUW A;  3U50 C;  4DV5 L;  4DAY B;  2OCE A;  1PA6 A;  2JQO A;  3A74 A;  4L5Q A;  2K5V A;  3I4M H;  1WYD A;  3K81 C;  4LF6 Q;  4OWT B;  2N78 A;  3PCO B;  4AQY Q;  5M3F H;  3I7F A;  3D0F A;  4YCV A;  2MQH A;  1KL9 A;  3A5U A;  1V43 A;  1QVC A;  3JAM i;  2E2H H;  1RIP A;  3FKI H;  4GNX A;  4DV2 Q;  1Z9F A;  3J80 c;  1G6P A;  2WAQ G;  4QIW E;  1EIF A;  1GO3 E;  4JI4 L;  3F2D A;  5M3F G;  3HKZ G;  4OON A;  1YHQ A;  1PVO A;  1UE1 A;  3S1R H;  3ZJY C;  4TQU S;  1I50 H;  1LM0 A;  1VQA A;  2NVX H;  4LF8 L;  5JJL A;  4IOA A;  3FKI G;  3E0E A;  4A4I A;  4GOP C;  3PF4 A;  2I5L X;  4GLV B;  3RLF A;  4AYB E;  2AHO B;  1VQH A;  3M7N A;  1IBK L;  1WOC A;  3PUY A;  1YJN A;  1UE6 A;  1EYG A;  5JEA G;  3U58 A;  1YJW A;  2OQK A;  3AFQ A;  4X66 Q;  2CFM A;  1PYS B;  2DGY A;  5C3E H;  1VQO A;  1ASY A;  2PQA A;  5JEA J;  1IBM L;  4P71 A;  1PH1 A;  3HFZ B;  5IWA Q;  1G29 1;  2IT1 A;  3PUX A;  1N33 L;  3L2P A;  1PH4 A;  1B70 B;  2YV5 A;  3OTO Q;  1QVG A;  1L1O C;  2EQS A;  1CKN A;  1HH2 P;  3ER0 A;  2JEA I;  1X3G A;  3KF6 B;  2UXD Q;  2V1C C;  3FHW A;  4GNX B;  3T1Y L;  1HNX Q;  5GAG C;  1X6O A;  2R93 H;  2NZO A;  4GLA C;  3UDI A;  1Q46 A;  2EIF A;  3CQZ H;  2R7F A;  1I3Q H;  3HOY H;  2B29 A;  4A93 H;  4DV0 L;  1YJ9 A;  2MNA A;  1IZ6 A;  4JI5 L;  5C0X G;  2YTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...